F496767

General Info

Members Datasets Scaffolds Average Seq Length
2388 826 2140 374

Family's Representative Sequence

Representative Sequence 3300005262|Ga0065165_1006106|Ga0065165_10061064
Length 435
Sequence VSSPGPLLVGGIRTAPACKTSTVYHSTRLALAIVLLQKQASSRRRLSLRRFQSNPLAPKYQLMASPELSQFRRIVVKVGSALLVDSDKGEVRASWLAALAADMAKLHKEGRDVLVVSSGSIALGRSRLKLPRGPLKLEESQAAAAVGQIALARIWSEVLGAHDIGAGQILVTLQDTEERRRYLNARSTIGKLLEWRAIPVINENDTVATTEIRYGDNDRLAARVATMASADLLVLLSDIDGLYDAPPKNNPNARLIPVVDSISSEIEAVAGDAESELSRGGMRTKVEAAKIATTGGTHMLIASGKIEHPLQAIADGGRCTWFLTPANPITSRKRWIAGSLEPKGTLTIDAGAVAALRAGASLLPAGVIKVEGQFARGDAVIVRGPDTSEVGRGLIAYDADDAERIKGRSSPDVMAILGISGRSEMIHRDDLVMGG

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
5 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
6 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
7 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
8 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
9 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
10 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
11 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
12 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
13 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
14 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
15 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
16 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
17 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
18 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
19 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
20 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
21 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
22 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
23 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
24 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
25 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
26 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
27 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
28 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
29 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
30 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
31 2643221651 Afipia sp. Root123D2 Isolate Unclassified
32 2643221734 Bosea sp. Root670 Isolate Unclassified
33 2643221736 Bosea sp. Root483D1 Isolate Unclassified
34 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
35 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
36 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
37 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
38 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
39 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
40 2791355199
41 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
42 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
43 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
44 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
45 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
46 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
47 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
48 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
49 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
50 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
51 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
52 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
53 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
54 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
55 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
56 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
57 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
58 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
59 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
60 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
61 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
62 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
63 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
64 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
65 2841760612 Bosea sp. Tri-49 Isolate Nodule
66 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
67 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
68 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
69 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
70 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
71 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
72 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
73 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
74 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
75 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
76 2842694124 Methylopila sp. R-72369 Isolate Unclassified
77 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
78 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
79 2844104063 Bosea sp. Tri-39 Isolate Nodule
80 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
81 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
82 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
83 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
84 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
85 2851182111 Bosea sp. Tri-44 Isolate Nodule
86 2851246043 Bosea sp. Tri-54 Isolate Nodule
87 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
88 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
89 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
90 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
91 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
92 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
93 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
94 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
95 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
96 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
97 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
98 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
99 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
100 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
101 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
102 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
103 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
104 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
105 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
106 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
107 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
108 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
109 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
110 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
111 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
112 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
113 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
114 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
115 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
116 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
117 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
118 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
119 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
120 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
121 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
122 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
123 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
124 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
125 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
126 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
127 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
128 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
129 2909042592 Labrys sp. LIt4 Isolate Nodule
130 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
131 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
132 2922368715
133 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
134 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
135 2922425934
136 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
137 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
138 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
139 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
140 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
141 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
142 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
143 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
144 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
145 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
146 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
147 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
148 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
149 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
150 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
151 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
152 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
153 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
154 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
155 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
156 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
157 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
158 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
159 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
160 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
161 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
162 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
163 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
164 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
165 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
166 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
167 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
168 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
169 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
170 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
171 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
172 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
173 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
174 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
175 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
176 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
177 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
178 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
179 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
180 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
181 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
182 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
183 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
184 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
185 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
186 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
187 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
188 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
189 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
190 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
191 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
192 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
193 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
194 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
195 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
196 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
197 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
198 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
199 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
200 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere
201 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
202 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
203 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
204 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
205 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
206 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
207 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
208 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
209 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
210 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
211 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
212 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
213 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
214 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
215 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
216 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
217 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
218 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
219 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
220 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
221 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
222 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
223 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
224 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
225 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
226 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
227 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
228 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
229 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
230 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
231 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
232 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
233 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
234 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
235 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
236 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
237 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
238 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
239 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
240 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
241 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
242 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
243 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
244 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
245 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
246 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
247 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
248 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
249 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
250 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
251 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
252 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
253 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
254 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
255 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
256 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
257 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
258 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
259 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
260 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
261 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
262 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
263 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
264 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
265 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
266 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
267 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
268 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
269 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
270 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
271 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
272 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
273 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
274 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
275 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
276 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
277 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
278 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
279 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
280 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
281 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
282 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
283 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
284 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
285 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
286 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
287 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
288 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
289 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
290 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
291 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
292 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
293 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
294 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
295 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
296 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
297 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
298 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
299 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
300 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
301 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
302 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
303 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
304 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
305 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
306 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
307 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
308 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
309 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
310 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
311 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
312 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
313 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
314 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
315 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
316 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
317 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
318 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
319 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
320 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
321 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
322 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
323 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
324 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
325 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
326 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
327 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
328 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
329 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
330 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
331 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
332 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
333 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
334 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
335 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
336 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
337 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
338 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
339 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
340 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
341 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
342 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
343 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
344 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
345 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
346 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
347 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
348 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
349 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
350 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
351 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
352 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
353 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
354 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
355 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
356 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
357 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
358 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
359 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
360 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
361 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
362 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
363 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
364 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
365 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
366 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
367 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
368 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
369 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
370 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
371 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
372 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
373 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
374 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
375 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
376 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
377 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
378 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
379 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
380 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
381 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
382 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
383 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
384 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
385 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
386 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
387 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
388 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
389 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
390 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
391 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
392 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
393 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
394 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
395 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
396 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
397 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
398 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
399 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
400 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
401 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
402 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
403 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
404 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
405 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
406 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
407 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
408 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
409 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
410 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
411 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
412 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
413 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
414 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
415 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
416 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
417 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
418 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
419 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
420 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
421 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
422 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
423 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
424 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
425 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
426 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
427 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
428 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
429 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
430 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
431 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
432 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
433 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
434 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
435 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
436 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
437 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
438 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
439 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
440 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
441 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
442 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
443 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
444 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
445 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
446 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
447 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
448 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
449 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
450 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
451 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
452 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
453 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
454 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
455 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
456 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
457 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
458 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
459 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
460 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
461 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
462 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
463 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
464 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
465 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
466 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
467 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
468 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
469 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
470 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
471 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
472 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
473 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
474 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
475 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
476 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
477 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
478 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
479 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
480 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
481 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
482 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
483 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
484 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
485 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
486 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
487 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
488 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
489 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
490 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
491 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
492 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
493 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
494 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
495 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
496 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
497 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
498 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
499 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
500 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
501 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
502 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
503 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
504 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
505 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
506 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
507 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
508 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
509 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
510 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
511 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
512 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
513 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
514 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
515 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
516 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
517 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
518 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
519 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
520 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
521 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
522 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
523 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
524 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
525 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
526 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
527 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
528 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
529 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
530 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
531 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
532 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
533 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
534 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
535 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
536 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
537 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
538 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
539 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
540 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
541 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
542 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
543 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
544 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
545 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
546 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
547 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
548 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
549 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
550 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
551 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
552 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
553 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
554 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
555 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
556 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
557 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
558 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
559 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
560 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
561 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
562 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
563 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
564 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
565 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
566 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
567 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
568 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
569 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
570 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
571 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
572 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
573 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
574 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
575 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
576 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
577 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
578 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
579 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
580 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
581 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
582 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
583 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
584 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
585 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
586 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
587 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
588 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
589 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
590 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
591 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
592 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
593 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
594 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
595 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
596 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
597 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
598 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
599 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
600 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
601 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
602 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
603 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
604 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
605 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
606 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
607 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
608 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
609 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
610 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
611 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
612 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
613 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
614 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
615 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
616 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
617 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
618 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
619 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
620 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
621 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
622 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
623 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
624 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
625 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
626 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
627 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
628 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
629 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
630 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
631 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
632 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
633 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
634 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
635 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
636 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
637 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
638 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
639 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
640 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
641 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
642 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
643 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
644 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
645 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
646 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
647 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
648 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
649 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
650 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
651 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
652 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
653 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
654 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
655 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
656 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
657 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
658 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
659 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
660 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
661 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
662 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
663 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
664 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
665 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
666 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
667 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
668 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
669 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
670 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
671 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
672 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
673 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
674 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
675 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
676 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
677 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
678 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
679 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
680 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
681 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
682 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
683 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
684 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
685 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
686 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
687 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
688 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
689 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
690 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
691 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
692 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
693 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
694 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
695 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
696 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
697 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
698 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
699 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
700 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
701 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
702 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
703 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
704 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
705 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
706 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
707 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
708 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
709 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
710 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
711 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
712 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
713 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
714 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
715 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
716 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
717 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
718 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
719 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
720 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
721 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
722 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
723 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
724 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
725 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
726 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
727 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
728 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
729 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
730 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
731 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
732 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
733 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
734 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
735 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
736 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
737 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
738 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
739 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
740 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
741 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
742 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
743 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
744 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
745 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
746 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
747 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
748 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
749 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
750 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
751 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
752 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
753 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
754 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
755 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
756 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
757 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
758 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
759 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
760 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
761 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
762 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
763 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
764 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
765 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
766 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
767 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
768 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
769 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
770 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
771 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
772 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
773 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
774 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
775 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
776 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
777 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
778 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
779 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
780 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
781 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
782 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
783 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
784 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
785 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
786 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
787 641228493 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
788 643348555 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
789 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
790 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
791 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
792 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
793 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
794 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
795 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
796 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
797 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
798 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
799 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
800 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
801 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
802 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
803 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
804 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
805 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
806 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
807 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
808 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
809 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
810 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
811 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
812 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
813 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
814 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
815 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
816 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
817 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
818 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
819 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
820 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
821 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
822 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
823 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
824 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
825 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule
826 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.64
Metatranscriptomes 0.08
Isolates 10.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.24
Nodule 7.54
Rhizoplane 6.32
Rhizosphere 71.61
Stem 0
Stem Tuber 0
Unclassified 7.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5oldR_c000068 3300000041 Bacteria 19044
2 ARSoilYngRDRAFT_c00047 3300000042 Bacteria 19344
3 ARcpr5yngRDRAFT_c000047 3300000043 Bacteria 19138
4 ARSoilOldRDRAFT_c000056 3300000044 Bacteria 23604
5 ARCol0oldRDRAFT_c00334 3300000045 Bacteria 4572
6 ARCol0yngRDRAFT_1000250 3300000652 Bacteria 8716
7 JGI24746J21847_1007104 3300001977 Bacteria 1720
8 JGI24739J22299_10008160 3300001989 Bacteria 3910
9 JGI24737J22298_10004184 3300001990 Bacteria 5045
10 JGI24735J21928_10024975 3300002067 Bacteria 1804
11 JGI24750J21931_1000878 3300002070 Bacteria 4126
12 JGI24738J21930_10007968 3300002075 Bacteria 2421
13 JGI24034J26672_10000659 3300002239 Bacteria 4430
14 JGI25151J46595_10000036 3300003187 Bacteria 188770
15 JGI25151J46595_10000179 3300003187 Bacteria 80108
16 JGI25151J46595_10000468 3300003187 Bacteria 38636
17 JGI25406J46586_10006273 3300003203 Bacteria 5487
18 JGI25153J46596_10001505 3300003215 Bacteria 13889
19 JGI25153J46596_10005044 3300003215 Bacteria 6983
20 JGI25153J46596_10005461 3300003215 Bacteria 6662
21 JGI25160J50197_1005464 3300003354 Bacteria 5285
22 JGI25160J50197_1009863 3300003354 Bacteria 3503
23 JGI25160J50197_1012505 3300003354 Bacteria 2942
24 Ga0055539_1002704 3300003752 Bacteria 2630
25 Ga0055526_1002133 3300003771 Bacteria 13575
26 Ga0055524_1000065 3300003775 Bacteria 132117
27 Ga0055543_1002453 3300004625 Bacteria 6121
28 Ga0065165_1000014 3300005262 Bacteria 292366
29 Ga0065165_1003985 3300005262 Bacteria 9655
30 Ga0065165_1006106 3300005262 Bacteria 6452
31 Ga0065165_1006972 3300005262 Bacteria 5722
32 Ga0065704_10101095 3300005289 Bacteria 2250
33 Ga0065712_10081939 3300005290 Bacteria 2962
34 Ga0065715_10092576 3300005293 Bacteria 5046
35 Ga0065715_10093776 3300005293 Bacteria 4560
36 Ga0065715_10150277 3300005293 Bacteria 1724
37 Ga0070658_10008308 3300005327 Bacteria 8352
38 Ga0070658_10037444 3300005327 Bacteria 3911
39 Ga0070658_10056027 3300005327 Bacteria 3203
40 Ga0070658_10084443 3300005327 Bacteria 2611
41 Ga0070658_10112197 3300005327 Bacteria 2260
42 Ga0070676_10001953 3300005328 Bacteria 10486
43 Ga0070676_10010063 3300005328 Bacteria 5123
44 Ga0070676_10022774 3300005328 Bacteria 3515
45 Ga0070676_10061174 3300005328 Bacteria 2238
46 Ga0070676_10161471 3300005328 Bacteria 1443
47 Ga0070683_100020845 3300005329 Bacteria 5841
48 Ga0070690_100005326 3300005330 Bacteria 7219
49 Ga0070690_100005673 3300005330 Bacteria 7026
50 Ga0070670_100020122 3300005331 Bacteria 5733
51 Ga0070670_100047973 3300005331 Bacteria 3676
52 Ga0070670_100143475 3300005331 Bacteria 2065
53 Ga0070670_100147350 3300005331 Bacteria 2037
54 Ga0070670_100151700 3300005331 Bacteria 2006
55 Ga0070670_100166255 3300005331 Bacteria 1913
56 Ga0070677_10005640 3300005333 Bacteria 4131
57 Ga0068869_100003307 3300005334 Bacteria 9846
58 Ga0068869_100003604 3300005334 Bacteria 9502
59 Ga0068869_100007944 3300005334 Bacteria 6815
60 Ga0070666_10000186 3300005335 Bacteria 42661
61 Ga0070666_10129979 3300005335 Bacteria 1749
62 Ga0070680_100003197 3300005336 Bacteria 12180
63 Ga0070680_100024704 3300005336 Bacteria 4803
64 Ga0070680_100046234 3300005336 Bacteria 3540
65 Ga0070680_100051759 3300005336 Bacteria 3351
66 Ga0070680_100106876 3300005336 Bacteria 2327
67 Ga0070680_100130607 3300005336 Bacteria 2101
68 Ga0070680_100153404 3300005336 Bacteria 1934
69 Ga0070680_100160408 3300005336 Bacteria 1890
70 Ga0070682_100001402 3300005337 Bacteria 13577
71 Ga0070682_100005660 3300005337 Bacteria 6967
72 Ga0070682_100166442 3300005337 Bacteria 1528
73 Ga0068868_100009048 3300005338 Bacteria 7149
74 Ga0068868_100034093 3300005338 Bacteria 3928
75 Ga0068868_100146266 3300005338 Bacteria 1943
76 Ga0068868_100152640 3300005338 Bacteria 1903
77 Ga0070660_100010072 3300005339 Bacteria 6668
78 Ga0070660_100018729 3300005339 Bacteria 5064
79 Ga0070660_100030527 3300005339 Bacteria 4044
80 Ga0070660_100066600 3300005339 Bacteria 2804
81 Ga0070660_100104216 3300005339 Bacteria 2250
82 Ga0070660_100127088 3300005339 Bacteria 2037
83 Ga0070689_100000391 3300005340 Bacteria 25693
84 Ga0070689_100010100 3300005340 Bacteria 6720
85 Ga0070689_100025998 3300005340 Bacteria 4403
86 Ga0070689_100040609 3300005340 Bacteria 3568
87 Ga0070689_100061066 3300005340 Bacteria 2931
88 Ga0070689_100160836 3300005340 Bacteria 1815
89 Ga0070689_100215495 3300005340 Bacteria 1573
90 Ga0070689_100255952 3300005340 Bacteria 1446
91 Ga0070691_10000745 3300005341 Bacteria 12815
92 Ga0070691_10008387 3300005341 Bacteria 4732
93 Ga0070691_10045737 3300005341 Bacteria 2077
94 Ga0070691_10080140 3300005341 Bacteria 1597
95 Ga0070687_100001228 3300005343 Bacteria 8886
96 Ga0070687_100003452 3300005343 Bacteria 6137
97 Ga0070687_100087832 3300005343 Bacteria 1712
98 Ga0070661_100004825 3300005344 Bacteria 9281
99 Ga0070661_100034801 3300005344 Bacteria 3655
100 Ga0070661_100136083 3300005344 Bacteria 1849
101 Ga0070692_10003127 3300005345 Bacteria 6638
102 Ga0070692_10088460 3300005345 Bacteria 1680
103 Ga0070668_100005189 3300005347 Bacteria 9662
104 Ga0070668_100017901 3300005347 Bacteria 5315
105 Ga0070668_100028887 3300005347 Bacteria 4209
106 Ga0070668_100045000 3300005347 Bacteria 3386
107 Ga0070668_100109052 3300005347 Bacteria 2202
108 Ga0070668_100120488 3300005347 Bacteria 2097
109 Ga0070668_100161129 3300005347 Bacteria 1820
110 Ga0070669_100037526 3300005353 Bacteria 3515
111 Ga0070675_100000583 3300005354 Bacteria 25031
112 Ga0070675_100093875 3300005354 Bacteria 2517
113 Ga0070675_100102597 3300005354 Bacteria 2410
114 Ga0070675_100119686 3300005354 Bacteria 2236
115 Ga0070675_100153862 3300005354 Bacteria 1973
116 Ga0070675_100167917 3300005354 Bacteria 1891
117 Ga0070671_100038982 3300005355 Bacteria 3943
118 Ga0070671_100082676 3300005355 Bacteria 2685
119 Ga0070671_100119080 3300005355 Bacteria 2221
120 Ga0070671_100220786 3300005355 Bacteria 1608
121 Ga0070671_100224388 3300005355 Bacteria 1594
122 Ga0070671_100228430 3300005355 Bacteria 1579
123 Ga0070674_100001774 3300005356 Bacteria 11697
124 Ga0070674_100004890 3300005356 Bacteria 7678
125 Ga0070674_100022944 3300005356 Bacteria 4029
126 Ga0070674_100024527 3300005356 Bacteria 3915
127 Ga0070674_100045667 3300005356 Bacteria 2993
128 Ga0070674_100125183 3300005356 Bacteria 1908
129 Ga0070674_100203142 3300005356 Bacteria 1531
130 Ga0070673_100001494 3300005364 Bacteria 13725
131 Ga0070673_100046039 3300005364 Bacteria 3386
132 Ga0070673_100208744 3300005364 Bacteria 1686
133 Ga0070688_100002589 3300005365 Bacteria 9163
134 Ga0070688_100003881 3300005365 Bacteria 7747
135 Ga0070688_100009486 3300005365 Bacteria 5325
136 Ga0070659_100008137 3300005366 Bacteria 7648
137 Ga0070659_100019257 3300005366 Bacteria 5168
138 Ga0070659_100081427 3300005366 Bacteria 2585
139 Ga0070659_100134842 3300005366 Bacteria 2007
140 Ga0070659_100158758 3300005366 Bacteria 1848
141 Ga0070659_100162100 3300005366 Bacteria 1829
142 Ga0070659_100295723 3300005366 Bacteria 1349
143 Ga0070667_100022657 3300005367 Bacteria 5208
144 Ga0070667_100071995 3300005367 Bacteria 2945
145 Ga0070667_100077328 3300005367 Bacteria 2841
146 Ga0070667_100169412 3300005367 Bacteria 1927
147 Ga0070703_10005687 3300005406 Bacteria 3488
148 Ga0070709_10000164 3300005434 Bacteria 42124
149 Ga0070709_10033577 3300005434 Bacteria 3104
150 Ga0070709_10066455 3300005434 Bacteria 2312
151 Ga0070709_10124489 3300005434 Bacteria 1752
152 Ga0070709_10148438 3300005434 Bacteria 1618
153 Ga0070714_100001570 3300005435 Bacteria 16615
154 Ga0070714_100006027 3300005435 Bacteria 9308
155 Ga0070714_100014414 3300005435 Bacteria 6351
156 Ga0070714_100111374 3300005435 Bacteria 2424
157 Ga0070713_100006415 3300005436 Bacteria 8152
158 Ga0070713_100051782 3300005436 Bacteria 3397
159 Ga0070713_100073367 3300005436 Bacteria 2897
160 Ga0070713_100077766 3300005436 Bacteria 2822
161 Ga0070713_100079583 3300005436 Bacteria 2792
162 Ga0070713_100171161 3300005436 Bacteria 1946
163 Ga0070710_10001859 3300005437 Bacteria 9943
164 Ga0070710_10020901 3300005437 Bacteria 3402
165 Ga0070710_10023219 3300005437 Bacteria 3257
166 Ga0070701_10011417 3300005438 Bacteria 3970
167 Ga0070711_100006405 3300005439 Bacteria 7096
168 Ga0070711_100019796 3300005439 Bacteria 4325
169 Ga0070711_100042211 3300005439 Bacteria 3082
170 Ga0070711_100047596 3300005439 Bacteria 2929
171 Ga0070705_100015179 3300005440 Bacteria 3976
172 Ga0070700_100002569 3300005441 Bacteria 9279
173 Ga0070700_100019743 3300005441 Bacteria 3893
174 Ga0070700_100027109 3300005441 Bacteria 3394
175 Ga0070700_100063082 3300005441 Bacteria 2343
176 Ga0070694_100013179 3300005444 Bacteria 5160
177 Ga0070708_100193154 3300005445 Bacteria 1904
178 Ga0070663_100007156 3300005455 Bacteria 6776
179 Ga0070663_100054202 3300005455 Bacteria 2865
180 Ga0070663_100087612 3300005455 Bacteria 2301
181 Ga0070678_100010470 3300005456 Bacteria 5669
182 Ga0070678_100015356 3300005456 Bacteria 4866
183 Ga0070678_100034696 3300005456 Bacteria 3515
184 Ga0070678_100112431 3300005456 Bacteria 2133
185 Ga0070678_100222208 3300005456 Bacteria 1570
186 Ga0070662_100006861 3300005457 Bacteria 7369
187 Ga0070662_100018911 3300005457 Bacteria 4668
188 Ga0070681_10002805 3300005458 Bacteria 16089
189 Ga0070681_10008769 3300005458 Bacteria 9924
190 Ga0070681_10014900 3300005458 Bacteria 7730
191 Ga0070681_10023941 3300005458 Bacteria 6148
192 Ga0070681_10024694 3300005458 Bacteria 6047
193 Ga0070681_10042344 3300005458 Bacteria 4563
194 Ga0070681_10063182 3300005458 Bacteria 3675
195 Ga0070681_10127749 3300005458 Bacteria 2475
196 Ga0070681_10130792 3300005458 Bacteria 2442
197 Ga0070681_10219118 3300005458 Bacteria 1818
198 Ga0068867_100021850 3300005459 Bacteria 4569
199 Ga0068867_100054255 3300005459 Bacteria 2961
200 Ga0068867_100171361 3300005459 Bacteria 1719
201 Ga0068867_100258307 3300005459 Bacteria 1419
202 Ga0068867_100276644 3300005459 Bacteria 1375
203 Ga0070685_10002366 3300005466 Bacteria 9704
204 Ga0070685_10007998 3300005466 Bacteria 5421
205 Ga0070685_10009962 3300005466 Bacteria 4930
206 Ga0070707_100014318 3300005468 Bacteria 7436
207 Ga0070698_100072539 3300005471 Bacteria 3451
208 Ga0070698_100088404 3300005471 Bacteria 3084
209 Ga0070698_100089301 3300005471 Bacteria 3066
210 Ga0070679_100012888 3300005530 Bacteria 8004
211 Ga0070679_100026052 3300005530 Bacteria 5740
212 Ga0070679_100033114 3300005530 Bacteria 5116
213 Ga0070679_100056002 3300005530 Bacteria 3928
214 Ga0070679_100074024 3300005530 Bacteria 3397
215 Ga0070679_100098356 3300005530 Bacteria 2913
216 Ga0070679_100109813 3300005530 Bacteria 2744
217 Ga0070679_100183365 3300005530 Bacteria 2065
218 Ga0070679_100283320 3300005530 Bacteria 1609
219 Ga0070684_100002191 3300005535 Bacteria 14406
220 Ga0070684_100004976 3300005535 Bacteria 10146
221 Ga0070684_100017501 3300005535 Bacteria 5886
222 Ga0070684_100116369 3300005535 Bacteria 2401
223 Ga0070684_100142783 3300005535 Bacteria 2166
224 Ga0070684_100178812 3300005535 Bacteria 1928
225 Ga0070697_100311760 3300005536 Bacteria 1354
226 Ga0068853_100010595 3300005539 Bacteria 7456
227 Ga0068853_100011756 3300005539 Bacteria 7115
228 Ga0068853_100041517 3300005539 Bacteria 3930
229 Ga0068853_100048189 3300005539 Bacteria 3659
230 Ga0068853_100101607 3300005539 Bacteria 2543
231 Ga0068853_100370655 3300005539 Bacteria 1336
232 Ga0070672_100005668 3300005543 Bacteria 8313
233 Ga0070672_100009090 3300005543 Bacteria 6833
234 Ga0070672_100009271 3300005543 Bacteria 6779
235 Ga0070672_100140382 3300005543 Bacteria 1992
236 Ga0070686_100010613 3300005544 Bacteria 5202
237 Ga0070686_100014956 3300005544 Bacteria 4483
238 Ga0070686_100234247 3300005544 Bacteria 1333
239 Ga0070695_100008500 3300005545 Bacteria 6093
240 Ga0070695_100019878 3300005545 Bacteria 4096
241 Ga0070695_100083808 3300005545 Bacteria 2113
242 Ga0070696_100036176 3300005546 Bacteria 3403
243 Ga0070693_100003509 3300005547 Bacteria 7313
244 Ga0070693_100004109 3300005547 Bacteria 6855
245 Ga0070693_100013294 3300005547 Bacteria 4190
246 Ga0070693_100171269 3300005547 Bacteria 1391
247 Ga0070665_100007488 3300005548 Bacteria 11101
248 Ga0070665_100012574 3300005548 Bacteria 8523
249 Ga0070665_100028361 3300005548 Bacteria 5639
250 Ga0070665_100076306 3300005548 Bacteria 3358
251 Ga0070665_100104914 3300005548 Bacteria 2829
252 Ga0070665_100138864 3300005548 Bacteria 2434
253 Ga0070665_100213744 3300005548 Bacteria 1929
254 Ga0070665_100264575 3300005548 Bacteria 1721
255 Ga0070704_100005591 3300005549 Bacteria 7338
256 Ga0070704_100012049 3300005549 Bacteria 5331
257 Ga0068855_100005017 3300005563 Bacteria 16158
258 Ga0068855_100018446 3300005563 Bacteria 8385
259 Ga0068855_100020322 3300005563 Bacteria 7967
260 Ga0068855_100023170 3300005563 Bacteria 7439
261 Ga0068855_100036717 3300005563 Bacteria 5830
262 Ga0068855_100088600 3300005563 Bacteria 3574
263 Ga0068855_100255072 3300005563 Bacteria 1955
264 Ga0068855_100378976 3300005563 Bacteria 1553
265 Ga0070664_100000613 3300005564 Bacteria 27268
266 Ga0070664_100104872 3300005564 Bacteria 2462
267 Ga0070664_100108880 3300005564 Bacteria 2416
268 Ga0070664_100172529 3300005564 Bacteria 1919
269 Ga0068857_100005360 3300005577 Bacteria 10933
270 Ga0068857_100012785 3300005577 Bacteria 7317
271 Ga0068857_100032619 3300005577 Bacteria 4605
272 Ga0068857_100236730 3300005577 Bacteria 1671
273 Ga0068854_100061841 3300005578 Bacteria 2713
274 Ga0068854_100062008 3300005578 Bacteria 2709
275 Ga0068856_100000651 3300005614 Bacteria 37648
276 Ga0068856_100013709 3300005614 Bacteria 7836
277 Ga0068856_100080598 3300005614 Bacteria 3229
278 Ga0068856_100178786 3300005614 Bacteria 2134
279 Ga0070702_100002455 3300005615 Bacteria 8008
280 Ga0070702_100014751 3300005615 Bacteria 3972
281 Ga0070702_100050079 3300005615 Bacteria 2384
282 Ga0068852_100011725 3300005616 Bacteria 6616
283 Ga0068852_100016683 3300005616 Bacteria 5737
284 Ga0068852_100025281 3300005616 Bacteria 4809
285 Ga0068852_100029264 3300005616 Bacteria 4522
286 Ga0068852_100092932 3300005616 Bacteria 2703
287 Ga0068852_100119851 3300005616 Bacteria 2406
288 Ga0068852_100227350 3300005616 Bacteria 1777
289 Ga0068859_100012388 3300005617 Bacteria 8579
290 Ga0068859_100014600 3300005617 Bacteria 7888
291 Ga0068859_100029114 3300005617 Bacteria 5542
292 Ga0068859_100072179 3300005617 Bacteria 3488
293 Ga0068859_100346218 3300005617 Bacteria 1581
294 Ga0068859_100386776 3300005617 Bacteria 1495
295 Ga0068864_100000969 3300005618 Bacteria 24049
296 Ga0068864_100013162 3300005618 Bacteria 6848
297 Ga0068864_100072905 3300005618 Bacteria 2993
298 Ga0068866_10048997 3300005718 Bacteria 2138
299 Ga0068866_10062306 3300005718 Bacteria 1940
300 Ga0068866_10103205 3300005718 Bacteria 1577
301 Ga0068861_100000011 3300005719 Bacteria 82099
302 Ga0068861_100011280 3300005719 Bacteria 6205
303 Ga0068861_100021250 3300005719 Bacteria 4664
304 Ga0068861_100031818 3300005719 Bacteria 3879
305 Ga0068861_100051276 3300005719 Bacteria 3132
306 Ga0068861_100067893 3300005719 Bacteria 2753
307 Ga0068861_100210205 3300005719 Bacteria 1638
308 Ga0068851_10109628 3300005834 Bacteria 1472
309 Ga0068870_10001753 3300005840 Bacteria 8895
310 Ga0068870_10001816 3300005840 Bacteria 8763
311 Ga0068870_10017075 3300005840 Bacteria 3483
312 Ga0068870_10038421 3300005840 Bacteria 2472
313 Ga0068863_100009807 3300005841 Bacteria 9332
314 Ga0068863_100027791 3300005841 Bacteria 5399
315 Ga0068863_100094759 3300005841 Bacteria 2833
316 Ga0068863_100146320 3300005841 Bacteria 2260
317 Ga0068863_100196591 3300005841 Bacteria 1939
318 Ga0068863_100295170 3300005841 Bacteria 1571
319 Ga0068858_100030453 3300005842 Bacteria 5010
320 Ga0068858_100032183 3300005842 Bacteria 4871
321 Ga0068858_100064016 3300005842 Bacteria 3403
322 Ga0068858_100169276 3300005842 Bacteria 2060
323 Ga0068858_100197526 3300005842 Bacteria 1901
324 Ga0068858_100293051 3300005842 Bacteria 1551
325 Ga0068860_100005403 3300005843 Bacteria 12964
326 Ga0068860_100042993 3300005843 Bacteria 4312
327 Ga0068860_100090706 3300005843 Bacteria 2911
328 Ga0068860_100297275 3300005843 Bacteria 1581
329 Ga0068862_100004342 3300005844 Bacteria 12003
330 Ga0068862_100036719 3300005844 Bacteria 4153
331 Ga0068862_100045004 3300005844 Bacteria 3765
332 Ga0068862_100085584 3300005844 Bacteria 2739
333 Ga0068862_100130702 3300005844 Bacteria 2220
334 Ga0068862_100177097 3300005844 Bacteria 1912
335 Ga0068862_100191272 3300005844 Bacteria 1841
336 Ga0068862_100199396 3300005844 Bacteria 1804
337 Ga0081455_10000002 3300005937 Bacteria 460472
338 Ga0081455_10002176 3300005937 Bacteria 23372
339 Ga0081455_10006012 3300005937 Bacteria 13150
340 Ga0081455_10007645 3300005937 Bacteria 11351
341 Ga0081455_10012417 3300005937 Bacteria 8498
342 Ga0081455_10058917 3300005937 Bacteria 3246
343 Ga0081455_10064904 3300005937 Bacteria 3056
344 Ga0081455_10075820 3300005937 Bacteria 2773
345 Ga0081455_10090641 3300005937 Bacteria 2478
346 Ga0081538_10002854 3300005981 Bacteria 16521
347 Ga0081538_10068962 3300005981 Bacteria 1962
348 Ga0081540_1000245 3300005983 Bacteria 56994
349 Ga0081540_1001138 3300005983 Bacteria 23482
350 Ga0081540_1001885 3300005983 Bacteria 17552
351 Ga0081540_1005464 3300005983 Bacteria 9481
352 Ga0081540_1008955 3300005983 Bacteria 6929
353 Ga0081540_1011835 3300005983 Bacteria 5797
354 Ga0081540_1013611 3300005983 Bacteria 5277
355 Ga0081540_1015277 3300005983 Bacteria 4868
356 Ga0081540_1035595 3300005983 Bacteria 2668
357 Ga0081540_1062832 3300005983 Bacteria 1761
358 Ga0081540_1064318 3300005983 Bacteria 1731
359 Ga0081539_10002005 3300005985 Bacteria 30877
360 Ga0081539_10009159 3300005985 Bacteria 8358
361 Ga0081539_10029288 3300005985 Bacteria 3442
362 Ga0081539_10089402 3300005985 Bacteria 1595
363 Ga0070717_10015334 3300006028 Bacteria 5918
364 Ga0070717_10057923 3300006028 Bacteria 3203
365 Ga0075365_10004545 3300006038 Bacteria 7370
366 Ga0075365_10040468 3300006038 Bacteria 3039
367 Ga0075365_10042704 3300006038 Bacteria 2965
368 Ga0075365_10087140 3300006038 Bacteria 2123
369 Ga0075365_10092604 3300006038 Bacteria 2060
370 Ga0075365_10093544 3300006038 Bacteria 2050
371 Ga0075365_10110215 3300006038 Bacteria 1891
372 Ga0075368_10011515 3300006042 Bacteria 3219
373 Ga0075363_100002635 3300006048 Bacteria 7396
374 Ga0075363_100005167 3300006048 Bacteria 5775
375 Ga0075363_100077996 3300006048 Bacteria 1808
376 Ga0075363_100093248 3300006048 Bacteria 1659
377 Ga0075363_100108633 3300006048 Bacteria 1540
378 Ga0075364_10028244 3300006051 Bacteria 3590
379 Ga0075364_10038602 3300006051 Bacteria 3094
380 Ga0070715_10001063 3300006163 Bacteria 7785
381 Ga0070716_100001724 3300006173 Bacteria 9859
382 Ga0070712_100002575 3300006175 Bacteria 11202
383 Ga0070712_100014212 3300006175 Bacteria 5109
384 Ga0070712_100022704 3300006175 Bacteria 4136
385 Ga0070712_100069246 3300006175 Bacteria 2517
386 Ga0070712_100110864 3300006175 Bacteria 2047
387 Ga0070712_100113599 3300006175 Bacteria 2026
388 Ga0075362_10000843 3300006177 Bacteria 9223
389 Ga0075362_10010498 3300006177 Bacteria 3618
390 Ga0075367_10052780 3300006178 Bacteria 2407
391 Ga0075367_10066400 3300006178 Bacteria 2161
392 Ga0075367_10109380 3300006178 Bacteria 1695
393 Ga0075367_10135857 3300006178 Bacteria 1521
394 Ga0075369_10009075 3300006186 Bacteria 3851
395 Ga0075369_10009532 3300006186 Bacteria 3776
396 Ga0075369_10034267 3300006186 Bacteria 2154
397 Ga0075369_10075869 3300006186 Bacteria 1485
398 Ga0075427_10000034 3300006194 Bacteria 9364
399 Ga0075366_10009232 3300006195 Bacteria 5504
400 Ga0075366_10021973 3300006195 Bacteria 3710
401 Ga0097621_100007850 3300006237 Bacteria 7654
402 Ga0097621_100015383 3300006237 Bacteria 5755
403 Ga0097621_100018986 3300006237 Bacteria 5268
404 Ga0075370_10070679 3300006353 Bacteria 1996
405 Ga0075370_10073066 3300006353 Bacteria 1964
406 Ga0075370_10084401 3300006353 Bacteria 1828
407 Ga0075370_10087992 3300006353 Bacteria 1790
408 Ga0068871_100006864 3300006358 Bacteria 8105
409 Ga0068871_100007848 3300006358 Bacteria 7648
410 Ga0068871_100046918 3300006358 Bacteria 3481
411 Ga0068871_100096323 3300006358 Bacteria 2472
412 Ga0068871_100147222 3300006358 Bacteria 2006
413 Ga0075428_100000063 3300006844 Bacteria 86012
414 Ga0075428_100015508 3300006844 Bacteria 8447
415 Ga0075428_100020977 3300006844 Bacteria 7237
416 Ga0075428_100051389 3300006844 Bacteria 4520
417 Ga0075428_100072125 3300006844 Bacteria 3774
418 Ga0075428_100208906 3300006844 Bacteria 2110
419 Ga0075428_100557744 3300006844 Bacteria 1224
420 Ga0075430_100001483 3300006846 Bacteria 19129
421 Ga0075430_100004870 3300006846 Bacteria 11299
422 Ga0075430_100007343 3300006846 Bacteria 9312
423 Ga0075430_100026582 3300006846 Bacteria 4921
424 Ga0075430_100043439 3300006846 Bacteria 3798
425 Ga0075430_100069264 3300006846 Bacteria 2960
426 Ga0075430_100081899 3300006846 Bacteria 2704
427 Ga0075430_100104504 3300006846 Bacteria 2364
428 Ga0075431_100000298 3300006847 Bacteria 39052
429 Ga0075431_100000736 3300006847 Bacteria 28248
430 Ga0075431_100001346 3300006847 Bacteria 22490
431 Ga0075431_100017634 3300006847 Bacteria 7258
432 Ga0075431_100019272 3300006847 Bacteria 6954
433 Ga0075431_100023378 3300006847 Bacteria 6323
434 Ga0075431_100113536 3300006847 Bacteria 2796
435 Ga0075431_100115208 3300006847 Bacteria 2774
436 Ga0075431_100122057 3300006847 Bacteria 2688
437 Ga0075433_10009808 3300006852 Bacteria 7674
438 Ga0075433_10107585 3300006852 Bacteria 2472
439 Ga0075433_10108895 3300006852 Bacteria 2458
440 Ga0075433_10144914 3300006852 Bacteria 2112
441 Ga0075434_100001473 3300006871 Bacteria 19815
442 Ga0075434_100002891 3300006871 Bacteria 15241
443 Ga0075434_100010565 3300006871 Bacteria 8663
444 Ga0075434_100013740 3300006871 Bacteria 7721
445 Ga0075434_100018589 3300006871 Bacteria 6716
446 Ga0075434_100135202 3300006871 Bacteria 2485
447 Ga0075434_100236024 3300006871 Bacteria 1848
448 Ga0075434_100250021 3300006871 Bacteria 1792
449 Ga0075429_100005777 3300006880 Bacteria 10678
450 Ga0075429_100079745 3300006880 Bacteria 2853
451 Ga0075429_100089330 3300006880 Bacteria 2686
452 Ga0068865_100033444 3300006881 Bacteria 3442
453 Ga0068865_100037458 3300006881 Bacteria 3275
454 Ga0068865_100061629 3300006881 Bacteria 2630
455 Ga0075436_100048215 3300006914 Bacteria 2939
456 Ga0075436_100066372 3300006914 Bacteria 2493
457 Ga0097620_100012388 3300006931 Bacteria 8579
458 Ga0097620_100014601 3300006931 Bacteria 7888
459 Ga0097620_100029113 3300006931 Bacteria 5542
460 Ga0097620_100072178 3300006931 Bacteria 3488
461 Ga0097620_100346220 3300006931 Bacteria 1581
462 Ga0097620_100386798 3300006931 Bacteria 1495
463 Ga0099825_1027845 3300006941 Bacteria 2827
464 Ga0099824_1017574 3300006942 Bacteria 6146
465 Ga0099822_1005813 3300006943 Bacteria 16112
466 Ga0099822_1047515 3300006943 Bacteria 1949
467 Ga0099823_1011851 3300006944 Bacteria 8829
468 Ga0075435_100002996 3300007076 Bacteria 11365
469 Ga0075435_100010089 3300007076 Bacteria 6892
470 Ga0075435_100053678 3300007076 Bacteria 3251
471 Ga0075435_100146030 3300007076 Bacteria 1987
472 Ga0075435_100302609 3300007076 Bacteria 1368
473 Ga0099795_10069255 3300007788 Bacteria 1327
474 Ga0105244_10120546 3300009036 Bacteria 1270
475 Ga0105240_10006144 3300009093 Bacteria 17713
476 Ga0105240_10031683 3300009093 Bacteria 6851
477 Ga0105240_10041859 3300009093 Bacteria 5842
478 Ga0105240_10042882 3300009093 Bacteria 5763
479 Ga0105240_10060680 3300009093 Bacteria 4714
480 Ga0105240_10099632 3300009093 Bacteria 3537
481 Ga0105240_10333558 3300009093 Bacteria 1725
482 Ga0111539_10000428 3300009094 Bacteria 52857
483 Ga0111539_10001391 3300009094 Bacteria 32180
484 Ga0111539_10025543 3300009094 Bacteria 7241
485 Ga0111539_10031170 3300009094 Bacteria 6480
486 Ga0111539_10041681 3300009094 Bacteria 5518
487 Ga0111539_10051155 3300009094 Bacteria 4922
488 Ga0111539_10054237 3300009094 Bacteria 4770
489 Ga0111539_10091494 3300009094 Bacteria 3574
490 Ga0111539_10104338 3300009094 Bacteria 3326
491 Ga0111539_10109625 3300009094 Bacteria 3240
492 Ga0111539_10129729 3300009094 Bacteria 2953
493 Ga0111539_10324219 3300009094 Bacteria 1793
494 Ga0111539_10357512 3300009094 Bacteria 1699
495 Ga0111539_10460877 3300009094 Bacteria 1480
496 Ga0105245_10000888 3300009098 Bacteria 27206
497 Ga0105245_10041487 3300009098 Bacteria 4102
498 Ga0105245_10078453 3300009098 Bacteria 3013
499 Ga0105247_10017376 3300009101 Bacteria 4320
500 Ga0105247_10065668 3300009101 Bacteria 2257
501 Ga0105247_10127522 3300009101 Bacteria 1655
502 Ga0105247_10127813 3300009101 Bacteria 1653
503 Ga0105247_10195051 3300009101 Bacteria 1358
504 Ga0114129_10005614 3300009147 Bacteria 17743
505 Ga0114129_10010165 3300009147 Bacteria 13417
506 Ga0114129_10013021 3300009147 Bacteria 11847
507 Ga0114129_10046855 3300009147 Bacteria 6076
508 Ga0114129_10150322 3300009147 Bacteria 3187
509 Ga0114129_10368325 3300009147 Bacteria 1900
510 Ga0105243_10001197 3300009148 Bacteria 23346
511 Ga0105243_10014854 3300009148 Bacteria 5891
512 Ga0105243_10031983 3300009148 Bacteria 4060
513 Ga0105243_10047121 3300009148 Bacteria 3392
514 Ga0105243_10228854 3300009148 Bacteria 1648
515 Ga0105243_10259563 3300009148 Bacteria 1555
516 Ga0105241_10082035 3300009174 Bacteria 2527
517 Ga0105241_10099523 3300009174 Bacteria 2309
518 Ga0105241_10181877 3300009174 Bacteria 1745
519 Ga0105241_10239301 3300009174 Bacteria 1534
520 Ga0105242_10003386 3300009176 Bacteria 12416
521 Ga0105242_10023894 3300009176 Bacteria 4823
522 Ga0105242_10151361 3300009176 Bacteria 2023
523 Ga0105248_10000001 3300009177 Bacteria 1881304
524 Ga0105248_10002019 3300009177 Bacteria 22514
525 Ga0105248_10022117 3300009177 Bacteria 7047
526 Ga0105248_10082463 3300009177 Bacteria 3616
527 Ga0105248_10128326 3300009177 Bacteria 2861
528 Ga0105248_10140733 3300009177 Bacteria 2722
529 Ga0105248_10182698 3300009177 Bacteria 2363
530 Ga0105248_10255057 3300009177 Bacteria 1974
531 Ga0105237_10009423 3300009545 Bacteria 10460
532 Ga0105237_10046675 3300009545 Bacteria 4357
533 Ga0105237_10063249 3300009545 Bacteria 3698
534 Ga0105237_10071343 3300009545 Bacteria 3468
535 Ga0105237_10081560 3300009545 Bacteria 3226
536 Ga0105237_10126308 3300009545 Bacteria 2552
537 Ga0105237_10190564 3300009545 Bacteria 2050
538 Ga0105238_10011779 3300009551 Bacteria 8814
539 Ga0105238_10040832 3300009551 Bacteria 4700
540 Ga0105238_10067394 3300009551 Bacteria 3581
541 Ga0105238_10070658 3300009551 Bacteria 3490
542 Ga0105238_10348881 3300009551 Bacteria 1469
543 Ga0105238_10421207 3300009551 Bacteria 1330
544 Ga0105249_10016547 3300009553 Bacteria 6544
545 Ga0105249_10019292 3300009553 Bacteria 6082
546 Ga0105249_10030871 3300009553 Bacteria 4844
547 Ga0105249_10080966 3300009553 Unclassified 3017
548 Ga0105249_10081204 3300009553 Bacteria 3013
549 Ga0105249_10121379 3300009553 Bacteria 2483
550 Ga0099796_10004162 3300010159 Bacteria 3468
551 Ga0105239_10010622 3300010375 Bacteria 10298
552 Ga0105239_10016077 3300010375 Bacteria 8279
553 Ga0105239_10054385 3300010375 Bacteria 4391
554 Ga0105239_10075776 3300010375 Bacteria 3699
555 Ga0105239_10130085 3300010375 Bacteria 2799
556 Ga0105239_10133338 3300010375 Bacteria 2764
557 Ga0105239_10206476 3300010375 Bacteria 2201
558 Ga0105239_10210541 3300010375 Bacteria 2179
559 Ga0105246_10046358 3300011119 Bacteria 2965
560 Ga0105246_10078268 3300011119 Bacteria 2348
561 Ga0105246_10096908 3300011119 Bacteria 2139
562 Ga0157373_10006372 3300013100 Bacteria 8816
563 Ga0157373_10049748 3300013100 Bacteria 2986
564 Ga0157373_10082626 3300013100 Bacteria 2264
565 Ga0157373_10164410 3300013100 Bacteria 1562
566 Ga0157371_10095161 3300013102 Bacteria 2111
567 Ga0157370_10004037 3300013104 Bacteria 17058
568 Ga0157370_10015393 3300013104 Bacteria 7774
569 Ga0157370_10065203 3300013104 Bacteria 3446
570 Ga0157370_10067696 3300013104 Bacteria 3375
571 Ga0157370_10193676 3300013104 Bacteria 1887
572 Ga0157369_10026404 3300013105 Bacteria 6442
573 Ga0157369_10027398 3300013105 Bacteria 6317
574 Ga0157369_10046781 3300013105 Bacteria 4701
575 Ga0157369_10072267 3300013105 Bacteria 3702
576 Ga0157369_10079352 3300013105 Bacteria 3516
577 Ga0157369_10114154 3300013105 Bacteria 2869
578 Ga0157369_10198678 3300013105 Bacteria 2105
579 Ga0157374_10011455 3300013296 Bacteria 7680
580 Ga0157374_10092096 3300013296 Bacteria 2892
581 Ga0157374_10098729 3300013296 Bacteria 2796
582 Ga0157374_10118369 3300013296 Bacteria 2554
583 Ga0157374_10162267 3300013296 Bacteria 2177
584 Ga0157374_10193049 3300013296 Bacteria 1992
585 Ga0157378_10002715 3300013297 Bacteria 15762
586 Ga0157378_10008331 3300013297 Bacteria 9033
587 Ga0163162_10022178 3300013306 Bacteria 6259
588 Ga0163162_10038053 3300013306 Bacteria 4802
589 Ga0163162_10142944 3300013306 Bacteria 2507
590 Ga0163162_10242241 3300013306 Bacteria 1934
591 Ga0157372_10003887 3300013307 Bacteria 16048
592 Ga0157372_10031372 3300013307 Bacteria 5819
593 Ga0157372_10059762 3300013307 Bacteria 4264
594 Ga0157372_10085902 3300013307 Bacteria 3569
595 Ga0157372_10219257 3300013307 Bacteria 2205
596 Ga0157375_10039792 3300013308 Bacteria 4527
597 Ga0157375_10117290 3300013308 Bacteria 2767
598 Ga0157375_10285577 3300013308 Bacteria 1813
599 Ga0163163_10003103 3300014325 Bacteria 14076
600 Ga0163163_10007860 3300014325 Bacteria 9427
601 Ga0163163_10013748 3300014325 Bacteria 7418
602 Ga0163163_10102640 3300014325 Bacteria 2884
603 Ga0157380_10013555 3300014326 Bacteria 5949
604 Ga0157380_10096818 3300014326 Bacteria 2448
605 Ga0157380_10214378 3300014326 Bacteria 1718
606 Ga0157380_10306222 3300014326 Bacteria 1466
607 Ga0157377_10004182 3300014745 Bacteria 6597
608 Ga0157379_10002897 3300014968 Bacteria 14477
609 Ga0157379_10024614 3300014968 Bacteria 5344
610 Ga0157379_10218160 3300014968 Bacteria 1728
611 Ga0157379_10269548 3300014968 Bacteria 1548
612 Ga0157376_10005383 3300014969 Bacteria 8946
613 Ga0157376_10022750 3300014969 Bacteria 4892
614 Ga0163161_10054226 3300017792 Bacteria 2909
615 Ga0163161_10069933 3300017792 Bacteria 2566
616 Ga0163161_10131987 3300017792 Bacteria 1885
617 Ga0163161_10134723 3300017792 Bacteria 1866
618 Ga0206353_10510854 3300020082 Bacteria 5477
619 Ga0206353_11384118 3300020082 Bacteria 1553
620 Ga0214544_1000665 3300021320 Bacteria 65630
621 Ga0214544_1015664 3300021320 Bacteria 7783
622 Ga0214542_1000486 3300021321 Bacteria 71884
623 Ga0214545_1000307 3300021324 Bacteria 71884
624 Ga0214543_1003627 3300021327 Bacteria 29806
625 Ga0213874_10041195 3300021377 Bacteria 1382
626 Ga0213876_10005899 3300021384 Bacteria 6696
627 Ga0213876_10006870 3300021384 Bacteria 6204
628 Ga0213876_10026126 3300021384 Bacteria 3080
629 Ga0213875_10000182 3300021388 Bacteria 64147
630 Ga0213875_10011963 3300021388 Bacteria 4299
631 Ga0209026_1000593 3300025250 Bacteria 23624
632 Ga0209677_100521 3300025253 Bacteria 21414
633 Ga0209677_103539 3300025253 Bacteria 4982
634 Ga0209148_1000418 3300025254 Bacteria 47611
635 Ga0209233_1006627 3300025261 Bacteria 3717
636 Ga0209233_1012618 3300025261 Bacteria 2442
637 Ga0209233_1021144 3300025261 Bacteria 1692
638 Ga0207666_1000463 3300025271 Bacteria 5235
639 Ga0209455_1002667 3300025272 Bacteria 6723
640 Ga0209455_1004449 3300025272 Bacteria 4583
641 Ga0209673_1015011 3300025273 Bacteria 2967
642 Ga0209130_1000024 3300025284 Bacteria 354212
643 Ga0209130_1000674 3300025284 Bacteria 30898
644 Ga0209675_1000802 3300025291 Bacteria 20717
645 Ga0209025_1000017 3300025294 Bacteria 768983
646 Ga0209025_1000251 3300025294 Bacteria 126418
647 Ga0209025_1001580 3300025294 Bacteria 28793
648 Ga0209564_1000059 3300025295 Bacteria 328782
649 Ga0209564_1000904 3300025295 Bacteria 38851
650 Ga0209564_1004051 3300025295 Bacteria 9245
651 Ga0209564_1005946 3300025295 Bacteria 6758
652 Ga0209564_1009196 3300025295 Bacteria 4743
653 Ga0209758_1000060 3300025297 Bacteria 324326
654 Ga0209758_1000069 3300025297 Bacteria 286161
655 Ga0209758_1000992 3300025297 Bacteria 37900
656 Ga0209758_1001512 3300025297 Bacteria 26996
657 Ga0209758_1003988 3300025297 Bacteria 12774
658 Ga0209758_1005623 3300025297 Bacteria 9518
659 Ga0209758_1009651 3300025297 Bacteria 5947
660 Ga0209758_1010749 3300025297 Bacteria 5425
661 Ga0209050_1003616 3300025298 Bacteria 11210
662 Ga0209256_1000033 3300025299 Bacteria 393924
663 Ga0209256_1001214 3300025299 Bacteria 28770
664 Ga0209256_1007451 3300025299 Bacteria 5387
665 Ga0207426_1000179 3300025302 Bacteria 158635
666 Ga0207426_1002389 3300025302 Bacteria 12105
667 Ga0207426_1002931 3300025302 Bacteria 10046
668 Ga0207426_1012062 3300025302 Bacteria 3263
669 Ga0209051_1020842 3300025303 Bacteria 2809
670 Ga0209257_1000589 3300025304 Bacteria 60641
671 Ga0209257_1001133 3300025304 Bacteria 34214
672 Ga0209257_1001379 3300025304 Bacteria 29154
673 Ga0209257_1010825 3300025304 Bacteria 4521
674 Ga0209257_1015698 3300025304 Bacteria 3128
675 Ga0207697_10007868 3300025315 Bacteria 4712
676 Ga0207653_10019008 3300025885 Bacteria 2165
677 Ga0207682_10000134 3300025893 Bacteria 33520
678 Ga0207682_10002832 3300025893 Bacteria 7658
679 Ga0207692_10001084 3300025898 Bacteria 9986
680 Ga0207692_10001784 3300025898 Bacteria 8166
681 Ga0207692_10032119 3300025898 Bacteria 2520
682 Ga0207692_10035203 3300025898 Bacteria 2432
683 Ga0207692_10080675 3300025898 Bacteria 1739
684 Ga0207642_10004667 3300025899 Bacteria 4426
685 Ga0207642_10026174 3300025899 Bacteria 2371
686 Ga0207710_10009679 3300025900 Bacteria 4051
687 Ga0207710_10044171 3300025900 Bacteria 1984
688 Ga0207710_10058110 3300025900 Bacteria 1748
689 Ga0207688_10008282 3300025901 Bacteria 5652
690 Ga0207680_10013229 3300025903 Bacteria 4232
691 Ga0207680_10039585 3300025903 Bacteria 2737
692 Ga0207680_10138308 3300025903 Bacteria 1612
693 Ga0207680_10149396 3300025903 Bacteria 1557
694 Ga0207647_10026061 3300025904 Bacteria 3829
695 Ga0207647_10047828 3300025904 Bacteria 2659
696 Ga0207647_10080936 3300025904 Bacteria 1947
697 Ga0207685_10008414 3300025905 Bacteria 2937
698 Ga0207699_10000184 3300025906 Bacteria 37990
699 Ga0207699_10147278 3300025906 Bacteria 1554
700 Ga0207645_10001493 3300025907 Bacteria 19117
701 Ga0207645_10002841 3300025907 Bacteria 13434
702 Ga0207645_10044302 3300025907 Bacteria 2847
703 Ga0207645_10095484 3300025907 Bacteria 1914
704 Ga0207645_10107031 3300025907 Bacteria 1808
705 Ga0207645_10108811 3300025907 Bacteria 1793
706 Ga0207643_10000475 3300025908 Bacteria 25958
707 Ga0207643_10002845 3300025908 Bacteria 9348
708 Ga0207643_10052085 3300025908 Bacteria 2324
709 Ga0207705_10000058 3300025909 Bacteria 155967
710 Ga0207705_10045547 3300025909 Bacteria 3152
711 Ga0207705_10054626 3300025909 Bacteria 2879
712 Ga0207705_10062423 3300025909 Bacteria 2691
713 Ga0207705_10261943 3300025909 Bacteria 1320
714 Ga0207684_10002963 3300025910 Bacteria 16822
715 Ga0207654_10020990 3300025911 Bacteria 3469
716 Ga0207654_10064521 3300025911 Bacteria 2153
717 Ga0207707_10001851 3300025912 Bacteria 19343
718 Ga0207707_10006404 3300025912 Bacteria 10277
719 Ga0207707_10010835 3300025912 Bacteria 7922
720 Ga0207707_10012573 3300025912 Bacteria 7357
721 Ga0207707_10022207 3300025912 Bacteria 5546
722 Ga0207707_10030614 3300025912 Bacteria 4708
723 Ga0207707_10084340 3300025912 Bacteria 2775
724 Ga0207707_10124271 3300025912 Bacteria 2256
725 Ga0207707_10132738 3300025912 Bacteria 2177
726 Ga0207695_10000148 3300025913 Bacteria 208344
727 Ga0207695_10001397 3300025913 Bacteria 40785
728 Ga0207695_10003713 3300025913 Bacteria 21253
729 Ga0207695_10043618 3300025913 Bacteria 4780
730 Ga0207695_10148636 3300025913 Bacteria 2284
731 Ga0207695_10150447 3300025913 Bacteria 2267
732 Ga0207695_10218940 3300025913 Bacteria 1812
733 Ga0207671_10009621 3300025914 Bacteria 8057
734 Ga0207671_10084216 3300025914 Bacteria 2388
735 Ga0207671_10097478 3300025914 Bacteria 2223
736 Ga0207671_10115669 3300025914 Bacteria 2045
737 Ga0207671_10271812 3300025914 Bacteria 1335
738 Ga0207693_10000145 3300025915 Bacteria 65383
739 Ga0207693_10003028 3300025915 Bacteria 14526
740 Ga0207693_10004934 3300025915 Bacteria 11209
741 Ga0207693_10033180 3300025915 Bacteria 4074
742 Ga0207693_10046473 3300025915 Bacteria 3410
743 Ga0207693_10132276 3300025915 Bacteria 1961
744 Ga0207663_10000585 3300025916 Bacteria 16125
745 Ga0207663_10000680 3300025916 Bacteria 15063
746 Ga0207663_10016826 3300025916 Bacteria 4065
747 Ga0207663_10105298 3300025916 Bacteria 1903
748 Ga0207660_10003913 3300025917 Bacteria 9706
749 Ga0207660_10005342 3300025917 Bacteria 8345
750 Ga0207660_10011491 3300025917 Bacteria 5766
751 Ga0207660_10015835 3300025917 Bacteria 4984
752 Ga0207660_10031485 3300025917 Bacteria 3654
753 Ga0207660_10032120 3300025917 Bacteria 3621
754 Ga0207660_10042874 3300025917 Bacteria 3178
755 Ga0207660_10067196 3300025917 Bacteria 2596
756 Ga0207660_10086902 3300025917 Bacteria 2309
757 Ga0207660_10258830 3300025917 Bacteria 1375
758 Ga0207662_10001348 3300025918 Bacteria 11851
759 Ga0207662_10012606 3300025918 Bacteria 4711
760 Ga0207662_10019432 3300025918 Bacteria 3866
761 Ga0207662_10030209 3300025918 Bacteria 3144
762 Ga0207662_10078002 3300025918 Bacteria 2015
763 Ga0207657_10001163 3300025919 Bacteria 27950
764 Ga0207657_10007796 3300025919 Bacteria 10928
765 Ga0207657_10009304 3300025919 Bacteria 9894
766 Ga0207657_10011539 3300025919 Bacteria 8771
767 Ga0207657_10014973 3300025919 Bacteria 7535
768 Ga0207657_10023545 3300025919 Bacteria 5732
769 Ga0207657_10067234 3300025919 Bacteria 3048
770 Ga0207657_10138625 3300025919 Bacteria 1989
771 Ga0207657_10143477 3300025919 Bacteria 1949
772 Ga0207657_10164327 3300025919 Bacteria 1801
773 Ga0207657_10209924 3300025919 Bacteria 1563
774 Ga0207649_10000271 3300025920 Bacteria 40924
775 Ga0207649_10006528 3300025920 Bacteria 6337
776 Ga0207649_10130275 3300025920 Bacteria 1707
777 Ga0207652_10001515 3300025921 Bacteria 20513
778 Ga0207652_10002661 3300025921 Bacteria 14988
779 Ga0207652_10007721 3300025921 Bacteria 8642
780 Ga0207652_10019461 3300025921 Bacteria 5584
781 Ga0207652_10025892 3300025921 Bacteria 4880
782 Ga0207652_10029863 3300025921 Bacteria 4562
783 Ga0207652_10054082 3300025921 Bacteria 3450
784 Ga0207652_10079308 3300025921 Bacteria 2868
785 Ga0207652_10111627 3300025921 Bacteria 2425
786 Ga0207652_10149685 3300025921 Bacteria 2089
787 Ga0207646_10024856 3300025922 Bacteria 5483
788 Ga0207681_10004316 3300025923 Bacteria 8779
789 Ga0207681_10007364 3300025923 Bacteria 6740
790 Ga0207681_10060801 3300025923 Bacteria 2595
791 Ga0207681_10212866 3300025923 Bacteria 1491
792 Ga0207681_10292679 3300025923 Bacteria 1286
793 Ga0207650_10016013 3300025925 Bacteria 5231
794 Ga0207650_10018233 3300025925 Bacteria 4923
795 Ga0207650_10087491 3300025925 Bacteria 2374
796 Ga0207650_10089791 3300025925 Bacteria 2346
797 Ga0207659_10002002 3300025926 Bacteria 12074
798 Ga0207659_10019518 3300025926 Bacteria 4464
799 Ga0207659_10020698 3300025926 Bacteria 4353
800 Ga0207687_10018555 3300025927 Bacteria 4595
801 Ga0207687_10078224 3300025927 Bacteria 2381
802 Ga0207687_10143493 3300025927 Bacteria 1814
803 Ga0207700_10000624 3300025928 Bacteria 20699
804 Ga0207700_10012229 3300025928 Bacteria 5524
805 Ga0207700_10104336 3300025928 Bacteria 2268
806 Ga0207700_10137156 3300025928 Bacteria 2006
807 Ga0207700_10326937 3300025928 Bacteria 1330
808 Ga0207664_10003622 3300025929 Bacteria 10338
809 Ga0207664_10012251 3300025929 Bacteria 6129
810 Ga0207664_10039619 3300025929 Bacteria 3659
811 Ga0207664_10040782 3300025929 Bacteria 3613
812 Ga0207664_10151651 3300025929 Bacteria 1969
813 Ga0207644_10000279 3300025931 Bacteria 33969
814 Ga0207644_10028212 3300025931 Bacteria 3884
815 Ga0207644_10033193 3300025931 Bacteria 3605
816 Ga0207644_10148743 3300025931 Bacteria 1811
817 Ga0207644_10165578 3300025931 Bacteria 1722
818 Ga0207644_10203575 3300025931 Bacteria 1562
819 Ga0207644_10275265 3300025931 Bacteria 1350
820 Ga0207690_10005129 3300025932 Bacteria 7734
821 Ga0207690_10020328 3300025932 Bacteria 4101
822 Ga0207690_10074138 3300025932 Bacteria 2356
823 Ga0207690_10202730 3300025932 Bacteria 1508
824 Ga0207690_10203309 3300025932 Bacteria 1506
825 Ga0207706_10002724 3300025933 Bacteria 17213
826 Ga0207706_10003321 3300025933 Bacteria 15400
827 Ga0207706_10021282 3300025933 Bacteria 5826
828 Ga0207706_10111140 3300025933 Bacteria 2411
829 Ga0207706_10143942 3300025933 Bacteria 2097
830 Ga0207686_10026303 3300025934 Bacteria 3393
831 Ga0207686_10070566 3300025934 Bacteria 2245
832 Ga0207709_10002372 3300025935 Bacteria 11884
833 Ga0207709_10036547 3300025935 Bacteria 2911
834 Ga0207709_10067100 3300025935 Bacteria 2263
835 Ga0207670_10001390 3300025936 Bacteria 12731
836 Ga0207670_10016957 3300025936 Bacteria 4391
837 Ga0207670_10052371 3300025936 Bacteria 2744
838 Ga0207670_10095621 3300025936 Bacteria 2110
839 Ga0207670_10197244 3300025936 Bacteria 1527
840 Ga0207669_10000808 3300025937 Bacteria 13424
841 Ga0207669_10017669 3300025937 Bacteria 3665
842 Ga0207669_10111479 3300025937 Bacteria 1835
843 Ga0207669_10222114 3300025937 Bacteria 1387
844 Ga0207704_10018037 3300025938 Bacteria 3675
845 Ga0207704_10034117 3300025938 Bacteria 2901
846 Ga0207704_10047776 3300025938 Bacteria 2561
847 Ga0207704_10198173 3300025938 Bacteria 1467
848 Ga0207665_10002484 3300025939 Bacteria 12418
849 Ga0207665_10007064 3300025939 Bacteria 7434
850 Ga0207665_10056485 3300025939 Bacteria 2649
851 Ga0207665_10107349 3300025939 Bacteria 1957
852 Ga0207691_10000635 3300025940 Bacteria 34764
853 Ga0207691_10005210 3300025940 Bacteria 12554
854 Ga0207691_10011532 3300025940 Bacteria 8483
855 Ga0207691_10019787 3300025940 Bacteria 6367
856 Ga0207691_10038313 3300025940 Bacteria 4436
857 Ga0207691_10044438 3300025940 Bacteria 4090
858 Ga0207691_10054742 3300025940 Bacteria 3639
859 Ga0207691_10100386 3300025940 Bacteria 2583
860 Ga0207711_10000001 3300025941 Bacteria 1325674
861 Ga0207711_10010975 3300025941 Bacteria 7525
862 Ga0207711_10021369 3300025941 Bacteria 5407
863 Ga0207711_10024403 3300025941 Bacteria 5065
864 Ga0207711_10025147 3300025941 Bacteria 4996
865 Ga0207711_10078692 3300025941 Bacteria 2876
866 Ga0207711_10222290 3300025941 Bacteria 1727
867 Ga0207689_10003227 3300025942 Bacteria 14940
868 Ga0207689_10008851 3300025942 Bacteria 8739
869 Ga0207689_10027414 3300025942 Bacteria 4769
870 Ga0207689_10028654 3300025942 Bacteria 4657
871 Ga0207689_10053851 3300025942 Bacteria 3315
872 Ga0207689_10139407 3300025942 Bacteria 1998
873 Ga0207679_10001585 3300025945 Bacteria 14207
874 Ga0207679_10005056 3300025945 Bacteria 8246
875 Ga0207679_10048249 3300025945 Bacteria 3099
876 Ga0207667_10001909 3300025949 Bacteria 26170
877 Ga0207667_10011376 3300025949 Bacteria 10348
878 Ga0207667_10023907 3300025949 Bacteria 6722
879 Ga0207667_10036427 3300025949 Bacteria 5274
880 Ga0207667_10138930 3300025949 Bacteria 2501
881 Ga0207667_10164239 3300025949 Bacteria 2283
882 Ga0207667_10295372 3300025949 Bacteria 1655
883 Ga0207651_10014190 3300025960 Bacteria 4592
884 Ga0207651_10041222 3300025960 Bacteria 3063
885 Ga0207651_10160843 3300025960 Bacteria 1760
886 Ga0207712_10014956 3300025961 Bacteria 4999
887 Ga0207712_10110718 3300025961 Bacteria 2059
888 Ga0207668_10008756 3300025972 Bacteria 6048
889 Ga0207668_10011903 3300025972 Bacteria 5305
890 Ga0207668_10050132 3300025972 Bacteria 2875
891 Ga0207668_10316757 3300025972 Bacteria 1293
892 Ga0207640_10002533 3300025981 Bacteria 9793
893 Ga0207640_10061002 3300025981 Bacteria 2496
894 Ga0207640_10092685 3300025981 Bacteria 2096
895 Ga0207640_10224897 3300025981 Bacteria 1439
896 Ga0207658_10013362 3300025986 Bacteria 5607
897 Ga0207658_10144316 3300025986 Bacteria 1931
898 Ga0207658_10172753 3300025986 Bacteria 1782
899 Ga0207658_10251670 3300025986 Bacteria 1501
900 Ga0207677_10011135 3300026023 Bacteria 5115
901 Ga0207677_10027080 3300026023 Bacteria 3605
902 Ga0207677_10091737 3300026023 Bacteria 2210
903 Ga0207703_10011681 3300026035 Bacteria 6830
904 Ga0207703_10045288 3300026035 Bacteria 3539
905 Ga0207703_10079466 3300026035 Bacteria 2729
906 Ga0207703_10134040 3300026035 Bacteria 2142
907 Ga0207639_10002004 3300026041 Bacteria 13735
908 Ga0207639_10002676 3300026041 Bacteria 11963
909 Ga0207639_10009900 3300026041 Bacteria 6583
910 Ga0207639_10029671 3300026041 Bacteria 4007
911 Ga0207639_10299060 3300026041 Bacteria 1422
912 Ga0207678_10004327 3300026067 Bacteria 12746
913 Ga0207678_10004902 3300026067 Bacteria 12024
914 Ga0207678_10006755 3300026067 Bacteria 10174
915 Ga0207678_10033535 3300026067 Bacteria 4472
916 Ga0207678_10049874 3300026067 Bacteria 3617
917 Ga0207678_10056557 3300026067 Bacteria 3376
918 Ga0207678_10085415 3300026067 Bacteria 2698
919 Ga0207678_10116443 3300026067 Bacteria 2280
920 Ga0207678_10145207 3300026067 Bacteria 2025
921 Ga0207678_10281290 3300026067 Bacteria 1428
922 Ga0207708_10004390 3300026075 Bacteria 10393
923 Ga0207708_10005428 3300026075 Bacteria 9398
924 Ga0207708_10021446 3300026075 Bacteria 4872
925 Ga0207708_10063119 3300026075 Bacteria 2830
926 Ga0207708_10096990 3300026075 Bacteria 2278
927 Ga0207708_10135482 3300026075 Bacteria 1928
928 Ga0207702_10000546 3300026078 Bacteria 42023
929 Ga0207702_10100264 3300026078 Bacteria 2554
930 Ga0207702_10238884 3300026078 Bacteria 1701
931 Ga0207641_10065743 3300026088 Bacteria 3102
932 Ga0207641_10100124 3300026088 Bacteria 2552
933 Ga0207648_10003105 3300026089 Bacteria 17542
934 Ga0207648_10006953 3300026089 Bacteria 11200
935 Ga0207648_10031091 3300026089 Bacteria 4722
936 Ga0207648_10250289 3300026089 Bacteria 1579
937 Ga0207648_10383842 3300026089 Bacteria 1270
938 Ga0207676_10026102 3300026095 Bacteria 4341
939 Ga0207676_10066888 3300026095 Bacteria 2868
940 Ga0207676_10068521 3300026095 Bacteria 2838
941 Ga0207676_10162861 3300026095 Bacteria 1934
942 Ga0207674_10003206 3300026116 Bacteria 20153
943 Ga0207674_10011817 3300026116 Bacteria 9791
944 Ga0207674_10028047 3300026116 Bacteria 5948
945 Ga0207675_100001048 3300026118 Bacteria 27391
946 Ga0207675_100002896 3300026118 Bacteria 16874
947 Ga0207675_100004255 3300026118 Bacteria 13848
948 Ga0207675_100007364 3300026118 Bacteria 10398
949 Ga0207675_100018040 3300026118 Bacteria 6582
950 Ga0207675_100022885 3300026118 Bacteria 5813
951 Ga0207675_100037571 3300026118 Bacteria 4516
952 Ga0207675_100137497 3300026118 Bacteria 2319
953 Ga0207675_100241184 3300026118 Bacteria 1747
954 Ga0207683_10000508 3300026121 Bacteria 35876
955 Ga0207683_10001717 3300026121 Bacteria 19589
956 Ga0207683_10005552 3300026121 Bacteria 10803
957 Ga0207683_10029715 3300026121 Bacteria 4733
958 Ga0207683_10075094 3300026121 Bacteria 2992
959 Ga0207683_10165236 3300026121 Bacteria 2002
960 Ga0207683_10406092 3300026121 Bacteria 1253
961 Ga0207698_10048658 3300026142 Bacteria 3220
962 Ga0207698_10081882 3300026142 Bacteria 2607
963 Ga0209389_1000102 3300027296 Bacteria 78475
964 Ga0209389_1000142 3300027296 Bacteria 62072
965 Ga0209589_1000331 3300027357 Bacteria 62072
966 Ga0209489_100404 3300027361 Bacteria 78473
967 Ga0209489_100818 3300027361 Bacteria 62070
968 Ga0209700_100408 3300027363 Bacteria 78496
969 Ga0210002_1002903 3300027617 Bacteria 2504
970 Ga0209971_1001682 3300027682 Bacteria 5466
971 Ga0209966_1000994 3300027695 Bacteria 5291
972 Ga0209998_10003097 3300027717 Bacteria 3684
973 Ga0209998_10003856 3300027717 Bacteria 3240
974 Ga0209998_10014963 3300027717 Bacteria 1622
975 Ga0207428_10000082 3300027907 Bacteria 133684
976 Ga0207428_10002785 3300027907 Bacteria 17359
977 Ga0207428_10004955 3300027907 Bacteria 12538
978 Ga0207428_10026953 3300027907 Bacteria 4788
979 Ga0207428_10027361 3300027907 Bacteria 4748
980 Ga0207428_10029766 3300027907 Bacteria 4520
981 Ga0207428_10036877 3300027907 Bacteria 3983
982 Ga0207428_10095576 3300027907 Bacteria 2302
983 Ga0207428_10128862 3300027907 Bacteria 1937
984 Ga0207428_10161847 3300027907 Bacteria 1699
985 Ga0268266_10001335 3300028379 Bacteria 29884
986 Ga0268266_10010858 3300028379 Bacteria 7933
987 Ga0268266_10026552 3300028379 Bacteria 4928
988 Ga0268266_10038187 3300028379 Bacteria 4089
989 Ga0268266_10108549 3300028379 Bacteria 2456
990 Ga0268266_10403375 3300028379 Bacteria 1293
991 Ga0268265_10000313 3300028380 Bacteria 53636
992 Ga0268265_10011724 3300028380 Bacteria 5928
993 Ga0268265_10022075 3300028380 Bacteria 4468
994 Ga0268265_10057451 3300028380 Bacteria 2966
995 Ga0268265_10057929 3300028380 Bacteria 2955
996 Ga0268265_10099943 3300028380 Bacteria 2340
997 Ga0268265_10150950 3300028380 Bacteria 1960
998 Ga0268265_10216904 3300028380 Bacteria 1671
999 Ga0268265_10241402 3300028380 Bacteria 1594
1000 Ga0268265_10262041 3300028380 Bacteria 1537
1001 Ga0268264_10000062 3300028381 Bacteria 302110
1002 Ga0268264_10021477 3300028381 Bacteria 5271
1003 Ga0268264_10026006 3300028381 Bacteria 4779
1004 Ga0268264_10065854 3300028381 Bacteria 3054
1005 Ga0268264_10078841 3300028381 Bacteria 2809
1006 Ga0268264_10167255 3300028381 Bacteria 1986
1007 Ga0265337_1000412 3300028556 Bacteria 22867
1008 Ga0265337_1003137 3300028556 Bacteria 7278
1009 Ga0265334_10004740 3300028573 Bacteria 5981
1010 Ga0265323_10008710 3300028653 Bacteria 4172
1011 Ga0265336_10002305 3300028666 Bacteria 7963
1012 Ga0307517_10000232 3300028786 Bacteria 94332
1013 Ga0307517_10149622 3300028786 Bacteria 1607
1014 Ga0307515_10092830 3300028794 Bacteria 3751
1015 Ga0265338_10000422 3300028800 Bacteria 75820
1016 Ga0265338_10031181 3300028800 Bacteria 5229
1017 Ga0265338_10032504 3300028800 Bacteria 5088
1018 Ga0265338_10038858 3300028800 Bacteria 4500
1019 Ga0265338_10045043 3300028800 Bacteria 4062
1020 Ga0265330_10016351 3300031235 Bacteria 3424
1021 Ga0265330_10062043 3300031235 Bacteria 1626
1022 Ga0265320_10001731 3300031240 Bacteria 15477
1023 Ga0265325_10000043 3300031241 Bacteria 89158
1024 Ga0265325_10033533 3300031241 Bacteria 2737
1025 Ga0265340_10030346 3300031247 Bacteria 2709
1026 Ga0265340_10034346 3300031247 Bacteria 2523
1027 Ga0265339_10000681 3300031249 Bacteria 26201
1028 Ga0265339_10018260 3300031249 Bacteria 4137
1029 Ga0265331_10000019 3300031250 Bacteria 258837
1030 Ga0265331_10002855 3300031250 Bacteria 11435
1031 Ga0265327_10006540 3300031251 Bacteria 9275
1032 Ga0265327_10106440 3300031251 Bacteria 1346
1033 Ga0265316_10126192 3300031344 Bacteria 1929
1034 Ga0265316_10208272 3300031344 Bacteria 1447
1035 Ga0265316_10223792 3300031344 Bacteria 1387
1036 Ga0307513_10004214 3300031456 Bacteria 19230
1037 Ga0307513_10005881 3300031456 Bacteria 16106
1038 Ga0307513_10124645 3300031456 Bacteria 2535
1039 Ga0307513_10147848 3300031456 Bacteria 2265
1040 Ga0307513_10157344 3300031456 Bacteria 2170
1041 Ga0307408_100019215 3300031548 Bacteria 4598
1042 Ga0307408_100149457 3300031548 Bacteria 1842
1043 Ga0265313_10012790 3300031595 Bacteria 5094
1044 Ga0265313_10060478 3300031595 Bacteria 1776
1045 Ga0307508_10021824 3300031616 Bacteria 5826
1046 Ga0307508_10135710 3300031616 Bacteria 2064
1047 Ga0307508_10217827 3300031616 Bacteria 1509
1048 Ga0316579_10105143 3300031691 Bacteria 1353
1049 Ga0265314_10003096 3300031711 Bacteria 16371
1050 Ga0265314_10009986 3300031711 Bacteria 7963
1051 Ga0265314_10035859 3300031711 Bacteria 3612
1052 Ga0265342_10000417 3300031712 Bacteria 46743
1053 Ga0265342_10027858 3300031712 Bacteria 3524
1054 Ga0265342_10044798 3300031712 Bacteria 2665
1055 Ga0316578_10005376 3300031728 Bacteria 6201
1056 Ga0307516_10011325 3300031730 Bacteria 9707
1057 Ga0307516_10031924 3300031730 Bacteria 5308
1058 Ga0307405_10028606 3300031731 Bacteria 3249
1059 Ga0307413_10061705 3300031824 Bacteria 2315
1060 Ga0307413_10095460 3300031824 Bacteria 1949
1061 Ga0307410_10016024 3300031852 Bacteria 4458
1062 Ga0307406_10040577 3300031901 Bacteria 2895
1063 Ga0307406_10074430 3300031901 Bacteria 2236
1064 Ga0307406_10122328 3300031901 Bacteria 1812
1065 Ga0307407_10009654 3300031903 Bacteria 4506
1066 Ga0307412_10060094 3300031911 Bacteria 2550
1067 Ga0307412_10235641 3300031911 Bacteria 1412
1068 Ga0307412_10240449 3300031911 Bacteria 1400
1069 Ga0307409_100007664 3300031995 Bacteria 6479
1070 Ga0307409_100215543 3300031995 Bacteria 1729
1071 Ga0307416_100026119 3300032002 Bacteria 4297
1072 Ga0307416_100129115 3300032002 Bacteria 2271
1073 Ga0307411_10002298 3300032005 Bacteria 8376
1074 Ga0307411_10142033 3300032005 Bacteria 1772
1075 Ga0316583_10001087 3300032133 Bacteria 8839
1076 Ga0307507_10025987 3300033179 Bacteria 6326
1077 Ga0307510_10006006 3300033180 Bacteria 14485
1078 Ga0307510_10019009 3300033180 Bacteria 8062
1079 Ga0307510_10138937 3300033180 Bacteria 2079
1080 Ga0315911_1000008 3300033442 Bacteria 381285
1081 Ga0373950_0000146 3300034818 Bacteria 11191
1082 Ga0373958_0001200 3300034819 Bacteria 3453
1083 Ga0373958_0001288 3300034819 Bacteria 3354
1084 Ga0373958_0001984 3300034819 Bacteria 2817
1085 Ga0373959_0000072 3300034820 Bacteria 22681
1086 Ga0373959_0000711 3300034820 Bacteria 5694
1087 Ga0373938_0000121 3300034957 Bacteria 10959
1088 Ga0373938_0003440 3300034957 Bacteria 2596
1089 Ga0373938_0021211 3300034957 Bacteria 1315
1090 Ga0373926_0000271 3300035083 Bacteria 12550
1091 Ga0373926_0025731 3300035083 Bacteria 2055
1092 Ga0373928_0000164 3300035084 Bacteria 12814
1093 Ga0373928_0004972 3300035084 Bacteria 2534
1094 Ga0373928_0008685 3300035084 Bacteria 1976
1095 Ga0373929_0002934 3300035085 Bacteria 3110
1096 Ga0373934_0043498 3300035086 Bacteria 1775
1097 Ga0373940_0001581 3300035088 Bacteria 4179
1098 Ga0373940_0039323 3300035088 Bacteria 1294
1099 Ga0373944_0015173 3300035089 Bacteria 2159
1100 Ga0373949_0002503 3300035090 Bacteria 4694
1101 Ga0373949_0017246 3300035090 Bacteria 1626
1102 Ga0373951_0000275 3300035091 Bacteria 16405
1103 Ga0373951_0001543 3300035091 Bacteria 6027
1104 Ga0373952_0000931 3300035092 Bacteria 5318
1105 Ga0373923_0019848 3300035111 Bacteria 2606
1106 Ga0373923_0023878 3300035111 Bacteria 2409
1107 Ga0373932_0000059 3300035112 Bacteria 27206
1108 Ga0373936_0001839 3300035113 Bacteria 7813
1109 Ga0373939_0001813 3300035114 Bacteria 5142
1110 Ga0373941_0000293 3300035115 Bacteria 9643
1111 Ga0373941_0002358 3300035115 Bacteria 4146
1112 Ga0373941_0041248 3300035115 Bacteria 1428
1113 Ga0373945_0025312 3300035116 Bacteria 2061
1114 Ga0373953_0004400 3300035117 Bacteria 4489
1115 Ga0373953_0063581 3300035117 Bacteria 1513
1116 Ga0373954_0003396 3300035118 Bacteria 6741
1117 Ga0373954_0020907 3300035118 Bacteria 2961
1118 Ga0373954_0021219 3300035118 Bacteria 2940
1119 Ga0373954_0046380 3300035118 Bacteria 2031
1120 Ga0373954_0061725 3300035118 Bacteria 1769
1121 Ga0373956_0043573 3300035119 Bacteria 1998
1122 Ga0373957_0001243 3300035120 Bacteria 6811
1123 Ga0373957_0046451 3300035120 Bacteria 1648
1124 Ga0373957_0062436 3300035120 Bacteria 1445
1125 Ga0373943_0014718 3300035170 Bacteria 3547
1126 Ga0373943_0048229 3300035170 Bacteria 2086
1127 Ga0373946_0003266 3300035171 Bacteria 5757
1128 Ga0373946_0032514 3300035171 Bacteria 2095
1129 Ga0373946_0054247 3300035171 Bacteria 1686
1130 Ga0373955_0000048 3300035172 Bacteria 48012
1131 Ga0373955_0000923 3300035172 Bacteria 12618
1132 Ga0373955_0017162 3300035172 Bacteria 3577
1133 Ga0373955_0045874 3300035172 Bacteria 2360
1134 Ga0373955_0058026 3300035172 Bacteria 2128
1135 Ga0373955_0154661 3300035172 Bacteria 1351
1136 Ga0373942_0000181 3300035207 Bacteria 15840
1137 Ga0373961_0003884 3300035241 Bacteria 3646
1138 Ga0373962_0000191 3300035242 Bacteria 12940
1139 Ga0373962_0001911 3300035242 Bacteria 4962
1140 Ga0373962_0018970 3300035242 Bacteria 1796
1141 Ga0316574_0000122 3300035398 Bacteria 24036
1142 Ga0316574_0052728 3300035398 Bacteria 2537
1143 Ga0373924_0000948 3300035410 Bacteria 9174
1144 Ga0373924_0001998 3300035410 Bacteria 6786
1145 Ga0373924_0006322 3300035410 Bacteria 4239
1146 Ga0373924_0025997 3300035410 Bacteria 2318
1147 Ga0373931_0007124 3300035691 Bacteria 5259
1148 Ga0373931_0017017 3300035691 Bacteria 3588
1149 Ga0373931_0037146 3300035691 Bacteria 2542
1150 Ga0373931_0185813 3300035691 Bacteria 1233
1151 Ga0373935_0000082 3300035692 Bacteria 41509
1152 Ga0373935_0000595 3300035692 Bacteria 18877
1153 Ga0373935_0004033 3300035692 Bacteria 8581
1154 Ga0373935_0017405 3300035692 Bacteria 4361
1155 Ga0373935_0025560 3300035692 Bacteria 3638
1156 Ga0373935_0114322 3300035692 Bacteria 1795
1157 Ga0373927_0001021 3300035695 Bacteria 21303
1158 Ga0373927_0011241 3300035695 Bacteria 5960
1159 Ga0373927_0014348 3300035695 Bacteria 5247
1160 Ga0373927_0015368 3300035695 Bacteria 5058
1161 Ga0373927_0021207 3300035695 Bacteria 4257
1162 Ga0373927_0036176 3300035695 Bacteria 3211
1163 Ga0373927_0038882 3300035695 Bacteria 3088
1164 Ga0373927_0044643 3300035695 Bacteria 2867
1165 Ga0373927_0094128 3300035695 Bacteria 1947
1166 Ga0373927_0168482 3300035695 Bacteria 1435
1167 Ga0373933_0000648 3300035724 Bacteria 21697
1168 Ga0373933_0000829 3300035724 Bacteria 18900
1169 Ga0373933_0003556 3300035724 Bacteria 8661
1170 Ga0373933_0028810 3300035724 Bacteria 3205
1171 Ga0373933_0036518 3300035724 Bacteria 2876
1172 Ga0373933_0125209 3300035724 Bacteria 1612
1173 Ga0373933_0208661 3300035724 Bacteria 1251
1174 Ga0373947_0000300 3300035725 Bacteria 27875
1175 Ga0373947_0000970 3300035725 Bacteria 17506
1176 Ga0373947_0001653 3300035725 Bacteria 13648
1177 Ga0373947_0005649 3300035725 Bacteria 7300
1178 Ga0373947_0007147 3300035725 Bacteria 6474
1179 Ga0373947_0007782 3300035725 Bacteria 6190
1180 Ga0373947_0049763 3300035725 Bacteria 2517
1181 Ga0373937_0000019 3300036401 Bacteria 138568
1182 Ga0373937_0001573 3300036401 Bacteria 19169
1183 Ga0373937_0003774 3300036401 Bacteria 12809
1184 Ga0373937_0009217 3300036401 Bacteria 8568
1185 Ga0373937_0009750 3300036401 Bacteria 8372
1186 Ga0373937_0010279 3300036401 Bacteria 8168
1187 Ga0373937_0017495 3300036401 Bacteria 6388
1188 Ga0373937_0026781 3300036401 Bacteria 5211
1189 Ga0373937_0061232 3300036401 Bacteria 3459
1190 Ga0373937_0064321 3300036401 Bacteria 3373
1191 Ga0373937_0145522 3300036401 Bacteria 2218
1192 Ga0316582_0081105 3300036647 Bacteria 2119
1193 Ga0316582_0118929 3300036647 Bacteria 1767
1194 Ga0316584_0081383 3300036712 Bacteria 2425
1195 Ga0316584_0094744 3300036712 Bacteria 2235
1196 Ga0373925_0000026 3300037068 Bacteria 154713
1197 Ga0373925_0006983 3300037068 Bacteria 8255
1198 Ga0373925_0053409 3300037068 Bacteria 3020
1199 Ga0373925_0075625 3300037068 Bacteria 2552
1200 Ga0373925_0096240 3300037068 Bacteria 2269
1201 Ga0373925_0113904 3300037068 Bacteria 2092
1202 Ga0373925_0208595 3300037068 Bacteria 1556
1203 Ga0395899_0000004 3300037312 Bacteria 874267
1204 Ga0395899_0044545 3300037312 Bacteria 3306
1205 Ga0395900_0000423 3300037418 Bacteria 60773
1206 Ga0395900_0063388 3300037418 Bacteria 3799
1207 Ga0395900_0154871 3300037418 Bacteria 2341
1208 Ga0395898_0010317 3300037466 Bacteria 9773
1209 Ga0395898_0027303 3300037466 Bacteria 5733
1210 Ga0395898_0212959 3300037466 Bacteria 1843
1211 Ga0395898_0312055 3300037466 Bacteria 1500
1212 Ga0395905_0014493 3300037471 Bacteria 7523
1213 Ga0395905_0019136 3300037471 Bacteria 6495
1214 Ga0436364_0240030 3300037853 Bacteria 11501
1215 Ga0436364_0276897 3300037853 Bacteria 48262
1216 Ga0436364_0541174 3300037853 Bacteria 2915
1217 Ga0436364_0602403 3300037853 Bacteria 2767
1218 Ga0436364_0678846 3300037853 Bacteria 8952
1219 Ga0436364_0846969 3300037853 Bacteria 1612
1220 Ga0436364_0930991 3300037853 Bacteria 3829
1221 Ga0436364_1088747 3300037853 Bacteria 1801
1222 Ga0436364_1399361 3300037853 Bacteria 2815
1223 Ga0395901_0042886 3300038443 Bacteria 4692
1224 Ga0395901_0482904 3300038443 Bacteria 1263
1225 Ga0400486_27145 3300038742 Bacteria 2190
1226 Ga0436365_0016645 3300039437 Bacteria 3469
1227 Ga0436365_0041017 3300039437 Bacteria 2544
1228 Ga0436365_0396709 3300039437 Bacteria 84982
1229 Ga0436365_0411209 3300039437 Bacteria 10910
1230 Ga0436365_0412203 3300039437 Bacteria 5409
1231 Ga0436365_0431929 3300039437 Bacteria 1985
1232 Ga0436365_0560499 3300039437 Bacteria 1323
1233 Ga0436365_1472236 3300039437 Bacteria 3466
1234 Ga0436360_0144121 3300039438 Bacteria 10956
1235 Ga0436360_0653946 3300039438 Bacteria 3869
1236 Ga0436363_0368824 3300039450 Bacteria 2070
1237 Ga0436363_0413167 3300039450 Bacteria 8578
1238 Ga0436363_0881254 3300039450 Bacteria 4922
1239 Ga0436363_1290700 3300039450 Bacteria 1784
1240 Ga0436362_0744510 3300039453 Bacteria 2861
1241 Ga0439453_0002904 3300041408 Bacteria 2413
1242 Ga0439441_008868 3300042001 Bacteria 1653
1243 Ga0439448_0006045 3300042005 Bacteria 3469
1244 Ga0439463_014375 3300042016 Bacteria 1951
1245 Ga0439435_0007011 3300042436 Bacteria 2560
1246 Ga0451577_0103345 3300042876 Bacteria 2546
1247 Ga0466969_0009377 3300044656 Bacteria 5188
1248 Ga0466972_0000306 3300044658 Bacteria 28921
1249 Ga0466966_0003218 3300044684 Bacteria 10765
1250 Ga0466966_0007733 3300044684 Bacteria 7118
1251 Ga0466961_0000770 3300044693 Bacteria 20096
1252 Ga0466961_0021238 3300044693 Bacteria 4179
1253 Ga0466963_0003783 3300044694 Bacteria 8723
1254 Ga0466963_0027881 3300044694 Bacteria 3621
1255 Ga0466964_0018362 3300044706 Bacteria 2683
1256 Ga0466964_0034149 3300044706 Bacteria 2029
1257 Ga0453684_0000204 3300044712 Bacteria 258105
1258 Ga0453684_0000395 3300044712 Bacteria 179647
1259 Ga0453684_0014504 3300044712 Bacteria 12587
1260 Ga0453684_0041717 3300044712 Bacteria 6199
1261 Ga0453684_0043460 3300044712 Bacteria 6038
1262 Ga0453684_0127521 3300044712 Bacteria 3060
1263 Ga0453684_0151976 3300044712 Bacteria 2750
1264 Ga0466971_0001535 3300044719 Bacteria 9725
1265 Ga0466970_0003306 3300044765 Bacteria 7838
1266 Ga0466957_0002146 3300044842 Bacteria 10557
1267 Ga0466957_0028116 3300044842 Bacteria 3347
1268 Ga0466957_0065336 3300044842 Bacteria 2240
1269 Ga0466957_0110355 3300044842 Bacteria 1744
1270 Ga0466957_0118750 3300044842 Bacteria 1684
1271 Ga0466957_0167932 3300044842 Bacteria 1428
1272 Ga0466959_0002729 3300045049 Bacteria 11357
1273 Ga0466959_0059425 3300045049 Bacteria 2784
1274 Ga0466959_0119180 3300045049 Bacteria 1878
1275 Ga0466959_0148136 3300045049 Bacteria 1656
1276 Ga0451576_0000262 3300045051 Bacteria 128472
1277 Ga0451576_0000709 3300045051 Bacteria 67301
1278 Ga0451576_0017565 3300045051 Bacteria 7862
1279 Ga0466958_0080809 3300045836 Bacteria 2000
1280 Ga0466958_0177500 3300045836 Bacteria 1351
1281 Ga0466967_0001756 3300045976 Bacteria 12954
1282 Ga0466967_0006466 3300045976 Bacteria 8296
1283 Ga0495617_041371 3300046452 Bacteria 1540
1284 Ga0495592_0000017 3300046454 Bacteria 142442
1285 Ga0495592_0002029 3300046454 Bacteria 14254
1286 Ga0495592_0011460 3300046454 Bacteria 6709
1287 Ga0495592_0013035 3300046454 Bacteria 6326
1288 Ga0495603_0005449 3300046455 Bacteria 7596
1289 Ga0495603_0007853 3300046455 Bacteria 6433
1290 Ga0495603_0009344 3300046455 Bacteria 5927
1291 Ga0495603_0073899 3300046455 Bacteria 2002
1292 Ga0495603_0127133 3300046455 Bacteria 1485
1293 Ga0495629_0000062 3300046459 Bacteria 97169
1294 Ga0495629_0000915 3300046459 Bacteria 23696
1295 Ga0495629_0023049 3300046459 Bacteria 4437
1296 Ga0495629_0051704 3300046459 Bacteria 2875
1297 Ga0495629_0086665 3300046459 Bacteria 2184
1298 Ga0495629_0106738 3300046459 Bacteria 1953
1299 Ga0495638_0000880 3300046460 Bacteria 30953
1300 Ga0495638_0112047 3300046460 Bacteria 1620
1301 Ga0495641_0005677 3300046461 Bacteria 8314
1302 Ga0495641_0021183 3300046461 Bacteria 3276
1303 Ga0495641_0047264 3300046461 Bacteria 1976
1304 Ga0495651_0001344 3300046462 Bacteria 19037
1305 Ga0495651_0002144 3300046462 Bacteria 15273
1306 Ga0495651_0002729 3300046462 Bacteria 13687
1307 Ga0495651_0064668 3300046462 Bacteria 2795
1308 Ga0495651_0106098 3300046462 Bacteria 2083
1309 Ga0495653_0000033 3300046463 Bacteria 131680
1310 Ga0495653_0001729 3300046463 Bacteria 17204
1311 Ga0495653_0004986 3300046463 Bacteria 10773
1312 Ga0495653_0009475 3300046463 Bacteria 7970
1313 Ga0495580_0001523 3300046472 Bacteria 20383
1314 Ga0495580_0172548 3300046472 Bacteria 1494
1315 Ga0495582_0002649 3300046473 Bacteria 9982
1316 Ga0495639_0001076 3300046475 Bacteria 12289
1317 Ga0495662_0001265 3300046476 Bacteria 12489
1318 Ga0495662_0012720 3300046476 Bacteria 4103
1319 Ga0495662_0041730 3300046476 Bacteria 2215
1320 Ga0495662_0054387 3300046476 Bacteria 1934
1321 Ga0495664_0000008 3300046477 Bacteria 307158
1322 Ga0495664_0002747 3300046477 Bacteria 9463
1323 Ga0495664_0012028 3300046477 Bacteria 4892
1324 Ga0495664_0018064 3300046477 Bacteria 4033
1325 Ga0495664_0028343 3300046477 Bacteria 3270
1326 Ga0495584_0081593 3300046491 Bacteria 1628
1327 Ga0495584_0117030 3300046491 Bacteria 1349
1328 Ga0495585_0016090 3300046492 Bacteria 4336
1329 Ga0495585_0017368 3300046492 Bacteria 4156
1330 Ga0495594_0000046 3300046499 Bacteria 53822
1331 Ga0495594_0038714 3300046499 Bacteria 2605
1332 Ga0495594_0069545 3300046499 Bacteria 1955
1333 Ga0495594_0074940 3300046499 Bacteria 1886
1334 Ga0495596_0057149 3300046500 Bacteria 1523
1335 Ga0495607_0047954 3300046501 Bacteria 2499
1336 Ga0495606_0162967 3300046507 Bacteria 1299
1337 Ga0495608_0000014 3300046511 Bacteria 221042
1338 Ga0495608_0000943 3300046511 Bacteria 20472
1339 Ga0495608_0002298 3300046511 Bacteria 13794
1340 Ga0495608_0045481 3300046511 Bacteria 2925
1341 Ga0495608_0163326 3300046511 Bacteria 1415
1342 Ga0495610_0012701 3300046512 Bacteria 5047
1343 Ga0495616_0000669 3300046513 Bacteria 25410
1344 Ga0495616_0057738 3300046513 Bacteria 1913
1345 Ga0495618_0000027 3300046514 Bacteria 112522
1346 Ga0495618_0001029 3300046514 Bacteria 19114
1347 Ga0495618_0002859 3300046514 Bacteria 10937
1348 Ga0495618_0120684 3300046514 Bacteria 1679
1349 Ga0495620_0030137 3300046515 Bacteria 2502
1350 Ga0495628_0000008 3300046516 Bacteria 284313
1351 Ga0495628_0006467 3300046516 Bacteria 10232
1352 Ga0495628_0009076 3300046516 Bacteria 8505
1353 Ga0495628_0130463 3300046516 Bacteria 1922
1354 Ga0495628_0213312 3300046516 Bacteria 1451
1355 Ga0495630_0000293 3300046517 Bacteria 40084
1356 Ga0495630_0010764 3300046517 Bacteria 6605
1357 Ga0495631_0013600 3300046518 Bacteria 3946
1358 Ga0495632_0030825 3300046519 Bacteria 2780
1359 Ga0495643_0027682 3300046522 Bacteria 3183
1360 Ga0495643_0041257 3300046522 Bacteria 2516
1361 Ga0495644_0000776 3300046523 Bacteria 13153
1362 Ga0495644_0028248 3300046523 Bacteria 2123
1363 Ga0495648_0001934 3300046524 Bacteria 19744
1364 Ga0495648_0005695 3300046524 Bacteria 10302
1365 Ga0495663_0013559 3300046525 Bacteria 2280
1366 Ga0495663_0032828 3300046525 Bacteria 1547
1367 Ga0495666_0027221 3300046526 Bacteria 2815
1368 Ga0495666_0101381 3300046526 Bacteria 1356
1369 Ga0495652_0000005 3300046529 Bacteria 524368
1370 Ga0495652_0009980 3300046529 Bacteria 8604
1371 Ga0495652_0024134 3300046529 Bacteria 5385
1372 Ga0495652_0052791 3300046529 Bacteria 3465
1373 Ga0495654_0012891 3300046530 Bacteria 4482
1374 Ga0495665_0005462 3300046531 Bacteria 6846
1375 Ga0495665_0005834 3300046531 Bacteria 6645
1376 Ga0495640_0000017 3300046533 Bacteria 138688
1377 Ga0495640_0004569 3300046533 Bacteria 11034
1378 Ga0495640_0008254 3300046533 Bacteria 8173
1379 Ga0495640_0014808 3300046533 Bacteria 5889
1380 Ga0495640_0040139 3300046533 Bacteria 3278
1381 Ga0495586_0021346 3300046535 Bacteria 3450
1382 Ga0495587_0000005 3300046536 Bacteria 358412
1383 Ga0495587_0001279 3300046536 Bacteria 16737
1384 Ga0495587_0006840 3300046536 Bacteria 7425
1385 Ga0495587_0008424 3300046536 Bacteria 6630
1386 Ga0495587_0013842 3300046536 Bacteria 5068
1387 Ga0495598_0003485 3300046537 Bacteria 3350
1388 Ga0495609_0037221 3300046538 Bacteria 2195
1389 Ga0495621_0044458 3300046539 Bacteria 1570
1390 Ga0495597_0051047 3300046542 Bacteria 1824
1391 Ga0495645_0000007 3300046543 Bacteria 376299
1392 Ga0495645_0004240 3300046543 Bacteria 9791
1393 Ga0495645_0018443 3300046543 Bacteria 5011
1394 Ga0495645_0035255 3300046543 Bacteria 3648
1395 Ga0495645_0105319 3300046543 Bacteria 2001
1396 Ga0495622_0003420 3300046557 Bacteria 7481
1397 Ga0495622_0019623 3300046557 Bacteria 3147
1398 Ga0495667_0000012 3300046559 Bacteria 220967
1399 Ga0495667_0001050 3300046559 Bacteria 17936
1400 Ga0495667_0013316 3300046559 Bacteria 5567
1401 Ga0495667_0018967 3300046559 Bacteria 4643
1402 Ga0495667_0067661 3300046559 Bacteria 2333
1403 Ga0495656_0004149 3300046615 Bacteria 4938
1404 Ga0495656_0024959 3300046615 Bacteria 2366
1405 Ga0495656_0035292 3300046615 Bacteria 2054
1406 Ga0495656_0083611 3300046615 Bacteria 1446
1407 Ga0495668_0023088 3300046616 Bacteria 3551
1408 Ga0495668_0048907 3300046616 Bacteria 2345
1409 Ga0495634_0001329 3300046642 Bacteria 22513
1410 Ga0495634_0001489 3300046642 Bacteria 20720
1411 Ga0495634_0002146 3300046642 Bacteria 16608
1412 Ga0495634_0028602 3300046642 Bacteria 3868
1413 Ga0495634_0100384 3300046642 Bacteria 1871
1414 Ga0495634_0125585 3300046642 Bacteria 1640
1415 Ga0495634_0180539 3300046642 Bacteria 1321
1416 Ga0495611_0026894 3300046648 Bacteria 2512
1417 Ga0495611_0039995 3300046648 Bacteria 2089
1418 Ga0495625_0047004 3300046660 Bacteria 3112
1419 Ga0495625_0185556 3300046660 Bacteria 1380
1420 Ga0495635_0000010 3300046663 Bacteria 246385
1421 Ga0495635_0002017 3300046663 Bacteria 13787
1422 Ga0495635_0004822 3300046663 Bacteria 9377
1423 Ga0495635_0012429 3300046663 Bacteria 5965
1424 Ga0495635_0025870 3300046663 Bacteria 4087
1425 Ga0495635_0042366 3300046663 Bacteria 3143
1426 Ga0495635_0043676 3300046663 Bacteria 3093
1427 Ga0495635_0073715 3300046663 Bacteria 2338
1428 Ga0495659_0016673 3300046664 Bacteria 2427
1429 Ga0495661_0017626 3300046665 Bacteria 4713
1430 Ga0495588_0001920 3300046674 Bacteria 8877
1431 Ga0495588_0003041 3300046674 Bacteria 7255
1432 Ga0495588_0022799 3300046674 Bacteria 3096
1433 Ga0495588_0033845 3300046674 Bacteria 2584
1434 Ga0495588_0123791 3300046674 Bacteria 1363
1435 Ga0495588_0130394 3300046674 Bacteria 1326
1436 Ga0495657_0000108 3300046675 Bacteria 74508
1437 Ga0495657_0020270 3300046675 Bacteria 4783
1438 Ga0495657_0027139 3300046675 Bacteria 4045
1439 Ga0495657_0033468 3300046675 Bacteria 3578
1440 Ga0495657_0063635 3300046675 Bacteria 2433
1441 Ga0495599_0000015 3300046678 Bacteria 175055
1442 Ga0495599_0002546 3300046678 Bacteria 10623
1443 Ga0495599_0004544 3300046678 Bacteria 8230
1444 Ga0495623_0000055 3300046679 Bacteria 69548
1445 Ga0495623_0000102 3300046679 Bacteria 52100
1446 Ga0495623_0000818 3300046679 Bacteria 20977
1447 Ga0495646_0000066 3300046680 Bacteria 50048
1448 Ga0495646_0001020 3300046680 Bacteria 16162
1449 Ga0495646_0001170 3300046680 Bacteria 15326
1450 Ga0495646_0043292 3300046680 Bacteria 2758
1451 Ga0495647_0049535 3300046681 Bacteria 1627
1452 Ga0495658_0000201 3300046683 Bacteria 34784
1453 Ga0495658_0002635 3300046683 Bacteria 9016
1454 Ga0495658_0048558 3300046683 Bacteria 2393
1455 Ga0495669_0007312 3300046684 Bacteria 4626
1456 Ga0495669_0046928 3300046684 Bacteria 1929
1457 Ga0495669_0077613 3300046684 Bacteria 1521
1458 Ga0495613_0003307 3300046689 Bacteria 12068
1459 Ga0495613_0004521 3300046689 Bacteria 10429
1460 Ga0495613_0023990 3300046689 Bacteria 4544
1461 Ga0495613_0060805 3300046689 Bacteria 2766
1462 Ga0495613_0102743 3300046689 Bacteria 2064
1463 Ga0495613_0152800 3300046689 Bacteria 1645
1464 Ga0495624_0001903 3300046690 Bacteria 15891
1465 Ga0495670_0116024 3300046691 Bacteria 1388
1466 Ga0495671_0057172 3300046692 Bacteria 1930
1467 Ga0495649_0016467 3300046694 Bacteria 4189
1468 Ga0495589_0057386 3300046794 Bacteria 1915
1469 Ga0495589_0106703 3300046794 Bacteria 1353
1470 Ga0495589_0124780 3300046794 Bacteria 1238
1471 Ga0495600_0000128 3300046809 Bacteria 42559
1472 Ga0495600_0001540 3300046809 Bacteria 12811
1473 Ga0495600_0007343 3300046809 Bacteria 6735
1474 Ga0495600_0131862 3300046809 Bacteria 1624
1475 Ga0495660_0133453 3300046810 Bacteria 1243
1476 Ga0495581_0006096 3300047315 Bacteria 6989
1477 Ga0495581_0016030 3300047315 Bacteria 4355
1478 Ga0495581_0056331 3300047315 Bacteria 2269
1479 Ga0495604_0000001 3300047317 Bacteria 708627
1480 Ga0495604_0000821 3300047317 Bacteria 25964
1481 Ga0495604_0003808 3300047317 Bacteria 12011
1482 Ga0495604_0006226 3300047317 Bacteria 9469
1483 Ga0495674_0000012 3300047319 Bacteria 270651
1484 Ga0495674_0002494 3300047319 Bacteria 17944
1485 Ga0495674_0006479 3300047319 Bacteria 11224
1486 Ga0495674_0016018 3300047319 Bacteria 6996
1487 Ga0495674_0068049 3300047319 Bacteria 3083
1488 Ga0495674_0132957 3300047319 Bacteria 2095
1489 Ga0495674_0152915 3300047319 Bacteria 1934
1490 Ga0495674_0257931 3300047319 Bacteria 1433
1491 Ga0495672_0053783 3300047320 Bacteria 2357
1492 Ga0495672_0065378 3300047320 Bacteria 2079
1493 Ga0495676_0082071 3300047321 Bacteria 2441
1494 Ga0495676_0085563 3300047321 Bacteria 2375
1495 Ga0495676_0092376 3300047321 Bacteria 2259
1496 Ga0495676_0095966 3300047321 Bacteria 2205
1497 Ga0495680_0000409 3300047322 Bacteria 47939
1498 Ga0495680_0001836 3300047322 Bacteria 22387
1499 Ga0495680_0002409 3300047322 Bacteria 19174
1500 Ga0495680_0008874 3300047322 Bacteria 9092
1501 Ga0495680_0013029 3300047322 Bacteria 7274
1502 Ga0495680_0021925 3300047322 Bacteria 5338
1503 Ga0495687_021492 3300047443 Bacteria 3119
1504 Ga0495675_0000152 3300047444 Bacteria 48625
1505 Ga0495675_0047388 3300047444 Bacteria 2734
1506 Ga0495675_0060968 3300047444 Bacteria 2390
1507 Ga0495679_053673 3300047446 Bacteria 1203
1508 Ga0495685_030482 3300047447 Bacteria 1854
1509 Ga0495673_0017469 3300047469 Bacteria 3642
1510 Ga0495684_0000022 3300047471 Bacteria 139507
1511 Ga0495684_0001237 3300047471 Bacteria 20565
1512 Ga0495684_0012198 3300047471 Bacteria 6630
1513 Ga0495684_0016109 3300047471 Bacteria 5755
1514 Ga0495684_0028674 3300047471 Bacteria 4273
1515 Ga0495684_0088582 3300047471 Bacteria 2346
1516 Ga0495684_0161861 3300047471 Bacteria 1668
1517 Ga0495686_0000074 3300047472 Bacteria 208094
1518 Ga0495593_0000100 3300047673 Bacteria 39337
1519 Ga0495593_0000416 3300047673 Bacteria 23665
1520 Ga0495593_0008670 3300047673 Bacteria 5911
1521 Ga0495593_0032485 3300047673 Bacteria 2845
1522 Ga0495593_0074558 3300047673 Bacteria 1759
1523 Ga0495602_0000106 3300048088 Bacteria 79677
1524 Ga0495602_0006837 3300048088 Bacteria 11980
1525 Ga0495602_0012502 3300048088 Bacteria 8718
1526 Ga0495602_0016666 3300048088 Bacteria 7384
1527 Ga0495602_0031546 3300048088 Bacteria 5008
1528 Ga0495614_0016086 3300048089 Bacteria 3258
1529 Ga0495626_0056916 3300048091 Bacteria 1789
1530 Ga0496100_0000980 3300048903 Bacteria 13723
1531 Ga0496100_0014253 3300048903 Bacteria 4611
1532 Ga0496100_0030317 3300048903 Bacteria 3354
1533 Ga0496100_0095665 3300048903 Bacteria 2036
1534 Ga0496100_0179309 3300048903 Bacteria 1531
1535 Ga0496101_0007045 3300048904 Bacteria 7266
1536 Ga0496101_0008538 3300048904 Bacteria 6695
1537 Ga0496101_0014498 3300048904 Bacteria 5298
1538 Ga0496101_0022646 3300048904 Bacteria 4328
1539 Ga0496101_0034008 3300048904 Bacteria 3599
1540 Ga0496101_0056627 3300048904 Bacteria 2834
1541 Ga0496101_0107096 3300048904 Bacteria 2100
1542 Ga0496102_0011068 3300048905 Bacteria 7770
1543 Ga0496102_0031956 3300048905 Bacteria 4726
1544 Ga0496102_0038022 3300048905 Bacteria 4341
1545 Ga0496102_0093950 3300048905 Bacteria 2778
1546 Ga0496102_0133128 3300048905 Bacteria 2328
1547 Ga0496102_0188407 3300048905 Bacteria 1944
1548 Ga0496102_0199977 3300048905 Bacteria 1883
1549 Ga0496102_0285159 3300048905 Bacteria 1556
1550 Ga0496103_0003062 3300048906 Bacteria 10279
1551 Ga0496103_0004432 3300048906 Bacteria 8517
1552 Ga0496103_0230611 3300048906 Bacteria 1191
1553 Ga0496104_0000431 3300048907 Bacteria 36365
1554 Ga0496104_0000528 3300048907 Bacteria 32836
1555 Ga0496104_0001836 3300048907 Bacteria 18358
1556 Ga0496104_0002017 3300048907 Bacteria 17626
1557 Ga0496104_0002512 3300048907 Bacteria 15791
1558 Ga0496104_0004953 3300048907 Bacteria 11622
1559 Ga0496104_0013397 3300048907 Bacteria 7388
1560 Ga0496104_0014292 3300048907 Bacteria 7168
1561 Ga0496104_0033296 3300048907 Bacteria 4800
1562 Ga0496104_0041580 3300048907 Bacteria 4311
1563 Ga0496104_0054703 3300048907 Bacteria 3772
1564 Ga0496104_0068772 3300048907 Bacteria 3365
1565 Ga0496104_0096106 3300048907 Bacteria 2834
1566 Ga0496104_0164327 3300048907 Bacteria 2128
1567 Ga0496104_0165444 3300048907 Bacteria 2121
1568 Ga0496105_0000246 3300048908 Bacteria 36588
1569 Ga0496105_0017668 3300048908 Bacteria 5722
1570 Ga0496105_0018293 3300048908 Bacteria 5628
1571 Ga0496105_0031865 3300048908 Bacteria 4323
1572 Ga0496105_0032948 3300048908 Bacteria 4253
1573 Ga0496105_0038811 3300048908 Bacteria 3924
1574 Ga0496105_0039611 3300048908 Bacteria 3884
1575 Ga0496105_0046209 3300048908 Bacteria 3594
1576 Ga0496105_0070003 3300048908 Bacteria 2900
1577 Ga0496105_0083764 3300048908 Bacteria 2633
1578 Ga0496105_0124118 3300048908 Bacteria 2128
1579 Ga0496106_0002067 3300048909 Bacteria 15058
1580 Ga0496106_0013799 3300048909 Bacteria 5969
1581 Ga0496106_0015143 3300048909 Bacteria 5707
1582 Ga0496106_0017601 3300048909 Bacteria 5286
1583 Ga0496106_0022235 3300048909 Bacteria 4710
1584 Ga0496106_0082186 3300048909 Bacteria 2476
1585 Ga0496106_0105570 3300048909 Bacteria 2189
1586 Ga0496106_0155999 3300048909 Bacteria 1803
1587 Ga0496106_0184107 3300048909 Bacteria 1659
1588 Ga0496106_0252202 3300048909 Bacteria 1411
1589 Ga0496107_0002883 3300048910 Bacteria 11367
1590 Ga0496107_0003797 3300048910 Bacteria 10143
1591 Ga0496107_0016125 3300048910 Bacteria 5242
1592 Ga0496107_0017334 3300048910 Bacteria 5064
1593 Ga0496107_0023165 3300048910 Bacteria 4389
1594 Ga0496107_0053885 3300048910 Bacteria 2902
1595 Ga0496107_0081728 3300048910 Bacteria 2356
1596 Ga0496107_0104424 3300048910 Bacteria 2079
1597 Ga0496108_0000160 3300048911 Bacteria 64120
1598 Ga0496108_0002867 3300048911 Bacteria 13838
1599 Ga0496108_0006166 3300048911 Bacteria 9699
1600 Ga0496108_0009525 3300048911 Bacteria 7871
1601 Ga0496108_0021805 3300048911 Bacteria 5265
1602 Ga0496108_0050060 3300048911 Bacteria 3496
1603 Ga0496108_0053832 3300048911 Bacteria 3376
1604 Ga0496108_0074274 3300048911 Bacteria 2870
1605 Ga0496108_0081848 3300048911 Bacteria 2736
1606 Ga0496108_0168362 3300048911 Bacteria 1895
1607 Ga0496108_0177656 3300048911 Bacteria 1843
1608 Ga0496108_0190029 3300048911 Bacteria 1780
1609 Ga0496108_0336571 3300048911 Bacteria 1316
1610 Ga0496108_0372513 3300048911 Bacteria 1247
1611 Ga0496109_0000245 3300048912 Bacteria 52201
1612 Ga0496109_0003116 3300048912 Bacteria 13828
1613 Ga0496109_0004926 3300048912 Bacteria 11144
1614 Ga0496109_0035138 3300048912 Bacteria 4519
1615 Ga0496109_0036343 3300048912 Bacteria 4445
1616 Ga0496109_0075605 3300048912 Bacteria 3097
1617 Ga0496109_0085388 3300048912 Bacteria 2913
1618 Ga0496109_0122003 3300048912 Bacteria 2428
1619 Ga0496109_0231504 3300048912 Bacteria 1738
1620 Ga0496109_0236963 3300048912 Bacteria 1717
1621 Ga0496109_0352989 3300048912 Bacteria 1389
1622 Ga0496110_0000294 3300048913 Bacteria 32685
1623 Ga0496110_0003653 3300048913 Bacteria 11834
1624 Ga0496110_0005974 3300048913 Bacteria 9585
1625 Ga0496110_0016126 3300048913 Bacteria 6232
1626 Ga0496110_0017145 3300048913 Bacteria 6055
1627 Ga0496110_0017684 3300048913 Bacteria 5963
1628 Ga0496110_0042157 3300048913 Bacteria 3983
1629 Ga0496110_0046314 3300048913 Bacteria 3804
1630 Ga0496110_0101821 3300048913 Bacteria 2575
1631 Ga0496110_0173862 3300048913 Bacteria 1954
1632 Ga0496110_0349695 3300048913 Bacteria 1346
1633 Ga0496111_0009899 3300048914 Bacteria 6372
1634 Ga0496111_0010932 3300048914 Bacteria 6105
1635 Ga0496111_0010974 3300048914 Bacteria 6095
1636 Ga0496111_0013193 3300048914 Bacteria 5619
1637 Ga0496111_0018797 3300048914 Bacteria 4790
1638 Ga0496111_0038213 3300048914 Bacteria 3438
1639 Ga0496111_0076283 3300048914 Bacteria 2443
1640 Ga0496111_0133119 3300048914 Bacteria 1841
1641 Ga0496112_0003018 3300048915 Bacteria 13759
1642 Ga0496112_0013071 3300048915 Bacteria 7658
1643 Ga0496112_0015871 3300048915 Bacteria 7038
1644 Ga0496112_0047161 3300048915 Bacteria 4226
1645 Ga0496112_0054732 3300048915 Bacteria 3921
1646 Ga0496112_0070653 3300048915 Bacteria 3450
1647 Ga0496112_0072921 3300048915 Bacteria 3394
1648 Ga0496112_0111150 3300048915 Bacteria 2710
1649 Ga0496112_0161249 3300048915 Bacteria 2209
1650 Ga0496112_0191347 3300048915 Bacteria 2008
1651 Ga0496112_0221801 3300048915 Bacteria 1846
1652 Ga0496112_0271750 3300048915 Bacteria 1643
1653 Ga0496112_0329177 3300048915 Bacteria 1472
1654 Ga0496112_0357043 3300048915 Bacteria 1404
1655 Ga0496113_0000829 3300048916 Bacteria 16139
1656 Ga0496113_0008097 3300048916 Bacteria 6825
1657 Ga0496113_0011155 3300048916 Bacteria 5978
1658 Ga0496113_0014545 3300048916 Bacteria 5372
1659 Ga0496113_0023296 3300048916 Bacteria 4391
1660 Ga0496113_0039186 3300048916 Bacteria 3487
1661 Ga0496113_0078002 3300048916 Bacteria 2534
1662 Ga0496113_0083994 3300048916 Bacteria 2444
1663 Ga0496113_0124354 3300048916 Bacteria 2019
1664 Ga0496113_0159908 3300048916 Bacteria 1780
1665 Ga0496114_0001871 3300048917 Bacteria 15946
1666 Ga0496114_0021241 3300048917 Bacteria 5279
1667 Ga0496114_0221909 3300048917 Bacteria 1659
1668 Ga0496115_0016282 3300048918 Bacteria 5658
1669 Ga0496115_0022801 3300048918 Bacteria 4854
1670 Ga0496115_0033915 3300048918 Bacteria 4033
1671 Ga0496115_0069273 3300048918 Bacteria 2857
1672 Ga0496115_0091560 3300048918 Bacteria 2485
1673 Ga0496115_0097484 3300048918 Bacteria 2408
1674 Ga0496115_0103788 3300048918 Bacteria 2332
1675 Ga0496115_0164639 3300048918 Bacteria 1834
1676 Ga0496115_0179705 3300048918 Bacteria 1749
1677 Ga0496115_0216662 3300048918 Bacteria 1580
1678 Ga0496115_0257165 3300048918 Bacteria 1436
1679 Ga0496117_0026032 3300048920 Bacteria 4585
1680 Ga0496117_0033040 3300048920 Bacteria 3918
1681 Ga0496117_0058907 3300048920 Bacteria 2657
1682 Ga0496117_0103939 3300048920 Bacteria 1789
1683 Ga0496118_0014225 3300048921 Bacteria 7461
1684 Ga0496118_0022155 3300048921 Bacteria 5566
1685 Ga0496118_0066364 3300048921 Bacteria 2634
1686 Ga0496118_0078978 3300048921 Bacteria 2325
1687 Ga0496118_0141225 3300048921 Bacteria 1526
1688 Ga0496118_0159012 3300048921 Bacteria 1400
1689 Ga0496118_0194531 3300048921 Bacteria 1209
1690 Ga0496119_0005178 3300048922 Bacteria 12605
1691 Ga0496119_0012332 3300048922 Bacteria 6953
1692 Ga0496120_0024959 3300048923 Bacteria 3718
1693 Ga0496121_0000278 3300048924 Bacteria 106838
1694 Ga0496121_0000754 3300048924 Bacteria 59457
1695 Ga0496121_0000811 3300048924 Bacteria 56962
1696 Ga0496121_0008230 3300048924 Bacteria 12349
1697 Ga0496121_0011276 3300048924 Bacteria 9957
1698 Ga0496121_0030206 3300048924 Bacteria 4981
1699 Ga0496121_0101046 3300048924 Bacteria 2225
1700 Ga0496121_0102622 3300048924 Bacteria 2203
1701 Ga0496121_0132417 3300048924 Bacteria 1863
1702 Ga0496122_0013321 3300048925 Bacteria 8059
1703 Ga0496122_0037084 3300048925 Bacteria 3930
1704 Ga0496123_0006678 3300048926 Bacteria 11119
1705 Ga0496124_0001369 3300048927 Bacteria 36505
1706 Ga0496124_0034366 3300048927 Bacteria 4451
1707 Ga0496124_0099959 3300048927 Bacteria 2352
1708 Ga0496124_0101944 3300048927 Bacteria 2324
1709 Ga0496124_0115467 3300048927 Bacteria 2154
1710 Ga0496124_0121459 3300048927 Bacteria 2087
1711 Ga0496125_0000207 3300048928 Bacteria 122897
1712 Ga0496125_0000571 3300048928 Bacteria 63074
1713 Ga0496125_0038368 3300048928 Bacteria 4147
1714 Ga0496125_0041835 3300048928 Bacteria 3912
1715 Ga0496125_0063472 3300048928 Bacteria 2945
1716 Ga0496125_0090618 3300048928 Bacteria 2294
1717 Ga0496125_0108318 3300048928 Bacteria 2021
1718 Ga0496125_0134890 3300048928 Bacteria 1729
1719 Ga0496126_0011363 3300048929 Bacteria 9229
1720 Ga0496126_0018522 3300048929 Bacteria 6895
1721 Ga0496126_0045277 3300048929 Bacteria 4045
1722 Ga0496126_0060819 3300048929 Bacteria 3396
1723 Ga0496126_0084170 3300048929 Bacteria 2805
1724 Ga0496126_0104001 3300048929 Bacteria 2481
1725 Ga0496126_0117408 3300048929 Bacteria 2311
1726 Ga0496126_0129043 3300048929 Bacteria 2186
1727 Ga0496126_0130996 3300048929 Bacteria 2167
1728 Ga0496126_0163424 3300048929 Bacteria 1901
1729 Ga0496126_0164049 3300048929 Bacteria 1897
1730 Ga0496126_0172381 3300048929 Bacteria 1842
1731 Ga0496126_0216191 3300048929 Bacteria 1612
1732 Ga0501031_0010398 3300049568 Bacteria 6059
1733 Ga0501031_0091747 3300049568 Bacteria 1981
1734 Ga0501031_0163010 3300049568 Bacteria 1457
1735 Ga0501032_0001422 3300049569 Bacteria 19011
1736 Ga0501032_0008649 3300049569 Bacteria 7421
1737 Ga0501032_0010272 3300049569 Bacteria 6754
1738 Ga0501032_0051874 3300049569 Bacteria 2764
1739 Ga0501032_0079059 3300049569 Bacteria 2189
1740 Ga0501032_0087245 3300049569 Bacteria 2072
1741 Ga0501032_0113830 3300049569 Bacteria 1789
1742 Ga0501032_0218539 3300049569 Bacteria 1241
1743 Ga0501033_0005041 3300049570 Bacteria 10517
1744 Ga0501033_0018913 3300049570 Bacteria 5206
1745 Ga0501033_0019771 3300049570 Bacteria 5090
1746 Ga0501033_0020633 3300049570 Bacteria 4978
1747 Ga0501033_0022313 3300049570 Bacteria 4775
1748 Ga0501033_0110241 3300049570 Bacteria 2003
1749 Ga0501033_0153286 3300049570 Bacteria 1661
1750 Ga0501034_0000673 3300049571 Bacteria 51868
1751 Ga0501034_0000691 3300049571 Bacteria 51242
1752 Ga0501034_0000933 3300049571 Bacteria 42599
1753 Ga0501034_0013091 3300049571 Bacteria 8550
1754 Ga0501034_0019340 3300049571 Bacteria 6966
1755 Ga0501034_0054154 3300049571 Bacteria 4038
1756 Ga0501034_0068096 3300049571 Bacteria 3571
1757 Ga0501034_0072154 3300049571 Bacteria 3461
1758 Ga0501034_0092984 3300049571 Bacteria 3012
1759 Ga0501034_0163959 3300049571 Bacteria 2192
1760 Ga0501034_0185848 3300049571 Bacteria 2041
1761 Ga0501034_0292799 3300049571 Bacteria 1565
1762 Ga0501036_0004882 3300049572 Bacteria 10832
1763 Ga0501036_0010354 3300049572 Bacteria 7697
1764 Ga0501036_0019678 3300049572 Bacteria 5667
1765 Ga0501036_0095375 3300049572 Bacteria 2514
1766 Ga0501036_0108200 3300049572 Bacteria 2350
1767 Ga0501036_0114171 3300049572 Bacteria 2282
1768 Ga0501036_0181331 3300049572 Bacteria 1772
1769 Ga0501037_0006667 3300049573 Bacteria 8444
1770 Ga0501037_0006984 3300049573 Bacteria 8244
1771 Ga0501037_0010589 3300049573 Bacteria 6774
1772 Ga0501037_0041278 3300049573 Bacteria 3393
1773 Ga0501037_0048598 3300049573 Bacteria 3107
1774 Ga0501037_0056550 3300049573 Bacteria 2864
1775 Ga0501037_0085308 3300049573 Bacteria 2286
1776 Ga0501037_0115721 3300049573 Bacteria 1930
1777 Ga0501037_0168932 3300049573 Bacteria 1556
1778 Ga0501038_0000948 3300049574 Bacteria 25902
1779 Ga0501038_0020847 3300049574 Bacteria 5891
1780 Ga0501038_0034831 3300049574 Bacteria 4424
1781 Ga0501038_0066489 3300049574 Bacteria 3069
1782 Ga0501038_0074193 3300049574 Bacteria 2879
1783 Ga0501038_0191862 3300049574 Bacteria 1643
1784 Ga0501038_0205026 3300049574 Bacteria 1580
1785 Ga0501038_0215951 3300049574 Bacteria 1532
1786 Ga0501038_0319622 3300049574 Bacteria 1215
1787 Ga0501039_0026395 3300049575 Bacteria 4463
1788 Ga0501039_0030541 3300049575 Bacteria 4155
1789 Ga0501039_0038484 3300049575 Bacteria 3694
1790 Ga0501039_0041189 3300049575 Bacteria 3566
1791 Ga0501039_0044576 3300049575 Bacteria 3426
1792 Ga0501039_0059733 3300049575 Bacteria 2953
1793 Ga0501039_0104757 3300049575 Bacteria 2208
1794 Ga0501039_0159574 3300049575 Bacteria 1772
1795 Ga0501040_0077508 3300049576 Bacteria 2299
1796 Ga0501040_0241087 3300049576 Bacteria 1289
1797 Ga0501042_0074908 3300049578 Bacteria 2422
1798 Ga0501042_0199333 3300049578 Bacteria 1443
1799 Ga0501042_0295126 3300049578 Bacteria 1171
1800 Ga0501043_0002349 3300049579 Bacteria 16039
1801 Ga0501043_0004950 3300049579 Bacteria 10776
1802 Ga0501043_0006067 3300049579 Bacteria 9711
1803 Ga0501043_0016514 3300049579 Bacteria 5786
1804 Ga0501043_0032628 3300049579 Bacteria 4094
1805 Ga0501043_0037137 3300049579 Bacteria 3832
1806 Ga0501043_0098491 3300049579 Bacteria 2298
1807 Ga0501043_0108247 3300049579 Bacteria 2183
1808 Ga0501043_0136142 3300049579 Bacteria 1924
1809 Ga0501046_0001586 3300049580 Bacteria 21746
1810 Ga0501046_0033536 3300049580 Bacteria 4147
1811 Ga0501046_0033734 3300049580 Bacteria 4134
1812 Ga0501046_0048377 3300049580 Bacteria 3367
1813 Ga0501046_0091087 3300049580 Bacteria 2345
1814 Ga0501046_0096698 3300049580 Bacteria 2268
1815 Ga0501046_0110463 3300049580 Bacteria 2101
1816 Ga0501046_0128965 3300049580 Bacteria 1919
1817 Ga0501047_0000073 3300049581 Bacteria 125990
1818 Ga0501047_0017656 3300049581 Bacteria 6837
1819 Ga0501047_0017861 3300049581 Bacteria 6795
1820 Ga0501047_0018610 3300049581 Bacteria 6659
1821 Ga0501047_0029883 3300049581 Bacteria 5252
1822 Ga0501047_0034366 3300049581 Bacteria 4894
1823 Ga0501047_0058103 3300049581 Bacteria 3737
1824 Ga0501047_0138245 3300049581 Bacteria 2315
1825 Ga0501047_0179518 3300049581 Bacteria 1983
1826 Ga0501047_0181752 3300049581 Bacteria 1969
1827 Ga0501047_0189884 3300049581 Bacteria 1918
1828 Ga0501047_0213311 3300049581 Bacteria 1788
1829 Ga0501047_0376027 3300049581 Bacteria 1255
1830 Ga0501047_0492878 3300049581 Bacteria 1052
1831 Ga0501048_0000014 3300049582 Bacteria 75001
1832 Ga0501048_0008876 3300049582 Bacteria 7569
1833 Ga0501048_0043637 3300049582 Bacteria 3209
1834 Ga0501048_0062592 3300049582 Bacteria 2633
1835 Ga0501048_0101362 3300049582 Bacteria 2031
1836 Ga0501048_0136654 3300049582 Bacteria 1732
1837 Ga0501048_0165677 3300049582 Bacteria 1565
1838 Ga0501067_0005018 3300049583 Bacteria 7353
1839 Ga0501067_0101423 3300049583 Bacteria 1599
1840 Ga0501068_0008224 3300049584 Bacteria 5801
1841 Ga0501068_0014019 3300049584 Bacteria 4574
1842 Ga0501068_0014897 3300049584 Bacteria 4454
1843 Ga0501068_0132273 3300049584 Bacteria 1560
1844 Ga0501069_0000190 3300049585 Bacteria 27163
1845 Ga0501069_0009841 3300049585 Bacteria 5055
1846 Ga0501069_0011609 3300049585 Bacteria 4669
1847 Ga0501069_0038783 3300049585 Bacteria 2630
1848 Ga0501069_0060135 3300049585 Bacteria 2121
1849 Ga0501069_0121530 3300049585 Bacteria 1492
1850 Ga0501070_0001037 3300049586 Bacteria 25015
1851 Ga0501070_0003489 3300049586 Bacteria 13638
1852 Ga0501070_0009555 3300049586 Bacteria 8192
1853 Ga0501070_0012906 3300049586 Bacteria 7041
1854 Ga0501070_0020179 3300049586 Bacteria 5591
1855 Ga0501070_0049313 3300049586 Bacteria 3496
1856 Ga0501070_0067767 3300049586 Bacteria 2956
1857 Ga0501070_0087459 3300049586 Bacteria 2579
1858 Ga0501070_0163895 3300049586 Bacteria 1832
1859 Ga0501070_0304842 3300049586 Bacteria 1297
1860 Ga0501071_0094674 3300049587 Bacteria 2197
1861 Ga0501071_0149725 3300049587 Bacteria 1740
1862 Ga0501072_0057836 3300049588 Bacteria 3056
1863 Ga0501072_0060517 3300049588 Bacteria 2986
1864 Ga0501072_0090281 3300049588 Bacteria 2432
1865 Ga0501073_0003174 3300049589 Bacteria 12336
1866 Ga0501073_0004001 3300049589 Bacteria 11068
1867 Ga0501073_0011356 3300049589 Bacteria 6515
1868 Ga0501073_0029367 3300049589 Bacteria 3930
1869 Ga0501073_0069891 3300049589 Bacteria 2446
1870 Ga0501073_0108681 3300049589 Bacteria 1924
1871 Ga0501074_0001948 3300049590 Bacteria 14198
1872 Ga0501074_0012282 3300049590 Bacteria 6226
1873 Ga0501074_0017338 3300049590 Bacteria 5223
1874 Ga0501074_0030505 3300049590 Bacteria 3907
1875 Ga0501074_0060488 3300049590 Bacteria 2729
1876 Ga0501074_0073140 3300049590 Bacteria 2463
1877 Ga0501075_0005436 3300049591 Bacteria 8712
1878 Ga0501075_0064579 3300049591 Bacteria 2761
1879 Ga0501076_0009787 3300049592 Bacteria 7080
1880 Ga0501076_0053302 3300049592 Bacteria 3205
1881 Ga0501076_0091917 3300049592 Bacteria 2441
1882 Ga0501076_0123157 3300049592 Bacteria 2100
1883 Ga0501076_0301094 3300049592 Bacteria 1315
1884 Ga0501077_0003603 3300049593 Bacteria 9313
1885 Ga0501077_0049718 3300049593 Bacteria 2664
1886 Ga0501079_0037744 3300049741 Bacteria 3724
1887 Ga0501079_0071590 3300049741 Bacteria 2679
1888 Ga0501079_0100570 3300049741 Bacteria 2241
1889 Ga0501079_0168348 3300049741 Bacteria 1709
1890 Ga0501080_0000187 3300049742 Bacteria 45224
1891 Ga0501080_0001815 3300049742 Bacteria 18292
1892 Ga0501080_0004185 3300049742 Bacteria 12795
1893 Ga0501080_0006919 3300049742 Bacteria 10230
1894 Ga0501080_0029012 3300049742 Bacteria 5151
1895 Ga0501080_0040215 3300049742 Bacteria 4362
1896 Ga0501080_0042290 3300049742 Bacteria 4243
1897 Ga0501080_0048913 3300049742 Bacteria 3934
1898 Ga0501080_0059457 3300049742 Bacteria 3556
1899 Ga0501080_0073456 3300049742 Bacteria 3182
1900 Ga0501080_0136252 3300049742 Bacteria 2272
1901 Ga0501080_0405110 3300049742 Bacteria 1227
1902 Ga0501080_0417736 3300049742 Bacteria 1205
1903 Ga0501081_0008438 3300049743 Bacteria 6691
1904 Ga0501081_0035782 3300049743 Bacteria 3381
1905 Ga0501081_0056279 3300049743 Bacteria 2718
1906 Ga0501081_0067508 3300049743 Bacteria 2489
1907 Ga0501081_0093478 3300049743 Bacteria 2117
1908 Ga0501081_0094358 3300049743 Bacteria 2108
1909 Ga0501081_0196139 3300049743 Bacteria 1463
1910 Ga0501083_0000901 3300049744 Bacteria 19671
1911 Ga0501083_0004446 3300049744 Bacteria 9902
1912 Ga0501083_0011803 3300049744 Bacteria 6122
1913 Ga0501083_0011884 3300049744 Bacteria 6100
1914 Ga0501083_0017373 3300049744 Bacteria 5015
1915 Ga0501083_0019361 3300049744 Bacteria 4742
1916 Ga0501083_0081354 3300049744 Bacteria 2147
1917 Ga0501083_0175838 3300049744 Bacteria 1399
1918 Ga0501083_0201935 3300049744 Bacteria 1296
1919 Ga0501035_0000197 3300049822 Bacteria 73618
1920 Ga0501035_0015596 3300049822 Bacteria 7011
1921 Ga0501035_0019995 3300049822 Bacteria 6150
1922 Ga0501035_0021710 3300049822 Bacteria 5902
1923 Ga0501035_0028447 3300049822 Bacteria 5101
1924 Ga0501035_0142593 3300049822 Bacteria 2082
1925 Ga0501035_0208562 3300049822 Bacteria 1673
1926 Ga0501044_0003755 3300049823 Bacteria 17071
1927 Ga0501044_0004583 3300049823 Bacteria 15458
1928 Ga0501044_0004911 3300049823 Bacteria 14944
1929 Ga0501044_0008628 3300049823 Bacteria 11161
1930 Ga0501044_0024675 3300049823 Bacteria 6378
1931 Ga0501044_0035948 3300049823 Bacteria 5184
1932 Ga0501044_0041060 3300049823 Bacteria 4816
1933 Ga0501044_0042563 3300049823 Bacteria 4722
1934 Ga0501044_0056058 3300049823 Bacteria 4046
1935 Ga0501044_0057160 3300049823 Bacteria 4003
1936 Ga0501044_0094111 3300049823 Bacteria 3021
1937 Ga0501044_0108404 3300049823 Bacteria 2787
1938 Ga0501044_0114590 3300049823 Bacteria 2701
1939 Ga0501044_0119765 3300049823 Bacteria 2634
1940 Ga0501044_0182183 3300049823 Bacteria 2066
1941 Ga0501044_0220400 3300049823 Bacteria 1848
1942 Ga0501044_0238704 3300049823 Bacteria 1762
1943 Ga0501044_0389412 3300049823 Bacteria 1308
1944 Ga0501045_0006306 3300049824 Bacteria 8202
1945 Ga0501045_0014375 3300049824 Bacteria 5610
1946 Ga0501045_0039946 3300049824 Bacteria 3414
1947 Ga0501045_0104498 3300049824 Bacteria 2099
1948 nmdc:mga03n38_27813_c1 3300050490 Bacteria 2350
1949 nmdc:mga03n38_44418_c1 3300050490 Bacteria 1952
1950 nmdc:mga03n38_73432_c1 3300050490 Bacteria 1588
1951 nmdc:mga00v17_10276_c1 3300050491 Bacteria 2414
1952 nmdc:mga00v17_30679_c2 3300050491 Bacteria 2160
1953 nmdc:mga00v17_54883_c1 3300050491 Bacteria 2431
1954 nmdc:mga00v17_93949_c1 3300050491 Bacteria 1886
1955 nmdc:mga0yw44_48515_c1 3300050492 Bacteria 2561
1956 nmdc:mga0yw44_95849_c1 3300050492 Bacteria 1883
1957 nmdc:mga0yw44_9683_c1 3300050492 Bacteria 4890
1958 nmdc:mga0k408_24413_c1 3300050493 Bacteria 3417
1959 nmdc:mga06z11_122160_c1 3300050494 Bacteria 1454
1960 nmdc:mga06z11_17936_c1 3300050494 Bacteria 3224
1961 nmdc:mga07m45_40497_c1 3300050496 Bacteria 2607
1962 nmdc:mga05p37_19_c3 3300050507 Bacteria 27587
1963 nmdc:mga05p37_255770_c1 3300050507 Bacteria 2099
1964 nmdc:mga05p37_41284_c1 3300050507 Bacteria 5664
1965 nmdc:mga05p37_413268_c1 3300050507 Bacteria 1572
1966 nmdc:mga05p37_5194_c1 3300050507 Bacteria 15277
1967 nmdc:mga05p37_78195_c1 3300050507 Bacteria 4073
1968 nmdc:mga05p37_91058_c1 3300050507 Bacteria 2777
1969 nmdc:mga09592_121543_c1 3300050508 Bacteria 2244
1970 nmdc:mga09592_24621_c1 3300050508 Bacteria 4979
1971 nmdc:mga09592_254035_c1 3300050508 Bacteria 1524
1972 nmdc:mga09592_758_c1 3300050508 Bacteria 24836
1973 nmdc:mga09592_77441_c1 3300050508 Bacteria 2829
1974 nmdc:mga09592_79985_c1 3300050508 Bacteria 2783
1975 nmdc:mga09592_85800_c1 3300050508 Bacteria 2686
1976 nmdc:mga0qj67_102339_c1 3300050509 Bacteria 2310
1977 nmdc:mga0qj67_216054_c1 3300050509 Bacteria 1557
1978 nmdc:mga0qj67_2551_c1 3300050509 Bacteria 13012
1979 nmdc:mga0qj67_3814_c1 3300050509 Bacteria 10890
1980 nmdc:mga0qj67_40740_c1 3300050509 Bacteria 3650
1981 nmdc:mga0qj67_4389_c1 3300050509 Bacteria 10214
1982 nmdc:mga06r32_1046_c2 3300050510 Bacteria 12365
1983 nmdc:mga06r32_104709_c1 3300050510 Bacteria 2779
1984 nmdc:mga06r32_1204_c2 3300050510 Bacteria 8356
1985 nmdc:mga06r32_12554_c1 3300050510 Bacteria 7649
1986 nmdc:mga06r32_181_c1 3300050510 Bacteria 49505
1987 nmdc:mga06r32_20164_c1 3300050510 Bacteria 6134
1988 nmdc:mga06r32_22755_c1 3300050510 Bacteria 5797
1989 nmdc:mga06r32_30846_c1 3300050510 Bacteria 5031
1990 nmdc:mga06r32_59283_c1 3300050510 Bacteria 3681
1991 nmdc:mga06r32_97876_c1 3300050510 Bacteria 2875
1992 nmdc:mga06r32_97896_c1 3300050510 Bacteria 2875
1993 nmdc:mga08y16_1185_c1 3300050511 Bacteria 25720
1994 nmdc:mga08y16_120623_c1 3300050511 Bacteria 2729
1995 nmdc:mga08y16_142867_c1 3300050511 Bacteria 2488
1996 nmdc:mga08y16_160593_c1 3300050511 Bacteria 2335
1997 nmdc:mga08y16_223492_c1 3300050511 Bacteria 1949
1998 nmdc:mga08y16_341235_c1 3300050511 Bacteria 1540
1999 nmdc:mga08y16_4195_c1 3300050511 Bacteria 15046
2000 nmdc:mga08y16_42039_c1 3300050511 Bacteria 4787
2001 nmdc:mga08y16_4379_c1 3300050511 Bacteria 14755
2002 nmdc:mga08y16_47004_c1 3300050511 Bacteria 4518
2003 nmdc:mga08y16_7723_c1 3300050511 Bacteria 11264
2004 nmdc:mga08y16_8243_c1 3300050511 Bacteria 10901
2005 nmdc:mga08y16_83622_c1 3300050511 Bacteria 3326
2006 nmdc:mga0n895_126234_c1 3300050512 Bacteria 2582
2007 nmdc:mga0n895_1573_c1 3300050512 Bacteria 17177
2008 nmdc:mga0n895_203821_c1 3300050512 Bacteria 2008
2009 nmdc:mga0n895_24239_c1 3300050512 Bacteria 5715
2010 nmdc:mga0n895_65679_c1 3300050512 Bacteria 3592
2011 nmdc:mga0rr50_25778_c1 3300050513 Bacteria 4092
2012 nmdc:mga0rr50_265928_c1 3300050513 Bacteria 1428
2013 nmdc:mga0rr50_390_c1 3300050513 Bacteria 23898
2014 nmdc:mga0rr50_68397_c1 3300050513 Bacteria 2701
2015 nmdc:mga08x19_18_c1 3300050514 Bacteria 321445
2016 nmdc:mga08x19_40219_c1 3300050514 Bacteria 2975
2017 nmdc:mga0a205_106802_c1 3300050515 Bacteria 2697
2018 nmdc:mga0a205_166926_c1 3300050515 Bacteria 2097
2019 nmdc:mga0a205_249744_c1 3300050515 Bacteria 1654
2020 nmdc:mga0a205_681_c1 3300050515 Bacteria 27171
2021 Ga0495601_0000011 3300053077 Bacteria 264937
2022 Ga0495601_0000787 3300053077 Bacteria 17135
2023 Ga0495601_0005014 3300053077 Bacteria 7684
2024 Ga0495601_0005317 3300053077 Bacteria 7493
2025 Ga0495601_0006576 3300053077 Bacteria 6799
2026 Ga0495601_0008279 3300053077 Bacteria 6136
2027 Ga0495601_0008413 3300053077 Bacteria 6095
2028 Ga0495612_0000006 3300053078 Bacteria 269278
2029 Ga0495612_0001215 3300053078 Bacteria 10624
2030 Ga0495612_0004156 3300053078 Bacteria 6000
2031 Ga0495612_0004476 3300053078 Bacteria 5800
2032 Ga0495612_0009585 3300053078 Bacteria 3922
2033 Ga0495612_0015781 3300053078 Bacteria 3027
2034 Ga0495612_0024636 3300053078 Bacteria 2415
2035 Ga0495655_0012391 3300053083 Bacteria 1737
2036 Ga0495595_0000021 3300053084 Bacteria 115921
2037 Ga0495595_0000235 3300053084 Bacteria 21997
2038 Ga0495595_0000883 3300053084 Bacteria 11520
2039 Ga0495595_0001298 3300053084 Bacteria 9734
2040 Ga0495595_0003055 3300053084 Bacteria 6619
2041 Ga0495595_0055539 3300053084 Bacteria 1843
2042 Ga0495619_0000013 3300053085 Bacteria 264865
2043 Ga0495619_0000378 3300053085 Bacteria 30722
2044 Ga0495619_0000897 3300053085 Bacteria 19498
2045 Ga0495619_0002647 3300053085 Bacteria 11703
2046 Ga0495619_0005295 3300053085 Bacteria 8173
2047 Ga0495619_0006153 3300053085 Bacteria 7602
2048 Ga0495619_0009627 3300053085 Bacteria 6095
2049 Ga0495619_0036531 3300053085 Bacteria 3199
2050 Ga0495619_0037466 3300053085 Bacteria 3160
2051 Ga0495619_0040924 3300053085 Bacteria 3029
2052 Ga0495619_0131254 3300053085 Bacteria 1722
2053 Ga0495619_0232482 3300053085 Bacteria 1277
2054 Ga0500578_0043962 3300053086 Bacteria 2867
2055 Ga0500643_000112 3300053087 Bacteria 84793
2056 Ga0500643_007044 3300053087 Bacteria 4609
2057 Ga0500644_0001381 3300053088 Bacteria 6468
2058 Ga0500647_0052629 3300053091 Bacteria 1959
2059 Ga0500651_0002657 3300053093 Bacteria 9500
2060 Ga0500651_0019614 3300053093 Bacteria 4203
2061 Ga0500566_0000234 3300053094 Bacteria 29561
2062 Ga0500566_0001195 3300053094 Bacteria 15155
2063 Ga0500566_0008103 3300053094 Bacteria 6218
2064 Ga0500650_0013287 3300053098 Bacteria 3450
2065 Ga0500555_001178 3300053103 Bacteria 8570
2066 Ga0500556_0000016 3300053104 Bacteria 194958
2067 Ga0500556_0000200 3300053104 Bacteria 49207
2068 Ga0500557_000021 3300053105 Bacteria 89662
2069 Ga0500562_002672 3300053108 Bacteria 4438
2070 Ga0500572_000229 3300053111 Bacteria 19843
2071 Ga0500592_002942 3300053116 Bacteria 2730
2072 Ga0500593_003727 3300053117 Bacteria 5811
2073 Ga0500595_000001 3300053119 Bacteria 1088438
2074 Ga0500595_000854 3300053119 Bacteria 17395
2075 Ga0500595_001023 3300053119 Bacteria 15679
2076 Ga0500595_006755 3300053119 Bacteria 4837
2077 Ga0500595_009949 3300053119 Bacteria 3804
2078 Ga0500595_014382 3300053119 Bacteria 3002
2079 Ga0500608_006748 3300053122 Bacteria 4702
2080 Ga0500642_0000261 3300053130 Bacteria 19727
2081 Ga0500642_0000583 3300053130 Bacteria 10905
2082 Ga0500642_0087857 3300053130 Bacteria 1434
2083 Ga0500652_001353 3300053131 Bacteria 7674
2084 Ga0500652_005218 3300053131 Bacteria 4074
2085 Ga0500559_0000161 3300053136 Bacteria 53055
2086 Ga0500559_0000186 3300053136 Bacteria 49470
2087 Ga0500559_0013598 3300053136 Bacteria 3445
2088 Ga0500568_0000005 3300053139 Bacteria 614296
2089 Ga0500568_0002662 3300053139 Bacteria 10360
2090 Ga0500588_0049440 3300053146 Bacteria 1305
2091 Ga0500590_075582 3300053148 Bacteria 1666
2092 Ga0500603_000700 3300053150 Bacteria 8154
2093 Ga0500604_0002947 3300053151 Bacteria 4592
2094 Ga0500616_0000001 3300053153 Bacteria 1986011
2095 Ga0500616_0000169 3300053153 Bacteria 109205
2096 Ga0500616_0006228 3300053153 Bacteria 7873
2097 Ga0500616_0006835 3300053153 Bacteria 7375
2098 Ga0500619_030422 3300053154 Bacteria 1640
2099 Ga0500619_037378 3300053154 Bacteria 1516
2100 Ga0500622_0004388 3300053156 Bacteria 8890
2101 Ga0500622_0020445 3300053156 Bacteria 3515
2102 Ga0500630_007436 3300053159 Bacteria 5373
2103 Ga0500638_002757 3300053162 Bacteria 6258
2104 Ga0500639_023398 3300053163 Bacteria 3264
2105 Ga0500639_032819 3300053163 Bacteria 2744
2106 Ga0500636_0003390 3300053177 Bacteria 8957
2107 Ga0500636_0004022 3300053177 Bacteria 8292
2108 Ga0500636_0009079 3300053177 Bacteria 5777
2109 Ga0500636_0034430 3300053177 Bacteria 2998
2110 Ga0500636_0034793 3300053177 Bacteria 2982
2111 Ga0500637_0000559 3300053178 Bacteria 14586
2112 Ga0500637_0013057 3300053178 Bacteria 4341
2113 Ga0500637_0097519 3300053178 Bacteria 1704
2114 Ga0500637_0122047 3300053178 Bacteria 1511
2115 Ga0500645_001447 3300053730 Bacteria 12021
2116 Ga0500645_006233 3300053730 Bacteria 4280
2117 Ga0500645_011174 3300053730 Bacteria 2942
2118 Ga0500645_015328 3300053730 Bacteria 2429
2119 Ga0500596_000722 3300053735 Bacteria 6467
2120 Ga0500596_000983 3300053735 Bacteria 5695
2121 Ga0500601_000713 3300053737 Bacteria 4407
2122 Ga0501084_0044287 3300054114 Bacteria 3726
2123 Ga0501084_0058948 3300054114 Bacteria 3213
2124 Ga0501084_0066132 3300054114 Bacteria 3025
2125 Ga0501084_0092863 3300054114 Bacteria 2533
2126 Ga0501084_0114936 3300054114 Bacteria 2262
2127 Ga0501084_0189085 3300054114 Bacteria 1737
2128 Ga0500661_007900 3300055283 Bacteria 1962
2129 Ga0501082_0000874 3300060353 Bacteria 26608
2130 Ga0501082_0002008 3300060353 Bacteria 17888
2131 Ga0501082_0003849 3300060353 Bacteria 13120
2132 Ga0501082_0027083 3300060353 Bacteria 4940
2133 Ga0501082_0032445 3300060353 Bacteria 4505
2134 Ga0501082_0070899 3300060353 Bacteria 3000
2135 Ga0501082_0119887 3300060353 Bacteria 2280
2136 Ga0501082_0122108 3300060353 Bacteria 2258
2137 Ga0501082_0123862 3300060353 Bacteria 2241
2138 Ga0530510_0008912 3300061734 Bacteria 7026
2139 Ga0530510_0013566 3300061734 Bacteria 5731
2140 Ga0530510_0093167 3300061734 Bacteria 2199

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049581 Ga0501047_0492878 Ga0501047_0492878_29_940 302
2 3300050510 nmdc:mga06r32_59283_c1 nmdc:mga06r32_59283_c1_2746_3669 306
3 3300005841 Ga0068863_100094759 Ga0068863_1000947592 309
4 3300006881 Ga0068865_100061629 Ga0068865_1000616292 309
5 3300025942 Ga0207689_10139407 Ga0207689_101394071 309
6 3300049582 Ga0501048_0101362 Ga0501048_0101362_17_985 322
7 3300050515 nmdc:mga0a205_166926_c1 nmdc:mga0a205_166926_c1_1110_2084 324
8 3300032133 Ga0316583_10001087 Ga0316583_100010874 330
9 3300028800 Ga0265338_10038858 Ga0265338_100388585 331
10 3300031711 Ga0265314_10003096 Ga0265314_1000309612 331
11 3300046514 Ga0495618_0120684 Ga0495618_0120684_431_1492 332
12 3300046462 Ga0495651_0106098 Ga0495651_0106098_13_1014 333
13 3300005530 Ga0070679_100056002 Ga0070679_1000560023 334
14 3300025921 Ga0207652_10079308 Ga0207652_100793082 334
15 3300049568 Ga0501031_0163010 Ga0501031_0163010_167_1327 334
16 3300049569 Ga0501032_0001422 Ga0501032_0001422_6972_8132 334
17 3300049570 Ga0501033_0005041 Ga0501033_0005041_8516_9676 334
18 3300049571 Ga0501034_0292799 Ga0501034_0292799_251_1411 334
19 3300049574 Ga0501038_0191862 Ga0501038_0191862_294_1454 334
20 3300049575 Ga0501039_0030541 Ga0501039_0030541_833_1993 334
21 3300049579 Ga0501043_0002349 Ga0501043_0002349_11299_12459 334
22 3300049580 Ga0501046_0001586 Ga0501046_0001586_4163_5323 334
23 3300049581 Ga0501047_0017656 Ga0501047_0017656_2463_3623 334
24 3300049583 Ga0501067_0101423 Ga0501067_0101423_443_1585 334
25 3300049586 Ga0501070_0001037 Ga0501070_0001037_11032_12192 334
26 3300049589 Ga0501073_0003174 Ga0501073_0003174_246_1406 334
27 3300049590 Ga0501074_0012282 Ga0501074_0012282_3104_4264 334
28 3300049741 Ga0501079_0071590 Ga0501079_0071590_343_1503 334
29 3300049742 Ga0501080_0001815 Ga0501080_0001815_9690_10850 334
30 3300049744 Ga0501083_0011803 Ga0501083_0011803_4109_5269 334
31 3300049822 Ga0501035_0021710 Ga0501035_0021710_4177_5337 334
32 3300049823 Ga0501044_0004911 Ga0501044_0004911_10868_12028 334
33 3300060353 Ga0501082_0002008 Ga0501082_0002008_15134_16294 334
34 3300048907 Ga0496104_0002512 Ga0496104_0002512_5281_6459 335
35 3300048908 Ga0496105_0046209 Ga0496105_0046209_1486_2664 335
36 3300048911 Ga0496108_0006166 Ga0496108_0006166_345_1523 335
37 3300048912 Ga0496109_0122003 Ga0496109_0122003_1008_2186 335
38 3300048913 Ga0496110_0000294 Ga0496110_0000294_14967_16145 335
39 3300048914 Ga0496111_0076283 Ga0496111_0076283_345_1523 335
40 3300048915 Ga0496112_0111150 Ga0496112_0111150_857_2035 335
41 3300048916 Ga0496113_0011155 Ga0496113_0011155_2989_4167 335
42 3300049572 Ga0501036_0019678 Ga0501036_0019678_4400_5560 336
43 3300049582 Ga0501048_0043637 Ga0501048_0043637_1132_2292 336
44 3300049585 Ga0501069_0000190 Ga0501069_0000190_10331_11491 336
45 3300003203 JGI25406J46586_10006273 JGI25406J46586_100062736 339
46 3300005985 Ga0081539_10009159 Ga0081539_100091595 339
47 3300006871 Ga0075434_100236024 Ga0075434_1002360242 339
48 3300005340 Ga0070689_100215495 Ga0070689_1002154951 341
49 3300006846 Ga0075430_100081899 Ga0075430_1000818991 341
50 3300006852 Ga0075433_10108895 Ga0075433_101088952 341
51 3300009094 Ga0111539_10109625 Ga0111539_101096252 341
52 3300009177 Ga0105248_10182698 Ga0105248_101826982 341
53 3300025936 Ga0207670_10197244 Ga0207670_101972441 341
54 3300035118 Ga0373954_0020907 Ga0373954_0020907_667_1800 341
55 3300035120 Ga0373957_0062436 Ga0373957_0062436_133_1266 341
56 3300035172 Ga0373955_0058026 Ga0373955_0058026_713_1846 341
57 3300035724 Ga0373933_0003556 Ga0373933_0003556_713_1846 341
58 3300036401 Ga0373937_0064321 Ga0373937_0064321_1264_2397 341
59 3300046675 Ga0495657_0063635 Ga0495657_0063635_1069_2193 341
60 3300048912 Ga0496109_0352989 Ga0496109_0352989_60_1217 341
61 3300048914 Ga0496111_0009899 Ga0496111_0009899_1317_2474 341
62 3300050512 nmdc:mga0n895_203821_c1 nmdc:mga0n895_203821_c1_347_1504 341
63 3300053077 Ga0495601_0005317 Ga0495601_0005317_316_1449 341
64 3300053085 Ga0495619_0040924 Ga0495619_0040924_600_1724 341
65 3300005617 Ga0068859_100346218 Ga0068859_1003462182 342
66 3300006931 Ga0097620_100346220 Ga0097620_1003462202 342
67 3300026041 Ga0207639_10002004 Ga0207639_1000200413 342
68 3300006358 Ga0068871_100007848 Ga0068871_1000078485 343
69 3300006846 Ga0075430_100004870 Ga0075430_1000048703 343
70 3300006847 Ga0075431_100023378 Ga0075431_1000233784 343
71 3300025261 Ga0209233_1021144 Ga0209233_10211442 343
72 3300047319 Ga0495674_0257931 Ga0495674_0257931_351_1406 343
73 3300049582 Ga0501048_0165677 Ga0501048_0165677_134_1285 343
74 3300049588 Ga0501072_0057836 Ga0501072_0057836_1574_2725 343
75 3300049743 Ga0501081_0067508 Ga0501081_0067508_1088_2239 343
76 3300049824 Ga0501045_0104498 Ga0501045_0104498_809_1960 343
77 3300050509 nmdc:mga0qj67_2551_c1 nmdc:mga0qj67_2551_c1_4703_5851 343
78 3300050510 nmdc:mga06r32_1046_c2 nmdc:mga06r32_1046_c2_9265_10413 343
79 3300060353 Ga0501082_0122108 Ga0501082_0122108_899_2050 343
80 3300061734 Ga0530510_0093167 Ga0530510_0093167_814_1965 343
81 3300005983 Ga0081540_1001138 Ga0081540_100113811 344
82 3300046674 Ga0495588_0033845 Ga0495588_0033845_567_1712 344
83 3300050490 nmdc:mga03n38_73432_c1 nmdc:mga03n38_73432_c1_182_1312 344
84 3300050508 nmdc:mga09592_77441_c1 nmdc:mga09592_77441_c1_1545_2705 344
85 iso_pu_bacteria 8016539877 8016544634 344
86 3300005327 Ga0070658_10037444 Ga0070658_100374442 345
87 3300005336 Ga0070680_100003197 Ga0070680_10000319714 345
88 3300005458 Ga0070681_10002805 Ga0070681_100028055 345
89 3300005530 Ga0070679_100109813 Ga0070679_1001098133 345
90 3300005563 Ga0068855_100005017 Ga0068855_1000050175 345
91 3300025909 Ga0207705_10045547 Ga0207705_100455473 345
92 3300025912 Ga0207707_10010835 Ga0207707_100108355 345
93 3300025917 Ga0207660_10005342 Ga0207660_100053423 345
94 3300025919 Ga0207657_10011539 Ga0207657_100115399 345
95 3300025921 Ga0207652_10019461 Ga0207652_100194613 345
96 3300025949 Ga0207667_10011376 Ga0207667_100113766 345
97 3300026041 Ga0207639_10009900 Ga0207639_100099002 345
98 3300006847 Ga0075431_100122057 Ga0075431_1001220571 346
99 3300028800 Ga0265338_10031181 Ga0265338_100311814 346
100 3300031712 Ga0265342_10044798 Ga0265342_100447981 346
101 3300046694 Ga0495649_0016467 Ga0495649_0016467_1627_2769 346
102 3300050510 nmdc:mga06r32_104709_c1 nmdc:mga06r32_104709_c1_169_1329 346
103 3300060353 Ga0501082_0032445 Ga0501082_0032445_1583_2746 346
104 3300005843 Ga0068860_100297275 Ga0068860_1002972752 347
105 3300005844 Ga0068862_100177097 Ga0068862_1001770972 347
106 3300005937 Ga0081455_10058917 Ga0081455_100589171 347
107 3300006194 Ga0075427_10000034 Ga0075427_100000346 347
108 3300006844 Ga0075428_100015508 Ga0075428_1000155087 347
109 3300006846 Ga0075430_100001483 Ga0075430_10000148317 347
110 3300006847 Ga0075431_100001346 Ga0075431_10000134618 347
111 3300006852 Ga0075433_10009808 Ga0075433_100098083 347
112 3300006871 Ga0075434_100001473 Ga0075434_10000147317 347
113 3300006880 Ga0075429_100005777 Ga0075429_1000057779 347
114 3300007076 Ga0075435_100002996 Ga0075435_1000029967 347
115 3300009094 Ga0111539_10001391 Ga0111539_100013913 347
116 3300009147 Ga0114129_10046855 Ga0114129_100468553 347
117 3300009553 Ga0105249_10016547 Ga0105249_100165476 347
118 3300025912 Ga0207707_10084340 Ga0207707_100843402 347
119 3300026075 Ga0207708_10096990 Ga0207708_100969902 347
120 3300026118 Ga0207675_100022885 Ga0207675_1000228855 347
121 3300027907 Ga0207428_10000082 Ga0207428_1000008229 347
122 3300028380 Ga0268265_10057929 Ga0268265_100579292 347
123 3300031824 Ga0307413_10095460 Ga0307413_100954602 347
124 3300049580 Ga0501046_0110463 Ga0501046_0110463_566_1807 347
125 3300049743 Ga0501081_0093478 Ga0501081_0093478_771_2012 347
126 3300050507 nmdc:mga05p37_19_c3 nmdc:mga05p37_19_c3_7057_8184 347
127 3300050508 nmdc:mga09592_758_c1 nmdc:mga09592_758_c1_5812_6939 347
128 3300050509 nmdc:mga0qj67_4389_c1 nmdc:mga0qj67_4389_c1_7228_8355 347
129 3300050510 nmdc:mga06r32_12554_c1 nmdc:mga06r32_12554_c1_4109_5236 347
130 3300050511 nmdc:mga08y16_7723_c1 nmdc:mga08y16_7723_c1_1824_2951 347
131 3300050511 nmdc:mga08y16_83622_c1 nmdc:mga08y16_83622_c1_1093_2226 347
132 3300050512 nmdc:mga0n895_1573_c1 nmdc:mga0n895_1573_c1_14879_16006 347
133 3300050513 nmdc:mga0rr50_390_c1 nmdc:mga0rr50_390_c1_5122_6249 347
134 3300050515 nmdc:mga0a205_681_c1 nmdc:mga0a205_681_c1_9112_10239 347
135 3300053153 Ga0500616_0006835 Ga0500616_0006835_3704_4843 347
136 3300054114 Ga0501084_0114936 Ga0501084_0114936_919_2160 347
137 3300060353 Ga0501082_0123862 Ga0501082_0123862_880_2121 347
138 3300061734 Ga0530510_0013566 Ga0530510_0013566_4381_5622 347
139 3300005328 Ga0070676_10061174 Ga0070676_100611742 348
140 3300005328 Ga0070676_10161471 Ga0070676_101614712 348
141 3300005334 Ga0068869_100007944 Ga0068869_1000079449 348
142 3300005354 Ga0070675_100093875 Ga0070675_1000938752 348
143 3300005354 Ga0070675_100153862 Ga0070675_1001538621 348
144 3300005356 Ga0070674_100022944 Ga0070674_1000229442 348
145 3300005456 Ga0070678_100010470 Ga0070678_1000104702 348
146 3300005459 Ga0068867_100021850 Ga0068867_1000218502 348
147 3300005548 Ga0070665_100264575 Ga0070665_1002645752 348
148 3300006358 Ga0068871_100046918 Ga0068871_1000469182 348
149 3300009148 Ga0105243_10001197 Ga0105243_1000119717 348
150 3300025907 Ga0207645_10095484 Ga0207645_100954842 348
151 3300025926 Ga0207659_10019518 Ga0207659_100195185 348
152 3300025935 Ga0207709_10036547 Ga0207709_100365472 348
153 3300025937 Ga0207669_10017669 Ga0207669_100176693 348
154 3300025940 Ga0207691_10005210 Ga0207691_1000521014 348
155 3300025942 Ga0207689_10028654 Ga0207689_100286542 348
156 3300025960 Ga0207651_10014190 Ga0207651_100141903 348
157 3300026089 Ga0207648_10383842 Ga0207648_103838421 348
158 3300031852 Ga0307410_10016024 Ga0307410_100160243 348
159 3300031911 Ga0307412_10240449 Ga0307412_102404492 348
160 3300031995 Ga0307409_100007664 Ga0307409_1000076642 348
161 3300032005 Ga0307411_10002298 Ga0307411_100022987 348
162 3300046513 Ga0495616_0000669 Ga0495616_0000669_10629_11768 348
163 3300046660 Ga0495625_0047004 Ga0495625_0047004_1351_2487 348
164 3300003215 JGI25153J46596_10001505 JGI25153J46596_1000150513 349
165 3300005337 Ga0070682_100166442 Ga0070682_1001664421 349
166 3300005844 Ga0068862_100199396 Ga0068862_1001993962 349
167 3300006175 Ga0070712_100069246 Ga0070712_1000692462 349
168 3300025297 Ga0209758_1000060 Ga0209758_1000060259 349
169 3300028380 Ga0268265_10057451 Ga0268265_100574512 349
170 3300037853 Ga0436364_0678846 Ga0436364_0678846_2945_4051 349
171 3300046616 Ga0495668_0023088 Ga0495668_0023088_2227_3366 349
172 3300005471 Ga0070698_100072539 Ga0070698_1000725391 350
173 3300025298 Ga0209050_1003616 Ga0209050_10036167 350
174 3300025303 Ga0209051_1020842 Ga0209051_10208423 350
175 3300025304 Ga0209257_1000589 Ga0209257_100058951 350
176 3300028379 Ga0268266_10038187 Ga0268266_100381873 350
177 3300049586 Ga0501070_0304842 Ga0501070_0304842_81_1223 350
178 3300049589 Ga0501073_0011356 Ga0501073_0011356_3747_4889 350
179 3300049823 Ga0501044_0238704 Ga0501044_0238704_87_1229 350
180 3300053151 Ga0500604_0002947 Ga0500604_0002947_2680_3819 350
181 3300005356 Ga0070674_100024527 Ga0070674_1000245273 351
182 3300006914 Ga0075436_100066372 Ga0075436_1000663722 351
183 3300028786 Ga0307517_10149622 Ga0307517_101496222 351
184 3300031456 Ga0307513_10147848 Ga0307513_101478482 351
185 3300046642 Ga0495634_0125585 Ga0495634_0125585_351_1547 351
186 3300049586 Ga0501070_0067767 Ga0501070_0067767_863_2062 351
187 3300049592 Ga0501076_0301094 Ga0501076_0301094_100_1221 351
188 3300049823 Ga0501044_0389412 Ga0501044_0389412_23_1165 351
189 3300053119 Ga0500595_000854 Ga0500595_000854_7475_8617 351
190 3300005434 Ga0070709_10148438 Ga0070709_101484381 352
191 3300005458 Ga0070681_10042344 Ga0070681_100423443 352
192 3300005535 Ga0070684_100142783 Ga0070684_1001427832 352
193 3300005841 Ga0068863_100146320 Ga0068863_1001463201 352
194 3300025297 Ga0209758_1009651 Ga0209758_10096515 352
195 3300047471 Ga0495684_0012198 Ga0495684_0012198_2835_3911 352
196 3300005545 Ga0070695_100083808 Ga0070695_1000838082 353
197 3300006846 Ga0075430_100026582 Ga0075430_1000265822 353
198 3300039438 Ga0436360_0144121 Ga0436360_0144121_5649_6806 353
199 3300050509 nmdc:mga0qj67_102339_c1 nmdc:mga0qj67_102339_c1_194_1330 353
200 3300005331 Ga0070670_100047973 Ga0070670_1000479732 354
201 3300005344 Ga0070661_100136083 Ga0070661_1001360832 354
202 3300005564 Ga0070664_100172529 Ga0070664_1001725292 354
203 3300005719 Ga0068861_100031818 Ga0068861_1000318182 354
204 3300005842 Ga0068858_100293051 Ga0068858_1002930512 354
205 3300025932 Ga0207690_10202730 Ga0207690_102027301 354
206 3300025940 Ga0207691_10044438 Ga0207691_100444383 354
207 3300031456 Ga0307513_10124645 Ga0307513_101246452 354
208 3300035120 Ga0373957_0046451 Ga0373957_0046451_236_1357 354
209 3300045051 Ga0451576_0000709 Ga0451576_0000709_7495_8616 354
210 3300048904 Ga0496101_0022646 Ga0496101_0022646_1284_2414 354
211 3300048907 Ga0496104_0000431 Ga0496104_0000431_11609_12739 354
212 3300048908 Ga0496105_0018293 Ga0496105_0018293_1147_2277 354
213 3300048909 Ga0496106_0252202 Ga0496106_0252202_24_1154 354
214 3300048912 Ga0496109_0085388 Ga0496109_0085388_78_1208 354
215 3300049581 Ga0501047_0376027 Ga0501047_0376027_61_1197 354
216 3300049589 Ga0501073_0004001 Ga0501073_0004001_5948_7084 354
217 3300049742 Ga0501080_0004185 Ga0501080_0004185_5612_6748 354
218 3300005981 Ga0081538_10002854 Ga0081538_100028548 355
219 3300036401 Ga0373937_0026781 Ga0373937_0026781_746_1888 355
220 3300049573 Ga0501037_0168932 Ga0501037_0168932_160_1299 355
221 3300053148 Ga0500590_075582 Ga0500590_075582_145_1347 355
222 3300053178 Ga0500637_0097519 Ga0500637_0097519_196_1398 355
223 3300005564 Ga0070664_100104872 Ga0070664_1001048721 356
224 3300025304 Ga0209257_1001133 Ga0209257_100113333 356
225 3300025945 Ga0207679_10048249 Ga0207679_100482491 356
226 3300031616 Ga0307508_10217827 Ga0307508_102178271 356
227 3300049571 Ga0501034_0163959 Ga0501034_0163959_48_1169 356
228 3300049823 Ga0501044_0220400 Ga0501044_0220400_433_1554 356
229 3300031250 Ga0265331_10000019 Ga0265331_10000019198 357
230 3300031251 Ga0265327_10106440 Ga0265327_101064402 357
231 3300031901 Ga0307406_10074430 Ga0307406_100744302 357
232 3300035083 Ga0373926_0025731 Ga0373926_0025731_845_1975 357
233 3300035111 Ga0373923_0019848 Ga0373923_0019848_340_1470 357
234 3300035113 Ga0373936_0001839 Ga0373936_0001839_2653_3783 357
235 3300035118 Ga0373954_0003396 Ga0373954_0003396_2679_3809 357
236 3300035171 Ga0373946_0003266 Ga0373946_0003266_571_1701 357
237 3300035172 Ga0373955_0000048 Ga0373955_0000048_24015_25145 357
238 3300035410 Ga0373924_0000948 Ga0373924_0000948_6999_8129 357
239 3300035692 Ga0373935_0000082 Ga0373935_0000082_8220_9350 357
240 3300035695 Ga0373927_0036176 Ga0373927_0036176_1167_2297 357
241 3300035724 Ga0373933_0000648 Ga0373933_0000648_15353_16483 357
242 3300035725 Ga0373947_0000300 Ga0373947_0000300_19987_21117 357
243 3300036401 Ga0373937_0000019 Ga0373937_0000019_37191_38321 357
244 3300037068 Ga0373925_0000026 Ga0373925_0000026_85476_86606 357
245 3300044842 Ga0466957_0028116 Ga0466957_0028116_46_1170 357
246 3300046454 Ga0495592_0000017 Ga0495592_0000017_108918_110048 357
247 3300046459 Ga0495629_0023049 Ga0495629_0023049_2236_3366 357
248 3300046462 Ga0495651_0002144 Ga0495651_0002144_1794_2924 357
249 3300046463 Ga0495653_0000033 Ga0495653_0000033_22195_23325 357
250 3300046476 Ga0495662_0012720 Ga0495662_0012720_2066_3196 357
251 3300046477 Ga0495664_0000008 Ga0495664_0000008_85476_86606 357
252 3300046511 Ga0495608_0000014 Ga0495608_0000014_22203_23333 357
253 3300046514 Ga0495618_0000027 Ga0495618_0000027_89190_90320 357
254 3300046516 Ga0495628_0000008 Ga0495628_0000008_85461_86591 357
255 3300046517 Ga0495630_0000293 Ga0495630_0000293_26947_28077 357
256 3300046529 Ga0495652_0000005 Ga0495652_0000005_85476_86606 357
257 3300046533 Ga0495640_0000017 Ga0495640_0000017_100361_101491 357
258 3300046536 Ga0495587_0000005 Ga0495587_0000005_271793_272923 357
259 3300046543 Ga0495645_0000007 Ga0495645_0000007_249939_251069 357
260 3300046559 Ga0495667_0000012 Ga0495667_0000012_197629_198759 357
261 3300046642 Ga0495634_0001489 Ga0495634_0001489_11961_13091 357
262 3300046663 Ga0495635_0000010 Ga0495635_0000010_22229_23359 357
263 3300046675 Ga0495657_0000108 Ga0495657_0000108_22272_23402 357
264 3300046678 Ga0495599_0000015 Ga0495599_0000015_85691_86821 357
265 3300046679 Ga0495623_0000102 Ga0495623_0000102_37509_38639 357
266 3300046680 Ga0495646_0000066 Ga0495646_0000066_37113_38243 357
267 3300046809 Ga0495600_0000128 Ga0495600_0000128_22763_23893 357
268 3300047317 Ga0495604_0000001 Ga0495604_0000001_197630_198760 357
269 3300047319 Ga0495674_0000012 Ga0495674_0000012_232361_233491 357
270 3300047322 Ga0495680_0000409 Ga0495680_0000409_22200_23330 357
271 3300047444 Ga0495675_0000152 Ga0495675_0000152_28747_29877 357
272 3300047471 Ga0495684_0000022 Ga0495684_0000022_52886_54016 357
273 3300047673 Ga0495593_0000416 Ga0495593_0000416_22200_23330 357
274 3300048088 Ga0495602_0000106 Ga0495602_0000106_22232_23362 357
275 3300049586 Ga0501070_0020179 Ga0501070_0020179_1733_2884 357
276 3300053077 Ga0495601_0000011 Ga0495601_0000011_226644_227774 357
277 3300053078 Ga0495612_0000006 Ga0495612_0000006_59118_60248 357
278 3300053084 Ga0495595_0000021 Ga0495595_0000021_92596_93726 357
279 3300053085 Ga0495619_0000013 Ga0495619_0000013_226565_227695 357
280 3300005434 Ga0070709_10124489 Ga0070709_101244892 358
281 3300013105 Ga0157369_10198678 Ga0157369_101986781 358
282 3300025939 Ga0207665_10056485 Ga0207665_100564852 358
283 3300048907 Ga0496104_0165444 Ga0496104_0165444_762_1910 358
284 3300049585 Ga0501069_0121530 Ga0501069_0121530_310_1440 358
285 3300049741 Ga0501079_0168348 Ga0501079_0168348_454_1602 358
286 3300049744 Ga0501083_0175838 Ga0501083_0175838_196_1326 358
287 3300053730 Ga0500645_015328 Ga0500645_015328_1119_2276 358
288 3300005457 Ga0070662_100018911 Ga0070662_1000189113 359
289 3300006175 Ga0070712_100110864 Ga0070712_1001108643 359
290 3300013100 Ga0157373_10082626 Ga0157373_100826262 359
291 3300013105 Ga0157369_10079352 Ga0157369_100793522 359
292 3300025915 Ga0207693_10003028 Ga0207693_100030288 359
293 3300025949 Ga0207667_10138930 Ga0207667_101389302 359
294 3300020082 Ga0206353_11384118 Ga0206353_113841182 360
295 3300025898 Ga0207692_10080675 Ga0207692_100806751 360
296 3300044712 Ga0453684_0043460 Ga0453684_0043460_943_2055 360
297 3300049571 Ga0501034_0000673 Ga0501034_0000673_19367_20491 360
298 3300049580 Ga0501046_0033536 Ga0501046_0033536_1085_2233 360
299 3300049743 Ga0501081_0008438 Ga0501081_0008438_47_1195 360
300 3300005328 Ga0070676_10010063 Ga0070676_100100632 361
301 3300005331 Ga0070670_100166255 Ga0070670_1001662551 361
302 3300005333 Ga0070677_10005640 Ga0070677_100056405 361
303 3300005338 Ga0068868_100146266 Ga0068868_1001462662 361
304 3300005355 Ga0070671_100082676 Ga0070671_1000826761 361
305 3300005367 Ga0070667_100077328 Ga0070667_1000773282 361
306 3300005436 Ga0070713_100073367 Ga0070713_1000733672 361
307 3300005441 Ga0070700_100027109 Ga0070700_1000271094 361
308 3300005456 Ga0070678_100222208 Ga0070678_1002222082 361
309 3300005466 Ga0070685_10009962 Ga0070685_100099624 361
310 3300005543 Ga0070672_100140382 Ga0070672_1001403821 361
311 3300005548 Ga0070665_100213744 Ga0070665_1002137441 361
312 3300005578 Ga0068854_100062008 Ga0068854_1000620082 361
313 3300005614 Ga0068856_100178786 Ga0068856_1001787862 361
314 3300005616 Ga0068852_100029264 Ga0068852_1000292643 361
315 3300005840 Ga0068870_10001753 Ga0068870_100017539 361
316 3300005840 Ga0068870_10038421 Ga0068870_100384212 361
317 3300005937 Ga0081455_10007645 Ga0081455_100076453 361
318 3300005937 Ga0081455_10012417 Ga0081455_100124173 361
319 3300005983 Ga0081540_1001885 Ga0081540_100188521 361
320 3300005983 Ga0081540_1005464 Ga0081540_10054647 361
321 3300005983 Ga0081540_1015277 Ga0081540_10152774 361
322 3300006038 Ga0075365_10093544 Ga0075365_100935441 361
323 3300006237 Ga0097621_100018986 Ga0097621_1000189863 361
324 3300006358 Ga0068871_100147222 Ga0068871_1001472222 361
325 3300006881 Ga0068865_100033444 Ga0068865_1000334442 361
326 3300009101 Ga0105247_10065668 Ga0105247_100656681 361
327 3300009148 Ga0105243_10259563 Ga0105243_102595631 361
328 3300009545 Ga0105237_10071343 Ga0105237_100713434 361
329 3300009551 Ga0105238_10421207 Ga0105238_104212071 361
330 3300013104 Ga0157370_10065203 Ga0157370_100652032 361
331 3300013296 Ga0157374_10162267 Ga0157374_101622671 361
332 3300013306 Ga0163162_10142944 Ga0163162_101429442 361
333 3300014326 Ga0157380_10214378 Ga0157380_102143781 361
334 3300014968 Ga0157379_10269548 Ga0157379_102695482 361
335 3300017792 Ga0163161_10134723 Ga0163161_101347232 361
336 3300025901 Ga0207688_10008282 Ga0207688_100082825 361
337 3300025904 Ga0207647_10080936 Ga0207647_100809362 361
338 3300025908 Ga0207643_10002845 Ga0207643_100028452 361
339 3300025908 Ga0207643_10052085 Ga0207643_100520851 361
340 3300025919 Ga0207657_10209924 Ga0207657_102099241 361
341 3300025920 Ga0207649_10130275 Ga0207649_101302751 361
342 3300025923 Ga0207681_10060801 Ga0207681_100608012 361
343 3300025928 Ga0207700_10137156 Ga0207700_101371562 361
344 3300025932 Ga0207690_10074138 Ga0207690_100741381 361
345 3300025936 Ga0207670_10095621 Ga0207670_100956211 361
346 3300025940 Ga0207691_10000635 Ga0207691_1000063533 361
347 3300025986 Ga0207658_10144316 Ga0207658_101443162 361
348 3300026023 Ga0207677_10091737 Ga0207677_100917372 361
349 3300026067 Ga0207678_10004902 Ga0207678_100049023 361
350 3300026067 Ga0207678_10116443 Ga0207678_101164432 361
351 3300026075 Ga0207708_10021446 Ga0207708_100214463 361
352 3300026089 Ga0207648_10003105 Ga0207648_1000310512 361
353 3300026118 Ga0207675_100004255 Ga0207675_1000042552 361
354 3300026118 Ga0207675_100037571 Ga0207675_1000375712 361
355 3300026121 Ga0207683_10005552 Ga0207683_100055526 361
356 3300026121 Ga0207683_10075094 Ga0207683_100750941 361
357 3300031456 Ga0307513_10004214 Ga0307513_100042149 361
358 3300035398 Ga0316574_0052728 Ga0316574_0052728_967_2094 361
359 3300035692 Ga0373935_0025560 Ga0373935_0025560_2380_3510 361
360 3300035695 Ga0373927_0011241 Ga0373927_0011241_3328_4458 361
361 3300035725 Ga0373947_0007782 Ga0373947_0007782_595_1725 361
362 3300037068 Ga0373925_0053409 Ga0373925_0053409_1645_2775 361
363 3300046500 Ga0495596_0057149 Ga0495596_0057149_253_1383 361
364 3300046525 Ga0495663_0032828 Ga0495663_0032828_202_1332 361
365 3300046539 Ga0495621_0044458 Ga0495621_0044458_38_1168 361
366 3300046615 Ga0495656_0004149 Ga0495656_0004149_3552_4682 361
367 3300046615 Ga0495656_0083611 Ga0495656_0083611_72_1214 361
368 3300046794 Ga0495589_0106703 Ga0495589_0106703_42_1172 361
369 3300046810 Ga0495660_0133453 Ga0495660_0133453_46_1176 361
370 3300047321 Ga0495676_0095966 Ga0495676_0095966_834_1964 361
371 3300048906 Ga0496103_0003062 Ga0496103_0003062_161_1291 361
372 3300048908 Ga0496105_0083764 Ga0496105_0083764_44_1174 361
373 3300048910 Ga0496107_0081728 Ga0496107_0081728_867_1997 361
374 3300048916 Ga0496113_0124354 Ga0496113_0124354_458_1588 361
375 3300048918 Ga0496115_0216662 Ga0496115_0216662_125_1255 361
376 3300048928 Ga0496125_0000571 Ga0496125_0000571_49253_50449 361
377 3300049569 Ga0501032_0218539 Ga0501032_0218539_17_1117 361
378 3300049572 Ga0501036_0108200 Ga0501036_0108200_484_1614 361
379 3300049573 Ga0501037_0010589 Ga0501037_0010589_1128_2258 361
380 3300049575 Ga0501039_0059733 Ga0501039_0059733_505_1635 361
381 3300049581 Ga0501047_0018610 Ga0501047_0018610_1342_2472 361
382 3300049823 Ga0501044_0041060 Ga0501044_0041060_2464_3594 361
383 3300050492 nmdc:mga0yw44_48515_c1 nmdc:mga0yw44_48515_c1_384_1580 361
384 3300053085 Ga0495619_0131254 Ga0495619_0131254_159_1289 361
385 3300005328 Ga0070676_10001953 Ga0070676_100019537 362
386 3300005336 Ga0070680_100024704 Ga0070680_1000247042 362
387 3300005340 Ga0070689_100025998 Ga0070689_1000259982 362
388 3300005340 Ga0070689_100160836 Ga0070689_1001608363 362
389 3300005345 Ga0070692_10088460 Ga0070692_100884602 362
390 3300005354 Ga0070675_100167917 Ga0070675_1001679172 362
391 3300005356 Ga0070674_100203142 Ga0070674_1002031422 362
392 3300005436 Ga0070713_100079583 Ga0070713_1000795832 362
393 3300005445 Ga0070708_100193154 Ga0070708_1001931542 362
394 3300005456 Ga0070678_100015356 Ga0070678_1000153564 362
395 3300005459 Ga0068867_100171361 Ga0068867_1001713612 362
396 3300005471 Ga0070698_100088404 Ga0070698_1000884043 362
397 3300005543 Ga0070672_100005668 Ga0070672_1000056688 362
398 3300005544 Ga0070686_100234247 Ga0070686_1002342471 362
399 3300005718 Ga0068866_10062306 Ga0068866_100623062 362
400 3300005840 Ga0068870_10017075 Ga0068870_100170753 362
401 3300005937 Ga0081455_10002176 Ga0081455_1000217619 362
402 3300005985 Ga0081539_10029288 Ga0081539_100292882 362
403 3300006028 Ga0070717_10015334 Ga0070717_100153342 362
404 3300006844 Ga0075428_100557744 Ga0075428_1005577442 362
405 3300006846 Ga0075430_100043439 Ga0075430_1000434392 362
406 3300006847 Ga0075431_100115208 Ga0075431_1001152082 362
407 3300006871 Ga0075434_100135202 Ga0075434_1001352021 362
408 3300009094 Ga0111539_10054237 Ga0111539_100542374 362
409 3300009098 Ga0105245_10041487 Ga0105245_100414872 362
410 3300009101 Ga0105247_10127813 Ga0105247_101278132 362
411 3300010159 Ga0099796_10004162 Ga0099796_100041622 362
412 3300010375 Ga0105239_10075776 Ga0105239_100757762 362
413 3300013308 Ga0157375_10285577 Ga0157375_102855772 362
414 3300025898 Ga0207692_10001784 Ga0207692_100017845 362
415 3300025900 Ga0207710_10009679 Ga0207710_100096794 362
416 3300025903 Ga0207680_10039585 Ga0207680_100395853 362
417 3300025905 Ga0207685_10008414 Ga0207685_100084141 362
418 3300025907 Ga0207645_10001493 Ga0207645_100014936 362
419 3300025907 Ga0207645_10044302 Ga0207645_100443022 362
420 3300025910 Ga0207684_10002963 Ga0207684_1000296310 362
421 3300025914 Ga0207671_10097478 Ga0207671_100974781 362
422 3300025918 Ga0207662_10078002 Ga0207662_100780021 362
423 3300025927 Ga0207687_10018555 Ga0207687_100185551 362
424 3300025928 Ga0207700_10000624 Ga0207700_100006247 362
425 3300025933 Ga0207706_10002724 Ga0207706_100027246 362
426 3300025940 Ga0207691_10019787 Ga0207691_100197876 362
427 3300025941 Ga0207711_10010975 Ga0207711_100109757 362
428 3300025972 Ga0207668_10008756 Ga0207668_100087563 362
429 3300026067 Ga0207678_10281290 Ga0207678_102812902 362
430 3300026075 Ga0207708_10135482 Ga0207708_101354822 362
431 3300026118 Ga0207675_100018040 Ga0207675_1000180403 362
432 3300027682 Ga0209971_1001682 Ga0209971_10016824 362
433 3300027717 Ga0209998_10003856 Ga0209998_100038562 362
434 3300027907 Ga0207428_10161847 Ga0207428_101618472 362
435 3300031344 Ga0265316_10208272 Ga0265316_102082722 362
436 3300035691 Ga0373931_0007124 Ga0373931_0007124_282_1421 362
437 3300035691 Ga0373931_0017017 Ga0373931_0017017_1965_3092 362
438 3300048903 Ga0496100_0095665 Ga0496100_0095665_581_1708 362
439 3300048905 Ga0496102_0199977 Ga0496102_0199977_698_1864 362
440 3300048905 Ga0496102_0285159 Ga0496102_0285159_149_1315 362
441 3300048907 Ga0496104_0004953 Ga0496104_0004953_2120_3250 362
442 3300048907 Ga0496104_0054703 Ga0496104_0054703_1665_2792 362
443 3300048907 Ga0496104_0096106 Ga0496104_0096106_1024_2151 362
444 3300048908 Ga0496105_0124118 Ga0496105_0124118_581_1708 362
445 3300048910 Ga0496107_0104424 Ga0496107_0104424_698_1864 362
446 3300048911 Ga0496108_0081848 Ga0496108_0081848_1572_2720 362
447 3300048911 Ga0496108_0177656 Ga0496108_0177656_22_1188 362
448 3300048912 Ga0496109_0036343 Ga0496109_0036343_914_2041 362
449 3300048913 Ga0496110_0349695 Ga0496110_0349695_154_1320 362
450 3300048914 Ga0496111_0038213 Ga0496111_0038213_27_1193 362
451 3300048915 Ga0496112_0047161 Ga0496112_0047161_1160_2287 362
452 3300048915 Ga0496112_0191347 Ga0496112_0191347_809_1936 362
453 3300048918 Ga0496115_0091560 Ga0496115_0091560_803_1933 362
454 3300048918 Ga0496115_0103788 Ga0496115_0103788_1140_2306 362
455 3300048918 Ga0496115_0179705 Ga0496115_0179705_109_1275 362
456 3300048918 Ga0496115_0257165 Ga0496115_0257165_27_1193 362
457 3300050508 nmdc:mga09592_254035_c1 nmdc:mga09592_254035_c1_159_1295 362
458 3300050509 nmdc:mga0qj67_216054_c1 nmdc:mga0qj67_216054_c1_20_1156 362
459 3300050510 nmdc:mga06r32_20164_c1 nmdc:mga06r32_20164_c1_4250_5386 362
460 3300053093 Ga0500651_0002657 Ga0500651_0002657_1415_2542 362
461 3300005355 Ga0070671_100228430 Ga0070671_1002284301 363
462 3300005367 Ga0070667_100022657 Ga0070667_1000226573 363
463 3300005459 Ga0068867_100276644 Ga0068867_1002766442 363
464 3300005615 Ga0070702_100050079 Ga0070702_1000500792 363
465 3300005719 Ga0068861_100067893 Ga0068861_1000678932 363
466 3300005841 Ga0068863_100295170 Ga0068863_1002951702 363
467 3300005842 Ga0068858_100197526 Ga0068858_1001975262 363
468 3300006871 Ga0075434_100018589 Ga0075434_1000185897 363
469 3300009177 Ga0105248_10082463 Ga0105248_100824631 363
470 3300013100 Ga0157373_10164410 Ga0157373_101644101 363
471 3300013104 Ga0157370_10193676 Ga0157370_101936762 363
472 3300013105 Ga0157369_10072267 Ga0157369_100722675 363
473 3300025250 Ga0209026_1000593 Ga0209026_10005938 363
474 3300025903 Ga0207680_10149396 Ga0207680_101493962 363
475 3300025913 Ga0207695_10003713 Ga0207695_100037138 363
476 3300025931 Ga0207644_10148743 Ga0207644_101487431 363
477 3300025941 Ga0207711_10025147 Ga0207711_100251477 363
478 3300025986 Ga0207658_10172753 Ga0207658_101727532 363
479 3300025986 Ga0207658_10251670 Ga0207658_102516702 363
480 3300028379 Ga0268266_10108549 Ga0268266_101085492 363
481 3300036401 Ga0373937_0010279 Ga0373937_0010279_2842_3957 363
482 3300036401 Ga0373937_0145522 Ga0373937_0145522_528_1643 363
483 3300046513 Ga0495616_0057738 Ga0495616_0057738_629_1810 363
484 3300046538 Ga0495609_0037221 Ga0495609_0037221_939_2066 363
485 3300046559 Ga0495667_0018967 Ga0495667_0018967_558_1673 363
486 3300046689 Ga0495613_0003307 Ga0495613_0003307_10876_11991 363
487 3300047446 Ga0495679_053673 Ga0495679_053673_21_1163 363
488 3300049571 Ga0501034_0000691 Ga0501034_0000691_115_1233 363
489 3300049742 Ga0501080_0040215 Ga0501080_0040215_50_1168 363
490 3300049744 Ga0501083_0004446 Ga0501083_0004446_712_1830 363
491 3300049823 Ga0501044_0004583 Ga0501044_0004583_465_1583 363
492 3300053131 Ga0500652_005218 Ga0500652_005218_2473_3606 363
493 3300053730 Ga0500645_001447 Ga0500645_001447_5018_6151 363
494 3300005338 Ga0068868_100152640 Ga0068868_1001526402 364
495 3300005340 Ga0070689_100061066 Ga0070689_1000610662 364
496 3300005347 Ga0070668_100045000 Ga0070668_1000450002 364
497 3300005441 Ga0070700_100019743 Ga0070700_1000197434 364
498 3300005544 Ga0070686_100010613 Ga0070686_1000106132 364
499 3300005617 Ga0068859_100072179 Ga0068859_1000721793 364
500 3300005618 Ga0068864_100072905 Ga0068864_1000729055 364
501 3300005719 Ga0068861_100051276 Ga0068861_1000512763 364
502 3300005842 Ga0068858_100064016 Ga0068858_1000640164 364
503 3300005937 Ga0081455_10075820 Ga0081455_100758202 364
504 3300005983 Ga0081540_1013611 Ga0081540_10136116 364
505 3300005983 Ga0081540_1062832 Ga0081540_10628321 364
506 3300006852 Ga0075433_10144914 Ga0075433_101449142 364
507 3300006931 Ga0097620_100072178 Ga0097620_1000721783 364
508 3300007076 Ga0075435_100053678 Ga0075435_1000536784 364
509 3300009147 Ga0114129_10013021 Ga0114129_100130217 364
510 3300009553 Ga0105249_10080966 Ga0105249_100809662 364
511 3300013307 Ga0157372_10059762 Ga0157372_100597623 364
512 3300021377 Ga0213874_10041195 Ga0213874_100411951 364
513 3300025936 Ga0207670_10052371 Ga0207670_100523712 364
514 3300025940 Ga0207691_10054742 Ga0207691_100547423 364
515 3300025961 Ga0207712_10110718 Ga0207712_101107182 364
516 3300026095 Ga0207676_10068521 Ga0207676_100685212 364
517 3300026118 Ga0207675_100002896 Ga0207675_10000289617 364
518 3300028381 Ga0268264_10026006 Ga0268264_100260066 364
519 3300031456 Ga0307513_10005881 Ga0307513_1000588111 364
520 3300039450 Ga0436363_0368824 Ga0436363_0368824_144_1277 364
521 3300046642 Ga0495634_0100384 Ga0495634_0100384_687_1805 364
522 3300046689 Ga0495613_0102743 Ga0495613_0102743_516_1634 364
523 3300047320 Ga0495672_0053783 Ga0495672_0053783_782_1912 364
524 3300047471 Ga0495684_0088582 Ga0495684_0088582_721_1839 364
525 3300050507 nmdc:mga05p37_5194_c1 nmdc:mga05p37_5194_c1_6284_7411 364
526 3300050515 nmdc:mga0a205_106802_c1 nmdc:mga0a205_106802_c1_1196_2323 364
527 3300005340 Ga0070689_100255952 Ga0070689_1002559522 365
528 3300005341 Ga0070691_10080140 Ga0070691_100801402 365
529 3300005347 Ga0070668_100017901 Ga0070668_1000179012 365
530 3300005356 Ga0070674_100125183 Ga0070674_1001251832 365
531 3300005459 Ga0068867_100258307 Ga0068867_1002583072 365
532 3300005718 Ga0068866_10048997 Ga0068866_100489972 365
533 3300014326 Ga0157380_10096818 Ga0157380_100968182 365
534 3300025899 Ga0207642_10026174 Ga0207642_100261742 365
535 3300025935 Ga0207709_10067100 Ga0207709_100671002 365
536 3300025937 Ga0207669_10222114 Ga0207669_102221142 365
537 3300025972 Ga0207668_10050132 Ga0207668_100501322 365
538 3300026035 Ga0207703_10045288 Ga0207703_100452882 365
539 3300026075 Ga0207708_10063119 Ga0207708_100631193 365
540 3300026089 Ga0207648_10250289 Ga0207648_102502892 365
541 3300037466 Ga0395898_0212959 Ga0395898_0212959_308_1420 365
542 3300038443 Ga0395901_0042886 Ga0395901_0042886_2783_3895 365
543 3300045836 Ga0466958_0177500 Ga0466958_0177500_64_1194 365
544 3300046452 Ga0495617_041371 Ga0495617_041371_257_1378 365
545 3300046794 Ga0495589_0057386 Ga0495589_0057386_250_1374 365
546 3300048904 Ga0496101_0034008 Ga0496101_0034008_526_1650 365
547 3300048907 Ga0496104_0041580 Ga0496104_0041580_577_1701 365
548 3300048908 Ga0496105_0070003 Ga0496105_0070003_1393_2517 365
549 3300048910 Ga0496107_0017334 Ga0496107_0017334_593_1717 365
550 3300048911 Ga0496108_0168362 Ga0496108_0168362_88_1212 365
551 3300048912 Ga0496109_0236963 Ga0496109_0236963_250_1374 365
552 3300048918 Ga0496115_0164639 Ga0496115_0164639_224_1348 365
553 3300005331 Ga0070670_100147350 Ga0070670_1001473502 366
554 3300028380 Ga0268265_10011724 Ga0268265_100117244 366
555 3300046524 Ga0495648_0005695 Ga0495648_0005695_4911_6041 366
556 3300053087 Ga0500643_007044 Ga0500643_007044_1296_2429 366
557 3300053088 Ga0500644_0001381 Ga0500644_0001381_1515_2648 366
558 3300053119 Ga0500595_000001 Ga0500595_000001_545406_546539 366
559 iso_pu_bacteria 2595698237 2596372329 366
560 iso_pu_bacteria 2821443989 2821451108 366
561 iso_pu_bacteria 2844533157 2844533178 366
562 iso_pu_bacteria 2928125067 2928126812 366
563 iso_pu_bacteria 3000017691 3000017926 366
564 3300006847 Ga0075431_100113536 Ga0075431_1001135362 367
565 3300021384 Ga0213876_10026126 Ga0213876_100261262 367
566 3300021388 Ga0213875_10011963 Ga0213875_100119633 367
567 3300037853 Ga0436364_0240030 Ga0436364_0240030_411_1520 367
568 3300039437 Ga0436365_0412203 Ga0436365_0412203_999_2108 367
569 3300049742 Ga0501080_0059457 Ga0501080_0059457_62_1171 367
570 3300049744 Ga0501083_0011884 Ga0501083_0011884_4933_6042 367
571 3300053730 Ga0500645_006233 Ga0500645_006233_1286_2395 367
572 3300009093 Ga0105240_10060680 Ga0105240_100606806 368
573 3300009094 Ga0111539_10104338 Ga0111539_101043381 368
574 3300009177 Ga0105248_10000001 Ga0105248_10000001619 368
575 3300025913 Ga0207695_10001397 Ga0207695_100013977 368
576 3300025933 Ga0207706_10143942 Ga0207706_101439422 368
577 3300025941 Ga0207711_10000001 Ga0207711_100000011252 368
578 3300044712 Ga0453684_0014504 Ga0453684_0014504_5628_6770 368
579 3300049578 Ga0501042_0074908 Ga0501042_0074908_872_1987 368
580 3300049592 Ga0501076_0091917 Ga0501076_0091917_546_1661 368
581 3300049742 Ga0501080_0405110 Ga0501080_0405110_18_1133 368
582 3300049743 Ga0501081_0094358 Ga0501081_0094358_718_1833 368
583 3300049824 Ga0501045_0014375 Ga0501045_0014375_2927_4042 368
584 3300050511 nmdc:mga08y16_160593_c1 nmdc:mga08y16_160593_c1_984_2114 368
585 3300061734 Ga0530510_0008912 Ga0530510_0008912_274_1389 368
586 iso_pu_bacteria 2513237096 2513659536 368
587 iso_pu_bacteria 2513237098 2513676348 368
588 iso_pu_bacteria 2513237101 2513695318 368
589 iso_pu_bacteria 2513237137 2513859358 368
590 iso_pu_bacteria 2513237145 2513921531 368
591 iso_pu_bacteria 2517572143 2517889077 368
592 iso_pu_bacteria 2667528175 2671124066 368
593 iso_pu_bacteria 2791355197 2793072684 368
594 iso_pu_bacteria 2874604998 2874607858 368
595 iso_pu_bacteria 2876808645 2876816434 368
596 iso_pu_bacteria 2879110137 2879113278 368
597 iso_pu_bacteria 2885374607 2885377583 368
598 iso_pu_bacteria 2889033259 2889035275 368
599 iso_pu_bacteria 2903748898 2903758770 368
600 iso_pu_bacteria 2903768456 2903770574 368
601 iso_pu_bacteria 2906635258 2906642599 368
602 iso_pu_bacteria 2906660503 2906668081 368
603 iso_pu_bacteria 2908739725 2908747680 368
604 iso_pu_bacteria 2909042592 2909046864 368
605 iso_pu_bacteria 2922361189 2922363239 368
606 iso_pu_bacteria 2922386360 2922388457 368
607 iso_pu_bacteria 2922425934 2922433985 368
608 iso_pu_bacteria 3005474847 3005475301 368
609 iso_pu_bacteria 8006964411 8006967669 368
610 iso_pu_bacteria 8006984368 8006991135 368
611 iso_pu_bacteria 8006994254 8007000468 368
612 iso_pu_bacteria 8019555841 8019562681 368
613 iso_pu_bacteria 8019565922 8019572762 368
614 iso_pu_bacteria 8056673599 8056676174 368
615 iso_pu_bacteria 8056681323 8056682969 368
616 iso_pu_bacteria 8056689827 8056693806 368
617 3300005458 Ga0070681_10130792 Ga0070681_101307922 369
618 3300005539 Ga0068853_100101607 Ga0068853_1001016071 369
619 3300005718 Ga0068866_10103205 Ga0068866_101032051 369
620 3300014968 Ga0157379_10024614 Ga0157379_100246142 369
621 3300025931 Ga0207644_10165578 Ga0207644_101655782 369
622 3300025941 Ga0207711_10222290 Ga0207711_102222901 369
623 3300025942 Ga0207689_10027414 Ga0207689_100274143 369
624 3300031240 Ga0265320_10001731 Ga0265320_1000173111 369
625 3300031251 Ga0265327_10006540 Ga0265327_100065409 369
626 3300031548 Ga0307408_100149457 Ga0307408_1001494572 369
627 3300031595 Ga0265313_10012790 Ga0265313_100127902 369
628 3300031711 Ga0265314_10009986 Ga0265314_100099869 369
629 3300044712 Ga0453684_0041717 Ga0453684_0041717_3494_4606 369
630 3300044712 Ga0453684_0127521 Ga0453684_0127521_525_1637 369
631 3300045051 Ga0451576_0000262 Ga0451576_0000262_98665_99792 369
632 3300048904 Ga0496101_0056627 Ga0496101_0056627_1354_2502 369
633 3300048909 Ga0496106_0017601 Ga0496106_0017601_3620_4768 369
634 3300048910 Ga0496107_0023165 Ga0496107_0023165_3093_4241 369
635 3300049823 Ga0501044_0108404 Ga0501044_0108404_219_1334 369
636 3300049824 Ga0501045_0039946 Ga0501045_0039946_1630_2871 369
637 3300053153 Ga0500616_0000001 Ga0500616_0000001_1442598_1443731 369
638 iso_pu_bacteria 2507262055 2507505475 369
639 iso_pu_bacteria 2508501009 2508539360 369
640 iso_pu_bacteria 2508501042 2508695690 369
641 iso_pu_bacteria 2511231028 2511397798 369
642 iso_pu_bacteria 2513237092 2513623900 369
643 iso_pu_bacteria 2513237094 2513642218 369
644 iso_pu_bacteria 2513237095 2513651308 369
645 iso_pu_bacteria 2513237104 2513718267 369
646 iso_pu_bacteria 2513237139 2513873321 369
647 iso_pu_bacteria 2513237141 2513888554 369
648 iso_pu_bacteria 2513237161 2514014650 369
649 iso_pu_bacteria 2515154112 2515627672 369
650 iso_pu_bacteria 2517093001 2517106251 369
651 iso_pu_bacteria 2524023205 2524441467 369
652 iso_pu_bacteria 2524023210 2524467198 369
653 iso_pu_bacteria 2528768022 2528852705 369
654 iso_pu_bacteria 2602042107 2603858271 369
655 iso_pu_bacteria 2643221651 2644291721 369
656 iso_pu_bacteria 2643221736 2644744163 369
657 iso_pu_bacteria 2744054633 2745077601 369
658 iso_pu_bacteria 2791355196 2793062263 369
659 iso_pu_bacteria 2802429603 2805920669 369
660 iso_pu_bacteria 2816332527 2818237882 369
661 iso_pu_bacteria 2824600985 2824604397 369
662 iso_pu_bacteria 2824609381 2824614873 369
663 iso_pu_bacteria 2824617872 2824624189 369
664 iso_pu_bacteria 2824626560 2824632869 369
665 iso_pu_bacteria 2824635225 2824641392 369
666 iso_pu_bacteria 2824653114 2824656319 369
667 iso_pu_bacteria 2824661429 2824667268 369
668 iso_pu_bacteria 2824671348 2824671777 369
669 iso_pu_bacteria 2824679649 2824684713 369
670 iso_pu_bacteria 2824687955 2824688541 369
671 iso_pu_bacteria 2824704595 2824710341 369
672 iso_pu_bacteria 2824714736 2824718454 369
673 iso_pu_bacteria 2824723954 2824728839 369
674 iso_pu_bacteria 2824732956 2824737643 369
675 iso_pu_bacteria 2824746037 2824751165 369
676 iso_pu_bacteria 2824753945 2824760677 369
677 iso_pu_bacteria 2824763712 2824768481 369
678 iso_pu_bacteria 2824773399 2824779967 369
679 iso_pu_bacteria 2838122688 2838124725 369
680 iso_pu_bacteria 2841760612 2841765398 369
681 iso_pu_bacteria 2841911363 2841914506 369
682 iso_pu_bacteria 2841917233 2841920329 369
683 iso_pu_bacteria 2841941048 2841945416 369
684 iso_pu_bacteria 2841949485 2841952203 369
685 iso_pu_bacteria 2841957949 2841965320 369
686 iso_pu_bacteria 2841966195 2841970407 369
687 iso_pu_bacteria 2841974524 2841981659 369
688 iso_pu_bacteria 2841983080 2841984939 369
689 iso_pu_bacteria 2842038055 2842043292 369
690 iso_pu_bacteria 2842045827 2842052718 369
691 iso_pu_bacteria 2844104063 2844107008 369
692 iso_pu_bacteria 2844315083 2844315572 369
693 iso_pu_bacteria 2847930680 2847931274 369
694 iso_pu_bacteria 2847939898 2847942367 369
695 iso_pu_bacteria 2849076700 2849083239 369
696 iso_pu_bacteria 2851182111 2851185992 369
697 iso_pu_bacteria 2851246043 2851249048 369
698 iso_pu_bacteria 2857509624 2857516326 369
699 iso_pu_bacteria 2857524615 2857527689 369
700 iso_pu_bacteria 2874590934 2874592522 369
701 iso_pu_bacteria 2874612657 2874618670 369
702 iso_pu_bacteria 2874620515 2874621176 369
703 iso_pu_bacteria 2874628541 2874628576 369
704 iso_pu_bacteria 2874645413 2874647141 369
705 iso_pu_bacteria 2876761206 2876769669 369
706 iso_pu_bacteria 2876771140 2876772525 369
707 iso_pu_bacteria 2876818435 2876819786 369
708 iso_pu_bacteria 2879074833 2879076292 369
709 iso_pu_bacteria 2879083081 2879083796 369
710 iso_pu_bacteria 2879099564 2879101964 369
711 iso_pu_bacteria 2879127579 2879128776 369
712 iso_pu_bacteria 2879142872 2879142904 369
713 iso_pu_bacteria 2881364244 2881368953 369
714 iso_pu_bacteria 2881665667 2881672934 369
715 iso_pu_bacteria 2888378607 2888379375 369
716 iso_pu_bacteria 2888388044 2888390474 369
717 iso_pu_bacteria 2888419890 2888420096 369
718 iso_pu_bacteria 2893066018 2893067122 369
719 iso_pu_bacteria 2903727486 2903733519 369
720 iso_pu_bacteria 2904666416 2904667721 369
721 iso_pu_bacteria 2904711408 2904716303 369
722 iso_pu_bacteria 2906602504 2906608873 369
723 iso_pu_bacteria 2906626472 2906631701 369
724 iso_pu_bacteria 2906643746 2906648363 369
725 iso_pu_bacteria 2908775508 2908775975 369
726 iso_pu_bacteria 2919073203 2919073550 369
727 iso_pu_bacteria 2922368715 2922369355 369
728 iso_pu_bacteria 2922393267 2922396554 369
729 iso_pu_bacteria 2929615660 2929618813 369
730 iso_pu_bacteria 2929624759 2929628502 369
731 iso_pu_bacteria 2932784394 2932790993 369
732 iso_pu_bacteria 2932794094 2932794116 369
733 iso_pu_bacteria 2932801729 2932809191 369
734 iso_pu_bacteria 2932809354 2932816229 369
735 iso_pu_bacteria 2932818245 2932827636 369
736 iso_pu_bacteria 2932828146 2932833709 369
737 iso_pu_bacteria 2933577622 2933580477 369
738 iso_pu_bacteria 2935608549 2935615494 369
739 iso_pu_bacteria 2935616580 2935623235 369
740 iso_pu_bacteria 2935638405 2935644310 369
741 iso_pu_bacteria 2935648319 2935654423 369
742 iso_pu_bacteria 2935656913 2935663303 369
743 iso_pu_bacteria 2935665750 2935672108 369
744 iso_pu_bacteria 2935675223 2935679370 369
745 iso_pu_bacteria 2935684952 2935686612 369
746 iso_pu_bacteria 2935694250 2935700395 369
747 iso_pu_bacteria 2935703347 2935710343 369
748 iso_pu_bacteria 2935713505 2935716300 369
749 iso_pu_bacteria 2935722832 2935723576 369
750 iso_pu_bacteria 2935732158 2935735131 369
751 iso_pu_bacteria 2935741537 2935744078 369
752 iso_pu_bacteria 2935750917 2935752578 369
753 iso_pu_bacteria 2935760218 2935763287 369
754 iso_pu_bacteria 2935769743 2935774261 369
755 iso_pu_bacteria 2935777560 2935785129 369
756 iso_pu_bacteria 2935785616 2935789024 369
757 iso_pu_bacteria 2935793552 2935796774 369
758 iso_pu_bacteria 2935801545 2935808334 369
759 iso_pu_bacteria 2935810662 2935816053 369
760 iso_pu_bacteria 2935819856 2935825705 369
761 iso_pu_bacteria 2935827899 2935833446 369
762 iso_pu_bacteria 2935837841 2935845996 369
763 iso_pu_bacteria 2935847175 2935853469 369
764 iso_pu_bacteria 2935855204 2935861483 369
765 iso_pu_bacteria 2935864058 2935869602 369
766 iso_pu_bacteria 2935873716 2935879931 369
767 iso_pu_bacteria 2935883170 2935889143 369
768 iso_pu_bacteria 2935908558 2935915070 369
769 iso_pu_bacteria 2935916978 2935918918 369
770 iso_pu_bacteria 2935926038 2935931365 369
771 iso_pu_bacteria 2935934488 2935939962 369
772 iso_pu_bacteria 2935942939 2935947691 369
773 iso_pu_bacteria 2935951376 2935956462 369
774 iso_pu_bacteria 2935959822 2935966691 369
775 iso_pu_bacteria 2935967501 2935973256 369
776 iso_pu_bacteria 2935975950 2935980499 369
777 iso_pu_bacteria 2935984226 2935990150 369
778 iso_pu_bacteria 2935992306 2935997846 369
779 iso_pu_bacteria 2936002035 2936008889 369
780 iso_pu_bacteria 2936011229 2936017538 369
781 iso_pu_bacteria 2936019824 2936025961 369
782 iso_pu_bacteria 2936028420 2936034803 369
783 iso_pu_bacteria 2936037263 2936041059 369
784 iso_pu_bacteria 2936046547 2936052939 369
785 iso_pu_bacteria 2936055302 2936060202 369
786 iso_pu_bacteria 2940556831 2940558491 369
787 iso_pu_bacteria 2941531003 2941535317 369
788 iso_pu_bacteria 2941538514 2941547165 369
789 iso_pu_bacteria 3002141150 3002141495 369
790 iso_pu_bacteria 3005483717 3005486646 369
791 iso_pu_bacteria 3005506211 3005508952 369
792 iso_pu_bacteria 3005594810 3005595262 369
793 iso_pu_bacteria 3005710791 3005711209 369
794 iso_pu_bacteria 3005718088 3005718510 369
795 iso_pu_bacteria 8006926726 8006927276 369
796 iso_pu_bacteria 8016511872 8016517961 369
797 iso_pu_bacteria 8016522445 8016526356 369
798 iso_pu_bacteria 8016530956 8016531422 369
799 iso_pu_bacteria 8016548790 8016557443 369
800 iso_pu_bacteria 8016557553 8016565798 369
801 iso_pu_bacteria 8016566248 8016569689 369
802 iso_pu_bacteria 8016575299 8016582295 369
803 iso_pu_bacteria 8016583857 8016586117 369
804 iso_pu_bacteria 8016595262 8016603401 369
805 iso_pu_bacteria 8016603502 8016606332 369
806 iso_pu_bacteria 8016613128 8016618241 369
807 iso_pu_bacteria 8016630954 8016635397 369
808 iso_pu_bacteria 8017057580 8017058677 369
809 iso_pu_bacteria 8019530166 8019531253 369
810 iso_pu_bacteria 8019538911 8019540299 369
811 iso_pu_bacteria 8019547302 8019549890 369
812 iso_pu_bacteria 8019576017 8019576981 369
813 iso_pu_bacteria 8019597564 8019606700 369
814 iso_pu_bacteria 8019608314 8019611811 369
815 iso_pu_bacteria 8019619141 8019623192 369
816 iso_pu_bacteria 8019629233 8019629906 369
817 iso_pu_bacteria 8019648815 8019652253 369
818 iso_pu_bacteria 8019668869 8019676504 369
819 iso_pu_bacteria 8019678201 8019679490 369
820 iso_pu_bacteria 8019687851 8019696022 369
821 iso_pu_bacteria 8055742211 8055742662 369
822 iso_pu_bacteria 8056967851 8056971520 369
823 3300003187 JGI25151J46595_10000179 JGI25151J46595_1000017962 370
824 3300003187 JGI25151J46595_10000468 JGI25151J46595_1000046836 370
825 3300003354 JGI25160J50197_1009863 JGI25160J50197_10098634 370
826 3300005354 Ga0070675_100119686 Ga0070675_1001196863 370
827 3300005364 Ga0070673_100208744 Ga0070673_1002087441 370
828 3300005539 Ga0068853_100041517 Ga0068853_1000415174 370
829 3300010375 Ga0105239_10054385 Ga0105239_100543852 370
830 3300025284 Ga0209130_1000674 Ga0209130_100067417 370
831 3300025294 Ga0209025_1000251 Ga0209025_100025162 370
832 3300025302 Ga0207426_1000179 Ga0207426_100017934 370
833 3300025923 Ga0207681_10212866 Ga0207681_102128662 370
834 3300025933 Ga0207706_10111140 Ga0207706_101111402 370
835 3300025937 Ga0207669_10111479 Ga0207669_101114792 370
836 3300026041 Ga0207639_10299060 Ga0207639_102990601 370
837 3300031235 Ga0265330_10062043 Ga0265330_100620432 370
838 3300037471 Ga0395905_0019136 Ga0395905_0019136_5345_6481 370
839 3300039438 Ga0436360_0653946 Ga0436360_0653946_2677_3792 370
840 3300046512 Ga0495610_0012701 Ga0495610_0012701_3382_4497 370
841 3300047447 Ga0495685_030482 Ga0495685_030482_54_1181 370
842 iso_pu_bacteria 2842694124 2842697695 370
843 iso_pu_bacteria 2842698319 2842699844 370
844 iso_pu_bacteria 2885366525 2885369310 370
845 iso_pu_bacteria 2891088606 2891088918 370
846 iso_pu_bacteria 2894652903 2894653918 370
847 iso_pu_bacteria 641228493 641337128 370
848 iso_pu_bacteria 643348555 643392698 370
849 3300005331 Ga0070670_100143475 Ga0070670_1001434752 371
850 3300005338 Ga0068868_100034093 Ga0068868_1000340932 371
851 3300005340 Ga0070689_100010100 Ga0070689_1000101006 371
852 3300005343 Ga0070687_100087832 Ga0070687_1000878322 371
853 3300005355 Ga0070671_100038982 Ga0070671_1000389822 371
854 3300005355 Ga0070671_100220786 Ga0070671_1002207861 371
855 3300005356 Ga0070674_100045667 Ga0070674_1000456673 371
856 3300005841 Ga0068863_100196591 Ga0068863_1001965912 371
857 3300005985 Ga0081539_10089402 Ga0081539_100894022 371
858 3300006844 Ga0075428_100051389 Ga0075428_1000513892 371
859 3300006844 Ga0075428_100208906 Ga0075428_1002089062 371
860 3300006846 Ga0075430_100007343 Ga0075430_1000073432 371
861 3300009094 Ga0111539_10091494 Ga0111539_100914943 371
862 3300009094 Ga0111539_10129729 Ga0111539_101297293 371
863 3300009094 Ga0111539_10357512 Ga0111539_103575122 371
864 3300009094 Ga0111539_10460877 Ga0111539_104608772 371
865 3300009098 Ga0105245_10078453 Ga0105245_100784532 371
866 3300009101 Ga0105247_10195051 Ga0105247_101950511 371
867 3300009147 Ga0114129_10005614 Ga0114129_100056147 371
868 3300009177 Ga0105248_10140733 Ga0105248_101407332 371
869 3300011119 Ga0105246_10078268 Ga0105246_100782682 371
870 3300013296 Ga0157374_10098729 Ga0157374_100987293 371
871 3300014325 Ga0163163_10013748 Ga0163163_100137488 371
872 3300014969 Ga0157376_10005383 Ga0157376_100053838 371
873 3300025893 Ga0207682_10002832 Ga0207682_100028326 371
874 3300025900 Ga0207710_10044171 Ga0207710_100441712 371
875 3300025918 Ga0207662_10019432 Ga0207662_100194323 371
876 3300025918 Ga0207662_10030209 Ga0207662_100302093 371
877 3300025923 Ga0207681_10292679 Ga0207681_102926792 371
878 3300025925 Ga0207650_10089791 Ga0207650_100897912 371
879 3300025931 Ga0207644_10203575 Ga0207644_102035751 371
880 3300025940 Ga0207691_10011532 Ga0207691_100115327 371
881 3300026088 Ga0207641_10100124 Ga0207641_101001242 371
882 3300026116 Ga0207674_10011817 Ga0207674_100118177 371
883 3300026121 Ga0207683_10000508 Ga0207683_1000050811 371
884 3300026121 Ga0207683_10165236 Ga0207683_101652362 371
885 3300027907 Ga0207428_10026953 Ga0207428_100269533 371
886 3300028380 Ga0268265_10150950 Ga0268265_101509501 371
887 3300028381 Ga0268264_10078841 Ga0268264_100788412 371
888 3300031728 Ga0316578_10005376 Ga0316578_100053762 371
889 3300035398 Ga0316574_0000122 Ga0316574_0000122_15040_16167 371
890 3300036712 Ga0316584_0081383 Ga0316584_0081383_407_1534 371
891 3300041408 Ga0439453_0002904 Ga0439453_0002904_19_1143 371
892 3300042436 Ga0439435_0007011 Ga0439435_0007011_495_1619 371
893 3300042876 Ga0451577_0103345 Ga0451577_0103345_1122_2240 371
894 3300044712 Ga0453684_0000204 Ga0453684_0000204_114279_115397 371
895 3300044712 Ga0453684_0000395 Ga0453684_0000395_36743_37861 371
896 3300046615 Ga0495656_0035292 Ga0495656_0035292_774_1904 371
897 3300047472 Ga0495686_0000074 Ga0495686_0000074_16257_17396 371
898 3300048904 Ga0496101_0007045 Ga0496101_0007045_1579_2727 371
899 3300048913 Ga0496110_0173862 Ga0496110_0173862_316_1464 371
900 3300049578 Ga0501042_0295126 Ga0501042_0295126_16_1140 371
901 3300049586 Ga0501070_0009555 Ga0501070_0009555_1616_2731 371
902 3300049587 Ga0501071_0094674 Ga0501071_0094674_818_1942 371
903 3300049588 Ga0501072_0090281 Ga0501072_0090281_77_1201 371
904 3300049743 Ga0501081_0056279 Ga0501081_0056279_1263_2387 371
905 3300050507 nmdc:mga05p37_255770_c1 nmdc:mga05p37_255770_c1_708_1838 371
906 3300050508 nmdc:mga09592_121543_c1 nmdc:mga09592_121543_c1_262_1392 371
907 3300050508 nmdc:mga09592_79985_c1 nmdc:mga09592_79985_c1_97_1227 371
908 3300050510 nmdc:mga06r32_1204_c2 nmdc:mga06r32_1204_c2_6940_8070 371
909 3300050511 nmdc:mga08y16_4195_c1 nmdc:mga08y16_4195_c1_1112_2233 371
910 3300060353 Ga0501082_0000874 Ga0501082_0000874_13499_14629 371
911 3300060353 Ga0501082_0119887 Ga0501082_0119887_82_1206 371
912 iso_pu_bacteria 2508501128 2509152205 371
913 3300003187 JGI25151J46595_10000036 JGI25151J46595_1000003687 372
914 3300003752 Ga0055539_1002704 Ga0055539_10027042 372
915 3300003771 Ga0055526_1002133 Ga0055526_10021339 372
916 3300003775 Ga0055524_1000065 Ga0055524_100006551 372
917 3300005262 Ga0065165_1000014 Ga0065165_100001433 372
918 3300005327 Ga0070658_10112197 Ga0070658_101121972 372
919 3300005339 Ga0070660_100010072 Ga0070660_1000100723 372
920 3300005339 Ga0070660_100030527 Ga0070660_1000305273 372
921 3300005341 Ga0070691_10000745 Ga0070691_100007453 372
922 3300005341 Ga0070691_10008387 Ga0070691_100083873 372
923 3300005347 Ga0070668_100109052 Ga0070668_1001090522 372
924 3300005347 Ga0070668_100161129 Ga0070668_1001611292 372
925 3300005366 Ga0070659_100134842 Ga0070659_1001348421 372
926 3300005366 Ga0070659_100158758 Ga0070659_1001587582 372
927 3300005366 Ga0070659_100162100 Ga0070659_1001621002 372
928 3300005434 Ga0070709_10000164 Ga0070709_1000016427 372
929 3300005434 Ga0070709_10033577 Ga0070709_100335773 372
930 3300005435 Ga0070714_100001570 Ga0070714_1000015703 372
931 3300005436 Ga0070713_100006415 Ga0070713_1000064157 372
932 3300005436 Ga0070713_100051782 Ga0070713_1000517823 372
933 3300005436 Ga0070713_100171161 Ga0070713_1001711611 372
934 3300005437 Ga0070710_10001859 Ga0070710_100018596 372
935 3300005437 Ga0070710_10023219 Ga0070710_100232192 372
936 3300005439 Ga0070711_100019796 Ga0070711_1000197963 372
937 3300005455 Ga0070663_100087612 Ga0070663_1000876122 372
938 3300005456 Ga0070678_100112431 Ga0070678_1001124312 372
939 3300005458 Ga0070681_10219118 Ga0070681_102191182 372
940 3300005468 Ga0070707_100014318 Ga0070707_1000143186 372
941 3300005471 Ga0070698_100089301 Ga0070698_1000893012 372
942 3300005535 Ga0070684_100017501 Ga0070684_1000175012 372
943 3300005539 Ga0068853_100010595 Ga0068853_1000105954 372
944 3300005547 Ga0070693_100171269 Ga0070693_1001712691 372
945 3300005548 Ga0070665_100007488 Ga0070665_10000748812 372
946 3300005548 Ga0070665_100076306 Ga0070665_1000763062 372
947 3300005563 Ga0068855_100020322 Ga0068855_10002032210 372
948 3300005563 Ga0068855_100255072 Ga0068855_1002550722 372
949 3300005563 Ga0068855_100378976 Ga0068855_1003789762 372
950 3300005577 Ga0068857_100012785 Ga0068857_1000127856 372
951 3300005614 Ga0068856_100080598 Ga0068856_1000805983 372
952 3300005616 Ga0068852_100227350 Ga0068852_1002273501 372
953 3300005834 Ga0068851_10109628 Ga0068851_101096281 372
954 3300005844 Ga0068862_100130702 Ga0068862_1001307021 372
955 3300005844 Ga0068862_100191272 Ga0068862_1001912721 372
956 3300005937 Ga0081455_10006012 Ga0081455_100060124 372
957 3300005937 Ga0081455_10064904 Ga0081455_100649042 372
958 3300005981 Ga0081538_10068962 Ga0081538_100689622 372
959 3300005983 Ga0081540_1008955 Ga0081540_10089556 372
960 3300005983 Ga0081540_1011835 Ga0081540_10118352 372
961 3300005983 Ga0081540_1035595 Ga0081540_10355952 372
962 3300006038 Ga0075365_10004545 Ga0075365_100045455 372
963 3300006038 Ga0075365_10087140 Ga0075365_100871402 372
964 3300006038 Ga0075365_10110215 Ga0075365_101102152 372
965 3300006048 Ga0075363_100002635 Ga0075363_1000026355 372
966 3300006051 Ga0075364_10038602 Ga0075364_100386023 372
967 3300006175 Ga0070712_100002575 Ga0070712_1000025757 372
968 3300006175 Ga0070712_100014212 Ga0070712_1000142125 372
969 3300006177 Ga0075362_10010498 Ga0075362_100104982 372
970 3300006178 Ga0075367_10109380 Ga0075367_101093801 372
971 3300006178 Ga0075367_10135857 Ga0075367_101358572 372
972 3300006186 Ga0075369_10034267 Ga0075369_100342672 372
973 3300006353 Ga0075370_10070679 Ga0075370_100706792 372
974 3300006353 Ga0075370_10073066 Ga0075370_100730662 372
975 3300006943 Ga0099822_1005813 Ga0099822_100581312 372
976 3300007788 Ga0099795_10069255 Ga0099795_100692551 372
977 3300009093 Ga0105240_10041859 Ga0105240_100418596 372
978 3300009093 Ga0105240_10099632 Ga0105240_100996322 372
979 3300009094 Ga0111539_10041681 Ga0111539_100416814 372
980 3300009545 Ga0105237_10009423 Ga0105237_100094233 372
981 3300009545 Ga0105237_10046675 Ga0105237_100466752 372
982 3300009545 Ga0105237_10081560 Ga0105237_100815603 372
983 3300009545 Ga0105237_10126308 Ga0105237_101263082 372
984 3300009551 Ga0105238_10011779 Ga0105238_1001177914 372
985 3300009551 Ga0105238_10040832 Ga0105238_100408324 372
986 3300009551 Ga0105238_10067394 Ga0105238_100673944 372
987 3300009551 Ga0105238_10348881 Ga0105238_103488811 372
988 3300010375 Ga0105239_10010622 Ga0105239_100106227 372
989 3300010375 Ga0105239_10210541 Ga0105239_102105412 372
990 3300013104 Ga0157370_10015393 Ga0157370_100153932 372
991 3300013104 Ga0157370_10067696 Ga0157370_100676963 372
992 3300013105 Ga0157369_10026404 Ga0157369_100264044 372
993 3300013105 Ga0157369_10027398 Ga0157369_100273983 372
994 3300013297 Ga0157378_10002715 Ga0157378_100027156 372
995 3300013307 Ga0157372_10085902 Ga0157372_100859022 372
996 3300014968 Ga0157379_10218160 Ga0157379_102181602 372
997 3300017792 Ga0163161_10069933 Ga0163161_100699332 372
998 3300025253 Ga0209677_100521 Ga0209677_10052114 372
999 3300025261 Ga0209233_1006627 Ga0209233_10066273 372
1000 3300025272 Ga0209455_1004449 Ga0209455_10044493 372
1001 3300025284 Ga0209130_1000024 Ga0209130_1000024240 372
1002 3300025291 Ga0209675_1000802 Ga0209675_100080211 372
1003 3300025294 Ga0209025_1000017 Ga0209025_1000017265 372
1004 3300025294 Ga0209025_1001580 Ga0209025_100158022 372
1005 3300025295 Ga0209564_1000059 Ga0209564_1000059257 372
1006 3300025297 Ga0209758_1001512 Ga0209758_100151226 372
1007 3300025299 Ga0209256_1000033 Ga0209256_100003371 372
1008 3300025299 Ga0209256_1001214 Ga0209256_10012147 372
1009 3300025302 Ga0207426_1012062 Ga0207426_10120622 372
1010 3300025898 Ga0207692_10001084 Ga0207692_100010846 372
1011 3300025898 Ga0207692_10035203 Ga0207692_100352032 372
1012 3300025906 Ga0207699_10000184 Ga0207699_1000018423 372
1013 3300025906 Ga0207699_10147278 Ga0207699_101472782 372
1014 3300025907 Ga0207645_10107031 Ga0207645_101070311 372
1015 3300025909 Ga0207705_10000058 Ga0207705_10000058122 372
1016 3300025911 Ga0207654_10020990 Ga0207654_100209903 372
1017 3300025912 Ga0207707_10001851 Ga0207707_1000185116 372
1018 3300025912 Ga0207707_10022207 Ga0207707_100222072 372
1019 3300025912 Ga0207707_10132738 Ga0207707_101327381 372
1020 3300025913 Ga0207695_10043618 Ga0207695_100436185 372
1021 3300025914 Ga0207671_10084216 Ga0207671_100842163 372
1022 3300025914 Ga0207671_10115669 Ga0207671_101156692 372
1023 3300025914 Ga0207671_10271812 Ga0207671_102718122 372
1024 3300025915 Ga0207693_10000145 Ga0207693_1000014530 372
1025 3300025915 Ga0207693_10004934 Ga0207693_100049347 372
1026 3300025916 Ga0207663_10000680 Ga0207663_100006808 372
1027 3300025917 Ga0207660_10003913 Ga0207660_1000391316 372
1028 3300025917 Ga0207660_10011491 Ga0207660_100114916 372
1029 3300025917 Ga0207660_10015835 Ga0207660_100158355 372
1030 3300025917 Ga0207660_10258830 Ga0207660_102588302 372
1031 3300025919 Ga0207657_10001163 Ga0207657_1000116324 372
1032 3300025919 Ga0207657_10009304 Ga0207657_100093043 372
1033 3300025919 Ga0207657_10143477 Ga0207657_101434772 372
1034 3300025921 Ga0207652_10001515 Ga0207652_1000151519 372
1035 3300025921 Ga0207652_10002661 Ga0207652_100026615 372
1036 3300025922 Ga0207646_10024856 Ga0207646_100248562 372
1037 3300025927 Ga0207687_10078224 Ga0207687_100782241 372
1038 3300025928 Ga0207700_10012229 Ga0207700_100122294 372
1039 3300025928 Ga0207700_10104336 Ga0207700_101043362 372
1040 3300025929 Ga0207664_10003622 Ga0207664_100036226 372
1041 3300025929 Ga0207664_10039619 Ga0207664_100396192 372
1042 3300025929 Ga0207664_10040782 Ga0207664_100407822 372
1043 3300025938 Ga0207704_10198173 Ga0207704_101981732 372
1044 3300025939 Ga0207665_10007064 Ga0207665_100070647 372
1045 3300025939 Ga0207665_10107349 Ga0207665_101073491 372
1046 3300025949 Ga0207667_10001909 Ga0207667_1000190914 372
1047 3300026023 Ga0207677_10027080 Ga0207677_100270802 372
1048 3300026035 Ga0207703_10134040 Ga0207703_101340402 372
1049 3300026041 Ga0207639_10002676 Ga0207639_100026763 372
1050 3300026067 Ga0207678_10085415 Ga0207678_100854152 372
1051 3300026078 Ga0207702_10100264 Ga0207702_101002642 372
1052 3300026116 Ga0207674_10028047 Ga0207674_100280474 372
1053 3300026118 Ga0207675_100137497 Ga0207675_1001374972 372
1054 3300026118 Ga0207675_100241184 Ga0207675_1002411842 372
1055 3300026142 Ga0207698_10048658 Ga0207698_100486582 372
1056 3300027907 Ga0207428_10128862 Ga0207428_101288622 372
1057 3300028379 Ga0268266_10001335 Ga0268266_1000133513 372
1058 3300028379 Ga0268266_10403375 Ga0268266_104033751 372
1059 3300028380 Ga0268265_10216904 Ga0268265_102169042 372
1060 3300028380 Ga0268265_10262041 Ga0268265_102620412 372
1061 3300028381 Ga0268264_10167255 Ga0268264_101672552 372
1062 3300028556 Ga0265337_1003137 Ga0265337_10031377 372
1063 3300028573 Ga0265334_10004740 Ga0265334_100047401 372
1064 3300028653 Ga0265323_10008710 Ga0265323_100087104 372
1065 3300028666 Ga0265336_10002305 Ga0265336_100023051 372
1066 3300028786 Ga0307517_10000232 Ga0307517_1000023250 372
1067 3300028800 Ga0265338_10000422 Ga0265338_1000042243 372
1068 3300028800 Ga0265338_10032504 Ga0265338_100325042 372
1069 3300031247 Ga0265340_10034346 Ga0265340_100343462 372
1070 3300031249 Ga0265339_10000681 Ga0265339_100006817 372
1071 3300031249 Ga0265339_10018260 Ga0265339_100182603 372
1072 3300031250 Ga0265331_10002855 Ga0265331_1000285510 372
1073 3300031344 Ga0265316_10126192 Ga0265316_101261922 372
1074 3300031456 Ga0307513_10157344 Ga0307513_101573441 372
1075 3300031616 Ga0307508_10135710 Ga0307508_101357102 372
1076 3300031711 Ga0265314_10035859 Ga0265314_100358592 372
1077 3300031730 Ga0307516_10011325 Ga0307516_100113256 372
1078 3300031730 Ga0307516_10031924 Ga0307516_100319244 372
1079 3300031731 Ga0307405_10028606 Ga0307405_100286062 372
1080 3300031901 Ga0307406_10040577 Ga0307406_100405772 372
1081 3300031995 Ga0307409_100215543 Ga0307409_1002155432 372
1082 3300032002 Ga0307416_100129115 Ga0307416_1001291152 372
1083 3300033179 Ga0307507_10025987 Ga0307507_100259873 372
1084 3300033180 Ga0307510_10019009 Ga0307510_100190097 372
1085 3300033442 Ga0315911_1000008 Ga0315911_100000871 372
1086 3300035117 Ga0373953_0063581 Ga0373953_0063581_254_1378 372
1087 3300035118 Ga0373954_0021219 Ga0373954_0021219_1365_2507 372
1088 3300035172 Ga0373955_0000923 Ga0373955_0000923_325_1449 372
1089 3300035172 Ga0373955_0045874 Ga0373955_0045874_1062_2204 372
1090 3300035410 Ga0373924_0001998 Ga0373924_0001998_1688_2812 372
1091 3300035410 Ga0373924_0025997 Ga0373924_0025997_497_1639 372
1092 3300035692 Ga0373935_0000595 Ga0373935_0000595_15006_16148 372
1093 3300035692 Ga0373935_0004033 Ga0373935_0004033_1688_2812 372
1094 3300035695 Ga0373927_0001021 Ga0373927_0001021_14880_16022 372
1095 3300035695 Ga0373927_0014348 Ga0373927_0014348_181_1323 372
1096 3300035695 Ga0373927_0021207 Ga0373927_0021207_2121_3263 372
1097 3300035695 Ga0373927_0044643 Ga0373927_0044643_1469_2596 372
1098 3300035724 Ga0373933_0000829 Ga0373933_0000829_11212_12336 372
1099 3300035725 Ga0373947_0000970 Ga0373947_0000970_2059_3201 372
1100 3300035725 Ga0373947_0005649 Ga0373947_0005649_4708_5832 372
1101 3300036401 Ga0373937_0001573 Ga0373937_0001573_12037_13161 372
1102 3300036401 Ga0373937_0009750 Ga0373937_0009750_5359_6486 372
1103 3300036401 Ga0373937_0017495 Ga0373937_0017495_3583_4725 372
1104 3300036712 Ga0316584_0094744 Ga0316584_0094744_189_1328 372
1105 3300037068 Ga0373925_0006983 Ga0373925_0006983_1957_3099 372
1106 3300037068 Ga0373925_0113904 Ga0373925_0113904_452_1579 372
1107 3300037068 Ga0373925_0208595 Ga0373925_0208595_247_1389 372
1108 3300037853 Ga0436364_0602403 Ga0436364_0602403_142_1266 372
1109 3300037853 Ga0436364_0846969 Ga0436364_0846969_223_1362 372
1110 3300037853 Ga0436364_1399361 Ga0436364_1399361_808_1932 372
1111 3300038742 Ga0400486_27145 Ga0400486_27145_33_1154 372
1112 3300039437 Ga0436365_0016645 Ga0436365_0016645_1820_2944 372
1113 3300039437 Ga0436365_0431929 Ga0436365_0431929_33_1160 372
1114 3300039453 Ga0436362_0744510 Ga0436362_0744510_880_2025 372
1115 3300044694 Ga0466963_0027881 Ga0466963_0027881_984_2129 372
1116 3300044842 Ga0466957_0110355 Ga0466957_0110355_305_1561 372
1117 3300044842 Ga0466957_0118750 Ga0466957_0118750_84_1226 372
1118 3300045049 Ga0466959_0059425 Ga0466959_0059425_165_1307 372
1119 3300045049 Ga0466959_0148136 Ga0466959_0148136_105_1247 372
1120 3300046454 Ga0495592_0011460 Ga0495592_0011460_1774_2898 372
1121 3300046454 Ga0495592_0013035 Ga0495592_0013035_5049_6191 372
1122 3300046455 Ga0495603_0005449 Ga0495603_0005449_1100_2242 372
1123 3300046455 Ga0495603_0007853 Ga0495603_0007853_2450_3592 372
1124 3300046455 Ga0495603_0009344 Ga0495603_0009344_268_1410 372
1125 3300046455 Ga0495603_0127133 Ga0495603_0127133_59_1201 372
1126 3300046459 Ga0495629_0000915 Ga0495629_0000915_7518_8660 372
1127 3300046460 Ga0495638_0112047 Ga0495638_0112047_396_1538 372
1128 3300046461 Ga0495641_0005677 Ga0495641_0005677_2112_3254 372
1129 3300046462 Ga0495651_0001344 Ga0495651_0001344_6111_7235 372
1130 3300046463 Ga0495653_0001729 Ga0495653_0001729_11353_12477 372
1131 3300046472 Ga0495580_0001523 Ga0495580_0001523_4770_5912 372
1132 3300046472 Ga0495580_0172548 Ga0495580_0172548_23_1150 372
1133 3300046473 Ga0495582_0002649 Ga0495582_0002649_7741_8883 372
1134 3300046475 Ga0495639_0001076 Ga0495639_0001076_6272_7414 372
1135 3300046476 Ga0495662_0001265 Ga0495662_0001265_4644_5786 372
1136 3300046477 Ga0495664_0002747 Ga0495664_0002747_3671_4813 372
1137 3300046491 Ga0495584_0081593 Ga0495584_0081593_74_1216 372
1138 3300046492 Ga0495585_0017368 Ga0495585_0017368_2427_3569 372
1139 3300046499 Ga0495594_0000046 Ga0495594_0000046_227_1369 372
1140 3300046499 Ga0495594_0074940 Ga0495594_0074940_287_1429 372
1141 3300046511 Ga0495608_0002298 Ga0495608_0002298_5569_6693 372
1142 3300046514 Ga0495618_0002859 Ga0495618_0002859_9279_10403 372
1143 3300046516 Ga0495628_0006467 Ga0495628_0006467_7467_8591 372
1144 3300046517 Ga0495630_0010764 Ga0495630_0010764_4602_5744 372
1145 3300046523 Ga0495644_0028248 Ga0495644_0028248_673_1815 372
1146 3300046524 Ga0495648_0001934 Ga0495648_0001934_6584_7726 372
1147 3300046525 Ga0495663_0013559 Ga0495663_0013559_54_1196 372
1148 3300046526 Ga0495666_0101381 Ga0495666_0101381_23_1165 372
1149 3300046529 Ga0495652_0009980 Ga0495652_0009980_1188_2312 372
1150 3300046531 Ga0495665_0005462 Ga0495665_0005462_5572_6714 372
1151 3300046533 Ga0495640_0004569 Ga0495640_0004569_8866_9990 372
1152 3300046533 Ga0495640_0014808 Ga0495640_0014808_103_1245 372
1153 3300046536 Ga0495587_0001279 Ga0495587_0001279_5891_7015 372
1154 3300046543 Ga0495645_0018443 Ga0495645_0018443_3825_4949 372
1155 3300046557 Ga0495622_0003420 Ga0495622_0003420_5337_6479 372
1156 3300046559 Ga0495667_0001050 Ga0495667_0001050_6508_7632 372
1157 3300046615 Ga0495656_0024959 Ga0495656_0024959_651_1793 372
1158 3300046642 Ga0495634_0001329 Ga0495634_0001329_6741_7883 372
1159 3300046642 Ga0495634_0002146 Ga0495634_0002146_10776_11900 372
1160 3300046648 Ga0495611_0039995 Ga0495611_0039995_525_1667 372
1161 3300046663 Ga0495635_0002017 Ga0495635_0002017_3844_4968 372
1162 3300046663 Ga0495635_0004822 Ga0495635_0004822_2673_3815 372
1163 3300046664 Ga0495659_0016673 Ga0495659_0016673_263_1405 372
1164 3300046674 Ga0495588_0003041 Ga0495588_0003041_5068_6210 372
1165 3300046675 Ga0495657_0033468 Ga0495657_0033468_334_1458 372
1166 3300046679 Ga0495623_0000818 Ga0495623_0000818_3639_4763 372
1167 3300046680 Ga0495646_0001020 Ga0495646_0001020_8119_9243 372
1168 3300046680 Ga0495646_0043292 Ga0495646_0043292_71_1213 372
1169 3300046683 Ga0495658_0000201 Ga0495658_0000201_14572_15714 372
1170 3300046684 Ga0495669_0007312 Ga0495669_0007312_791_1933 372
1171 3300046684 Ga0495669_0077613 Ga0495669_0077613_64_1206 372
1172 3300046689 Ga0495613_0004521 Ga0495613_0004521_9143_10285 372
1173 3300046690 Ga0495624_0001903 Ga0495624_0001903_9635_10777 372
1174 3300046809 Ga0495600_0131862 Ga0495600_0131862_197_1321 372
1175 3300047315 Ga0495581_0006096 Ga0495581_0006096_4748_5890 372
1176 3300047315 Ga0495581_0056331 Ga0495581_0056331_274_1416 372
1177 3300047317 Ga0495604_0000821 Ga0495604_0000821_1061_2185 372
1178 3300047319 Ga0495674_0002494 Ga0495674_0002494_5870_7012 372
1179 3300047319 Ga0495674_0016018 Ga0495674_0016018_1419_2543 372
1180 3300047321 Ga0495676_0082071 Ga0495676_0082071_1069_2211 372
1181 3300047322 Ga0495680_0002409 Ga0495680_0002409_6303_7427 372
1182 3300047469 Ga0495673_0017469 Ga0495673_0017469_1117_2259 372
1183 3300047471 Ga0495684_0001237 Ga0495684_0001237_9811_10935 372
1184 3300047471 Ga0495684_0161861 Ga0495684_0161861_398_1540 372
1185 3300047673 Ga0495593_0000100 Ga0495593_0000100_9463_10605 372
1186 3300047673 Ga0495593_0032485 Ga0495593_0032485_1060_2184 372
1187 3300048088 Ga0495602_0016666 Ga0495602_0016666_4730_5854 372
1188 3300048089 Ga0495614_0016086 Ga0495614_0016086_1327_2469 372
1189 3300048904 Ga0496101_0107096 Ga0496101_0107096_637_1779 372
1190 3300048905 Ga0496102_0133128 Ga0496102_0133128_1170_2312 372
1191 3300048907 Ga0496104_0013397 Ga0496104_0013397_2272_3414 372
1192 3300048909 Ga0496106_0002067 Ga0496106_0002067_12991_14133 372
1193 3300048909 Ga0496106_0082186 Ga0496106_0082186_1245_2372 372
1194 3300048909 Ga0496106_0105570 Ga0496106_0105570_672_1814 372
1195 3300048909 Ga0496106_0155999 Ga0496106_0155999_61_1194 372
1196 3300048909 Ga0496106_0184107 Ga0496106_0184107_98_1240 372
1197 3300048910 Ga0496107_0003797 Ga0496107_0003797_6811_7953 372
1198 3300048911 Ga0496108_0000160 Ga0496108_0000160_41915_43057 372
1199 3300048911 Ga0496108_0053832 Ga0496108_0053832_1137_2279 372
1200 3300048911 Ga0496108_0190029 Ga0496108_0190029_545_1687 372
1201 3300048912 Ga0496109_0000245 Ga0496109_0000245_10080_11222 372
1202 3300048913 Ga0496110_0016126 Ga0496110_0016126_3216_4358 372
1203 3300048913 Ga0496110_0017145 Ga0496110_0017145_2567_3709 372
1204 3300048914 Ga0496111_0018797 Ga0496111_0018797_1305_2447 372
1205 3300048915 Ga0496112_0003018 Ga0496112_0003018_4036_5178 372
1206 3300048915 Ga0496112_0072921 Ga0496112_0072921_2070_3203 372
1207 3300048915 Ga0496112_0329177 Ga0496112_0329177_244_1386 372
1208 3300048915 Ga0496112_0357043 Ga0496112_0357043_142_1266 372
1209 3300048916 Ga0496113_0039186 Ga0496113_0039186_121_1263 372
1210 3300048918 Ga0496115_0069273 Ga0496115_0069273_76_1218 372
1211 3300048918 Ga0496115_0097484 Ga0496115_0097484_64_1206 372
1212 3300048920 Ga0496117_0026032 Ga0496117_0026032_1793_2935 372
1213 3300048920 Ga0496117_0033040 Ga0496117_0033040_2226_3350 372
1214 3300048921 Ga0496118_0014225 Ga0496118_0014225_3804_4946 372
1215 3300048921 Ga0496118_0078978 Ga0496118_0078978_836_1984 372
1216 3300048921 Ga0496118_0141225 Ga0496118_0141225_349_1482 372
1217 3300048921 Ga0496118_0194531 Ga0496118_0194531_15_1157 372
1218 3300048924 Ga0496121_0000754 Ga0496121_0000754_1689_2822 372
1219 3300048924 Ga0496121_0008230 Ga0496121_0008230_2682_3824 372
1220 3300048924 Ga0496121_0011276 Ga0496121_0011276_2392_3522 372
1221 3300048924 Ga0496121_0101046 Ga0496121_0101046_190_1332 372
1222 3300048924 Ga0496121_0102622 Ga0496121_0102622_803_1945 372
1223 3300048924 Ga0496121_0132417 Ga0496121_0132417_677_1819 372
1224 3300048927 Ga0496124_0001369 Ga0496124_0001369_23462_24604 372
1225 3300048927 Ga0496124_0101944 Ga0496124_0101944_736_1875 372
1226 3300048928 Ga0496125_0000207 Ga0496125_0000207_45522_46652 372
1227 3300048928 Ga0496125_0041835 Ga0496125_0041835_1356_2498 372
1228 3300048928 Ga0496125_0063472 Ga0496125_0063472_20_1159 372
1229 3300048928 Ga0496125_0134890 Ga0496125_0134890_386_1528 372
1230 3300048929 Ga0496126_0011363 Ga0496126_0011363_4122_5264 372
1231 3300048929 Ga0496126_0018522 Ga0496126_0018522_3784_4926 372
1232 3300048929 Ga0496126_0045277 Ga0496126_0045277_595_1737 372
1233 3300048929 Ga0496126_0060819 Ga0496126_0060819_895_2028 372
1234 3300048929 Ga0496126_0084170 Ga0496126_0084170_291_1487 372
1235 3300048929 Ga0496126_0117408 Ga0496126_0117408_501_1643 372
1236 3300048929 Ga0496126_0130996 Ga0496126_0130996_470_1612 372
1237 3300048929 Ga0496126_0164049 Ga0496126_0164049_646_1788 372
1238 3300048929 Ga0496126_0172381 Ga0496126_0172381_297_1439 372
1239 3300048929 Ga0496126_0216191 Ga0496126_0216191_151_1293 372
1240 3300049575 Ga0501039_0159574 Ga0501039_0159574_544_1677 372
1241 3300049579 Ga0501043_0108247 Ga0501043_0108247_443_1576 372
1242 3300049581 Ga0501047_0189884 Ga0501047_0189884_722_1855 372
1243 3300049586 Ga0501070_0163895 Ga0501070_0163895_84_1217 372
1244 3300049590 Ga0501074_0073140 Ga0501074_0073140_709_1842 372
1245 3300049592 Ga0501076_0123157 Ga0501076_0123157_664_1839 372
1246 3300049742 Ga0501080_0417736 Ga0501080_0417736_15_1148 372
1247 3300049822 Ga0501035_0208562 Ga0501035_0208562_327_1469 372
1248 3300049823 Ga0501044_0024675 Ga0501044_0024675_3004_4137 372
1249 3300050490 nmdc:mga03n38_44418_c1 nmdc:mga03n38_44418_c1_550_1692 372
1250 3300050491 nmdc:mga00v17_10276_c1 nmdc:mga00v17_10276_c1_1028_2161 372
1251 3300050491 nmdc:mga00v17_54883_c1 nmdc:mga00v17_54883_c1_494_1636 372
1252 3300050492 nmdc:mga0yw44_95849_c1 nmdc:mga0yw44_95849_c1_508_1650 372
1253 3300050494 nmdc:mga06z11_17936_c1 nmdc:mga06z11_17936_c1_2029_3159 372
1254 3300050511 nmdc:mga08y16_47004_c1 nmdc:mga08y16_47004_c1_3174_4316 372
1255 3300053077 Ga0495601_0008279 Ga0495601_0008279_664_1788 372
1256 3300053078 Ga0495612_0004156 Ga0495612_0004156_1180_2304 372
1257 3300053084 Ga0495595_0001298 Ga0495595_0001298_4478_5602 372
1258 3300053085 Ga0495619_0006153 Ga0495619_0006153_6134_7258 372
1259 3300053085 Ga0495619_0037466 Ga0495619_0037466_615_1793 372
1260 3300053085 Ga0495619_0232482 Ga0495619_0232482_28_1170 372
1261 3300053093 Ga0500651_0019614 Ga0500651_0019614_1715_2848 372
1262 3300053094 Ga0500566_0008103 Ga0500566_0008103_518_1708 372
1263 3300053103 Ga0500555_001178 Ga0500555_001178_5668_6792 372
1264 3300053111 Ga0500572_000229 Ga0500572_000229_1960_3102 372
1265 3300053119 Ga0500595_001023 Ga0500595_001023_12762_13952 372
1266 3300053130 Ga0500642_0087857 Ga0500642_0087857_213_1346 372
1267 3300053136 Ga0500559_0000186 Ga0500559_0000186_38168_39310 372
1268 3300053139 Ga0500568_0000005 Ga0500568_0000005_124337_125458 372
1269 3300053146 Ga0500588_0049440 Ga0500588_0049440_115_1257 372
1270 3300053150 Ga0500603_000700 Ga0500603_000700_2455_3597 372
1271 3300053156 Ga0500622_0020445 Ga0500622_0020445_68_1192 372
1272 3300053162 Ga0500638_002757 Ga0500638_002757_4144_5334 372
1273 3300053163 Ga0500639_032819 Ga0500639_032819_489_1631 372
1274 3300053177 Ga0500636_0009079 Ga0500636_0009079_1295_2419 372
1275 3300053177 Ga0500636_0034430 Ga0500636_0034430_774_1916 372
1276 3300053178 Ga0500637_0000559 Ga0500637_0000559_2729_3919 372
1277 3300053178 Ga0500637_0013057 Ga0500637_0013057_1585_2727 372
1278 3300053178 Ga0500637_0122047 Ga0500637_0122047_19_1161 372
1279 3300053730 Ga0500645_011174 Ga0500645_011174_586_1728 372
1280 3300053735 Ga0500596_000722 Ga0500596_000722_3110_4252 372
1281 iso_pu_bacteria 2511231027 2511388857 372
1282 iso_pu_bacteria 2513237102 2513703482 372
1283 iso_pu_bacteria 2775506902 2776269763 372
1284 iso_pu_bacteria 2775506904 2776282693 372
1285 iso_pu_bacteria 2791355199 2793078277 372
1286 iso_pu_bacteria 2840764183 2840766190 372
1287 iso_pu_bacteria 2842871566 2842873786 372
1288 iso_pu_bacteria 2928521798 2928522949 372
1289 iso_pu_bacteria 2954011201 2954013686 372
1290 iso_pu_bacteria 8057529695 8057532433 372
1291 3300002067 JGI24735J21928_10024975 JGI24735J21928_100249751 373
1292 3300003215 JGI25153J46596_10005044 JGI25153J46596_100050445 373
1293 3300003215 JGI25153J46596_10005461 JGI25153J46596_100054617 373
1294 3300003354 JGI25160J50197_1005464 JGI25160J50197_10054643 373
1295 3300003354 JGI25160J50197_1012505 JGI25160J50197_10125052 373
1296 3300004625 Ga0055543_1002453 Ga0055543_10024537 373
1297 3300005262 Ga0065165_1003985 Ga0065165_10039859 373
1298 3300005262 Ga0065165_1006106 Ga0065165_10061064 373
1299 3300005262 Ga0065165_1006972 Ga0065165_10069725 373
1300 3300005293 Ga0065715_10093776 Ga0065715_100937764 373
1301 3300005330 Ga0070690_100005673 Ga0070690_1000056733 373
1302 3300005331 Ga0070670_100020122 Ga0070670_1000201225 373
1303 3300005331 Ga0070670_100151700 Ga0070670_1001517002 373
1304 3300005334 Ga0068869_100003307 Ga0068869_1000033077 373
1305 3300005339 Ga0070660_100127088 Ga0070660_1001270881 373
1306 3300005340 Ga0070689_100000391 Ga0070689_10000039121 373
1307 3300005343 Ga0070687_100001228 Ga0070687_1000012287 373
1308 3300005344 Ga0070661_100034801 Ga0070661_1000348015 373
1309 3300005347 Ga0070668_100120488 Ga0070668_1001204882 373
1310 3300005354 Ga0070675_100000583 Ga0070675_10000058321 373
1311 3300005355 Ga0070671_100119080 Ga0070671_1001190802 373
1312 3300005366 Ga0070659_100295723 Ga0070659_1002957231 373
1313 3300005367 Ga0070667_100071995 Ga0070667_1000719952 373
1314 3300005435 Ga0070714_100006027 Ga0070714_1000060272 373
1315 3300005435 Ga0070714_100111374 Ga0070714_1001113743 373
1316 3300005437 Ga0070710_10020901 Ga0070710_100209012 373
1317 3300005439 Ga0070711_100006405 Ga0070711_1000064055 373
1318 3300005439 Ga0070711_100042211 Ga0070711_1000422112 373
1319 3300005441 Ga0070700_100002569 Ga0070700_1000025696 373
1320 3300005455 Ga0070663_100054202 Ga0070663_1000542023 373
1321 3300005457 Ga0070662_100006861 Ga0070662_1000068615 373
1322 3300005458 Ga0070681_10014900 Ga0070681_100149004 373
1323 3300005466 Ga0070685_10007998 Ga0070685_100079984 373
1324 3300005530 Ga0070679_100012888 Ga0070679_1000128885 373
1325 3300005530 Ga0070679_100098356 Ga0070679_1000983563 373
1326 3300005535 Ga0070684_100002191 Ga0070684_10000219113 373
1327 3300005535 Ga0070684_100178812 Ga0070684_1001788121 373
1328 3300005543 Ga0070672_100009090 Ga0070672_1000090901 373
1329 3300005548 Ga0070665_100012574 Ga0070665_1000125744 373
1330 3300005548 Ga0070665_100104914 Ga0070665_1001049143 373
1331 3300005548 Ga0070665_100138864 Ga0070665_1001388643 373
1332 3300005564 Ga0070664_100000613 Ga0070664_1000006136 373
1333 3300005577 Ga0068857_100236730 Ga0068857_1002367301 373
1334 3300005578 Ga0068854_100061841 Ga0068854_1000618412 373
1335 3300005614 Ga0068856_100000651 Ga0068856_10000065139 373
1336 3300005615 Ga0070702_100002455 Ga0070702_1000024556 373
1337 3300005616 Ga0068852_100025281 Ga0068852_1000252815 373
1338 3300005616 Ga0068852_100092932 Ga0068852_1000929323 373
1339 3300005617 Ga0068859_100029114 Ga0068859_1000291144 373
1340 3300005617 Ga0068859_100386776 Ga0068859_1003867761 373
1341 3300005618 Ga0068864_100000969 Ga0068864_10000096910 373
1342 3300005719 Ga0068861_100000011 Ga0068861_10000001157 373
1343 3300005719 Ga0068861_100021250 Ga0068861_1000212502 373
1344 3300005841 Ga0068863_100009807 Ga0068863_1000098076 373
1345 3300005843 Ga0068860_100005403 Ga0068860_1000054035 373
1346 3300005844 Ga0068862_100004342 Ga0068862_10000434212 373
1347 3300005844 Ga0068862_100036719 Ga0068862_1000367192 373
1348 3300005937 Ga0081455_10090641 Ga0081455_100906412 373
1349 3300005983 Ga0081540_1000245 Ga0081540_100024540 373
1350 3300005983 Ga0081540_1064318 Ga0081540_10643181 373
1351 3300005985 Ga0081539_10002005 Ga0081539_1000200529 373
1352 3300006028 Ga0070717_10057923 Ga0070717_100579232 373
1353 3300006038 Ga0075365_10040468 Ga0075365_100404683 373
1354 3300006038 Ga0075365_10042704 Ga0075365_100427043 373
1355 3300006048 Ga0075363_100005167 Ga0075363_1000051674 373
1356 3300006048 Ga0075363_100093248 Ga0075363_1000932481 373
1357 3300006051 Ga0075364_10028244 Ga0075364_100282442 373
1358 3300006163 Ga0070715_10001063 Ga0070715_100010638 373
1359 3300006173 Ga0070716_100001724 Ga0070716_10000172410 373
1360 3300006175 Ga0070712_100022704 Ga0070712_1000227045 373
1361 3300006177 Ga0075362_10000843 Ga0075362_100008436 373
1362 3300006186 Ga0075369_10009075 Ga0075369_100090753 373
1363 3300006186 Ga0075369_10009532 Ga0075369_100095323 373
1364 3300006195 Ga0075366_10009232 Ga0075366_100092324 373
1365 3300006195 Ga0075366_10021973 Ga0075366_100219733 373
1366 3300006237 Ga0097621_100015383 Ga0097621_1000153832 373
1367 3300006353 Ga0075370_10087992 Ga0075370_100879921 373
1368 3300006358 Ga0068871_100096323 Ga0068871_1000963233 373
1369 3300006844 Ga0075428_100000063 Ga0075428_10000006370 373
1370 3300006844 Ga0075428_100072125 Ga0075428_1000721253 373
1371 3300006846 Ga0075430_100069264 Ga0075430_1000692643 373
1372 3300006846 Ga0075430_100104504 Ga0075430_1001045042 373
1373 3300006847 Ga0075431_100000298 Ga0075431_10000029827 373
1374 3300006847 Ga0075431_100000736 Ga0075431_1000007363 373
1375 3300006847 Ga0075431_100019272 Ga0075431_1000192726 373
1376 3300006871 Ga0075434_100010565 Ga0075434_1000105654 373
1377 3300006880 Ga0075429_100079745 Ga0075429_1000797452 373
1378 3300006880 Ga0075429_100089330 Ga0075429_1000893303 373
1379 3300006881 Ga0068865_100037458 Ga0068865_1000374581 373
1380 3300006914 Ga0075436_100048215 Ga0075436_1000482153 373
1381 3300006931 Ga0097620_100029113 Ga0097620_1000291134 373
1382 3300006931 Ga0097620_100386798 Ga0097620_1003867981 373
1383 3300006941 Ga0099825_1027845 Ga0099825_10278452 373
1384 3300006942 Ga0099824_1017574 Ga0099824_10175744 373
1385 3300006943 Ga0099822_1047515 Ga0099822_10475152 373
1386 3300006944 Ga0099823_1011851 Ga0099823_10118514 373
1387 3300009093 Ga0105240_10006144 Ga0105240_1000614416 373
1388 3300009093 Ga0105240_10031683 Ga0105240_100316833 373
1389 3300009093 Ga0105240_10042882 Ga0105240_100428824 373
1390 3300009094 Ga0111539_10000428 Ga0111539_1000042819 373
1391 3300009094 Ga0111539_10051155 Ga0111539_100511553 373
1392 3300009147 Ga0114129_10010165 Ga0114129_100101655 373
1393 3300009174 Ga0105241_10181877 Ga0105241_101818772 373
1394 3300009174 Ga0105241_10239301 Ga0105241_102393011 373
1395 3300009176 Ga0105242_10151361 Ga0105242_101513613 373
1396 3300009177 Ga0105248_10002019 Ga0105248_1000201913 373
1397 3300009551 Ga0105238_10070658 Ga0105238_100706582 373
1398 3300009553 Ga0105249_10030871 Ga0105249_100308715 373
1399 3300010375 Ga0105239_10016077 Ga0105239_100160771 373
1400 3300010375 Ga0105239_10130085 Ga0105239_101300852 373
1401 3300010375 Ga0105239_10206476 Ga0105239_102064762 373
1402 3300011119 Ga0105246_10096908 Ga0105246_100969082 373
1403 3300013105 Ga0157369_10046781 Ga0157369_100467812 373
1404 3300013296 Ga0157374_10118369 Ga0157374_101183692 373
1405 3300013296 Ga0157374_10193049 Ga0157374_101930492 373
1406 3300013306 Ga0163162_10038053 Ga0163162_100380535 373
1407 3300013307 Ga0157372_10031372 Ga0157372_100313726 373
1408 3300014325 Ga0163163_10003103 Ga0163163_100031034 373
1409 3300017792 Ga0163161_10131987 Ga0163161_101319872 373
1410 3300021320 Ga0214544_1000665 Ga0214544_100066535 373
1411 3300021320 Ga0214544_1015664 Ga0214544_10156644 373
1412 3300021321 Ga0214542_1000486 Ga0214542_100048635 373
1413 3300021324 Ga0214545_1000307 Ga0214545_100030735 373
1414 3300021327 Ga0214543_1003627 Ga0214543_100362719 373
1415 3300021384 Ga0213876_10005899 Ga0213876_100058993 373
1416 3300021384 Ga0213876_10006870 Ga0213876_100068704 373
1417 3300021388 Ga0213875_10000182 Ga0213875_1000018213 373
1418 3300025253 Ga0209677_103539 Ga0209677_1035392 373
1419 3300025254 Ga0209148_1000418 Ga0209148_100041814 373
1420 3300025261 Ga0209233_1012618 Ga0209233_10126182 373
1421 3300025272 Ga0209455_1002667 Ga0209455_10026672 373
1422 3300025273 Ga0209673_1015011 Ga0209673_10150114 373
1423 3300025295 Ga0209564_1000904 Ga0209564_100090416 373
1424 3300025295 Ga0209564_1004051 Ga0209564_100405111 373
1425 3300025295 Ga0209564_1005946 Ga0209564_10059464 373
1426 3300025295 Ga0209564_1009196 Ga0209564_10091963 373
1427 3300025297 Ga0209758_1000069 Ga0209758_1000069275 373
1428 3300025297 Ga0209758_1000992 Ga0209758_100099229 373
1429 3300025297 Ga0209758_1003988 Ga0209758_10039887 373
1430 3300025297 Ga0209758_1005623 Ga0209758_10056234 373
1431 3300025297 Ga0209758_1010749 Ga0209758_10107495 373
1432 3300025299 Ga0209256_1007451 Ga0209256_10074518 373
1433 3300025302 Ga0207426_1002389 Ga0207426_10023897 373
1434 3300025302 Ga0207426_1002931 Ga0207426_10029314 373
1435 3300025304 Ga0209257_1001379 Ga0209257_100137927 373
1436 3300025304 Ga0209257_1010825 Ga0209257_10108252 373
1437 3300025304 Ga0209257_1015698 Ga0209257_10156983 373
1438 3300025898 Ga0207692_10032119 Ga0207692_100321192 373
1439 3300025900 Ga0207710_10058110 Ga0207710_100581101 373
1440 3300025903 Ga0207680_10138308 Ga0207680_101383081 373
1441 3300025907 Ga0207645_10108811 Ga0207645_101088112 373
1442 3300025909 Ga0207705_10062423 Ga0207705_100624232 373
1443 3300025911 Ga0207654_10064521 Ga0207654_100645212 373
1444 3300025912 Ga0207707_10012573 Ga0207707_100125734 373
1445 3300025913 Ga0207695_10000148 Ga0207695_1000014858 373
1446 3300025913 Ga0207695_10218940 Ga0207695_102189401 373
1447 3300025914 Ga0207671_10009621 Ga0207671_100096214 373
1448 3300025915 Ga0207693_10033180 Ga0207693_100331803 373
1449 3300025916 Ga0207663_10000585 Ga0207663_100005859 373
1450 3300025916 Ga0207663_10105298 Ga0207663_101052982 373
1451 3300025917 Ga0207660_10086902 Ga0207660_100869022 373
1452 3300025918 Ga0207662_10012606 Ga0207662_100126065 373
1453 3300025919 Ga0207657_10138625 Ga0207657_101386252 373
1454 3300025919 Ga0207657_10164327 Ga0207657_101643273 373
1455 3300025920 Ga0207649_10006528 Ga0207649_100065285 373
1456 3300025921 Ga0207652_10007721 Ga0207652_100077219 373
1457 3300025923 Ga0207681_10004316 Ga0207681_100043165 373
1458 3300025925 Ga0207650_10018233 Ga0207650_100182336 373
1459 3300025925 Ga0207650_10087491 Ga0207650_100874911 373
1460 3300025926 Ga0207659_10020698 Ga0207659_100206982 373
1461 3300025928 Ga0207700_10326937 Ga0207700_103269371 373
1462 3300025929 Ga0207664_10012251 Ga0207664_100122513 373
1463 3300025929 Ga0207664_10151651 Ga0207664_101516512 373
1464 3300025931 Ga0207644_10028212 Ga0207644_100282121 373
1465 3300025931 Ga0207644_10033193 Ga0207644_100331931 373
1466 3300025933 Ga0207706_10021282 Ga0207706_100212823 373
1467 3300025934 Ga0207686_10026303 Ga0207686_100263034 373
1468 3300025936 Ga0207670_10001390 Ga0207670_100013906 373
1469 3300025939 Ga0207665_10002484 Ga0207665_100024848 373
1470 3300025940 Ga0207691_10100386 Ga0207691_101003864 373
1471 3300025941 Ga0207711_10021369 Ga0207711_100213693 373
1472 3300025942 Ga0207689_10008851 Ga0207689_100088516 373
1473 3300025945 Ga0207679_10001585 Ga0207679_100015855 373
1474 3300025961 Ga0207712_10014956 Ga0207712_100149564 373
1475 3300025972 Ga0207668_10316757 Ga0207668_103167571 373
1476 3300025981 Ga0207640_10061002 Ga0207640_100610021 373
1477 3300025981 Ga0207640_10092685 Ga0207640_100926853 373
1478 3300026067 Ga0207678_10004327 Ga0207678_100043273 373
1479 3300026067 Ga0207678_10049874 Ga0207678_100498743 373
1480 3300026067 Ga0207678_10145207 Ga0207678_101452071 373
1481 3300026075 Ga0207708_10005428 Ga0207708_100054286 373
1482 3300026078 Ga0207702_10000546 Ga0207702_1000054639 373
1483 3300026089 Ga0207648_10031091 Ga0207648_100310915 373
1484 3300026095 Ga0207676_10026102 Ga0207676_100261022 373
1485 3300026118 Ga0207675_100001048 Ga0207675_10000104825 373
1486 3300026121 Ga0207683_10029715 Ga0207683_100297155 373
1487 3300027296 Ga0209389_1000102 Ga0209389_100010231 373
1488 3300027296 Ga0209389_1000142 Ga0209389_100014224 373
1489 3300027357 Ga0209589_1000331 Ga0209589_100033124 373
1490 3300027361 Ga0209489_100404 Ga0209489_10040431 373
1491 3300027361 Ga0209489_100818 Ga0209489_10081824 373
1492 3300027363 Ga0209700_100408 Ga0209700_10040831 373
1493 3300027907 Ga0207428_10002785 Ga0207428_100027859 373
1494 3300027907 Ga0207428_10027361 Ga0207428_100273612 373
1495 3300027907 Ga0207428_10095576 Ga0207428_100955763 373
1496 3300028379 Ga0268266_10010858 Ga0268266_100108584 373
1497 3300028380 Ga0268265_10000313 Ga0268265_100003132 373
1498 3300028380 Ga0268265_10022075 Ga0268265_100220752 373
1499 3300028381 Ga0268264_10000062 Ga0268264_10000062295 373
1500 3300028381 Ga0268264_10021477 Ga0268264_100214773 373
1501 3300028794 Ga0307515_10092830 Ga0307515_100928303 373
1502 3300031247 Ga0265340_10030346 Ga0265340_100303462 373
1503 3300031548 Ga0307408_100019215 Ga0307408_1000192153 373
1504 3300031616 Ga0307508_10021824 Ga0307508_100218242 373
1505 3300031691 Ga0316579_10105143 Ga0316579_101051432 373
1506 3300031824 Ga0307413_10061705 Ga0307413_100617053 373
1507 3300031901 Ga0307406_10122328 Ga0307406_101223282 373
1508 3300031903 Ga0307407_10009654 Ga0307407_100096544 373
1509 3300031911 Ga0307412_10060094 Ga0307412_100600942 373
1510 3300031911 Ga0307412_10235641 Ga0307412_102356412 373
1511 3300032002 Ga0307416_100026119 Ga0307416_1000261195 373
1512 3300032005 Ga0307411_10142033 Ga0307411_101420332 373
1513 3300033180 Ga0307510_10006006 Ga0307510_100060063 373
1514 3300033180 Ga0307510_10138937 Ga0307510_101389371 373
1515 3300035115 Ga0373941_0041248 Ga0373941_0041248_183_1340 373
1516 3300035695 Ga0373927_0015368 Ga0373927_0015368_3904_5046 373
1517 3300035725 Ga0373947_0007147 Ga0373947_0007147_987_2129 373
1518 3300036647 Ga0316582_0118929 Ga0316582_0118929_361_1485 373
1519 3300037312 Ga0395899_0000004 Ga0395899_0000004_221299_222453 373
1520 3300037312 Ga0395899_0044545 Ga0395899_0044545_1640_2815 373
1521 3300037418 Ga0395900_0000423 Ga0395900_0000423_19016_20137 373
1522 3300037418 Ga0395900_0063388 Ga0395900_0063388_2245_3420 373
1523 3300037418 Ga0395900_0154871 Ga0395900_0154871_982_2127 373
1524 3300037466 Ga0395898_0010317 Ga0395898_0010317_3845_4966 373
1525 3300037466 Ga0395898_0312055 Ga0395898_0312055_225_1400 373
1526 3300037471 Ga0395905_0014493 Ga0395905_0014493_3906_5027 373
1527 3300037853 Ga0436364_0276897 Ga0436364_0276897_6117_7253 373
1528 3300037853 Ga0436364_0930991 Ga0436364_0930991_2612_3742 373
1529 3300038443 Ga0395901_0482904 Ga0395901_0482904_75_1250 373
1530 3300039437 Ga0436365_0041017 Ga0436365_0041017_644_1777 373
1531 3300039437 Ga0436365_0411209 Ga0436365_0411209_4145_5311 373
1532 3300039437 Ga0436365_1472236 Ga0436365_1472236_1054_2235 373
1533 3300039450 Ga0436363_0881254 Ga0436363_0881254_107_1249 373
1534 3300039450 Ga0436363_1290700 Ga0436363_1290700_444_1625 373
1535 3300044658 Ga0466972_0000306 Ga0466972_0000306_23161_24282 373
1536 3300044684 Ga0466966_0007733 Ga0466966_0007733_4751_5872 373
1537 3300044693 Ga0466961_0000770 Ga0466961_0000770_6004_7125 373
1538 3300044694 Ga0466963_0003783 Ga0466963_0003783_5082_6203 373
1539 3300044706 Ga0466964_0034149 Ga0466964_0034149_472_1593 373
1540 3300044842 Ga0466957_0167932 Ga0466957_0167932_177_1298 373
1541 3300045051 Ga0451576_0017565 Ga0451576_0017565_5845_6987 373
1542 3300045976 Ga0466967_0006466 Ga0466967_0006466_5091_6212 373
1543 3300046460 Ga0495638_0000880 Ga0495638_0000880_14344_15465 373
1544 3300046477 Ga0495664_0028343 Ga0495664_0028343_1505_2647 373
1545 3300046501 Ga0495607_0047954 Ga0495607_0047954_663_1793 373
1546 3300046507 Ga0495606_0162967 Ga0495606_0162967_84_1205 373
1547 3300046515 Ga0495620_0030137 Ga0495620_0030137_822_1952 373
1548 3300046518 Ga0495631_0013600 Ga0495631_0013600_2274_3404 373
1549 3300046519 Ga0495632_0030825 Ga0495632_0030825_1226_2356 373
1550 3300046522 Ga0495643_0027682 Ga0495643_0027682_1620_2750 373
1551 3300046522 Ga0495643_0041257 Ga0495643_0041257_238_1359 373
1552 3300046530 Ga0495654_0012891 Ga0495654_0012891_3160_4290 373
1553 3300046536 Ga0495587_0008424 Ga0495587_0008424_4451_5572 373
1554 3300046542 Ga0495597_0051047 Ga0495597_0051047_90_1220 373
1555 3300046543 Ga0495645_0035255 Ga0495645_0035255_1793_2914 373
1556 3300046557 Ga0495622_0019623 Ga0495622_0019623_1980_3101 373
1557 3300046616 Ga0495668_0048907 Ga0495668_0048907_739_1860 373
1558 3300046642 Ga0495634_0028602 Ga0495634_0028602_702_1823 373
1559 3300046648 Ga0495611_0026894 Ga0495611_0026894_1068_2198 373
1560 3300046660 Ga0495625_0185556 Ga0495625_0185556_53_1183 373
1561 3300046663 Ga0495635_0025870 Ga0495635_0025870_937_2226 373
1562 3300046663 Ga0495635_0042366 Ga0495635_0042366_602_1723 373
1563 3300046665 Ga0495661_0017626 Ga0495661_0017626_2850_3980 373
1564 3300046674 Ga0495588_0001920 Ga0495588_0001920_4200_5321 373
1565 3300046674 Ga0495588_0123791 Ga0495588_0123791_180_1310 373
1566 3300046675 Ga0495657_0020270 Ga0495657_0020270_823_2112 373
1567 3300046675 Ga0495657_0027139 Ga0495657_0027139_2337_3458 373
1568 3300046678 Ga0495599_0004544 Ga0495599_0004544_6195_7316 373
1569 3300046684 Ga0495669_0046928 Ga0495669_0046928_748_1914 373
1570 3300046689 Ga0495613_0023990 Ga0495613_0023990_2899_4188 373
1571 3300046691 Ga0495670_0116024 Ga0495670_0116024_240_1370 373
1572 3300046692 Ga0495671_0057172 Ga0495671_0057172_653_1783 373
1573 3300046794 Ga0495589_0124780 Ga0495589_0124780_60_1190 373
1574 3300046809 Ga0495600_0007343 Ga0495600_0007343_2856_3977 373
1575 3300047317 Ga0495604_0003808 Ga0495604_0003808_4946_6067 373
1576 3300047317 Ga0495604_0006226 Ga0495604_0006226_4603_5892 373
1577 3300047319 Ga0495674_0068049 Ga0495674_0068049_1768_2889 373
1578 3300047320 Ga0495672_0065378 Ga0495672_0065378_432_1574 373
1579 3300047321 Ga0495676_0085563 Ga0495676_0085563_511_1632 373
1580 3300047322 Ga0495680_0008874 Ga0495680_0008874_1387_2508 373
1581 3300047443 Ga0495687_021492 Ga0495687_021492_211_1332 373
1582 3300047444 Ga0495675_0060968 Ga0495675_0060968_57_1178 373
1583 3300047471 Ga0495684_0016109 Ga0495684_0016109_1692_2813 373
1584 3300048088 Ga0495602_0031546 Ga0495602_0031546_2659_3780 373
1585 3300048091 Ga0495626_0056916 Ga0495626_0056916_56_1186 373
1586 3300048903 Ga0496100_0014253 Ga0496100_0014253_2893_4035 373
1587 3300048903 Ga0496100_0179309 Ga0496100_0179309_330_1460 373
1588 3300048905 Ga0496102_0038022 Ga0496102_0038022_3197_4318 373
1589 3300048905 Ga0496102_0188407 Ga0496102_0188407_491_1633 373
1590 3300048906 Ga0496103_0230611 Ga0496103_0230611_25_1146 373
1591 3300048907 Ga0496104_0002017 Ga0496104_0002017_12295_13584 373
1592 3300048907 Ga0496104_0068772 Ga0496104_0068772_152_1273 373
1593 3300048908 Ga0496105_0031865 Ga0496105_0031865_2277_3398 373
1594 3300048908 Ga0496105_0038811 Ga0496105_0038811_2542_3669 373
1595 3300048908 Ga0496105_0039611 Ga0496105_0039611_630_1919 373
1596 3300048909 Ga0496106_0013799 Ga0496106_0013799_4553_5710 373
1597 3300048911 Ga0496108_0050060 Ga0496108_0050060_1095_2216 373
1598 3300048913 Ga0496110_0005974 Ga0496110_0005974_5663_6820 373
1599 3300048913 Ga0496110_0101821 Ga0496110_0101821_1364_2485 373
1600 3300048915 Ga0496112_0054732 Ga0496112_0054732_1611_2732 373
1601 3300048915 Ga0496112_0221801 Ga0496112_0221801_313_1470 373
1602 3300048916 Ga0496113_0014545 Ga0496113_0014545_1197_2354 373
1603 3300048916 Ga0496113_0083994 Ga0496113_0083994_279_1421 373
1604 3300048918 Ga0496115_0016282 Ga0496115_0016282_409_1536 373
1605 3300048920 Ga0496117_0058907 Ga0496117_0058907_395_1516 373
1606 3300048920 Ga0496117_0103939 Ga0496117_0103939_528_1658 373
1607 3300048921 Ga0496118_0022155 Ga0496118_0022155_951_2081 373
1608 3300048921 Ga0496118_0066364 Ga0496118_0066364_779_1900 373
1609 3300048921 Ga0496118_0159012 Ga0496118_0159012_62_1192 373
1610 3300048922 Ga0496119_0012332 Ga0496119_0012332_437_1726 373
1611 3300048923 Ga0496120_0024959 Ga0496120_0024959_2286_3416 373
1612 3300048924 Ga0496121_0000278 Ga0496121_0000278_81720_82862 373
1613 3300048924 Ga0496121_0000811 Ga0496121_0000811_38651_39796 373
1614 3300048924 Ga0496121_0030206 Ga0496121_0030206_906_2027 373
1615 3300048925 Ga0496122_0037084 Ga0496122_0037084_355_1485 373
1616 3300048927 Ga0496124_0034366 Ga0496124_0034366_2467_3597 373
1617 3300048927 Ga0496124_0099959 Ga0496124_0099959_561_1682 373
1618 3300048927 Ga0496124_0115467 Ga0496124_0115467_64_1353 373
1619 3300048927 Ga0496124_0121459 Ga0496124_0121459_925_2046 373
1620 3300048928 Ga0496125_0038368 Ga0496125_0038368_1444_2733 373
1621 3300048928 Ga0496125_0090618 Ga0496125_0090618_649_1770 373
1622 3300048928 Ga0496125_0108318 Ga0496125_0108318_136_1266 373
1623 3300048929 Ga0496126_0129043 Ga0496126_0129043_487_1632 373
1624 3300048929 Ga0496126_0163424 Ga0496126_0163424_293_1582 373
1625 3300049568 Ga0501031_0091747 Ga0501031_0091747_363_1517 373
1626 3300049569 Ga0501032_0008649 Ga0501032_0008649_3974_5143 373
1627 3300049569 Ga0501032_0051874 Ga0501032_0051874_935_2089 373
1628 3300049570 Ga0501033_0110241 Ga0501033_0110241_136_1290 373
1629 3300049571 Ga0501034_0185848 Ga0501034_0185848_349_1503 373
1630 3300049572 Ga0501036_0181331 Ga0501036_0181331_563_1717 373
1631 3300049573 Ga0501037_0048598 Ga0501037_0048598_714_1868 373
1632 3300049574 Ga0501038_0000948 Ga0501038_0000948_22167_23321 373
1633 3300049574 Ga0501038_0066489 Ga0501038_0066489_484_1638 373
1634 3300049574 Ga0501038_0074193 Ga0501038_0074193_1263_2432 373
1635 3300049574 Ga0501038_0205026 Ga0501038_0205026_326_1480 373
1636 3300049575 Ga0501039_0104757 Ga0501039_0104757_986_2140 373
1637 3300049576 Ga0501040_0077508 Ga0501040_0077508_1070_2224 373
1638 3300049578 Ga0501042_0199333 Ga0501042_0199333_112_1266 373
1639 3300049580 Ga0501046_0048377 Ga0501046_0048377_2158_3312 373
1640 3300049580 Ga0501046_0128965 Ga0501046_0128965_531_1685 373
1641 3300049581 Ga0501047_0017861 Ga0501047_0017861_408_1577 373
1642 3300049581 Ga0501047_0179518 Ga0501047_0179518_326_1480 373
1643 3300049582 Ga0501048_0136654 Ga0501048_0136654_506_1660 373
1644 3300049583 Ga0501067_0005018 Ga0501067_0005018_6134_7288 373
1645 3300049584 Ga0501068_0014019 Ga0501068_0014019_713_1867 373
1646 3300049585 Ga0501069_0038783 Ga0501069_0038783_538_1692 373
1647 3300049586 Ga0501070_0049313 Ga0501070_0049313_2017_3171 373
1648 3300049589 Ga0501073_0029367 Ga0501073_0029367_80_1207 373
1649 3300049589 Ga0501073_0069891 Ga0501073_0069891_187_1341 373
1650 3300049590 Ga0501074_0017338 Ga0501074_0017338_2407_3561 373
1651 3300049590 Ga0501074_0060488 Ga0501074_0060488_1440_2567 373
1652 3300049741 Ga0501079_0037744 Ga0501079_0037744_1892_3046 373
1653 3300049742 Ga0501080_0048913 Ga0501080_0048913_1240_2394 373
1654 3300049744 Ga0501083_0019361 Ga0501083_0019361_191_1345 373
1655 3300049822 Ga0501035_0019995 Ga0501035_0019995_3686_4855 373
1656 3300049823 Ga0501044_0056058 Ga0501044_0056058_2531_3658 373
1657 3300049823 Ga0501044_0057160 Ga0501044_0057160_783_1937 373
1658 3300049824 Ga0501045_0006306 Ga0501045_0006306_4630_5784 373
1659 3300050490 nmdc:mga03n38_27813_c1 nmdc:mga03n38_27813_c1_799_1935 373
1660 3300050491 nmdc:mga00v17_30679_c2 nmdc:mga00v17_30679_c2_529_1659 373
1661 3300050491 nmdc:mga00v17_93949_c1 nmdc:mga00v17_93949_c1_348_1469 373
1662 3300050492 nmdc:mga0yw44_9683_c1 nmdc:mga0yw44_9683_c1_2281_3426 373
1663 3300050493 nmdc:mga0k408_24413_c1 nmdc:mga0k408_24413_c1_2046_3182 373
1664 3300050507 nmdc:mga05p37_41284_c1 nmdc:mga05p37_41284_c1_2359_3501 373
1665 3300050508 nmdc:mga09592_24621_c1 nmdc:mga09592_24621_c1_1118_2269 373
1666 3300050508 nmdc:mga09592_85800_c1 nmdc:mga09592_85800_c1_606_1748 373
1667 3300050509 nmdc:mga0qj67_3814_c1 nmdc:mga0qj67_3814_c1_4026_5168 373
1668 3300050509 nmdc:mga0qj67_40740_c1 nmdc:mga0qj67_40740_c1_986_2128 373
1669 3300050510 nmdc:mga06r32_181_c1 nmdc:mga06r32_181_c1_24038_25180 373
1670 3300050510 nmdc:mga06r32_22755_c1 nmdc:mga06r32_22755_c1_276_1418 373
1671 3300050510 nmdc:mga06r32_30846_c1 nmdc:mga06r32_30846_c1_2586_3737 373
1672 3300050511 nmdc:mga08y16_1185_c1 nmdc:mga08y16_1185_c1_13834_14976 373
1673 3300050511 nmdc:mga08y16_8243_c1 nmdc:mga08y16_8243_c1_829_1971 373
1674 3300050514 nmdc:mga08x19_40219_c1 nmdc:mga08x19_40219_c1_364_1503 373
1675 3300053078 Ga0495612_0009585 Ga0495612_0009585_802_1944 373
1676 3300053086 Ga0500578_0043962 Ga0500578_0043962_1130_2260 373
1677 3300053087 Ga0500643_000112 Ga0500643_000112_39140_40261 373
1678 3300053091 Ga0500647_0052629 Ga0500647_0052629_372_1493 373
1679 3300053094 Ga0500566_0000234 Ga0500566_0000234_22849_24051 373
1680 3300053094 Ga0500566_0001195 Ga0500566_0001195_5938_7080 373
1681 3300053098 Ga0500650_0013287 Ga0500650_0013287_1980_3110 373
1682 3300053104 Ga0500556_0000016 Ga0500556_0000016_153536_154666 373
1683 3300053105 Ga0500557_000021 Ga0500557_000021_66031_67152 373
1684 3300053108 Ga0500562_002672 Ga0500562_002672_1682_2803 373
1685 3300053116 Ga0500592_002942 Ga0500592_002942_684_1814 373
1686 3300053119 Ga0500595_006755 Ga0500595_006755_2930_4072 373
1687 3300053119 Ga0500595_014382 Ga0500595_014382_383_1504 373
1688 3300053122 Ga0500608_006748 Ga0500608_006748_1477_2679 373
1689 3300053130 Ga0500642_0000261 Ga0500642_0000261_14773_15903 373
1690 3300053130 Ga0500642_0000583 Ga0500642_0000583_2472_3593 373
1691 3300053131 Ga0500652_001353 Ga0500652_001353_3062_4192 373
1692 3300053136 Ga0500559_0000161 Ga0500559_0000161_39014_40216 373
1693 3300053136 Ga0500559_0013598 Ga0500559_0013598_134_1255 373
1694 3300053139 Ga0500568_0002662 Ga0500568_0002662_8115_9245 373
1695 3300053153 Ga0500616_0000169 Ga0500616_0000169_67603_68733 373
1696 3300053153 Ga0500616_0006228 Ga0500616_0006228_4167_5288 373
1697 3300053154 Ga0500619_030422 Ga0500619_030422_319_1449 373
1698 3300053154 Ga0500619_037378 Ga0500619_037378_380_1501 373
1699 3300053156 Ga0500622_0004388 Ga0500622_0004388_3961_5091 373
1700 3300053159 Ga0500630_007436 Ga0500630_007436_2355_3497 373
1701 3300053163 Ga0500639_023398 Ga0500639_023398_1730_2872 373
1702 3300053177 Ga0500636_0003390 Ga0500636_0003390_7605_8807 373
1703 3300053177 Ga0500636_0004022 Ga0500636_0004022_4072_5193 373
1704 3300053735 Ga0500596_000983 Ga0500596_000983_2815_3957 373
1705 3300053737 Ga0500601_000713 Ga0500601_000713_54_1175 373
1706 3300054114 Ga0501084_0092863 Ga0501084_0092863_1187_2341 373
1707 3300055283 Ga0500661_007900 Ga0500661_007900_442_1563 373
1708 3300060353 Ga0501082_0070899 Ga0501082_0070899_1575_2729 373
1709 iso_pu_bacteria 2617270735 2617352034 373
1710 iso_pu_bacteria 2617270741 2617373504 373
1711 iso_pu_bacteria 2885409591 2885417977 373
1712 iso_pu_bacteria 2939669807 2939674241 373
1713 iso_pu_bacteria 3005587118 3005593267 373
1714 3300005335 Ga0070666_10000186 Ga0070666_1000018643 374
1715 3300006038 Ga0075365_10092604 Ga0075365_100926042 374
1716 3300006042 Ga0075368_10011515 Ga0075368_100115151 374
1717 3300006844 Ga0075428_100020977 Ga0075428_1000209774 374
1718 3300006847 Ga0075431_100017634 Ga0075431_1000176343 374
1719 3300006871 Ga0075434_100013740 Ga0075434_1000137404 374
1720 3300007076 Ga0075435_100010089 Ga0075435_1000100897 374
1721 3300009094 Ga0111539_10025543 Ga0111539_100255434 374
1722 3300009147 Ga0114129_10150322 Ga0114129_101503223 374
1723 3300009147 Ga0114129_10368325 Ga0114129_103683252 374
1724 3300025904 Ga0207647_10047828 Ga0207647_100478282 374
1725 3300027907 Ga0207428_10036877 Ga0207428_100368773 374
1726 3300031344 Ga0265316_10223792 Ga0265316_102237921 374
1727 3300035170 Ga0373943_0048229 Ga0373943_0048229_886_2058 374
1728 3300035695 Ga0373927_0038882 Ga0373927_0038882_180_1310 374
1729 3300035724 Ga0373933_0208661 Ga0373933_0208661_70_1194 374
1730 3300036401 Ga0373937_0009217 Ga0373937_0009217_1213_2337 374
1731 3300037466 Ga0395898_0027303 Ga0395898_0027303_2983_4149 374
1732 3300037853 Ga0436364_0541174 Ga0436364_0541174_1291_2421 374
1733 3300037853 Ga0436364_1088747 Ga0436364_1088747_295_1464 374
1734 3300045049 Ga0466959_0119180 Ga0466959_0119180_718_1848 374
1735 3300049568 Ga0501031_0010398 Ga0501031_0010398_2435_3559 374
1736 3300049569 Ga0501032_0010272 Ga0501032_0010272_4965_6101 374
1737 3300049569 Ga0501032_0079059 Ga0501032_0079059_862_1986 374
1738 3300049569 Ga0501032_0087245 Ga0501032_0087245_128_1252 374
1739 3300049569 Ga0501032_0113830 Ga0501032_0113830_267_1391 374
1740 3300049570 Ga0501033_0018913 Ga0501033_0018913_245_1369 374
1741 3300049570 Ga0501033_0019771 Ga0501033_0019771_3228_4352 374
1742 3300049570 Ga0501033_0022313 Ga0501033_0022313_1486_2610 374
1743 3300049570 Ga0501033_0153286 Ga0501033_0153286_291_1415 374
1744 3300049571 Ga0501034_0000933 Ga0501034_0000933_16154_17290 374
1745 3300049571 Ga0501034_0019340 Ga0501034_0019340_1996_3120 374
1746 3300049571 Ga0501034_0068096 Ga0501034_0068096_1069_2205 374
1747 3300049571 Ga0501034_0092984 Ga0501034_0092984_1306_2430 374
1748 3300049572 Ga0501036_0004882 Ga0501036_0004882_3507_4631 374
1749 3300049572 Ga0501036_0010354 Ga0501036_0010354_846_1982 374
1750 3300049572 Ga0501036_0095375 Ga0501036_0095375_1132_2256 374
1751 3300049572 Ga0501036_0114171 Ga0501036_0114171_1103_2227 374
1752 3300049573 Ga0501037_0006667 Ga0501037_0006667_5263_6387 374
1753 3300049573 Ga0501037_0041278 Ga0501037_0041278_409_1533 374
1754 3300049573 Ga0501037_0056550 Ga0501037_0056550_500_1624 374
1755 3300049573 Ga0501037_0085308 Ga0501037_0085308_559_1713 374
1756 3300049574 Ga0501038_0020847 Ga0501038_0020847_4185_5321 374
1757 3300049574 Ga0501038_0034831 Ga0501038_0034831_2079_3203 374
1758 3300049574 Ga0501038_0319622 Ga0501038_0319622_46_1200 374
1759 3300049575 Ga0501039_0038484 Ga0501039_0038484_1332_2456 374
1760 3300049575 Ga0501039_0041189 Ga0501039_0041189_587_1711 374
1761 3300049575 Ga0501039_0044576 Ga0501039_0044576_97_1221 374
1762 3300049576 Ga0501040_0241087 Ga0501040_0241087_85_1233 374
1763 3300049579 Ga0501043_0004950 Ga0501043_0004950_4144_5268 374
1764 3300049579 Ga0501043_0006067 Ga0501043_0006067_7754_8890 374
1765 3300049579 Ga0501043_0016514 Ga0501043_0016514_3810_4934 374
1766 3300049579 Ga0501043_0032628 Ga0501043_0032628_178_1302 374
1767 3300049579 Ga0501043_0037137 Ga0501043_0037137_615_1739 374
1768 3300049579 Ga0501043_0098491 Ga0501043_0098491_747_1871 374
1769 3300049579 Ga0501043_0136142 Ga0501043_0136142_698_1822 374
1770 3300049580 Ga0501046_0033734 Ga0501046_0033734_1923_3059 374
1771 3300049580 Ga0501046_0091087 Ga0501046_0091087_26_1150 374
1772 3300049581 Ga0501047_0000073 Ga0501047_0000073_73310_74446 374
1773 3300049581 Ga0501047_0029883 Ga0501047_0029883_247_1371 374
1774 3300049581 Ga0501047_0034366 Ga0501047_0034366_433_1557 374
1775 3300049581 Ga0501047_0181752 Ga0501047_0181752_138_1262 374
1776 3300049581 Ga0501047_0213311 Ga0501047_0213311_401_1525 374
1777 3300049582 Ga0501048_0000014 Ga0501048_0000014_18977_20113 374
1778 3300049582 Ga0501048_0062592 Ga0501048_0062592_454_1578 374
1779 3300049584 Ga0501068_0008224 Ga0501068_0008224_3761_4885 374
1780 3300049584 Ga0501068_0014897 Ga0501068_0014897_1475_2599 374
1781 3300049584 Ga0501068_0132273 Ga0501068_0132273_62_1186 374
1782 3300049585 Ga0501069_0011609 Ga0501069_0011609_439_1575 374
1783 3300049586 Ga0501070_0003489 Ga0501070_0003489_11377_12501 374
1784 3300049586 Ga0501070_0012906 Ga0501070_0012906_5671_6795 374
1785 3300049587 Ga0501071_0149725 Ga0501071_0149725_473_1597 374
1786 3300049588 Ga0501072_0060517 Ga0501072_0060517_703_1851 374
1787 3300049589 Ga0501073_0108681 Ga0501073_0108681_353_1477 374
1788 3300049590 Ga0501074_0001948 Ga0501074_0001948_1253_2389 374
1789 3300049591 Ga0501075_0064579 Ga0501075_0064579_1460_2608 374
1790 3300049741 Ga0501079_0100570 Ga0501079_0100570_272_1396 374
1791 3300049742 Ga0501080_0000187 Ga0501080_0000187_41758_42894 374
1792 3300049742 Ga0501080_0006919 Ga0501080_0006919_6000_7124 374
1793 3300049742 Ga0501080_0029012 Ga0501080_0029012_189_1313 374
1794 3300049742 Ga0501080_0042290 Ga0501080_0042290_1486_2610 374
1795 3300049742 Ga0501080_0073456 Ga0501080_0073456_1474_2598 374
1796 3300049742 Ga0501080_0136252 Ga0501080_0136252_863_1999 374
1797 3300049743 Ga0501081_0196139 Ga0501081_0196139_61_1209 374
1798 3300049744 Ga0501083_0000901 Ga0501083_0000901_16873_18009 374
1799 3300049744 Ga0501083_0017373 Ga0501083_0017373_2823_3947 374
1800 3300049822 Ga0501035_0000197 Ga0501035_0000197_61776_62912 374
1801 3300049822 Ga0501035_0015596 Ga0501035_0015596_5547_6671 374
1802 3300049822 Ga0501035_0142593 Ga0501035_0142593_678_1802 374
1803 3300049823 Ga0501044_0003755 Ga0501044_0003755_7126_8262 374
1804 3300049823 Ga0501044_0035948 Ga0501044_0035948_1159_2283 374
1805 3300049823 Ga0501044_0042563 Ga0501044_0042563_1543_2667 374
1806 3300050507 nmdc:mga05p37_413268_c1 nmdc:mga05p37_413268_c1_194_1342 374
1807 3300050507 nmdc:mga05p37_78195_c1 nmdc:mga05p37_78195_c1_627_1784 374
1808 3300050507 nmdc:mga05p37_91058_c1 nmdc:mga05p37_91058_c1_67_1281 374
1809 3300050510 nmdc:mga06r32_97876_c1 nmdc:mga06r32_97876_c1_1011_2141 374
1810 3300050510 nmdc:mga06r32_97896_c1 nmdc:mga06r32_97896_c1_1427_2641 374
1811 3300050511 nmdc:mga08y16_142867_c1 nmdc:mga08y16_142867_c1_681_1895 374
1812 3300050511 nmdc:mga08y16_223492_c1 nmdc:mga08y16_223492_c1_691_1851 374
1813 3300050511 nmdc:mga08y16_42039_c1 nmdc:mga08y16_42039_c1_1865_3022 374
1814 3300050512 nmdc:mga0n895_24239_c1 nmdc:mga0n895_24239_c1_1199_2353 374
1815 3300050513 nmdc:mga0rr50_25778_c1 nmdc:mga0rr50_25778_c1_1064_2218 374
1816 3300050513 nmdc:mga0rr50_265928_c1 nmdc:mga0rr50_265928_c1_204_1334 374
1817 3300053085 Ga0495619_0009627 Ga0495619_0009627_574_1698 374
1818 3300053117 Ga0500593_003727 Ga0500593_003727_2421_3551 374
1819 3300053119 Ga0500595_009949 Ga0500595_009949_403_1533 374
1820 3300053177 Ga0500636_0034793 Ga0500636_0034793_707_1888 374
1821 3300054114 Ga0501084_0066132 Ga0501084_0066132_697_1845 374
1822 3300054114 Ga0501084_0189085 Ga0501084_0189085_550_1674 374
1823 iso_pu_bacteria 2643221734 2644737779 374
1824 iso_pu_bacteria 2828305725 2828308419 374
1825 3300000041 ARcpr5oldR_c000068 ARcpr5oldR_0000688 375
1826 3300000042 ARSoilYngRDRAFT_c00047 ARSoilYngRDRAFT_0004715 375
1827 3300000043 ARcpr5yngRDRAFT_c000047 ARcpr5yngRDRAFT_0000478 375
1828 3300000044 ARSoilOldRDRAFT_c000056 ARSoilOldRDRAFT_0000568 375
1829 3300000045 ARCol0oldRDRAFT_c00334 ARCol0oldRDRAFT_003342 375
1830 3300000652 ARCol0yngRDRAFT_1000250 ARCol0yngRDRAFT_10002502 375
1831 3300001977 JGI24746J21847_1007104 JGI24746J21847_10071041 375
1832 3300001989 JGI24739J22299_10008160 JGI24739J22299_100081602 375
1833 3300001990 JGI24737J22298_10004184 JGI24737J22298_100041845 375
1834 3300002070 JGI24750J21931_1000878 JGI24750J21931_10008781 375
1835 3300002075 JGI24738J21930_10007968 JGI24738J21930_100079682 375
1836 3300002239 JGI24034J26672_10000659 JGI24034J26672_100006594 375
1837 3300005289 Ga0065704_10101095 Ga0065704_101010952 375
1838 3300005290 Ga0065712_10081939 Ga0065712_100819392 375
1839 3300005293 Ga0065715_10092576 Ga0065715_100925761 375
1840 3300005293 Ga0065715_10150277 Ga0065715_101502772 375
1841 3300005327 Ga0070658_10008308 Ga0070658_100083084 375
1842 3300005327 Ga0070658_10056027 Ga0070658_100560273 375
1843 3300005327 Ga0070658_10084443 Ga0070658_100844433 375
1844 3300005328 Ga0070676_10022774 Ga0070676_100227742 375
1845 3300005329 Ga0070683_100020845 Ga0070683_1000208457 375
1846 3300005330 Ga0070690_100005326 Ga0070690_1000053264 375
1847 3300005334 Ga0068869_100003604 Ga0068869_1000036049 375
1848 3300005335 Ga0070666_10129979 Ga0070666_101299791 375
1849 3300005336 Ga0070680_100046234 Ga0070680_1000462342 375
1850 3300005336 Ga0070680_100051759 Ga0070680_1000517592 375
1851 3300005336 Ga0070680_100106876 Ga0070680_1001068762 375
1852 3300005336 Ga0070680_100130607 Ga0070680_1001306071 375
1853 3300005336 Ga0070680_100153404 Ga0070680_1001534041 375
1854 3300005336 Ga0070680_100160408 Ga0070680_1001604081 375
1855 3300005337 Ga0070682_100001402 Ga0070682_1000014026 375
1856 3300005337 Ga0070682_100005660 Ga0070682_1000056602 375
1857 3300005338 Ga0068868_100009048 Ga0068868_1000090483 375
1858 3300005339 Ga0070660_100018729 Ga0070660_1000187292 375
1859 3300005339 Ga0070660_100066600 Ga0070660_1000666002 375
1860 3300005339 Ga0070660_100104216 Ga0070660_1001042162 375
1861 3300005340 Ga0070689_100040609 Ga0070689_1000406092 375
1862 3300005341 Ga0070691_10045737 Ga0070691_100457371 375
1863 3300005343 Ga0070687_100003452 Ga0070687_1000034526 375
1864 3300005344 Ga0070661_100004825 Ga0070661_1000048258 375
1865 3300005345 Ga0070692_10003127 Ga0070692_100031271 375
1866 3300005347 Ga0070668_100005189 Ga0070668_1000051899 375
1867 3300005347 Ga0070668_100028887 Ga0070668_1000288873 375
1868 3300005353 Ga0070669_100037526 Ga0070669_1000375262 375
1869 3300005354 Ga0070675_100102597 Ga0070675_1001025972 375
1870 3300005355 Ga0070671_100224388 Ga0070671_1002243882 375
1871 3300005356 Ga0070674_100001774 Ga0070674_1000017747 375
1872 3300005356 Ga0070674_100004890 Ga0070674_1000048903 375
1873 3300005364 Ga0070673_100001494 Ga0070673_10000149414 375
1874 3300005364 Ga0070673_100046039 Ga0070673_1000460392 375
1875 3300005365 Ga0070688_100002589 Ga0070688_1000025892 375
1876 3300005365 Ga0070688_100003881 Ga0070688_1000038814 375
1877 3300005365 Ga0070688_100009486 Ga0070688_1000094861 375
1878 3300005366 Ga0070659_100008137 Ga0070659_1000081372 375
1879 3300005366 Ga0070659_100019257 Ga0070659_1000192574 375
1880 3300005366 Ga0070659_100081427 Ga0070659_1000814272 375
1881 3300005367 Ga0070667_100169412 Ga0070667_1001694122 375
1882 3300005406 Ga0070703_10005687 Ga0070703_100056872 375
1883 3300005434 Ga0070709_10066455 Ga0070709_100664552 375
1884 3300005435 Ga0070714_100014414 Ga0070714_1000144142 375
1885 3300005436 Ga0070713_100077766 Ga0070713_1000777663 375
1886 3300005438 Ga0070701_10011417 Ga0070701_100114173 375
1887 3300005439 Ga0070711_100047596 Ga0070711_1000475961 375
1888 3300005440 Ga0070705_100015179 Ga0070705_1000151794 375
1889 3300005441 Ga0070700_100063082 Ga0070700_1000630822 375
1890 3300005444 Ga0070694_100013179 Ga0070694_1000131792 375
1891 3300005455 Ga0070663_100007156 Ga0070663_1000071567 375
1892 3300005456 Ga0070678_100034696 Ga0070678_1000346962 375
1893 3300005458 Ga0070681_10008769 Ga0070681_100087695 375
1894 3300005458 Ga0070681_10023941 Ga0070681_100239414 375
1895 3300005458 Ga0070681_10024694 Ga0070681_100246942 375
1896 3300005458 Ga0070681_10063182 Ga0070681_100631822 375
1897 3300005458 Ga0070681_10127749 Ga0070681_101277492 375
1898 3300005459 Ga0068867_100054255 Ga0068867_1000542553 375
1899 3300005466 Ga0070685_10002366 Ga0070685_100023665 375
1900 3300005530 Ga0070679_100026052 Ga0070679_1000260526 375
1901 3300005530 Ga0070679_100033114 Ga0070679_1000331146 375
1902 3300005530 Ga0070679_100074024 Ga0070679_1000740242 375
1903 3300005530 Ga0070679_100183365 Ga0070679_1001833651 375
1904 3300005530 Ga0070679_100283320 Ga0070679_1002833202 375
1905 3300005535 Ga0070684_100004976 Ga0070684_1000049769 375
1906 3300005535 Ga0070684_100116369 Ga0070684_1001163692 375
1907 3300005536 Ga0070697_100311760 Ga0070697_1003117601 375
1908 3300005539 Ga0068853_100011756 Ga0068853_1000117567 375
1909 3300005539 Ga0068853_100048189 Ga0068853_1000481893 375
1910 3300005539 Ga0068853_100370655 Ga0068853_1003706551 375
1911 3300005543 Ga0070672_100009271 Ga0070672_1000092714 375
1912 3300005544 Ga0070686_100014956 Ga0070686_1000149563 375
1913 3300005545 Ga0070695_100008500 Ga0070695_1000085005 375
1914 3300005545 Ga0070695_100019878 Ga0070695_1000198784 375
1915 3300005546 Ga0070696_100036176 Ga0070696_1000361762 375
1916 3300005547 Ga0070693_100003509 Ga0070693_1000035093 375
1917 3300005547 Ga0070693_100004109 Ga0070693_1000041096 375
1918 3300005547 Ga0070693_100013294 Ga0070693_1000132942 375
1919 3300005548 Ga0070665_100028361 Ga0070665_1000283612 375
1920 3300005549 Ga0070704_100005591 Ga0070704_1000055914 375
1921 3300005549 Ga0070704_100012049 Ga0070704_1000120491 375
1922 3300005563 Ga0068855_100018446 Ga0068855_1000184466 375
1923 3300005563 Ga0068855_100023170 Ga0068855_1000231707 375
1924 3300005563 Ga0068855_100036717 Ga0068855_1000367177 375
1925 3300005563 Ga0068855_100088600 Ga0068855_1000886003 375
1926 3300005564 Ga0070664_100108880 Ga0070664_1001088802 375
1927 3300005577 Ga0068857_100005360 Ga0068857_10000536010 375
1928 3300005577 Ga0068857_100032619 Ga0068857_1000326192 375
1929 3300005614 Ga0068856_100013709 Ga0068856_1000137093 375
1930 3300005615 Ga0070702_100014751 Ga0070702_1000147512 375
1931 3300005616 Ga0068852_100011725 Ga0068852_1000117254 375
1932 3300005616 Ga0068852_100016683 Ga0068852_1000166837 375
1933 3300005616 Ga0068852_100119851 Ga0068852_1001198512 375
1934 3300005617 Ga0068859_100012388 Ga0068859_1000123881 375
1935 3300005617 Ga0068859_100014600 Ga0068859_1000146002 375
1936 3300005618 Ga0068864_100013162 Ga0068864_1000131628 375
1937 3300005719 Ga0068861_100011280 Ga0068861_1000112806 375
1938 3300005719 Ga0068861_100210205 Ga0068861_1002102052 375
1939 3300005840 Ga0068870_10001816 Ga0068870_100018169 375
1940 3300005841 Ga0068863_100027791 Ga0068863_1000277913 375
1941 3300005842 Ga0068858_100030453 Ga0068858_1000304532 375
1942 3300005842 Ga0068858_100032183 Ga0068858_1000321832 375
1943 3300005842 Ga0068858_100169276 Ga0068858_1001692761 375
1944 3300005843 Ga0068860_100042993 Ga0068860_1000429932 375
1945 3300005843 Ga0068860_100090706 Ga0068860_1000907062 375
1946 3300005844 Ga0068862_100045004 Ga0068862_1000450043 375
1947 3300005844 Ga0068862_100085584 Ga0068862_1000855842 375
1948 3300005937 Ga0081455_10000002 Ga0081455_10000002470 375
1949 3300006048 Ga0075363_100077996 Ga0075363_1000779961 375
1950 3300006048 Ga0075363_100108633 Ga0075363_1001086332 375
1951 3300006175 Ga0070712_100113599 Ga0070712_1001135992 375
1952 3300006178 Ga0075367_10052780 Ga0075367_100527802 375
1953 3300006178 Ga0075367_10066400 Ga0075367_100664002 375
1954 3300006186 Ga0075369_10075869 Ga0075369_100758692 375
1955 3300006237 Ga0097621_100007850 Ga0097621_1000078508 375
1956 3300006353 Ga0075370_10084401 Ga0075370_100844012 375
1957 3300006358 Ga0068871_100006864 Ga0068871_1000068642 375
1958 3300006852 Ga0075433_10107585 Ga0075433_101075851 375
1959 3300006871 Ga0075434_100002891 Ga0075434_10000289116 375
1960 3300006871 Ga0075434_100250021 Ga0075434_1002500212 375
1961 3300006931 Ga0097620_100012388 Ga0097620_10001238810 375
1962 3300006931 Ga0097620_100014601 Ga0097620_1000146012 375
1963 3300007076 Ga0075435_100146030 Ga0075435_1001460302 375
1964 3300007076 Ga0075435_100302609 Ga0075435_1003026092 375
1965 3300009036 Ga0105244_10120546 Ga0105244_101205461 375
1966 3300009093 Ga0105240_10333558 Ga0105240_103335581 375
1967 3300009094 Ga0111539_10031170 Ga0111539_100311702 375
1968 3300009094 Ga0111539_10324219 Ga0111539_103242191 375
1969 3300009098 Ga0105245_10000888 Ga0105245_100008881 375
1970 3300009101 Ga0105247_10017376 Ga0105247_100173761 375
1971 3300009101 Ga0105247_10127522 Ga0105247_101275221 375
1972 3300009148 Ga0105243_10014854 Ga0105243_100148544 375
1973 3300009148 Ga0105243_10031983 Ga0105243_100319833 375
1974 3300009148 Ga0105243_10047121 Ga0105243_100471213 375
1975 3300009148 Ga0105243_10228854 Ga0105243_102288542 375
1976 3300009174 Ga0105241_10082035 Ga0105241_100820352 375
1977 3300009174 Ga0105241_10099523 Ga0105241_100995232 375
1978 3300009176 Ga0105242_10003386 Ga0105242_1000338611 375
1979 3300009176 Ga0105242_10023894 Ga0105242_100238945 375
1980 3300009177 Ga0105248_10022117 Ga0105248_100221177 375
1981 3300009177 Ga0105248_10128326 Ga0105248_101283262 375
1982 3300009177 Ga0105248_10255057 Ga0105248_102550572 375
1983 3300009545 Ga0105237_10063249 Ga0105237_100632492 375
1984 3300009545 Ga0105237_10190564 Ga0105237_101905642 375
1985 3300009553 Ga0105249_10019292 Ga0105249_100192921 375
1986 3300009553 Ga0105249_10081204 Ga0105249_100812044 375
1987 3300009553 Ga0105249_10121379 Ga0105249_101213792 375
1988 3300010375 Ga0105239_10133338 Ga0105239_101333382 375
1989 3300011119 Ga0105246_10046358 Ga0105246_100463582 375
1990 3300013100 Ga0157373_10006372 Ga0157373_100063726 375
1991 3300013100 Ga0157373_10049748 Ga0157373_100497481 375
1992 3300013102 Ga0157371_10095161 Ga0157371_100951611 375
1993 3300013104 Ga0157370_10004037 Ga0157370_1000403716 375
1994 3300013105 Ga0157369_10114154 Ga0157369_101141542 375
1995 3300013296 Ga0157374_10011455 Ga0157374_100114558 375
1996 3300013296 Ga0157374_10092096 Ga0157374_100920963 375
1997 3300013297 Ga0157378_10008331 Ga0157378_100083319 375
1998 3300013306 Ga0163162_10022178 Ga0163162_100221786 375
1999 3300013306 Ga0163162_10242241 Ga0163162_102422412 375
2000 3300013307 Ga0157372_10003887 Ga0157372_100038876 375
2001 3300013307 Ga0157372_10219257 Ga0157372_102192572 375
2002 3300013308 Ga0157375_10039792 Ga0157375_100397922 375
2003 3300013308 Ga0157375_10117290 Ga0157375_101172902 375
2004 3300014325 Ga0163163_10007860 Ga0163163_100078606 375
2005 3300014325 Ga0163163_10102640 Ga0163163_101026401 375
2006 3300014326 Ga0157380_10013555 Ga0157380_100135552 375
2007 3300014326 Ga0157380_10306222 Ga0157380_103062221 375
2008 3300014745 Ga0157377_10004182 Ga0157377_100041822 375
2009 3300014968 Ga0157379_10002897 Ga0157379_100028973 375
2010 3300014969 Ga0157376_10022750 Ga0157376_100227502 375
2011 3300017792 Ga0163161_10054226 Ga0163161_100542262 375
2012 3300020082 Ga0206353_10510854 Ga0206353_105108544 375
2013 3300025271 Ga0207666_1000463 Ga0207666_10004633 375
2014 3300025315 Ga0207697_10007868 Ga0207697_100078684 375
2015 3300025885 Ga0207653_10019008 Ga0207653_100190082 375
2016 3300025893 Ga0207682_10000134 Ga0207682_100001344 375
2017 3300025899 Ga0207642_10004667 Ga0207642_100046672 375
2018 3300025903 Ga0207680_10013229 Ga0207680_100132292 375
2019 3300025904 Ga0207647_10026061 Ga0207647_100260612 375
2020 3300025907 Ga0207645_10002841 Ga0207645_1000284110 375
2021 3300025908 Ga0207643_10000475 Ga0207643_1000047515 375
2022 3300025909 Ga0207705_10054626 Ga0207705_100546262 375
2023 3300025909 Ga0207705_10261943 Ga0207705_102619431 375
2024 3300025912 Ga0207707_10006404 Ga0207707_100064046 375
2025 3300025912 Ga0207707_10030614 Ga0207707_100306143 375
2026 3300025912 Ga0207707_10124271 Ga0207707_101242711 375
2027 3300025913 Ga0207695_10148636 Ga0207695_101486362 375
2028 3300025913 Ga0207695_10150447 Ga0207695_101504472 375
2029 3300025915 Ga0207693_10046473 Ga0207693_100464734 375
2030 3300025915 Ga0207693_10132276 Ga0207693_101322761 375
2031 3300025916 Ga0207663_10016826 Ga0207663_100168264 375
2032 3300025917 Ga0207660_10031485 Ga0207660_100314852 375
2033 3300025917 Ga0207660_10032120 Ga0207660_100321202 375
2034 3300025917 Ga0207660_10042874 Ga0207660_100428743 375
2035 3300025917 Ga0207660_10067196 Ga0207660_100671962 375
2036 3300025918 Ga0207662_10001348 Ga0207662_100013489 375
2037 3300025919 Ga0207657_10007796 Ga0207657_100077969 375
2038 3300025919 Ga0207657_10014973 Ga0207657_100149738 375
2039 3300025919 Ga0207657_10023545 Ga0207657_100235455 375
2040 3300025919 Ga0207657_10067234 Ga0207657_100672342 375
2041 3300025920 Ga0207649_10000271 Ga0207649_1000027127 375
2042 3300025921 Ga0207652_10025892 Ga0207652_100258922 375
2043 3300025921 Ga0207652_10029863 Ga0207652_100298631 375
2044 3300025921 Ga0207652_10054082 Ga0207652_100540823 375
2045 3300025921 Ga0207652_10111627 Ga0207652_101116272 375
2046 3300025921 Ga0207652_10149685 Ga0207652_101496852 375
2047 3300025923 Ga0207681_10007364 Ga0207681_100073644 375
2048 3300025925 Ga0207650_10016013 Ga0207650_100160134 375
2049 3300025926 Ga0207659_10002002 Ga0207659_100020024 375
2050 3300025927 Ga0207687_10143493 Ga0207687_101434932 375
2051 3300025931 Ga0207644_10000279 Ga0207644_1000027926 375
2052 3300025931 Ga0207644_10275265 Ga0207644_102752651 375
2053 3300025932 Ga0207690_10005129 Ga0207690_100051295 375
2054 3300025932 Ga0207690_10020328 Ga0207690_100203282 375
2055 3300025932 Ga0207690_10203309 Ga0207690_102033091 375
2056 3300025933 Ga0207706_10003321 Ga0207706_1000332115 375
2057 3300025934 Ga0207686_10070566 Ga0207686_100705662 375
2058 3300025935 Ga0207709_10002372 Ga0207709_1000237212 375
2059 3300025936 Ga0207670_10016957 Ga0207670_100169574 375
2060 3300025937 Ga0207669_10000808 Ga0207669_100008083 375
2061 3300025938 Ga0207704_10018037 Ga0207704_100180372 375
2062 3300025938 Ga0207704_10034117 Ga0207704_100341172 375
2063 3300025938 Ga0207704_10047776 Ga0207704_100477763 375
2064 3300025940 Ga0207691_10038313 Ga0207691_100383132 375
2065 3300025941 Ga0207711_10024403 Ga0207711_100244032 375
2066 3300025941 Ga0207711_10078692 Ga0207711_100786922 375
2067 3300025942 Ga0207689_10003227 Ga0207689_100032273 375
2068 3300025942 Ga0207689_10053851 Ga0207689_100538511 375
2069 3300025945 Ga0207679_10005056 Ga0207679_100050565 375
2070 3300025949 Ga0207667_10023907 Ga0207667_100239077 375
2071 3300025949 Ga0207667_10036427 Ga0207667_100364274 375
2072 3300025949 Ga0207667_10164239 Ga0207667_101642392 375
2073 3300025949 Ga0207667_10295372 Ga0207667_102953722 375
2074 3300025960 Ga0207651_10041222 Ga0207651_100412222 375
2075 3300025960 Ga0207651_10160843 Ga0207651_101608432 375
2076 3300025972 Ga0207668_10011903 Ga0207668_100119036 375
2077 3300025981 Ga0207640_10002533 Ga0207640_100025339 375
2078 3300025981 Ga0207640_10224897 Ga0207640_102248972 375
2079 3300025986 Ga0207658_10013362 Ga0207658_100133625 375
2080 3300026023 Ga0207677_10011135 Ga0207677_100111353 375
2081 3300026035 Ga0207703_10011681 Ga0207703_100116815 375
2082 3300026035 Ga0207703_10079466 Ga0207703_100794662 375
2083 3300026041 Ga0207639_10029671 Ga0207639_100296713 375
2084 3300026067 Ga0207678_10006755 Ga0207678_100067559 375
2085 3300026067 Ga0207678_10033535 Ga0207678_100335354 375
2086 3300026067 Ga0207678_10056557 Ga0207678_100565573 375
2087 3300026075 Ga0207708_10004390 Ga0207708_100043909 375
2088 3300026078 Ga0207702_10238884 Ga0207702_102388841 375
2089 3300026088 Ga0207641_10065743 Ga0207641_100657433 375
2090 3300026089 Ga0207648_10006953 Ga0207648_100069533 375
2091 3300026095 Ga0207676_10066888 Ga0207676_100668881 375
2092 3300026095 Ga0207676_10162861 Ga0207676_101628612 375
2093 3300026116 Ga0207674_10003206 Ga0207674_100032069 375
2094 3300026118 Ga0207675_100007364 Ga0207675_1000073642 375
2095 3300026121 Ga0207683_10001717 Ga0207683_100017172 375
2096 3300026121 Ga0207683_10406092 Ga0207683_104060921 375
2097 3300026142 Ga0207698_10081882 Ga0207698_100818822 375
2098 3300027617 Ga0210002_1002903 Ga0210002_10029031 375
2099 3300027695 Ga0209966_1000994 Ga0209966_10009943 375
2100 3300027717 Ga0209998_10003097 Ga0209998_100030972 375
2101 3300027717 Ga0209998_10014963 Ga0209998_100149631 375
2102 3300027907 Ga0207428_10004955 Ga0207428_100049551 375
2103 3300027907 Ga0207428_10029766 Ga0207428_100297661 375
2104 3300028379 Ga0268266_10026552 Ga0268266_100265523 375
2105 3300028380 Ga0268265_10099943 Ga0268265_100999432 375
2106 3300028380 Ga0268265_10241402 Ga0268265_102414021 375
2107 3300028381 Ga0268264_10065854 Ga0268264_100658542 375
2108 3300028556 Ga0265337_1000412 Ga0265337_10004129 375
2109 3300028800 Ga0265338_10045043 Ga0265338_100450432 375
2110 3300031235 Ga0265330_10016351 Ga0265330_100163514 375
2111 3300031241 Ga0265325_10000043 Ga0265325_1000004343 375
2112 3300031241 Ga0265325_10033533 Ga0265325_100335332 375
2113 3300031595 Ga0265313_10060478 Ga0265313_100604782 375
2114 3300031712 Ga0265342_10000417 Ga0265342_1000041737 375
2115 3300031712 Ga0265342_10027858 Ga0265342_100278581 375
2116 3300034818 Ga0373950_0000146 Ga0373950_0000146_299_1426 375
2117 3300034819 Ga0373958_0001200 Ga0373958_0001200_1861_2988 375
2118 3300034819 Ga0373958_0001288 Ga0373958_0001288_180_1307 375
2119 3300034819 Ga0373958_0001984 Ga0373958_0001984_1442_2569 375
2120 3300034820 Ga0373959_0000072 Ga0373959_0000072_19952_21079 375
2121 3300034820 Ga0373959_0000711 Ga0373959_0000711_3841_4968 375
2122 3300034957 Ga0373938_0000121 Ga0373938_0000121_2265_3392 375
2123 3300034957 Ga0373938_0003440 Ga0373938_0003440_190_1317 375
2124 3300034957 Ga0373938_0021211 Ga0373938_0021211_73_1239 375
2125 3300035083 Ga0373926_0000271 Ga0373926_0000271_7309_8475 375
2126 3300035084 Ga0373928_0000164 Ga0373928_0000164_11300_12427 375
2127 3300035084 Ga0373928_0004972 Ga0373928_0004972_1043_2173 375
2128 3300035084 Ga0373928_0008685 Ga0373928_0008685_515_1681 375
2129 3300035085 Ga0373929_0002934 Ga0373929_0002934_268_1395 375
2130 3300035086 Ga0373934_0043498 Ga0373934_0043498_62_1189 375
2131 3300035088 Ga0373940_0001581 Ga0373940_0001581_1954_3081 375
2132 3300035088 Ga0373940_0039323 Ga0373940_0039323_14_1141 375
2133 3300035089 Ga0373944_0015173 Ga0373944_0015173_98_1225 375
2134 3300035090 Ga0373949_0002503 Ga0373949_0002503_108_1235 375
2135 3300035090 Ga0373949_0017246 Ga0373949_0017246_225_1373 375
2136 3300035091 Ga0373951_0000275 Ga0373951_0000275_14451_15578 375
2137 3300035091 Ga0373951_0001543 Ga0373951_0001543_3980_5107 375
2138 3300035092 Ga0373952_0000931 Ga0373952_0000931_375_1502 375
2139 3300035111 Ga0373923_0023878 Ga0373923_0023878_21_1187 375
2140 3300035112 Ga0373932_0000059 Ga0373932_0000059_14780_15907 375
2141 3300035114 Ga0373939_0001813 Ga0373939_0001813_1813_2940 375
2142 3300035115 Ga0373941_0000293 Ga0373941_0000293_3819_4946 375
2143 3300035115 Ga0373941_0002358 Ga0373941_0002358_2376_3503 375
2144 3300035116 Ga0373945_0025312 Ga0373945_0025312_271_1437 375
2145 3300035117 Ga0373953_0004400 Ga0373953_0004400_318_1466 375
2146 3300035118 Ga0373954_0046380 Ga0373954_0046380_191_1318 375
2147 3300035118 Ga0373954_0061725 Ga0373954_0061725_330_1478 375
2148 3300035119 Ga0373956_0043573 Ga0373956_0043573_782_1930 375
2149 3300035120 Ga0373957_0001243 Ga0373957_0001243_893_2041 375
2150 3300035170 Ga0373943_0014718 Ga0373943_0014718_2158_3324 375
2151 3300035171 Ga0373946_0032514 Ga0373946_0032514_348_1514 375
2152 3300035171 Ga0373946_0054247 Ga0373946_0054247_58_1185 375
2153 3300035172 Ga0373955_0017162 Ga0373955_0017162_1699_2847 375
2154 3300035172 Ga0373955_0154661 Ga0373955_0154661_191_1318 375
2155 3300035207 Ga0373942_0000181 Ga0373942_0000181_11035_12162 375
2156 3300035241 Ga0373961_0003884 Ga0373961_0003884_924_2051 375
2157 3300035242 Ga0373962_0000191 Ga0373962_0000191_700_1827 375
2158 3300035242 Ga0373962_0001911 Ga0373962_0001911_3683_4831 375
2159 3300035242 Ga0373962_0018970 Ga0373962_0018970_266_1396 375
2160 3300035410 Ga0373924_0006322 Ga0373924_0006322_16_1182 375
2161 3300035691 Ga0373931_0037146 Ga0373931_0037146_818_1948 375
2162 3300035691 Ga0373931_0185813 Ga0373931_0185813_61_1191 375
2163 3300035692 Ga0373935_0017405 Ga0373935_0017405_2135_3265 375
2164 3300035692 Ga0373935_0114322 Ga0373935_0114322_625_1752 375
2165 3300035695 Ga0373927_0094128 Ga0373927_0094128_631_1761 375
2166 3300035695 Ga0373927_0168482 Ga0373927_0168482_21_1169 375
2167 3300035724 Ga0373933_0028810 Ga0373933_0028810_557_1684 375
2168 3300035724 Ga0373933_0036518 Ga0373933_0036518_1096_2244 375
2169 3300035724 Ga0373933_0125209 Ga0373933_0125209_259_1401 375
2170 3300035725 Ga0373947_0001653 Ga0373947_0001653_9636_10763 375
2171 3300035725 Ga0373947_0049763 Ga0373947_0049763_1183_2331 375
2172 3300036401 Ga0373937_0003774 Ga0373937_0003774_1644_2786 375
2173 3300036401 Ga0373937_0061232 Ga0373937_0061232_1168_2316 375
2174 3300036647 Ga0316582_0081105 Ga0316582_0081105_759_1967 375
2175 3300037068 Ga0373925_0075625 Ga0373925_0075625_298_1425 375
2176 3300037068 Ga0373925_0096240 Ga0373925_0096240_959_2119 375
2177 3300039437 Ga0436365_0396709 Ga0436365_0396709_78954_80081 375
2178 3300039437 Ga0436365_0560499 Ga0436365_0560499_155_1285 375
2179 3300039450 Ga0436363_0413167 Ga0436363_0413167_3974_5101 375
2180 3300042001 Ga0439441_008868 Ga0439441_008868_364_1491 375
2181 3300042005 Ga0439448_0006045 Ga0439448_0006045_432_1562 375
2182 3300042016 Ga0439463_014375 Ga0439463_014375_72_1199 375
2183 3300044656 Ga0466969_0009377 Ga0466969_0009377_3213_4394 375
2184 3300044684 Ga0466966_0003218 Ga0466966_0003218_3232_4413 375
2185 3300044693 Ga0466961_0021238 Ga0466961_0021238_1845_3026 375
2186 3300044706 Ga0466964_0018362 Ga0466964_0018362_950_2131 375
2187 3300044712 Ga0453684_0151976 Ga0453684_0151976_387_1514 375
2188 3300044719 Ga0466971_0001535 Ga0466971_0001535_3594_4775 375
2189 3300044765 Ga0466970_0003306 Ga0466970_0003306_2552_3733 375
2190 3300044842 Ga0466957_0002146 Ga0466957_0002146_6202_7383 375
2191 3300044842 Ga0466957_0065336 Ga0466957_0065336_452_1588 375
2192 3300045049 Ga0466959_0002729 Ga0466959_0002729_2367_3548 375
2193 3300045836 Ga0466958_0080809 Ga0466958_0080809_675_1856 375
2194 3300045976 Ga0466967_0001756 Ga0466967_0001756_3811_4947 375
2195 3300046454 Ga0495592_0002029 Ga0495592_0002029_8771_9898 375
2196 3300046455 Ga0495603_0073899 Ga0495603_0073899_107_1234 375
2197 3300046459 Ga0495629_0000062 Ga0495629_0000062_73706_74833 375
2198 3300046459 Ga0495629_0051704 Ga0495629_0051704_784_1911 375
2199 3300046459 Ga0495629_0086665 Ga0495629_0086665_195_1343 375
2200 3300046459 Ga0495629_0106738 Ga0495629_0106738_415_1563 375
2201 3300046461 Ga0495641_0021183 Ga0495641_0021183_789_1937 375
2202 3300046461 Ga0495641_0047264 Ga0495641_0047264_663_1829 375
2203 3300046462 Ga0495651_0002729 Ga0495651_0002729_11011_12159 375
2204 3300046462 Ga0495651_0064668 Ga0495651_0064668_1041_2207 375
2205 3300046463 Ga0495653_0004986 Ga0495653_0004986_2996_4162 375
2206 3300046463 Ga0495653_0009475 Ga0495653_0009475_6516_7664 375
2207 3300046476 Ga0495662_0041730 Ga0495662_0041730_151_1299 375
2208 3300046476 Ga0495662_0054387 Ga0495662_0054387_415_1542 375
2209 3300046477 Ga0495664_0012028 Ga0495664_0012028_1331_2497 375
2210 3300046477 Ga0495664_0018064 Ga0495664_0018064_1291_2439 375
2211 3300046491 Ga0495584_0117030 Ga0495584_0117030_198_1325 375
2212 3300046492 Ga0495585_0016090 Ga0495585_0016090_2801_3928 375
2213 3300046499 Ga0495594_0038714 Ga0495594_0038714_944_2110 375
2214 3300046499 Ga0495594_0069545 Ga0495594_0069545_313_1440 375
2215 3300046511 Ga0495608_0000943 Ga0495608_0000943_1680_2828 375
2216 3300046511 Ga0495608_0045481 Ga0495608_0045481_1780_2907 375
2217 3300046511 Ga0495608_0163326 Ga0495608_0163326_85_1251 375
2218 3300046514 Ga0495618_0001029 Ga0495618_0001029_13474_14622 375
2219 3300046516 Ga0495628_0009076 Ga0495628_0009076_222_1349 375
2220 3300046516 Ga0495628_0130463 Ga0495628_0130463_723_1871 375
2221 3300046516 Ga0495628_0213312 Ga0495628_0213312_15_1181 375
2222 3300046523 Ga0495644_0000776 Ga0495644_0000776_1709_2836 375
2223 3300046526 Ga0495666_0027221 Ga0495666_0027221_1364_2512 375
2224 3300046529 Ga0495652_0024134 Ga0495652_0024134_126_1274 375
2225 3300046529 Ga0495652_0052791 Ga0495652_0052791_723_1871 375
2226 3300046531 Ga0495665_0005834 Ga0495665_0005834_893_2059 375
2227 3300046533 Ga0495640_0008254 Ga0495640_0008254_142_1308 375
2228 3300046533 Ga0495640_0040139 Ga0495640_0040139_642_1790 375
2229 3300046535 Ga0495586_0021346 Ga0495586_0021346_1658_2806 375
2230 3300046536 Ga0495587_0006840 Ga0495587_0006840_5044_6192 375
2231 3300046536 Ga0495587_0013842 Ga0495587_0013842_271_1398 375
2232 3300046537 Ga0495598_0003485 Ga0495598_0003485_1923_3089 375
2233 3300046543 Ga0495645_0004240 Ga0495645_0004240_7104_8231 375
2234 3300046543 Ga0495645_0105319 Ga0495645_0105319_674_1822 375
2235 3300046559 Ga0495667_0013316 Ga0495667_0013316_3143_4270 375
2236 3300046559 Ga0495667_0067661 Ga0495667_0067661_280_1446 375
2237 3300046642 Ga0495634_0180539 Ga0495634_0180539_72_1220 375
2238 3300046663 Ga0495635_0012429 Ga0495635_0012429_4586_5734 375
2239 3300046663 Ga0495635_0043676 Ga0495635_0043676_1799_2941 375
2240 3300046663 Ga0495635_0073715 Ga0495635_0073715_271_1437 375
2241 3300046674 Ga0495588_0022799 Ga0495588_0022799_116_1264 375
2242 3300046674 Ga0495588_0130394 Ga0495588_0130394_54_1220 375
2243 3300046678 Ga0495599_0002546 Ga0495599_0002546_7535_8662 375
2244 3300046679 Ga0495623_0000055 Ga0495623_0000055_66788_67936 375
2245 3300046680 Ga0495646_0001170 Ga0495646_0001170_5309_6457 375
2246 3300046681 Ga0495647_0049535 Ga0495647_0049535_260_1387 375
2247 3300046683 Ga0495658_0002635 Ga0495658_0002635_6578_7705 375
2248 3300046683 Ga0495658_0048558 Ga0495658_0048558_984_2150 375
2249 3300046689 Ga0495613_0060805 Ga0495613_0060805_111_1238 375
2250 3300046689 Ga0495613_0152800 Ga0495613_0152800_279_1445 375
2251 3300046809 Ga0495600_0001540 Ga0495600_0001540_218_1384 375
2252 3300047315 Ga0495581_0016030 Ga0495581_0016030_2268_3416 375
2253 3300047319 Ga0495674_0006479 Ga0495674_0006479_232_1380 375
2254 3300047319 Ga0495674_0132957 Ga0495674_0132957_677_1825 375
2255 3300047319 Ga0495674_0152915 Ga0495674_0152915_310_1452 375
2256 3300047321 Ga0495676_0092376 Ga0495676_0092376_321_1469 375
2257 3300047322 Ga0495680_0001836 Ga0495680_0001836_19750_20898 375
2258 3300047322 Ga0495680_0013029 Ga0495680_0013029_5990_7156 375
2259 3300047322 Ga0495680_0021925 Ga0495680_0021925_2778_3905 375
2260 3300047444 Ga0495675_0047388 Ga0495675_0047388_180_1328 375
2261 3300047471 Ga0495684_0028674 Ga0495684_0028674_2376_3542 375
2262 3300047673 Ga0495593_0008670 Ga0495593_0008670_4100_5227 375
2263 3300047673 Ga0495593_0074558 Ga0495593_0074558_141_1307 375
2264 3300048088 Ga0495602_0006837 Ga0495602_0006837_1116_2264 375
2265 3300048088 Ga0495602_0012502 Ga0495602_0012502_5172_6299 375
2266 3300048903 Ga0496100_0000980 Ga0496100_0000980_1704_2858 375
2267 3300048903 Ga0496100_0030317 Ga0496100_0030317_1992_3122 375
2268 3300048904 Ga0496101_0008538 Ga0496101_0008538_5456_6586 375
2269 3300048904 Ga0496101_0014498 Ga0496101_0014498_1334_2461 375
2270 3300048905 Ga0496102_0011068 Ga0496102_0011068_2769_3896 375
2271 3300048905 Ga0496102_0031956 Ga0496102_0031956_2866_4020 375
2272 3300048905 Ga0496102_0093950 Ga0496102_0093950_548_1675 375
2273 3300048906 Ga0496103_0004432 Ga0496103_0004432_814_1968 375
2274 3300048907 Ga0496104_0000528 Ga0496104_0000528_13679_14806 375
2275 3300048907 Ga0496104_0001836 Ga0496104_0001836_16015_17169 375
2276 3300048907 Ga0496104_0014292 Ga0496104_0014292_3811_4941 375
2277 3300048907 Ga0496104_0033296 Ga0496104_0033296_2700_3827 375
2278 3300048907 Ga0496104_0164327 Ga0496104_0164327_39_1205 375
2279 3300048908 Ga0496105_0000246 Ga0496105_0000246_31061_32188 375
2280 3300048908 Ga0496105_0017668 Ga0496105_0017668_568_1695 375
2281 3300048908 Ga0496105_0032948 Ga0496105_0032948_2480_3610 375
2282 3300048909 Ga0496106_0015143 Ga0496106_0015143_1871_3019 375
2283 3300048909 Ga0496106_0022235 Ga0496106_0022235_1419_2549 375
2284 3300048910 Ga0496107_0002883 Ga0496107_0002883_3805_4932 375
2285 3300048910 Ga0496107_0016125 Ga0496107_0016125_1573_2703 375
2286 3300048910 Ga0496107_0053885 Ga0496107_0053885_912_2066 375
2287 3300048911 Ga0496108_0002867 Ga0496108_0002867_2142_3296 375
2288 3300048911 Ga0496108_0009525 Ga0496108_0009525_3326_4480 375
2289 3300048911 Ga0496108_0021805 Ga0496108_0021805_325_1494 375
2290 3300048911 Ga0496108_0074274 Ga0496108_0074274_899_2029 375
2291 3300048911 Ga0496108_0336571 Ga0496108_0336571_15_1181 375
2292 3300048911 Ga0496108_0372513 Ga0496108_0372513_38_1168 375
2293 3300048912 Ga0496109_0003116 Ga0496109_0003116_6033_7187 375
2294 3300048912 Ga0496109_0004926 Ga0496109_0004926_1237_2406 375
2295 3300048912 Ga0496109_0035138 Ga0496109_0035138_901_2031 375
2296 3300048912 Ga0496109_0075605 Ga0496109_0075605_1935_3083 375
2297 3300048912 Ga0496109_0231504 Ga0496109_0231504_95_1249 375
2298 3300048913 Ga0496110_0003653 Ga0496110_0003653_8526_9680 375
2299 3300048913 Ga0496110_0017684 Ga0496110_0017684_4405_5574 375
2300 3300048913 Ga0496110_0042157 Ga0496110_0042157_882_2012 375
2301 3300048913 Ga0496110_0046314 Ga0496110_0046314_2630_3784 375
2302 3300048914 Ga0496111_0010932 Ga0496111_0010932_145_1299 375
2303 3300048914 Ga0496111_0010974 Ga0496111_0010974_2786_3940 375
2304 3300048914 Ga0496111_0013193 Ga0496111_0013193_4283_5413 375
2305 3300048914 Ga0496111_0133119 Ga0496111_0133119_184_1332 375
2306 3300048915 Ga0496112_0013071 Ga0496112_0013071_414_1568 375
2307 3300048915 Ga0496112_0015871 Ga0496112_0015871_2098_3267 375
2308 3300048915 Ga0496112_0070653 Ga0496112_0070653_39_1205 375
2309 3300048915 Ga0496112_0161249 Ga0496112_0161249_866_1996 375
2310 3300048915 Ga0496112_0271750 Ga0496112_0271750_496_1623 375
2311 3300048916 Ga0496113_0000829 Ga0496113_0000829_9431_10600 375
2312 3300048916 Ga0496113_0008097 Ga0496113_0008097_699_1829 375
2313 3300048916 Ga0496113_0023296 Ga0496113_0023296_572_1699 375
2314 3300048916 Ga0496113_0078002 Ga0496113_0078002_996_2123 375
2315 3300048916 Ga0496113_0159908 Ga0496113_0159908_417_1547 375
2316 3300048917 Ga0496114_0001871 Ga0496114_0001871_8697_9824 375
2317 3300048917 Ga0496114_0021241 Ga0496114_0021241_578_1708 375
2318 3300048917 Ga0496114_0221909 Ga0496114_0221909_39_1205 375
2319 3300048918 Ga0496115_0022801 Ga0496115_0022801_1092_2222 375
2320 3300048918 Ga0496115_0033915 Ga0496115_0033915_2056_3183 375
2321 3300048922 Ga0496119_0005178 Ga0496119_0005178_3739_4896 375
2322 3300048925 Ga0496122_0013321 Ga0496122_0013321_4020_5177 375
2323 3300048926 Ga0496123_0006678 Ga0496123_0006678_2481_3638 375
2324 3300048929 Ga0496126_0104001 Ga0496126_0104001_850_1989 375
2325 3300049570 Ga0501033_0020633 Ga0501033_0020633_2757_3902 375
2326 3300049571 Ga0501034_0013091 Ga0501034_0013091_7073_8200 375
2327 3300049571 Ga0501034_0054154 Ga0501034_0054154_2213_3358 375
2328 3300049571 Ga0501034_0072154 Ga0501034_0072154_1621_2760 375
2329 3300049573 Ga0501037_0006984 Ga0501037_0006984_2209_3354 375
2330 3300049573 Ga0501037_0115721 Ga0501037_0115721_589_1728 375
2331 3300049574 Ga0501038_0215951 Ga0501038_0215951_221_1360 375
2332 3300049575 Ga0501039_0026395 Ga0501039_0026395_3303_4448 375
2333 3300049580 Ga0501046_0096698 Ga0501046_0096698_762_1907 375
2334 3300049581 Ga0501047_0058103 Ga0501047_0058103_668_1813 375
2335 3300049581 Ga0501047_0138245 Ga0501047_0138245_819_1946 375
2336 3300049582 Ga0501048_0008876 Ga0501048_0008876_4403_5548 375
2337 3300049585 Ga0501069_0009841 Ga0501069_0009841_1740_2885 375
2338 3300049585 Ga0501069_0060135 Ga0501069_0060135_160_1287 375
2339 3300049586 Ga0501070_0087459 Ga0501070_0087459_1313_2440 375
2340 3300049590 Ga0501074_0030505 Ga0501074_0030505_2322_3467 375
2341 3300049591 Ga0501075_0005436 Ga0501075_0005436_813_1943 375
2342 3300049592 Ga0501076_0009787 Ga0501076_0009787_2203_3378 375
2343 3300049592 Ga0501076_0053302 Ga0501076_0053302_954_2084 375
2344 3300049593 Ga0501077_0003603 Ga0501077_0003603_4385_5515 375
2345 3300049593 Ga0501077_0049718 Ga0501077_0049718_1315_2490 375
2346 3300049743 Ga0501081_0035782 Ga0501081_0035782_724_1854 375
2347 3300049744 Ga0501083_0081354 Ga0501083_0081354_331_1470 375
2348 3300049744 Ga0501083_0201935 Ga0501083_0201935_90_1235 375
2349 3300049822 Ga0501035_0028447 Ga0501035_0028447_525_1652 375
2350 3300049823 Ga0501044_0008628 Ga0501044_0008628_8736_9881 375
2351 3300049823 Ga0501044_0094111 Ga0501044_0094111_1557_2684 375
2352 3300049823 Ga0501044_0114590 Ga0501044_0114590_1377_2504 375
2353 3300049823 Ga0501044_0119765 Ga0501044_0119765_202_1341 375
2354 3300049823 Ga0501044_0182183 Ga0501044_0182183_120_1265 375
2355 3300050494 nmdc:mga06z11_122160_c1 nmdc:mga06z11_122160_c1_152_1279 375
2356 3300050496 nmdc:mga07m45_40497_c1 nmdc:mga07m45_40497_c1_316_1446 375
2357 3300050511 nmdc:mga08y16_120623_c1 nmdc:mga08y16_120623_c1_280_1407 375
2358 3300050511 nmdc:mga08y16_341235_c1 nmdc:mga08y16_341235_c1_390_1517 375
2359 3300050511 nmdc:mga08y16_4379_c1 nmdc:mga08y16_4379_c1_11492_12619 375
2360 3300050512 nmdc:mga0n895_126234_c1 nmdc:mga0n895_126234_c1_882_2030 375
2361 3300050512 nmdc:mga0n895_65679_c1 nmdc:mga0n895_65679_c1_675_1802 375
2362 3300050513 nmdc:mga0rr50_68397_c1 nmdc:mga0rr50_68397_c1_461_1627 375
2363 3300050514 nmdc:mga08x19_18_c1 nmdc:mga08x19_18_c1_20142_21272 375
2364 3300050515 nmdc:mga0a205_249744_c1 nmdc:mga0a205_249744_c1_87_1214 375
2365 3300053077 Ga0495601_0000787 Ga0495601_0000787_14913_16040 375
2366 3300053077 Ga0495601_0005014 Ga0495601_0005014_5058_6206 375
2367 3300053077 Ga0495601_0006576 Ga0495601_0006576_5289_6431 375
2368 3300053077 Ga0495601_0008413 Ga0495601_0008413_595_1743 375
2369 3300053078 Ga0495612_0001215 Ga0495612_0001215_6854_7981 375
2370 3300053078 Ga0495612_0004476 Ga0495612_0004476_2951_4099 375
2371 3300053078 Ga0495612_0015781 Ga0495612_0015781_1467_2615 375
2372 3300053078 Ga0495612_0024636 Ga0495612_0024636_277_1404 375
2373 3300053083 Ga0495655_0012391 Ga0495655_0012391_457_1587 375
2374 3300053084 Ga0495595_0000235 Ga0495595_0000235_19888_21036 375
2375 3300053084 Ga0495595_0000883 Ga0495595_0000883_6111_7253 375
2376 3300053084 Ga0495595_0003055 Ga0495595_0003055_4601_5728 375
2377 3300053084 Ga0495595_0055539 Ga0495595_0055539_51_1217 375
2378 3300053085 Ga0495619_0000378 Ga0495619_0000378_27172_28299 375
2379 3300053085 Ga0495619_0000897 Ga0495619_0000897_5975_7117 375
2380 3300053085 Ga0495619_0002647 Ga0495619_0002647_5426_6574 375
2381 3300053085 Ga0495619_0005295 Ga0495619_0005295_1186_2313 375
2382 3300053085 Ga0495619_0036531 Ga0495619_0036531_1920_3068 375
2383 3300053104 Ga0500556_0000200 Ga0500556_0000200_40256_41416 375
2384 3300054114 Ga0501084_0044287 Ga0501084_0044287_430_1605 375
2385 3300054114 Ga0501084_0058948 Ga0501084_0058948_373_1503 375
2386 3300060353 Ga0501082_0003849 Ga0501082_0003849_10291_11421 375
2387 3300060353 Ga0501082_0027083 Ga0501082_0027083_1873_3000 375
2388 iso_pu_bacteria 2513237087 2513593129 375

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01472

PUA

PUA domain

344

417

0.97

PF00696

AA_kinase

Amino acid kinase family

72

303

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ey4-assembly1.cif.gz_A crystal structure of a cbf5-nop10-gar1 complex 0.9542 283 341
2apo-assembly1.cif.gz_A crystal structure of the methanococcus jannaschii cbf5 nop10 complex 0.9391 283 341
4q1t-assembly1.cif.gz_B crystal structure of a glutamate 5-kinase from burkholderia thailandensis 0.9303 8 372
7trc-assembly1.cif.gz_C human telomerase h/aca rnp at 3.3 angstrom 0.9275 282 342
2w21-assembly1.cif.gz_A-2 crystal structure of the aminoacid kinase domain of the glutamate 5 kinase of escherichia coli. 0.922 9 263
ID Description Score Start End Superfamily
2j5tB02 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;PUA domain 0.9808 281 372 2.30.130.10
af_O13810_285_387_2.30.130.10 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;PUA domain 0.9702 274 372 2.30.130.10
af_Q54LB6_223_322_2.30.130.10 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;PUA domain 0.9624 280 372 2.30.130.10
af_A0A1D8PU95_3_196_3.40.1160.10 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.955 12 202 3.40.1160.10
4q1tD02 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;PUA domain 0.9527 273 372 2.30.130.10
ID Description Score Start End GO Terms
AF-A0A4Q3C6E4-F1-model_v4 Glutamate 5-kinase 0.9989 286 371 GO:0003723
GO:0004349
GO:0005524
GO:0005829
GO:0006561
AF-A0A383D3J9-F1-model_v4 PUA domain-containing protein 0.9973 298 372 GO:0003723
GO:0004349
GO:0005524
GO:0005829
GO:0006561
AF-A0A355T3B8-F1-model_v4 Glutamate 5-kinase 0.9944 285 374 GO:0003723
GO:0004349
GO:0005524
GO:0005829
GO:0006561
AF-A0A2M7JRI8-F1-model_v4 Glutamate 5-kinase (EC 2.7.2.11) 0.9929 283 372 GO:0003723
GO:0004349
GO:0005524
GO:0005829
GO:0006561
AF-A0A7C7Q729-F1-model_v4 Glutamate 5-kinase (EC 2.7.2.11) 0.991 287 372 GO:0003723
GO:0004349
GO:0005524
GO:0005829
GO:0006561

Feature Viewer

pLDDT pTM Quality
90.73 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map