F496772
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 2394 | 848 | 4789 | 112 |
Family's Representative Sequence
| Representative Sequence | 3300005457|Ga0070662_100019784|Ga0070662_1000197845 |
| Length | 128 |
| Sequence | MRWRVAASKRFEGIPTVPIIKILPHPEYCPKGATVEAPSGTSICEALLENDIPIEHACEMSCACTTCHVVVREGFNSLGEMDESEEDLLDRAWGLEPNSRLSCQAILSNQDVTIEIPKYSINHAKENH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 7 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 8 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 9 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 10 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 11 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 12 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 13 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 14 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 15 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 16 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 17 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 18 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 19 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 20 | 3300003347 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM | Metagenome | Rhizosphere |
| 21 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 22 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 23 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 24 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 25 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 26 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 27 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 28 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 29 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 30 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 31 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 32 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 33 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 34 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 35 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 36 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 37 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 38 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 39 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 40 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 41 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 42 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 43 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 44 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 45 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 46 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 50 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 53 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 57 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 59 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 69 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 79 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 80 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 81 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 85 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 86 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 88 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 89 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 92 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 94 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 95 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 96 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 98 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 99 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 100 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 101 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 102 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 103 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 104 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 105 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 106 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 107 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 108 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 109 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 110 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 111 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 112 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 113 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 114 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 115 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 116 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 117 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 118 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 120 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 121 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 122 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 123 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 125 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 126 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 127 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300012490 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 | Metagenome | Rhizosphere |
| 145 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 146 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 147 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 148 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 149 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 150 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 162 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 166 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 167 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 168 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 170 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 171 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 172 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 173 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 174 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 183 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 184 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 185 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 187 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 188 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 189 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 190 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 191 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 192 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 193 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 194 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 195 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 196 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 197 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 198 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 199 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 200 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 201 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 202 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 203 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 268 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 275 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 278 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 280 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 284 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 285 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 286 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 287 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 288 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 289 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 290 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 291 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 292 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 293 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 294 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 295 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 296 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 297 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 298 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 299 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 300 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 301 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 302 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 303 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 304 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 305 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 306 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 307 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 308 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 309 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 310 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 311 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 312 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 313 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 314 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 315 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 316 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 317 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 318 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 319 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 320 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 321 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 322 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 323 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 324 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 325 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 326 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 327 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 328 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 329 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 330 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 331 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 332 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 333 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 334 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 335 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 336 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 337 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 338 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 339 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 340 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 341 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 342 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 343 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 344 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 345 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 346 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 347 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 348 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 349 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 350 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 351 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 352 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 353 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 354 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 355 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 356 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 357 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 358 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 359 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 360 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 361 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 362 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 363 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 364 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 365 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 366 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 367 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 368 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 369 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 370 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 371 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 372 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 373 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 374 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 375 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 376 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 377 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 378 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 379 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 380 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 381 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 382 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 383 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 384 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 385 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 386 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 387 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 388 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 389 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 390 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 391 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 392 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 393 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 394 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 395 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 396 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 397 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 398 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 399 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 400 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 401 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 402 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 403 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 404 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 405 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 406 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 407 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 408 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 409 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 410 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 411 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 412 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 413 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 414 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 415 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 416 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 417 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 418 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 419 | 3300044668 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3E2 | Metagenome | Unclassified |
| 420 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 421 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 422 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 423 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 424 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 425 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 426 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 427 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 428 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 429 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 430 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 431 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 432 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 433 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 434 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 435 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 436 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 489 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 491 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 492 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 493 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 494 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 495 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 498 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 499 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 500 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 501 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 502 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 503 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 504 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 505 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 506 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 507 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 508 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 509 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 510 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 511 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 512 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 513 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 514 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 515 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 516 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 517 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 518 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 519 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 520 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 521 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 522 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 523 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 524 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 525 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 526 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 527 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 528 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 529 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 530 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 531 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 532 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 533 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 534 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 535 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 536 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 537 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 538 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 539 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 540 | 3300049524 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control | Metagenome | Rhizosphere |
| 541 | 3300049526 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control | Metagenome | Rhizosphere |
| 542 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 543 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 544 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 545 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 546 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 547 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 548 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 549 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 550 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 551 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 552 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 553 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 554 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 555 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 556 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 557 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 558 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 559 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 560 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 561 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 562 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 563 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 564 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 565 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 566 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 567 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 568 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 569 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 570 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 571 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 572 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 573 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 574 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 575 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 576 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 577 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 578 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 579 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 580 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 581 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 582 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 583 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 584 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 585 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 586 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 587 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 588 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 589 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 590 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 591 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 592 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 593 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 594 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 595 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 596 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 597 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 598 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 599 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 600 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 601 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 602 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 603 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 604 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 605 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 606 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 607 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 608 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 609 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 610 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 611 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 612 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 613 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 614 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 615 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 616 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 617 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 618 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 619 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 620 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 621 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 622 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 623 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 624 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 625 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 626 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 627 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 628 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 629 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 630 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 631 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 632 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 633 | 2501025501 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 634 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 635 | 2501025504 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 636 | 2508501125 | Burkholderia sp. WSM2232 | Isolate | Nodule |
| 637 | 2510065045 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 638 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 639 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 640 | 2510917015 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 641 | 2512047030 | Paraburkholderia tuberum STM678 | Isolate | Nodule |
| 642 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 643 | 2513237151 | Burkholderia sp. WSM2230 | Isolate | Nodule |
| 644 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 645 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 646 | 2515154123 | Trinickia symbiotica JPY347 | Isolate | Nodule |
| 647 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 648 | 2519103095 | Burkholderia sp. KJ006 | Isolate | Nodule |
| 649 | 2526164713 | Paraburkholderia phenoliruptrix JPY366 | Isolate | Nodule |
| 650 | 2547132103 | Chromobacterium sp. C-61 | Isolate | Rhizosphere |
| 651 | 2554235234 | Klebsiella michiganensis SA2 | Isolate | Unclassified |
| 652 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 653 | 2582581311 | Burkholderia sp. WP42 | Isolate | Rhizosphere |
| 654 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 655 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 656 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 657 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 658 | 2599185169 | Klebsiella quasipneumoniae NFPP35 | Isolate | Rhizoplane |
| 659 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 660 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 661 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 662 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 663 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 664 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 665 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 666 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 667 | 2600255067 | Paraburkholderia kururiensis thiooxydans NBRC 107107 | Isolate | Unclassified |
| 668 | 2600255254 | Klebsiella quasipneumoniae NFIX15 | Isolate | Rhizoplane |
| 669 | 2600255255 | Klebsiella quasipneumoniae NFIX23 | Isolate | Rhizoplane |
| 670 | 2600255280 | Klebsiella quasipneumoniae NFIX42 | Isolate | Rhizoplane |
| 671 | 2600255281 | Klebsiella quasipneumoniae NFIX43 | Isolate | Rhizoplane |
| 672 | 2600255287 | Klebsiella quasipneumoniae NFIX11 | Isolate | Rhizoplane |
| 673 | 2600255288 | Klebsiella quasipneumoniae NFIX14 | Isolate | Rhizoplane |
| 674 | 2600255289 | Klebsiella quasipneumoniae NFIX16 | Isolate | Rhizoplane |
| 675 | 2600255290 | Klebsiella quasipneumoniae NFIX17 | Isolate | Rhizoplane |
| 676 | 2600255291 | Klebsiella quasipneumoniae NFIX19 | Isolate | Rhizoplane |
| 677 | 2600255298 | Klebsiella quasipneumoniae NFIX21 | Isolate | Rhizoplane |
| 678 | 2600255299 | Klebsiella quasipneumoniae NFIX22 | Isolate | Rhizoplane |
| 679 | 2600255300 | Klebsiella quasipneumoniae NFIX30 | Isolate | Rhizoplane |
| 680 | 2600255301 | Klebsiella quasipneumoniae NFIX33 | Isolate | Rhizoplane |
| 681 | 2600255302 | Klebsiella quasipneumoniae NFIX35 | Isolate | Rhizoplane |
| 682 | 2600255303 | Klebsiella quasipneumoniae NFIX36 | Isolate | Rhizoplane |
| 683 | 2600255304 | Klebsiella quasipneumoniae NFIX37 | Isolate | Rhizoplane |
| 684 | 2600255305 | Klebsiella quasipneumoniae NFIX41 | Isolate | Rhizoplane |
| 685 | 2600255306 | Klebsiella quasipneumoniae NFIX44 | Isolate | Rhizoplane |
| 686 | 2600255307 | Klebsiella quasipneumoniae NFIX56 | Isolate | Rhizoplane |
| 687 | 2600255309 | Klebsiella sp. NFIX53 | Isolate | Rhizoplane |
| 688 | 2600255392 | Klebsiella quasipneumoniae NFIX54 | Isolate | Rhizoplane |
| 689 | 2602042052 | Klebsiella quasipneumoniae NFIX18 | Isolate | Rhizoplane |
| 690 | 2602042053 | Klebsiella quasipneumoniae NFIX12 | Isolate | Rhizoplane |
| 691 | 2602042103 | Klebsiella quasipneumoniae NFIX29 | Isolate | Rhizoplane |
| 692 | 2602042104 | Klebsiella quasipneumoniae NFIX26 | Isolate | Rhizoplane |
| 693 | 2602042105 | Klebsiella quasipneumoniae NFIX25 | Isolate | Rhizoplane |
| 694 | 2602042106 | Klebsiella quasipneumoniae NFIX13 | Isolate | Rhizoplane |
| 695 | 2602042109 | Klebsiella aerogenes NFIX39 | Isolate | Rhizoplane |
| 696 | 2602042110 | Klebsiella quasipneumoniae NFIX40 | Isolate | Rhizoplane |
| 697 | 2602042111 | Klebsiella quasipneumoniae NFIX20 | Isolate | Rhizoplane |
| 698 | 2603880178 | Klebsiella quasipneumoniae NFIX34 | Isolate | Rhizoplane |
| 699 | 2603880184 | Klebsiella quasipneumoniae NFIX27 | Isolate | Rhizoplane |
| 700 | 2603880202 | Klebsiella quasipneumoniae NFIX38 | Isolate | Rhizoplane |
| 701 | 2603880211 | Klebsiella quasipneumoniae NFIX24 | Isolate | Rhizoplane |
| 702 | 2609459761 | Enterobacter sp. NFR05 | Isolate | Rhizoplane |
| 703 | 2636415599 | Klebsiella variicola DX120E | Isolate | Unclassified |
| 704 | 2643221569 | Achromobacter sp. Root565 | Isolate | Unclassified |
| 705 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 706 | 2643221594 | Achromobacter sp. Root170 | Isolate | Unclassified |
| 707 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 708 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 709 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 710 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 711 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 712 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 713 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 714 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 715 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 716 | 2675903046 | Klebsiella quasipneumoniae NFIX52 | Isolate | Rhizoplane |
| 717 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 718 | 2706794495 | Dickeya zeae ZJU1202 | Isolate | Unclassified |
| 719 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 720 | 2718217991 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 721 | 2721755763 | Pandoraea thiooxydans ATSB16 | Isolate | Rhizosphere |
| 722 | 2734482258 | Glomeribacter sp. phylotype 3 | Isolate | Unclassified |
| 723 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 724 | 2738541296 | Paraburkholderia sp. GV073 | Isolate | Unclassified |
| 725 | 2738541298 | Paraburkholderia sp. GV068 | Isolate | Unclassified |
| 726 | 2738541306 | Paraburkholderia sp. GV052 | Isolate | Unclassified |
| 727 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 728 | 2738543002 | Paraburkholderia sp. GV072 | Isolate | Unclassified |
| 729 | 2738543008 | Paraburkholderia sp. GV060 | Isolate | Unclassified |
| 730 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 731 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 732 | 2739367655 | Pusillimonas sp. YR330 | Isolate | Unclassified |
| 733 | 2744054900 | Paraburkholderia ginsengiterrae DCY85-1 | Isolate | Unclassified |
| 734 | 2744054901 | Paraburkholderia ginsengiterrae DCY85 | Isolate | Unclassified |
| 735 | 2751185846 | Paraburkholderia ribeironis STM 7296 | Isolate | Unclassified |
| 736 | 2775507074 | Klebsiella sp. D5A | Isolate | Unclassified |
| 737 | 2791354903 | Mangrovibacter phragmitis MP23 | Isolate | Unclassified |
| 738 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 739 | 2808606384 | Burkholderia sp. SJZ089 | Isolate | Rhizosphere |
| 740 | 2808606390 | Burkholderia sp. SJZ115 | Isolate | Rhizosphere |
| 741 | 2808606391 | Burkholderia sp. SJZ091 | Isolate | Rhizosphere |
| 742 | 2808606395 | Achromobacter sp. SLBN-14 | Isolate | Unclassified |
| 743 | 2816332253 | Burkholderia vietnamiensis HI2297 | Isolate | Unclassified |
| 744 | 2816332256 | Burkholderia vietnamiensis MSMB608WGS | Isolate | Unclassified |
| 745 | 2816332286 | Burkholderia vietnamiensis HI2221 | Isolate | Rhizosphere |
| 746 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 747 | 2818991450 | Burkholderia sp. 604 | Isolate | Unclassified |
| 748 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 749 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 750 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 751 | 2834641062 | Cupriavidus gilardii JZ4 | Isolate | Unclassified |
| 752 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 753 | 2842324504 | Paraburkholderia fungorum SEMIA 4007 | Isolate | Nodule |
| 754 | 2842348783 | Paraburkholderia fungorum SEMIA 4013 | Isolate | Nodule |
| 755 | 2842454564 | Paraburkholderia fungorum SEMIA 4056 | Isolate | Nodule |
| 756 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 757 | 2843690924 | Chromobacterium rhizoryzae JP2-74 | Isolate | Rhizosphere |
| 758 | 2846540461 | Photorhabdus luminescens HIM3 | Isolate | Rhizosphere |
| 759 | 2852103415 | Edaphovirga cremea DSM 105170 | Isolate | Rhizosphere |
| 760 | 2854601825 | Dickeya dianthicola SS70 | Isolate | Stem Tuber |
| 761 | 2857537821 | Achromobacter sp. R-71975 | Isolate | Unclassified |
| 762 | 2857542790 | Achromobacter sp. R-72367 | Isolate | Unclassified |
| 763 | 2858950400 | Achromobacter sp. K91 | Isolate | Unclassified |
| 764 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 765 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 766 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 767 | 2881714928 | Pseudidiomarina mangrovi ZQ330 | Isolate | Rhizosphere |
| 768 | 2881927736 | Candidimonas sp. SYP-B2681 | Isolate | Rhizosphere |
| 769 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 770 | 2884086401 | Kluyvera sp. PO2S7 | Isolate | Rhizosphere |
| 771 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 772 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 773 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 774 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 775 | 2886848708 | Mitsuaria sp. TWR114 | Isolate | Rhizosphere |
| 776 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 777 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 778 | 2900051742 | Pectobacterium zantedeschiae 2M | Isolate | Stem Tuber |
| 779 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 780 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 781 | 2904434214 | Robbsia andropogonis 1567 | Isolate | Rhizosphere |
| 782 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 783 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 784 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 785 | 2904483920 | Paraburkholderia caledonica 575 | Isolate | Unclassified |
| 786 | 2904513164 | Klebsiella variicola 1431 | Isolate | Rhizosphere |
| 787 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 788 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 789 | 2904571731 | Burkholderia cenocepacia 574 | Isolate | Unclassified |
| 790 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 791 | 2919108558 | Klebsiella sp. 1400 | Isolate | Rhizosphere |
| 792 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 793 | 2919527303 | Paraburkholderia strydomiana 3827 | Isolate | Unclassified |
| 794 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 795 | 2921643360 | Paraburkholderia steynii HC1.1ba | Isolate | Nodule |
| 796 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 797 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 798 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 799 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 800 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 801 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 802 | 2928108538 | Paraburkholderia terricola 1595 | Isolate | Rhizosphere |
| 803 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 804 | 2928135762 | Paraburkholderia terricola 1988 | Isolate | Unclassified |
| 805 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 806 | 2928503688 | Paraburkholderia terricola 1263 | Isolate | Rhizosphere |
| 807 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 808 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 809 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 810 | 2935625433 | Kosakonia sp. 1610 | Isolate | Rhizosphere |
| 811 | 2939568625 | Lelliottia sp. 489 | Isolate | Rhizosphere |
| 812 | 2939617950 | Kosakonia cowanii 2056 | Isolate | Rhizosphere |
| 813 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 814 | 2939642701 | Lelliottia nimipressuralis 2756 | Isolate | Rhizosphere |
| 815 | 2941479691 | |||
| 816 | 2945874760 | Phytobacter diazotrophicus UAEU22 | Isolate | Rhizosphere |
| 817 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 818 | 2945934425 | Paraburkholderia graminis W1I13 | Isolate | Rhizosphere |
| 819 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 820 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 821 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 822 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 823 | 2969079654 | Klebsiella variicola E57-7 | Isolate | Unclassified |
| 824 | 2971820967 | Klebsiella sp. MPUS7 | Isolate | Rhizosphere |
| 825 | 2974435778 | Kosakonia cowanii SORGH_AS 304 | Isolate | Unclassified |
| 826 | 2984559226 | Klebsiella variicola SORGH_AS834 | Isolate | Aerial Root |
| 827 | 2984595703 | Klebsiella variicola SORGH_AS1070 | Isolate | Aerial Root |
| 828 | 2990703756 | Paraburkholderia graminis SLBN-33 | Isolate | Rhizosphere |
| 829 | 2998344455 | Vogesella urethralis SLBN-145 | Isolate | Rhizosphere |
| 830 | 3000376612 | Enterobacteriaceae bacterium 4M9 | Isolate | Rhizosphere |
| 831 | 641736151 | Paraburkholderia graminis C4D1M | Isolate | Rhizoplane |
| 832 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 833 | 642555112 | Paraburkholderia phymatum STM815 | Isolate | Nodule |
| 834 | 642555113 | Paraburkholderia phytofirmans PsJN | Isolate | Unclassified |
| 835 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 836 | 8019504834 | Atlantibacter hermannii 1903 | Isolate | Rhizosphere |
| 837 | 8020807995 | Burkholderia sp. B10 | Isolate | Rhizosphere |
| 838 | 8020938398 | Burkholderia sp. BE12 | Isolate | Rhizosphere |
| 839 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 840 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
| 841 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 842 | 8039098773 | Burkholderia multivorans MSMB612WGS | Isolate | Unclassified |
| 843 | 8040167225 | Burkholderia vietnamiensis RS1 | Isolate | Unclassified |
| 844 | 8040173305 | Burkholderia vietnamiensis BE10 | Isolate | Rhizosphere |
| 845 | 8055225921 | Achromobacter panacis KCTC 42751 | Isolate | Rhizosphere |
| 846 | 8055266321 | Paraburkholderia rhynchosiae LMG 27174 | Isolate | Nodule |
| 847 | 8055301274 | Paraburkholderia kirstenboschensis LMG 28727 | Isolate | Nodule |
| 848 | 8055693939 | Hafnia alvei A23BA | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.56 |
| Metatranscriptomes | 0.42 |
| Isolates | 9.02 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.08 |
| Bulb | 0 |
| Endosphere | 19.05 |
| Nodule | 1 |
| Rhizoplane | 5.1 |
| Rhizosphere | 63.58 |
| Stem | 0 |
| Stem Tuber | 0.08 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070662_100019784 | 3300005457 | Bacteria | 4577 |
| 2 | SwRhRL2b_contig_1415115 | 2162886007 | Bacteria | 1282 |
| 3 | JGI24740J21852_10005200 | 3300001979 | Bacteria | 5524 |
| 4 | JGI24739J22299_10033552 | 3300001989 | Bacteria | 1755 |
| 5 | JGI24739J22299_10040520 | 3300001989 | Bacteria | 1554 |
| 6 | JGI24737J22298_10022183 | 3300001990 | Bacteria | 2017 |
| 7 | JGI24735J21928_10043643 | 3300002067 | Bacteria | 1303 |
| 8 | JGI24744J21845_10047460 | 3300002077 | Bacteria | 795 |
| 9 | JGI25156J39149_1000200 | 3300002705 | Bacteria | 41286 |
| 10 | JGI25156J39149_1001430 | 3300002705 | Bacteria | 10139 |
| 11 | JGI25156J39149_1004572 | 3300002705 | Bacteria | 4182 |
| 12 | JGI25156J39149_1007679 | 3300002705 | Bacteria | 2799 |
| 13 | JGI25156J39149_1020932 | 3300002705 | Bacteria | 1139 |
| 14 | JGI25154J39366_1000288 | 3300002738 | Bacteria | 30264 |
| 15 | JGI25154J39366_1000649 | 3300002738 | Bacteria | 16270 |
| 16 | JGI25157J39369_1000095 | 3300002741 | Bacteria | 74770 |
| 17 | JGI25152J39213_1001922 | 3300002773 | Bacteria | 8286 |
| 18 | JGI25152J39213_1004308 | 3300002773 | Bacteria | 4530 |
| 19 | JGI25150J39212_1027828 | 3300002774 | Bacteria | 806 |
| 20 | JGI25159J45721_1010035 | 3300002987 | Bacteria | 2447 |
| 21 | JGI25159J45721_1010105 | 3300002987 | Bacteria | 2433 |
| 22 | JGI25151J46595_10000262 | 3300003187 | Bacteria | 61170 |
| 23 | JGI25151J46595_10001813 | 3300003187 | Bacteria | 13787 |
| 24 | JGI25151J46595_10023911 | 3300003187 | Bacteria | 2508 |
| 25 | JGI25151J46595_10030757 | 3300003187 | Bacteria | 2107 |
| 26 | JGI25153J46596_10001361 | 3300003215 | Bacteria | 14627 |
| 27 | JGI25153J46596_10020746 | 3300003215 | Bacteria | 2474 |
| 28 | rootH1_10061749 | 3300003316 | Bacteria | 1861 |
| 29 | rootH2_10002329 | 3300003320 | Bacteria | 1251 |
| 30 | rootH2_10166799 | 3300003320 | Bacteria | 1243 |
| 31 | rootL2_10000441 | 3300003322 | Bacteria | 16020 |
| 32 | rootL2_10237090 | 3300003322 | Bacteria | 2024 |
| 33 | rootH1_10049462 | 3300003316 | Bacteria | 3729 |
| 34 | rootH1_10049462 | 3300003323 | Bacteria | 1783 |
| 35 | rootH1_10068787 | 3300003323 | Bacteria | 2523 |
| 36 | JGI26128J50194_1001209 | 3300003347 | Bacteria | 1609 |
| 37 | Ga0006562J51391_1061692 | 3300003578 | Bacteria | 950 |
| 38 | Ga0055538_1004535 | 3300003751 | Bacteria | 1562 |
| 39 | Ga0055539_1000688 | 3300003752 | Bacteria | 8766 |
| 40 | Ga0055539_1001465 | 3300003752 | Bacteria | 4360 |
| 41 | Ga0055539_1014267 | 3300003752 | Bacteria | 970 |
| 42 | Ga0055533_1000100 | 3300003756 | Bacteria | 111692 |
| 43 | Ga0055533_1006422 | 3300003756 | Bacteria | 1735 |
| 44 | Ga0055532_1002241 | 3300003758 | Bacteria | 4232 |
| 45 | Ga0055532_1003811 | 3300003758 | Bacteria | 2445 |
| 46 | Ga0055525_1000011 | 3300003759 | Bacteria | 503124 |
| 47 | Ga0055525_1001558 | 3300003759 | Bacteria | 3787 |
| 48 | Ga0055535_1001571 | 3300003761 | Bacteria | 11046 |
| 49 | Ga0055535_1001668 | 3300003761 | Bacteria | 10206 |
| 50 | Ga0055542_1000027 | 3300003762 | Bacteria | 254819 |
| 51 | Ga0055542_1002307 | 3300003762 | Bacteria | 6568 |
| 52 | Ga0055529_1001099 | 3300003763 | Bacteria | 12159 |
| 53 | Ga0055529_1001608 | 3300003763 | Bacteria | 6106 |
| 54 | Ga0055526_1005479 | 3300003771 | Bacteria | 7286 |
| 55 | Ga0055526_1013218 | 3300003771 | Bacteria | 3512 |
| 56 | Ga0055537_1000193 | 3300003773 | Bacteria | 45640 |
| 57 | Ga0055524_1002870 | 3300003775 | Bacteria | 8638 |
| 58 | Ga0055524_1015745 | 3300003775 | Bacteria | 2744 |
| 59 | Ga0055536_1000726 | 3300003781 | Bacteria | 22133 |
| 60 | Ga0055536_1003097 | 3300003781 | Bacteria | 9048 |
| 61 | Ga0055536_1007352 | 3300003781 | Bacteria | 4949 |
| 62 | Ga0055536_1015208 | 3300003781 | Bacteria | 2648 |
| 63 | Ga0055536_1048677 | 3300003781 | Bacteria | 946 |
| 64 | Ga0055534_1000186 | 3300003784 | Bacteria | 45640 |
| 65 | Ga0055534_1002158 | 3300003784 | Bacteria | 7033 |
| 66 | Ga0055534_1023929 | 3300003784 | Bacteria | 995 |
| 67 | Ga0055528_1073688 | 3300003790 | Bacteria | 612 |
| 68 | Ga0055530_10000754 | 3300003791 | Bacteria | 26927 |
| 69 | Ga0055530_10008221 | 3300003791 | Bacteria | 4219 |
| 70 | Ga0055530_10030912 | 3300003791 | Bacteria | 1412 |
| 71 | Ga0055530_10073206 | 3300003791 | Bacteria | 734 |
| 72 | Ga0055540_1002266 | 3300003792 | Bacteria | 10370 |
| 73 | Ga0055540_1002894 | 3300003792 | Bacteria | 8695 |
| 74 | Ga0055540_1004211 | 3300003792 | Bacteria | 6608 |
| 75 | Ga0055540_1005185 | 3300003792 | Bacteria | 5590 |
| 76 | Ga0055540_1010868 | 3300003792 | Bacteria | 2993 |
| 77 | Ga0055531_10000985 | 3300003794 | Bacteria | 22675 |
| 78 | Ga0055531_10002017 | 3300003794 | Bacteria | 14071 |
| 79 | Ga0055531_10013088 | 3300003794 | Bacteria | 3851 |
| 80 | Ga0055531_10054307 | 3300003794 | Bacteria | 1028 |
| 81 | Ga0055531_10065267 | 3300003794 | Bacteria | 866 |
| 82 | Ga0055541_1000908 | 3300003841 | Bacteria | 7082 |
| 83 | Ga0065165_1000613 | 3300005262 | Bacteria | 51836 |
| 84 | Ga0065165_1055167 | 3300005262 | Bacteria | 1110 |
| 85 | Ga0065714_10078829 | 3300005288 | Bacteria | 2558 |
| 86 | Ga0065714_10187930 | 3300005288 | Bacteria | 930 |
| 87 | Ga0065704_10079876 | 3300005289 | Bacteria | 4051 |
| 88 | Ga0065704_10094721 | 3300005289 | Bacteria | 2528 |
| 89 | Ga0065704_10315903 | 3300005289 | Bacteria | 861 |
| 90 | Ga0065712_10111357 | 3300005290 | Bacteria | 1819 |
| 91 | Ga0065715_10214645 | 3300005293 | Bacteria | 1298 |
| 92 | Ga0065715_10427078 | 3300005293 | Bacteria | 851 |
| 93 | Ga0065715_10978353 | 3300005293 | Bacteria | 551 |
| 94 | Ga0065707_10081939 | 3300005295 | Bacteria | 28637 |
| 95 | Ga0070658_10028554 | 3300005327 | Bacteria | 4480 |
| 96 | Ga0070658_10607777 | 3300005327 | Bacteria | 948 |
| 97 | Ga0070658_11588604 | 3300005327 | Bacteria | 567 |
| 98 | Ga0070676_10023135 | 3300005328 | Bacteria | 3491 |
| 99 | Ga0070676_10024406 | 3300005328 | Bacteria | 3406 |
| 100 | Ga0070676_10062029 | 3300005328 | Bacteria | 2223 |
| 101 | Ga0070676_10137992 | 3300005328 | Bacteria | 1549 |
| 102 | Ga0070676_10199487 | 3300005328 | Bacteria | 1311 |
| 103 | Ga0070676_11612860 | 3300005328 | Bacteria | 502 |
| 104 | Ga0070683_100007089 | 3300005329 | Bacteria | 9442 |
| 105 | Ga0070683_100161279 | 3300005329 | Bacteria | 2127 |
| 106 | Ga0070690_100558986 | 3300005330 | Bacteria | 863 |
| 107 | Ga0070690_101013982 | 3300005330 | Bacteria | 654 |
| 108 | Ga0070690_101151193 | 3300005330 | Bacteria | 617 |
| 109 | Ga0070670_100001125 | 3300005331 | Bacteria | 21269 |
| 110 | Ga0070670_100046529 | 3300005331 | Bacteria | 3731 |
| 111 | Ga0070670_100096992 | 3300005331 | Bacteria | 2536 |
| 112 | Ga0070670_100454984 | 3300005331 | Bacteria | 1135 |
| 113 | Ga0070670_100472434 | 3300005331 | Bacteria | 1113 |
| 114 | Ga0070677_10004970 | 3300005333 | Bacteria | 4368 |
| 115 | Ga0070677_10053445 | 3300005333 | Bacteria | 1642 |
| 116 | Ga0070677_10106704 | 3300005333 | Bacteria | 1244 |
| 117 | Ga0070677_10469173 | 3300005333 | Bacteria | 677 |
| 118 | Ga0068869_100001634 | 3300005334 | Bacteria | 13365 |
| 119 | Ga0068869_100011402 | 3300005334 | Bacteria | 5828 |
| 120 | Ga0068869_100186279 | 3300005334 | Bacteria | 1630 |
| 121 | Ga0068869_100186727 | 3300005334 | Bacteria | 1628 |
| 122 | Ga0070666_10027432 | 3300005335 | Bacteria | 3730 |
| 123 | Ga0070666_10385928 | 3300005335 | Bacteria | 1006 |
| 124 | Ga0070680_100096787 | 3300005336 | Bacteria | 2447 |
| 125 | Ga0070680_100200062 | 3300005336 | Bacteria | 1685 |
| 126 | Ga0070682_100287160 | 3300005337 | Bacteria | 1202 |
| 127 | Ga0070682_100362998 | 3300005337 | Bacteria | 1084 |
| 128 | Ga0068868_100006467 | 3300005338 | Bacteria | 8293 |
| 129 | Ga0068868_100007731 | 3300005338 | Bacteria | 7671 |
| 130 | Ga0068868_100025309 | 3300005338 | Bacteria | 4513 |
| 131 | Ga0068868_100065185 | 3300005338 | Bacteria | 2893 |
| 132 | Ga0068868_100118510 | 3300005338 | Bacteria | 2158 |
| 133 | Ga0068868_101187791 | 3300005338 | Bacteria | 705 |
| 134 | Ga0068868_101773706 | 3300005338 | Bacteria | 583 |
| 135 | Ga0070660_100057666 | 3300005339 | Bacteria | 3009 |
| 136 | Ga0070660_100060030 | 3300005339 | Bacteria | 2950 |
| 137 | Ga0070660_100064464 | 3300005339 | Bacteria | 2850 |
| 138 | Ga0070660_100084433 | 3300005339 | Bacteria | 2496 |
| 139 | Ga0070660_100100400 | 3300005339 | Bacteria | 2292 |
| 140 | Ga0070660_100421144 | 3300005339 | Bacteria | 1106 |
| 141 | Ga0070660_100487769 | 3300005339 | Bacteria | 1024 |
| 142 | Ga0070689_100051808 | 3300005340 | Bacteria | 3173 |
| 143 | Ga0070689_101720046 | 3300005340 | Bacteria | 571 |
| 144 | Ga0070691_10511035 | 3300005341 | Bacteria | 696 |
| 145 | Ga0070691_10702540 | 3300005341 | Bacteria | 607 |
| 146 | Ga0070687_100030647 | 3300005343 | Bacteria | 2631 |
| 147 | Ga0070687_100101179 | 3300005343 | Bacteria | 1614 |
| 148 | Ga0070661_100006518 | 3300005344 | Bacteria | 8054 |
| 149 | Ga0070661_100048491 | 3300005344 | Bacteria | 3109 |
| 150 | Ga0070661_100171509 | 3300005344 | Bacteria | 1647 |
| 151 | Ga0070668_100181696 | 3300005347 | Bacteria | 1718 |
| 152 | Ga0070668_100317949 | 3300005347 | Bacteria | 1310 |
| 153 | Ga0070668_100685438 | 3300005347 | Bacteria | 903 |
| 154 | Ga0070668_100787852 | 3300005347 | Bacteria | 844 |
| 155 | Ga0070669_100021660 | 3300005353 | Bacteria | 4593 |
| 156 | Ga0070669_100094234 | 3300005353 | Bacteria | 2250 |
| 157 | Ga0070669_100160968 | 3300005353 | Bacteria | 1744 |
| 158 | Ga0070669_100256084 | 3300005353 | Bacteria | 1395 |
| 159 | Ga0070669_100256428 | 3300005353 | Bacteria | 1394 |
| 160 | Ga0070669_100521925 | 3300005353 | Bacteria | 987 |
| 161 | Ga0070669_100936393 | 3300005353 | Bacteria | 741 |
| 162 | Ga0070669_101719900 | 3300005353 | Bacteria | 547 |
| 163 | Ga0070675_100000735 | 3300005354 | Bacteria | 22835 |
| 164 | Ga0070675_100004598 | 3300005354 | Bacteria | 10540 |
| 165 | Ga0070675_100015112 | 3300005354 | Bacteria | 6098 |
| 166 | Ga0070675_100207836 | 3300005354 | Bacteria | 1701 |
| 167 | Ga0070675_100693446 | 3300005354 | Bacteria | 927 |
| 168 | Ga0070671_100001944 | 3300005355 | Bacteria | 15849 |
| 169 | Ga0070671_100005456 | 3300005355 | Bacteria | 10154 |
| 170 | Ga0070671_100022352 | 3300005355 | Bacteria | 5165 |
| 171 | Ga0070671_100046866 | 3300005355 | Bacteria | 3595 |
| 172 | Ga0070671_100081043 | 3300005355 | Bacteria | 2714 |
| 173 | Ga0070671_100161322 | 3300005355 | Bacteria | 1895 |
| 174 | Ga0070671_100195282 | 3300005355 | Bacteria | 1716 |
| 175 | Ga0070671_100511880 | 3300005355 | Bacteria | 1033 |
| 176 | Ga0070671_100848462 | 3300005355 | Bacteria | 797 |
| 177 | Ga0070674_100013900 | 3300005356 | Bacteria | 4990 |
| 178 | Ga0070674_100236533 | 3300005356 | Bacteria | 1428 |
| 179 | Ga0070674_100393943 | 3300005356 | Bacteria | 1130 |
| 180 | Ga0070674_100558089 | 3300005356 | Bacteria | 962 |
| 181 | Ga0070674_100572738 | 3300005356 | Bacteria | 950 |
| 182 | Ga0070674_101435039 | 3300005356 | Bacteria | 619 |
| 183 | Ga0070673_100023482 | 3300005364 | Bacteria | 4506 |
| 184 | Ga0070673_100066105 | 3300005364 | Bacteria | 2887 |
| 185 | Ga0070673_100071444 | 3300005364 | Bacteria | 2789 |
| 186 | Ga0070673_100132605 | 3300005364 | Bacteria | 2093 |
| 187 | Ga0070673_100167182 | 3300005364 | Bacteria | 1875 |
| 188 | Ga0070673_101028246 | 3300005364 | Bacteria | 768 |
| 189 | Ga0070673_101089811 | 3300005364 | Bacteria | 746 |
| 190 | Ga0070673_101167683 | 3300005364 | Bacteria | 721 |
| 191 | Ga0070673_101976188 | 3300005364 | Bacteria | 553 |
| 192 | Ga0070688_101394628 | 3300005365 | Bacteria | 568 |
| 193 | Ga0070659_100003967 | 3300005366 | Bacteria | 10534 |
| 194 | Ga0070659_100008273 | 3300005366 | Bacteria | 7595 |
| 195 | Ga0070659_100025101 | 3300005366 | Bacteria | 4575 |
| 196 | Ga0070659_100063404 | 3300005366 | Bacteria | 2924 |
| 197 | Ga0070659_100227135 | 3300005366 | Bacteria | 1542 |
| 198 | Ga0070659_100239306 | 3300005366 | Bacteria | 1501 |
| 199 | Ga0070659_100776578 | 3300005366 | Bacteria | 832 |
| 200 | Ga0070659_100897242 | 3300005366 | Bacteria | 774 |
| 201 | Ga0070659_101989550 | 3300005366 | Bacteria | 522 |
| 202 | Ga0070667_100006642 | 3300005367 | Bacteria | 9617 |
| 203 | Ga0070667_100021358 | 3300005367 | Bacteria | 5376 |
| 204 | Ga0070667_100032736 | 3300005367 | Bacteria | 4337 |
| 205 | Ga0070667_100065683 | 3300005367 | Bacteria | 3081 |
| 206 | Ga0070667_100157606 | 3300005367 | Bacteria | 1998 |
| 207 | Ga0070667_100177885 | 3300005367 | Bacteria | 1880 |
| 208 | Ga0070667_100358733 | 3300005367 | Bacteria | 1321 |
| 209 | Ga0070667_100500355 | 3300005367 | Bacteria | 1114 |
| 210 | Ga0070711_101059401 | 3300005439 | Bacteria | 697 |
| 211 | Ga0070705_101672577 | 3300005440 | Bacteria | 537 |
| 212 | Ga0070700_100009387 | 3300005441 | Bacteria | 5367 |
| 213 | Ga0070694_101409094 | 3300005444 | Bacteria | 588 |
| 214 | Ga0070708_100234856 | 3300005445 | Bacteria | 1721 |
| 215 | Ga0070663_100037434 | 3300005455 | Bacteria | 3378 |
| 216 | Ga0070663_100087596 | 3300005455 | Bacteria | 2302 |
| 217 | Ga0070678_100024742 | 3300005456 | Bacteria | 4026 |
| 218 | Ga0070678_100035395 | 3300005456 | Bacteria | 3485 |
| 219 | Ga0070678_100077032 | 3300005456 | Bacteria | 2514 |
| 220 | Ga0070678_100309688 | 3300005456 | Bacteria | 1345 |
| 221 | Ga0070678_100343197 | 3300005456 | Bacteria | 1282 |
| 222 | Ga0070678_100580319 | 3300005456 | Bacteria | 999 |
| 223 | Ga0070678_101064826 | 3300005456 | Bacteria | 745 |
| 224 | Ga0070678_101213316 | 3300005456 | Bacteria | 700 |
| 225 | Ga0070678_101541364 | 3300005456 | Bacteria | 623 |
| 226 | Ga0070662_100009726 | 3300005457 | Bacteria | 6293 |
| 227 | Ga0070662_100011762 | 3300005457 | Bacteria | 5781 |
| 228 | Ga0070662_100320690 | 3300005457 | Bacteria | 1263 |
| 229 | Ga0070662_100597588 | 3300005457 | Bacteria | 928 |
| 230 | Ga0070662_100649418 | 3300005457 | Bacteria | 890 |
| 231 | Ga0070681_10680870 | 3300005458 | Bacteria | 944 |
| 232 | Ga0070681_11479174 | 3300005458 | Bacteria | 604 |
| 233 | Ga0068867_100000085 | 3300005459 | Bacteria | 58473 |
| 234 | Ga0068867_100004130 | 3300005459 | Bacteria | 10199 |
| 235 | Ga0068867_100008539 | 3300005459 | Bacteria | 7229 |
| 236 | Ga0068867_100013868 | 3300005459 | Bacteria | 5705 |
| 237 | Ga0068867_100105705 | 3300005459 | Bacteria | 2155 |
| 238 | Ga0068867_100115384 | 3300005459 | Bacteria | 2068 |
| 239 | Ga0068867_100197479 | 3300005459 | Bacteria | 1609 |
| 240 | Ga0068867_100322526 | 3300005459 | Bacteria | 1280 |
| 241 | Ga0068867_100575423 | 3300005459 | Bacteria | 979 |
| 242 | Ga0068867_100597927 | 3300005459 | Bacteria | 962 |
| 243 | Ga0070685_10597373 | 3300005466 | Bacteria | 794 |
| 244 | Ga0070706_100000822 | 3300005467 | Bacteria | 34270 |
| 245 | Ga0070706_100156252 | 3300005467 | Bacteria | 2129 |
| 246 | Ga0070707_100631562 | 3300005468 | Bacteria | 1034 |
| 247 | Ga0070707_100926753 | 3300005468 | Bacteria | 836 |
| 248 | Ga0070699_101304060 | 3300005518 | Bacteria | 666 |
| 249 | Ga0070684_100002981 | 3300005535 | Bacteria | 12599 |
| 250 | Ga0070684_100170273 | 3300005535 | Bacteria | 1978 |
| 251 | Ga0070684_100300695 | 3300005535 | Bacteria | 1472 |
| 252 | Ga0068853_100057775 | 3300005539 | Bacteria | 3349 |
| 253 | Ga0068853_100149756 | 3300005539 | Bacteria | 2100 |
| 254 | Ga0068853_100157572 | 3300005539 | Bacteria | 2046 |
| 255 | Ga0068853_100222162 | 3300005539 | Bacteria | 1726 |
| 256 | Ga0068853_100375749 | 3300005539 | Bacteria | 1326 |
| 257 | Ga0070672_100000244 | 3300005543 | Bacteria | 30475 |
| 258 | Ga0070672_100005577 | 3300005543 | Bacteria | 8364 |
| 259 | Ga0070672_100008576 | 3300005543 | Bacteria | 7001 |
| 260 | Ga0070672_100010686 | 3300005543 | Bacteria | 6377 |
| 261 | Ga0070672_100125840 | 3300005543 | Bacteria | 2102 |
| 262 | Ga0070672_100350090 | 3300005543 | Bacteria | 1259 |
| 263 | Ga0070672_100377133 | 3300005543 | Bacteria | 1213 |
| 264 | Ga0070672_100592457 | 3300005543 | Bacteria | 965 |
| 265 | Ga0070686_100295769 | 3300005544 | Bacteria | 1199 |
| 266 | Ga0070695_100421502 | 3300005545 | Bacteria | 1016 |
| 267 | Ga0070693_100355385 | 3300005547 | Bacteria | 1004 |
| 268 | Ga0070693_100570766 | 3300005547 | Bacteria | 813 |
| 269 | Ga0070665_100006131 | 3300005548 | Bacteria | 12289 |
| 270 | Ga0070665_100107301 | 3300005548 | Bacteria | 2795 |
| 271 | Ga0070665_100225136 | 3300005548 | Bacteria | 1876 |
| 272 | Ga0070665_100573091 | 3300005548 | Bacteria | 1142 |
| 273 | Ga0070665_102492028 | 3300005548 | Bacteria | 519 |
| 274 | Ga0068855_100030205 | 3300005563 | Bacteria | 6482 |
| 275 | Ga0068855_100125071 | 3300005563 | Bacteria | 2941 |
| 276 | Ga0068855_100166273 | 3300005563 | Bacteria | 2500 |
| 277 | Ga0068855_100176007 | 3300005563 | Bacteria | 2421 |
| 278 | Ga0068855_100191710 | 3300005563 | Bacteria | 2305 |
| 279 | Ga0068855_100395419 | 3300005563 | Bacteria | 1516 |
| 280 | Ga0068855_101423419 | 3300005563 | Bacteria | 714 |
| 281 | Ga0068855_101437348 | 3300005563 | Bacteria | 710 |
| 282 | Ga0070664_100021750 | 3300005564 | Bacteria | 5289 |
| 283 | Ga0070664_100037096 | 3300005564 | Bacteria | 4096 |
| 284 | Ga0070664_100050836 | 3300005564 | Bacteria | 3509 |
| 285 | Ga0070664_100179981 | 3300005564 | Bacteria | 1879 |
| 286 | Ga0070664_100319026 | 3300005564 | Bacteria | 1407 |
| 287 | Ga0070664_100451978 | 3300005564 | Bacteria | 1180 |
| 288 | Ga0070664_100552726 | 3300005564 | Bacteria | 1064 |
| 289 | Ga0068857_100018728 | 3300005577 | Bacteria | 6076 |
| 290 | Ga0068857_100045340 | 3300005577 | Bacteria | 3900 |
| 291 | Ga0068857_100115387 | 3300005577 | Bacteria | 2415 |
| 292 | Ga0068857_100426752 | 3300005577 | Bacteria | 1237 |
| 293 | Ga0068857_100600050 | 3300005577 | Bacteria | 1041 |
| 294 | Ga0068857_100787047 | 3300005577 | Bacteria | 908 |
| 295 | Ga0068857_100845678 | 3300005577 | Bacteria | 875 |
| 296 | Ga0068857_101495090 | 3300005577 | Bacteria | 658 |
| 297 | Ga0068854_100002508 | 3300005578 | Bacteria | 11387 |
| 298 | Ga0068854_100006996 | 3300005578 | Bacteria | 7195 |
| 299 | Ga0068854_100080379 | 3300005578 | Bacteria | 2405 |
| 300 | Ga0068854_100096393 | 3300005578 | Bacteria | 2210 |
| 301 | Ga0068854_100130539 | 3300005578 | Bacteria | 1918 |
| 302 | Ga0068854_100375269 | 3300005578 | Bacteria | 1170 |
| 303 | Ga0068854_100384051 | 3300005578 | Bacteria | 1158 |
| 304 | Ga0068854_100527821 | 3300005578 | Bacteria | 998 |
| 305 | Ga0068854_100754653 | 3300005578 | Bacteria | 844 |
| 306 | Ga0068856_100013314 | 3300005614 | Bacteria | 7966 |
| 307 | Ga0068856_100022023 | 3300005614 | Bacteria | 6197 |
| 308 | Ga0068856_100043233 | 3300005614 | Bacteria | 4433 |
| 309 | Ga0068856_100098167 | 3300005614 | Bacteria | 2919 |
| 310 | Ga0068856_100521922 | 3300005614 | Bacteria | 1209 |
| 311 | Ga0068856_100707698 | 3300005614 | Bacteria | 1028 |
| 312 | Ga0070702_100122681 | 3300005615 | Bacteria | 1629 |
| 313 | Ga0068852_100008757 | 3300005616 | Bacteria | 7484 |
| 314 | Ga0068852_100076296 | 3300005616 | Bacteria | 2959 |
| 315 | Ga0068852_100109246 | 3300005616 | Bacteria | 2511 |
| 316 | Ga0068852_100126238 | 3300005616 | Bacteria | 2350 |
| 317 | Ga0068852_100162554 | 3300005616 | Bacteria | 2086 |
| 318 | Ga0068852_100177678 | 3300005616 | Bacteria | 2000 |
| 319 | Ga0068852_100206166 | 3300005616 | Bacteria | 1863 |
| 320 | Ga0068852_100252479 | 3300005616 | Bacteria | 1690 |
| 321 | Ga0068852_100295609 | 3300005616 | Bacteria | 1566 |
| 322 | Ga0068852_101055902 | 3300005616 | Bacteria | 832 |
| 323 | Ga0068852_102076170 | 3300005616 | Bacteria | 590 |
| 324 | Ga0068859_100032096 | 3300005617 | Bacteria | 5275 |
| 325 | Ga0068859_100222130 | 3300005617 | Bacteria | 1977 |
| 326 | Ga0068859_100437590 | 3300005617 | Bacteria | 1404 |
| 327 | Ga0068859_100539851 | 3300005617 | Bacteria | 1261 |
| 328 | Ga0068859_100586895 | 3300005617 | Bacteria | 1208 |
| 329 | Ga0068859_101977742 | 3300005617 | Bacteria | 644 |
| 330 | Ga0068864_100011590 | 3300005618 | Bacteria | 7281 |
| 331 | Ga0068864_100015868 | 3300005618 | Bacteria | 6268 |
| 332 | Ga0068864_100032380 | 3300005618 | Bacteria | 4442 |
| 333 | Ga0068864_100078599 | 3300005618 | Bacteria | 2887 |
| 334 | Ga0068866_10035274 | 3300005718 | Bacteria | 2442 |
| 335 | Ga0068866_10245943 | 3300005718 | Bacteria | 1092 |
| 336 | Ga0068861_100000582 | 3300005719 | Bacteria | 21639 |
| 337 | Ga0068861_100000677 | 3300005719 | Bacteria | 20324 |
| 338 | Ga0068861_100119213 | 3300005719 | Bacteria | 2126 |
| 339 | Ga0068851_10005711 | 3300005834 | Bacteria | 5657 |
| 340 | Ga0068851_10079563 | 3300005834 | Bacteria | 1710 |
| 341 | Ga0068851_10086935 | 3300005834 | Bacteria | 1641 |
| 342 | Ga0068851_10112479 | 3300005834 | Bacteria | 1455 |
| 343 | Ga0068851_10405114 | 3300005834 | Bacteria | 803 |
| 344 | Ga0068851_10606699 | 3300005834 | Bacteria | 667 |
| 345 | Ga0068870_10205411 | 3300005840 | Bacteria | 1197 |
| 346 | Ga0068870_10257640 | 3300005840 | Bacteria | 1084 |
| 347 | Ga0068870_10540408 | 3300005840 | Bacteria | 783 |
| 348 | Ga0068870_10725988 | 3300005840 | Bacteria | 688 |
| 349 | Ga0068870_11226770 | 3300005840 | Bacteria | 544 |
| 350 | Ga0068863_100004173 | 3300005841 | Bacteria | 14266 |
| 351 | Ga0068863_100082398 | 3300005841 | Bacteria | 3049 |
| 352 | Ga0068863_100093622 | 3300005841 | Bacteria | 2851 |
| 353 | Ga0068863_100357715 | 3300005841 | Bacteria | 1423 |
| 354 | Ga0068858_100000560 | 3300005842 | Bacteria | 38798 |
| 355 | Ga0068858_100037529 | 3300005842 | Bacteria | 4494 |
| 356 | Ga0068858_100057084 | 3300005842 | Bacteria | 3608 |
| 357 | Ga0068858_100397457 | 3300005842 | Bacteria | 1324 |
| 358 | Ga0068858_100780252 | 3300005842 | Bacteria | 932 |
| 359 | Ga0068858_101140323 | 3300005842 | Bacteria | 766 |
| 360 | Ga0068860_100002632 | 3300005843 | Bacteria | 18674 |
| 361 | Ga0068860_100061216 | 3300005843 | Bacteria | 3577 |
| 362 | Ga0068860_100240537 | 3300005843 | Bacteria | 1761 |
| 363 | Ga0068860_100341603 | 3300005843 | Bacteria | 1472 |
| 364 | Ga0068860_101736591 | 3300005843 | Bacteria | 646 |
| 365 | Ga0068862_100010198 | 3300005844 | Bacteria | 7752 |
| 366 | Ga0068862_100070096 | 3300005844 | Bacteria | 3026 |
| 367 | Ga0068862_100823561 | 3300005844 | Bacteria | 908 |
| 368 | Ga0068862_101997397 | 3300005844 | Bacteria | 590 |
| 369 | Ga0081455_10232278 | 3300005937 | Bacteria | 1360 |
| 370 | Ga0075365_10004297 | 3300006038 | Bacteria | 7518 |
| 371 | Ga0075365_10029244 | 3300006038 | Bacteria | 3520 |
| 372 | Ga0075368_10015003 | 3300006042 | Bacteria | 2868 |
| 373 | Ga0075368_10025640 | 3300006042 | Bacteria | 2262 |
| 374 | Ga0075368_10089158 | 3300006042 | Bacteria | 1261 |
| 375 | Ga0075368_10110095 | 3300006042 | Bacteria | 1135 |
| 376 | Ga0075368_10120838 | 3300006042 | Bacteria | 1085 |
| 377 | Ga0075368_10127894 | 3300006042 | Bacteria | 1055 |
| 378 | Ga0075368_10233661 | 3300006042 | Bacteria | 783 |
| 379 | Ga0075368_10483754 | 3300006042 | Bacteria | 551 |
| 380 | Ga0075363_100001372 | 3300006048 | Bacteria | 9171 |
| 381 | Ga0075363_100011135 | 3300006048 | Bacteria | 4299 |
| 382 | Ga0075363_100036596 | 3300006048 | Bacteria | 2575 |
| 383 | Ga0075363_100083784 | 3300006048 | Bacteria | 1747 |
| 384 | Ga0075363_100083793 | 3300006048 | Bacteria | 1747 |
| 385 | Ga0075363_100135138 | 3300006048 | Bacteria | 1385 |
| 386 | Ga0075363_100145033 | 3300006048 | Bacteria | 1338 |
| 387 | Ga0075363_100245793 | 3300006048 | Bacteria | 1029 |
| 388 | Ga0075363_100532557 | 3300006048 | Bacteria | 700 |
| 389 | Ga0075363_100642870 | 3300006048 | Bacteria | 638 |
| 390 | Ga0075364_10012528 | 3300006051 | Bacteria | 5191 |
| 391 | Ga0075364_10016278 | 3300006051 | Bacteria | 4625 |
| 392 | Ga0075364_10085088 | 3300006051 | Bacteria | 2094 |
| 393 | Ga0075364_10100218 | 3300006051 | Bacteria | 1928 |
| 394 | Ga0075364_10393356 | 3300006051 | Bacteria | 946 |
| 395 | Ga0075364_10433501 | 3300006051 | Bacteria | 898 |
| 396 | Ga0075364_10457758 | 3300006051 | Bacteria | 872 |
| 397 | Ga0075364_10624434 | 3300006051 | Bacteria | 736 |
| 398 | Ga0075364_10754383 | 3300006051 | Bacteria | 664 |
| 399 | Ga0075432_10150260 | 3300006058 | Bacteria | 894 |
| 400 | Ga0075362_10005070 | 3300006177 | Bacteria | 4788 |
| 401 | Ga0075362_10006907 | 3300006177 | Bacteria | 4255 |
| 402 | Ga0075362_10006970 | 3300006177 | Bacteria | 4243 |
| 403 | Ga0075362_10018421 | 3300006177 | Bacteria | 2888 |
| 404 | Ga0075362_10024484 | 3300006177 | Bacteria | 2561 |
| 405 | Ga0075362_10114760 | 3300006177 | Bacteria | 1271 |
| 406 | Ga0075362_10125632 | 3300006177 | Bacteria | 1217 |
| 407 | Ga0075362_10135822 | 3300006177 | Bacteria | 1173 |
| 408 | Ga0075362_10150654 | 3300006177 | Bacteria | 1116 |
| 409 | Ga0075362_10288997 | 3300006177 | Bacteria | 812 |
| 410 | Ga0075362_10299394 | 3300006177 | Bacteria | 798 |
| 411 | Ga0075362_10536063 | 3300006177 | Bacteria | 601 |
| 412 | Ga0075362_10589544 | 3300006177 | Bacteria | 574 |
| 413 | Ga0075367_10005547 | 3300006178 | Bacteria | 6284 |
| 414 | Ga0075367_10012600 | 3300006178 | Bacteria | 4517 |
| 415 | Ga0075367_10026352 | 3300006178 | Bacteria | 3297 |
| 416 | Ga0075367_10036496 | 3300006178 | Bacteria | 2851 |
| 417 | Ga0075367_10037500 | 3300006178 | Bacteria | 2817 |
| 418 | Ga0075367_10062713 | 3300006178 | Bacteria | 2221 |
| 419 | Ga0075367_10069417 | 3300006178 | Bacteria | 2116 |
| 420 | Ga0075367_10111626 | 3300006178 | Bacteria | 1678 |
| 421 | Ga0075367_10574567 | 3300006178 | Bacteria | 716 |
| 422 | Ga0075367_10846119 | 3300006178 | Bacteria | 583 |
| 423 | Ga0075369_10001852 | 3300006186 | Bacteria | 7383 |
| 424 | Ga0075369_10095160 | 3300006186 | Bacteria | 1332 |
| 425 | Ga0075369_10097573 | 3300006186 | Bacteria | 1316 |
| 426 | Ga0075369_10136040 | 3300006186 | Bacteria | 1119 |
| 427 | Ga0075366_10001677 | 3300006195 | Bacteria | 11115 |
| 428 | Ga0075366_10002935 | 3300006195 | Bacteria | 8866 |
| 429 | Ga0075366_10003541 | 3300006195 | Bacteria | 8255 |
| 430 | Ga0075366_10004492 | 3300006195 | Bacteria | 7483 |
| 431 | Ga0075366_10005743 | 3300006195 | Bacteria | 6734 |
| 432 | Ga0075366_10009910 | 3300006195 | Bacteria | 5332 |
| 433 | Ga0075366_10010575 | 3300006195 | Bacteria | 5180 |
| 434 | Ga0075366_10011468 | 3300006195 | Bacteria | 5006 |
| 435 | Ga0075366_10013487 | 3300006195 | Bacteria | 4654 |
| 436 | Ga0075366_10033053 | 3300006195 | Bacteria | 3046 |
| 437 | Ga0075366_10034984 | 3300006195 | Bacteria | 2961 |
| 438 | Ga0075366_10043108 | 3300006195 | Bacteria | 2672 |
| 439 | Ga0075366_10048738 | 3300006195 | Bacteria | 2513 |
| 440 | Ga0075366_10051847 | 3300006195 | Bacteria | 2438 |
| 441 | Ga0075366_10052964 | 3300006195 | Bacteria | 2411 |
| 442 | Ga0075366_10091551 | 3300006195 | Bacteria | 1822 |
| 443 | Ga0075366_10096603 | 3300006195 | Bacteria | 1771 |
| 444 | Ga0075366_10101808 | 3300006195 | Bacteria | 1724 |
| 445 | Ga0075366_10106830 | 3300006195 | Bacteria | 1683 |
| 446 | Ga0075366_10148761 | 3300006195 | Bacteria | 1418 |
| 447 | Ga0075366_10155628 | 3300006195 | Bacteria | 1384 |
| 448 | Ga0075366_10196689 | 3300006195 | Bacteria | 1226 |
| 449 | Ga0075366_10201532 | 3300006195 | Bacteria | 1211 |
| 450 | Ga0075366_10219966 | 3300006195 | Bacteria | 1157 |
| 451 | Ga0075366_10257032 | 3300006195 | Bacteria | 1066 |
| 452 | Ga0075366_10278101 | 3300006195 | Bacteria | 1023 |
| 453 | Ga0075366_10284664 | 3300006195 | Bacteria | 1010 |
| 454 | Ga0075366_10307972 | 3300006195 | Bacteria | 969 |
| 455 | Ga0075366_10319902 | 3300006195 | Bacteria | 950 |
| 456 | Ga0075366_10389133 | 3300006195 | Bacteria | 858 |
| 457 | Ga0075366_10441189 | 3300006195 | Bacteria | 803 |
| 458 | Ga0075366_10879797 | 3300006195 | Bacteria | 558 |
| 459 | Ga0075366_11018047 | 3300006195 | Bacteria | 517 |
| 460 | Ga0097621_100011918 | 3300006237 | Bacteria | 6430 |
| 461 | Ga0097621_100040679 | 3300006237 | Bacteria | 3738 |
| 462 | Ga0097621_100064071 | 3300006237 | Bacteria | 3022 |
| 463 | Ga0097621_100107140 | 3300006237 | Bacteria | 2358 |
| 464 | Ga0097621_100134827 | 3300006237 | Bacteria | 2105 |
| 465 | Ga0097621_100137354 | 3300006237 | Bacteria | 2086 |
| 466 | Ga0097621_100498620 | 3300006237 | Bacteria | 1103 |
| 467 | Ga0097621_101343929 | 3300006237 | Bacteria | 676 |
| 468 | Ga0075370_10000124 | 3300006353 | Bacteria | 25565 |
| 469 | Ga0075370_10000159 | 3300006353 | Bacteria | 22949 |
| 470 | Ga0075370_10001473 | 3300006353 | Bacteria | 10252 |
| 471 | Ga0075370_10003561 | 3300006353 | Bacteria | 7444 |
| 472 | Ga0075370_10004375 | 3300006353 | Bacteria | 6848 |
| 473 | Ga0075370_10008986 | 3300006353 | Bacteria | 5167 |
| 474 | Ga0075370_10011875 | 3300006353 | Bacteria | 4586 |
| 475 | Ga0075370_10012982 | 3300006353 | Bacteria | 4418 |
| 476 | Ga0075370_10018684 | 3300006353 | Bacteria | 3762 |
| 477 | Ga0075370_10024332 | 3300006353 | Bacteria | 3344 |
| 478 | Ga0075370_10031609 | 3300006353 | Bacteria | 2955 |
| 479 | Ga0075370_10041223 | 3300006353 | Bacteria | 2606 |
| 480 | Ga0075370_10044762 | 3300006353 | Bacteria | 2502 |
| 481 | Ga0075370_10049244 | 3300006353 | Bacteria | 2388 |
| 482 | Ga0075370_10081886 | 3300006353 | Bacteria | 1855 |
| 483 | Ga0075370_10083339 | 3300006353 | Bacteria | 1839 |
| 484 | Ga0075370_10103526 | 3300006353 | Bacteria | 1649 |
| 485 | Ga0075370_10150489 | 3300006353 | Bacteria | 1364 |
| 486 | Ga0075370_10170120 | 3300006353 | Bacteria | 1281 |
| 487 | Ga0075370_10539614 | 3300006353 | Bacteria | 705 |
| 488 | Ga0075370_10877565 | 3300006353 | Bacteria | 548 |
| 489 | Ga0068871_100044806 | 3300006358 | Bacteria | 3559 |
| 490 | Ga0068871_100108518 | 3300006358 | Bacteria | 2333 |
| 491 | Ga0068871_100526870 | 3300006358 | Bacteria | 1068 |
| 492 | Ga0075429_101499775 | 3300006880 | Bacteria | 587 |
| 493 | Ga0068865_100040309 | 3300006881 | Bacteria | 3172 |
| 494 | Ga0068865_100058476 | 3300006881 | Bacteria | 2693 |
| 495 | Ga0068865_100168495 | 3300006881 | Bacteria | 1677 |
| 496 | Ga0068865_100459002 | 3300006881 | Bacteria | 1055 |
| 497 | Ga0068865_100749447 | 3300006881 | Bacteria | 839 |
| 498 | Ga0097620_100032096 | 3300006931 | Bacteria | 5275 |
| 499 | Ga0097620_100222131 | 3300006931 | Bacteria | 1977 |
| 500 | Ga0097620_100437573 | 3300006931 | Bacteria | 1404 |
| 501 | Ga0097620_100539782 | 3300006931 | Bacteria | 1261 |
| 502 | Ga0097620_100586914 | 3300006931 | Bacteria | 1208 |
| 503 | Ga0097620_101977887 | 3300006931 | Bacteria | 644 |
| 504 | Ga0099823_1058477 | 3300006944 | Bacteria | 2082 |
| 505 | Ga0099826_10029080 | 3300006948 | Bacteria | 4032 |
| 506 | Ga0099826_10131993 | 3300006948 | Bacteria | 1455 |
| 507 | Ga0075435_100640821 | 3300007076 | Bacteria | 922 |
| 508 | Ga0105251_10002173 | 3300009011 | Bacteria | 15740 |
| 509 | Ga0105251_10017441 | 3300009011 | Bacteria | 3847 |
| 510 | Ga0105251_10058772 | 3300009011 | Bacteria | 1815 |
| 511 | Ga0105244_10000329 | 3300009036 | Bacteria | 45045 |
| 512 | Ga0105244_10001834 | 3300009036 | Bacteria | 16612 |
| 513 | Ga0105244_10024925 | 3300009036 | Bacteria | 3258 |
| 514 | Ga0105244_10037053 | 3300009036 | Bacteria | 2551 |
| 515 | Ga0105244_10368012 | 3300009036 | Bacteria | 662 |
| 516 | Ga0105250_10000105 | 3300009092 | Bacteria | 75608 |
| 517 | Ga0105250_10129259 | 3300009092 | Bacteria | 1042 |
| 518 | Ga0105240_10017700 | 3300009093 | Bacteria | 9595 |
| 519 | Ga0105240_10020431 | 3300009093 | Bacteria | 8833 |
| 520 | Ga0105240_10022278 | 3300009093 | Bacteria | 8403 |
| 521 | Ga0105240_10336480 | 3300009093 | Bacteria | 1716 |
| 522 | Ga0105240_11672081 | 3300009093 | Bacteria | 665 |
| 523 | Ga0111539_11096507 | 3300009094 | Bacteria | 925 |
| 524 | Ga0111539_11532128 | 3300009094 | Bacteria | 773 |
| 525 | Ga0111539_12951320 | 3300009094 | Bacteria | 550 |
| 526 | Ga0105245_10150078 | 3300009098 | Bacteria | 2203 |
| 527 | Ga0105245_10172687 | 3300009098 | Bacteria | 2059 |
| 528 | Ga0105245_10245508 | 3300009098 | Bacteria | 1738 |
| 529 | Ga0105245_10485053 | 3300009098 | Bacteria | 1250 |
| 530 | Ga0105245_10669374 | 3300009098 | Bacteria | 1069 |
| 531 | Ga0105245_11204771 | 3300009098 | Bacteria | 805 |
| 532 | Ga0105245_11594832 | 3300009098 | Bacteria | 704 |
| 533 | Ga0105247_10441827 | 3300009101 | Bacteria | 936 |
| 534 | Ga0105247_11257926 | 3300009101 | Bacteria | 592 |
| 535 | Ga0114129_10051750 | 3300009147 | Bacteria | 5765 |
| 536 | Ga0105243_10000486 | 3300009148 | Bacteria | 40508 |
| 537 | Ga0105243_10003231 | 3300009148 | Bacteria | 13312 |
| 538 | Ga0105243_10003279 | 3300009148 | Bacteria | 13149 |
| 539 | Ga0105243_10021379 | 3300009148 | Bacteria | 4910 |
| 540 | Ga0105243_10105356 | 3300009148 | Bacteria | 2349 |
| 541 | Ga0105243_10120855 | 3300009148 | Bacteria | 2208 |
| 542 | Ga0105243_10335147 | 3300009148 | Bacteria | 1383 |
| 543 | Ga0105243_10415518 | 3300009148 | Bacteria | 1253 |
| 544 | Ga0105243_11059092 | 3300009148 | Bacteria | 817 |
| 545 | Ga0105243_11142834 | 3300009148 | Bacteria | 789 |
| 546 | Ga0105243_12170737 | 3300009148 | Bacteria | 592 |
| 547 | Ga0105241_10003239 | 3300009174 | Bacteria | 12103 |
| 548 | Ga0105241_10401883 | 3300009174 | Bacteria | 1202 |
| 549 | Ga0105241_10724360 | 3300009174 | Bacteria | 910 |
| 550 | Ga0105241_10935623 | 3300009174 | Bacteria | 807 |
| 551 | Ga0105241_11873201 | 3300009174 | Bacteria | 587 |
| 552 | Ga0105241_12604394 | 3300009174 | Bacteria | 508 |
| 553 | Ga0105242_10961652 | 3300009176 | Bacteria | 859 |
| 554 | Ga0105242_11425078 | 3300009176 | Bacteria | 721 |
| 555 | Ga0105248_10000445 | 3300009177 | Bacteria | 46980 |
| 556 | Ga0105248_10017866 | 3300009177 | Bacteria | 7827 |
| 557 | Ga0105248_10025421 | 3300009177 | Bacteria | 6583 |
| 558 | Ga0105248_10046075 | 3300009177 | Bacteria | 4887 |
| 559 | Ga0105248_10409042 | 3300009177 | Bacteria | 1528 |
| 560 | Ga0105248_10728412 | 3300009177 | Bacteria | 1119 |
| 561 | Ga0105248_11419170 | 3300009177 | Bacteria | 786 |
| 562 | Ga0105248_11874896 | 3300009177 | Bacteria | 680 |
| 563 | Ga0105248_12224160 | 3300009177 | Bacteria | 624 |
| 564 | Ga0105237_10000548 | 3300009545 | Bacteria | 52739 |
| 565 | Ga0105237_10015839 | 3300009545 | Bacteria | 7841 |
| 566 | Ga0105237_10182787 | 3300009545 | Bacteria | 2097 |
| 567 | Ga0105237_10231058 | 3300009545 | Bacteria | 1851 |
| 568 | Ga0105237_10341422 | 3300009545 | Bacteria | 1502 |
| 569 | Ga0105237_10445838 | 3300009545 | Bacteria | 1300 |
| 570 | Ga0105237_10738902 | 3300009545 | Bacteria | 990 |
| 571 | Ga0105237_10923354 | 3300009545 | Bacteria | 880 |
| 572 | Ga0105238_10020973 | 3300009551 | Bacteria | 6657 |
| 573 | Ga0105238_10136657 | 3300009551 | Bacteria | 2429 |
| 574 | Ga0105238_10161939 | 3300009551 | Bacteria | 2213 |
| 575 | Ga0105238_10650503 | 3300009551 | Bacteria | 1064 |
| 576 | Ga0105249_10038755 | 3300009553 | Bacteria | 4325 |
| 577 | Ga0105249_10052334 | 3300009553 | Bacteria | 3728 |
| 578 | Ga0105249_10177219 | 3300009553 | Bacteria | 2071 |
| 579 | Ga0105249_10318349 | 3300009553 | Bacteria | 1566 |
| 580 | Ga0105249_10336225 | 3300009553 | Bacteria | 1525 |
| 581 | Ga0105249_13095095 | 3300009553 | Bacteria | 534 |
| 582 | Ga0105239_10001569 | 3300010375 | Bacteria | 30171 |
| 583 | Ga0105239_10052411 | 3300010375 | Bacteria | 4474 |
| 584 | Ga0105239_10174209 | 3300010375 | Bacteria | 2406 |
| 585 | Ga0105239_10274852 | 3300010375 | Bacteria | 1895 |
| 586 | Ga0105239_10280880 | 3300010375 | Bacteria | 1874 |
| 587 | Ga0105239_10777111 | 3300010375 | Bacteria | 1097 |
| 588 | Ga0105239_13137326 | 3300010375 | Bacteria | 538 |
| 589 | Ga0105246_10007754 | 3300011119 | Bacteria | 6590 |
| 590 | Ga0105246_10200957 | 3300011119 | Bacteria | 1549 |
| 591 | Ga0105246_10375419 | 3300011119 | Bacteria | 1173 |
| 592 | Ga0105246_11159263 | 3300011119 | Bacteria | 709 |
| 593 | Ga0105246_11783863 | 3300011119 | Bacteria | 587 |
| 594 | Ga0157322_1021901 | 3300012490 | Bacteria | 622 |
| 595 | Ga0157319_1000006 | 3300012497 | Bacteria | 361506 |
| 596 | Ga0157347_1003675 | 3300012502 | Bacteria | 1389 |
| 597 | Ga0157339_1024310 | 3300012505 | Bacteria | 667 |
| 598 | Ga0157342_1018967 | 3300012507 | Bacteria | 784 |
| 599 | Ga0157327_1046646 | 3300012512 | Bacteria | 602 |
| 600 | Ga0157373_10004477 | 3300013100 | Bacteria | 10519 |
| 601 | Ga0157373_10005848 | 3300013100 | Bacteria | 9205 |
| 602 | Ga0157373_10037609 | 3300013100 | Bacteria | 3469 |
| 603 | Ga0157373_10103380 | 3300013100 | Bacteria | 2004 |
| 604 | Ga0157373_10115188 | 3300013100 | Bacteria | 1890 |
| 605 | Ga0157373_10151556 | 3300013100 | Bacteria | 1631 |
| 606 | Ga0157371_10099143 | 3300013102 | Bacteria | 2066 |
| 607 | Ga0157371_10255462 | 3300013102 | Bacteria | 1262 |
| 608 | Ga0157371_10616305 | 3300013102 | Bacteria | 808 |
| 609 | Ga0157371_10722570 | 3300013102 | Bacteria | 747 |
| 610 | Ga0157371_11100124 | 3300013102 | Bacteria | 609 |
| 611 | Ga0157370_10001046 | 3300013104 | Bacteria | 34825 |
| 612 | Ga0157370_10014128 | 3300013104 | Bacteria | 8189 |
| 613 | Ga0157370_10217371 | 3300013104 | Bacteria | 1771 |
| 614 | Ga0157370_10312903 | 3300013104 | Bacteria | 1449 |
| 615 | Ga0157370_10353690 | 3300013104 | Bacteria | 1354 |
| 616 | Ga0157370_10923045 | 3300013104 | Bacteria | 792 |
| 617 | Ga0157369_10000981 | 3300013105 | Bacteria | 36190 |
| 618 | Ga0157369_10014051 | 3300013105 | Bacteria | 9045 |
| 619 | Ga0157369_10017535 | 3300013105 | Bacteria | 8045 |
| 620 | Ga0157369_10019561 | 3300013105 | Bacteria | 7576 |
| 621 | Ga0157369_10374804 | 3300013105 | Bacteria | 1477 |
| 622 | Ga0157369_10397815 | 3300013105 | Bacteria | 1429 |
| 623 | Ga0157369_11428250 | 3300013105 | Bacteria | 704 |
| 624 | Ga0157374_10000032 | 3300013296 | Bacteria | 202485 |
| 625 | Ga0157374_10005865 | 3300013296 | Bacteria | 10372 |
| 626 | Ga0157374_10014186 | 3300013296 | Bacteria | 6967 |
| 627 | Ga0157374_10145876 | 3300013296 | Bacteria | 2299 |
| 628 | Ga0157374_10277004 | 3300013296 | Bacteria | 1655 |
| 629 | Ga0157374_10380304 | 3300013296 | Bacteria | 1406 |
| 630 | Ga0157374_10419587 | 3300013296 | Bacteria | 1337 |
| 631 | Ga0157378_10000558 | 3300013297 | Bacteria | 35454 |
| 632 | Ga0157378_10481027 | 3300013297 | Bacteria | 1237 |
| 633 | Ga0157378_10511813 | 3300013297 | Bacteria | 1201 |
| 634 | Ga0157378_10831066 | 3300013297 | Bacteria | 951 |
| 635 | Ga0157378_10835110 | 3300013297 | Bacteria | 949 |
| 636 | Ga0157378_11412386 | 3300013297 | Bacteria | 739 |
| 637 | Ga0157378_11729265 | 3300013297 | Bacteria | 673 |
| 638 | Ga0157378_11757097 | 3300013297 | Bacteria | 668 |
| 639 | Ga0157378_12632226 | 3300013297 | Bacteria | 555 |
| 640 | Ga0157378_12638068 | 3300013297 | Bacteria | 555 |
| 641 | Ga0163162_10005747 | 3300013306 | Bacteria | 11998 |
| 642 | Ga0163162_10045656 | 3300013306 | Bacteria | 4389 |
| 643 | Ga0163162_10109110 | 3300013306 | Bacteria | 2864 |
| 644 | Ga0163162_10223961 | 3300013306 | Bacteria | 2010 |
| 645 | Ga0163162_10232252 | 3300013306 | Bacteria | 1975 |
| 646 | Ga0163162_10609804 | 3300013306 | Bacteria | 1217 |
| 647 | Ga0163162_11187961 | 3300013306 | Bacteria | 865 |
| 648 | Ga0157372_10019251 | 3300013307 | Bacteria | 7351 |
| 649 | Ga0157372_10188302 | 3300013307 | Bacteria | 2390 |
| 650 | Ga0157372_10276126 | 3300013307 | Bacteria | 1953 |
| 651 | Ga0157372_10372342 | 3300013307 | Bacteria | 1664 |
| 652 | Ga0157372_10388386 | 3300013307 | Bacteria | 1626 |
| 653 | Ga0157372_10712918 | 3300013307 | Bacteria | 1167 |
| 654 | Ga0157372_11133255 | 3300013307 | Bacteria | 905 |
| 655 | Ga0157372_11258917 | 3300013307 | Bacteria | 854 |
| 656 | Ga0157375_10013127 | 3300013308 | Bacteria | 7361 |
| 657 | Ga0157375_10031297 | 3300013308 | Bacteria | 5027 |
| 658 | Ga0157375_10059867 | 3300013308 | Bacteria | 3774 |
| 659 | Ga0157375_10068447 | 3300013308 | Bacteria | 3552 |
| 660 | Ga0157375_10106464 | 3300013308 | Bacteria | 2896 |
| 661 | Ga0157375_10119991 | 3300013308 | Bacteria | 2738 |
| 662 | Ga0157375_10187002 | 3300013308 | Bacteria | 2225 |
| 663 | Ga0157375_10325666 | 3300013308 | Bacteria | 1701 |
| 664 | Ga0157375_10548459 | 3300013308 | Bacteria | 1318 |
| 665 | Ga0157375_10723557 | 3300013308 | Bacteria | 1148 |
| 666 | Ga0157375_11604339 | 3300013308 | Bacteria | 769 |
| 667 | Ga0163163_10129383 | 3300014325 | Bacteria | 2565 |
| 668 | Ga0163163_10272395 | 3300014325 | Bacteria | 1744 |
| 669 | Ga0163163_10817455 | 3300014325 | Bacteria | 995 |
| 670 | Ga0163163_11322412 | 3300014325 | Bacteria | 783 |
| 671 | Ga0157380_10053803 | 3300014326 | Bacteria | 3192 |
| 672 | Ga0157380_10228832 | 3300014326 | Bacteria | 1668 |
| 673 | Ga0157380_10320589 | 3300014326 | Bacteria | 1436 |
| 674 | Ga0157380_10571025 | 3300014326 | Bacteria | 1113 |
| 675 | Ga0157380_11716265 | 3300014326 | Bacteria | 686 |
| 676 | Ga0157380_12956872 | 3300014326 | Bacteria | 541 |
| 677 | Ga0182008_10001960 | 3300014497 | Bacteria | 13217 |
| 678 | Ga0182008_10009359 | 3300014497 | Bacteria | 5292 |
| 679 | Ga0182008_10116948 | 3300014497 | Bacteria | 1323 |
| 680 | Ga0182008_10431370 | 3300014497 | Bacteria | 713 |
| 681 | Ga0182008_10983333 | 3300014497 | Bacteria | 502 |
| 682 | Ga0157377_10000028 | 3300014745 | Bacteria | 134810 |
| 683 | Ga0157377_10077811 | 3300014745 | Bacteria | 1932 |
| 684 | Ga0157379_10035995 | 3300014968 | Bacteria | 4414 |
| 685 | Ga0157379_10043963 | 3300014968 | Bacteria | 3989 |
| 686 | Ga0157379_10051052 | 3300014968 | Bacteria | 3694 |
| 687 | Ga0157379_10107677 | 3300014968 | Bacteria | 2502 |
| 688 | Ga0157379_10142242 | 3300014968 | Bacteria | 2163 |
| 689 | Ga0157379_10181011 | 3300014968 | Bacteria | 1904 |
| 690 | Ga0157379_10242497 | 3300014968 | Bacteria | 1635 |
| 691 | Ga0157379_10290484 | 3300014968 | Bacteria | 1489 |
| 692 | Ga0157379_11078161 | 3300014968 | Bacteria | 769 |
| 693 | Ga0157376_10009600 | 3300014969 | Bacteria | 7037 |
| 694 | Ga0157376_10048381 | 3300014969 | Bacteria | 3516 |
| 695 | Ga0157376_10092691 | 3300014969 | Bacteria | 2620 |
| 696 | Ga0157376_10187310 | 3300014969 | Bacteria | 1895 |
| 697 | Ga0157376_10576089 | 3300014969 | Bacteria | 1117 |
| 698 | Ga0157376_10671608 | 3300014969 | Bacteria | 1039 |
| 699 | Ga0157376_11200374 | 3300014969 | Bacteria | 787 |
| 700 | Ga0157376_11914755 | 3300014969 | Bacteria | 630 |
| 701 | Ga0182006_1001354 | 3300015261 | Bacteria | 14997 |
| 702 | Ga0182006_1010741 | 3300015261 | Bacteria | 4056 |
| 703 | Ga0182006_1011055 | 3300015261 | Bacteria | 3985 |
| 704 | Ga0182006_1030375 | 3300015261 | Bacteria | 2184 |
| 705 | Ga0182006_1071057 | 3300015261 | Bacteria | 1291 |
| 706 | Ga0182007_10001767 | 3300015262 | Bacteria | 11326 |
| 707 | Ga0182007_10021863 | 3300015262 | Bacteria | 2265 |
| 708 | Ga0182007_10111558 | 3300015262 | Bacteria | 910 |
| 709 | Ga0182007_10270552 | 3300015262 | Bacteria | 615 |
| 710 | Ga0182005_1029694 | 3300015265 | Bacteria | 1491 |
| 711 | Ga0182005_1091376 | 3300015265 | Bacteria | 847 |
| 712 | Ga0182005_1297163 | 3300015265 | Bacteria | 509 |
| 713 | Ga0163161_10001250 | 3300017792 | Bacteria | 19010 |
| 714 | Ga0163161_10023133 | 3300017792 | Bacteria | 4380 |
| 715 | Ga0163161_10048400 | 3300017792 | Bacteria | 3070 |
| 716 | Ga0163161_10196275 | 3300017792 | Bacteria | 1554 |
| 717 | Ga0163161_10216770 | 3300017792 | Bacteria | 1481 |
| 718 | Ga0163161_10669334 | 3300017792 | Bacteria | 862 |
| 719 | Ga0163161_10675892 | 3300017792 | Bacteria | 858 |
| 720 | Ga0206355_1269035 | 3300020076 | Bacteria | 762 |
| 721 | Ga0206352_10797362 | 3300020078 | Bacteria | 510 |
| 722 | Ga0213872_10000011 | 3300021361 | Bacteria | 194139 |
| 723 | Ga0213872_10000043 | 3300021361 | Bacteria | 117678 |
| 724 | Ga0213872_10000272 | 3300021361 | Bacteria | 44319 |
| 725 | Ga0213872_10040543 | 3300021361 | Bacteria | 2126 |
| 726 | Ga0213872_10060109 | 3300021361 | Bacteria | 1719 |
| 727 | Ga0213872_10074479 | 3300021361 | Bacteria | 1528 |
| 728 | Ga0213872_10075054 | 3300021361 | Bacteria | 1522 |
| 729 | Ga0213872_10227793 | 3300021361 | Bacteria | 791 |
| 730 | Ga0213876_10287255 | 3300021384 | Bacteria | 874 |
| 731 | Ga0209435_125931 | 3300025206 | Bacteria | 545 |
| 732 | Ga0209436_101446 | 3300025208 | Bacteria | 8293 |
| 733 | Ga0209784_100938 | 3300025224 | Bacteria | 5660 |
| 734 | Ga0209566_100561 | 3300025225 | Bacteria | 24375 |
| 735 | Ga0209674_100003 | 3300025226 | Bacteria | 2196646 |
| 736 | Ga0209674_100122 | 3300025226 | Bacteria | 131720 |
| 737 | Ga0209672_100191 | 3300025228 | Bacteria | 49747 |
| 738 | Ga0209672_100222 | 3300025228 | Bacteria | 44005 |
| 739 | Ga0209147_100435 | 3300025229 | Bacteria | 26860 |
| 740 | Ga0209563_100005 | 3300025230 | Bacteria | 1774893 |
| 741 | Ga0209563_100017 | 3300025230 | Bacteria | 796449 |
| 742 | Ga0209563_103222 | 3300025230 | Bacteria | 3436 |
| 743 | Ga0209258_100048 | 3300025242 | Bacteria | 365881 |
| 744 | Ga0209258_100559 | 3300025242 | Bacteria | 32575 |
| 745 | Ga0209258_102813 | 3300025242 | Bacteria | 4173 |
| 746 | Ga0207425_1000786 | 3300025245 | Bacteria | 16194 |
| 747 | Ga0207425_1003597 | 3300025245 | Bacteria | 4906 |
| 748 | Ga0209646_1000022 | 3300025246 | Bacteria | 446621 |
| 749 | Ga0209646_1000271 | 3300025246 | Bacteria | 47713 |
| 750 | Ga0209026_1000085 | 3300025250 | Bacteria | 185778 |
| 751 | Ga0209026_1004183 | 3300025250 | Bacteria | 4407 |
| 752 | Ga0209677_101546 | 3300025253 | Bacteria | 9813 |
| 753 | Ga0209677_101615 | 3300025253 | Bacteria | 9505 |
| 754 | Ga0209677_103383 | 3300025253 | Bacteria | 5220 |
| 755 | Ga0209148_1000021 | 3300025254 | Bacteria | 714645 |
| 756 | Ga0209148_1000040 | 3300025254 | Bacteria | 473531 |
| 757 | Ga0209148_1012316 | 3300025254 | Bacteria | 1567 |
| 758 | Ga0209759_1000068 | 3300025256 | Bacteria | 183479 |
| 759 | Ga0209759_1001746 | 3300025256 | Bacteria | 11158 |
| 760 | Ga0209759_1001796 | 3300025256 | Bacteria | 10868 |
| 761 | Ga0209759_1002047 | 3300025256 | Bacteria | 9476 |
| 762 | Ga0209759_1021973 | 3300025256 | Bacteria | 1437 |
| 763 | Ga0209759_1031313 | 3300025256 | Bacteria | 1037 |
| 764 | Ga0209129_1000007 | 3300025258 | Bacteria | 771325 |
| 765 | Ga0209129_1000369 | 3300025258 | Bacteria | 36698 |
| 766 | Ga0209129_1001205 | 3300025258 | Bacteria | 14869 |
| 767 | Ga0209129_1024238 | 3300025258 | Bacteria | 1070 |
| 768 | Ga0209565_1000153 | 3300025263 | Bacteria | 92909 |
| 769 | Ga0209565_1001390 | 3300025263 | Bacteria | 10816 |
| 770 | Ga0209565_1003425 | 3300025263 | Bacteria | 5136 |
| 771 | Ga0209565_1078898 | 3300025263 | Bacteria | 544 |
| 772 | Ga0209455_1000643 | 3300025272 | Bacteria | 21407 |
| 773 | Ga0209455_1001880 | 3300025272 | Bacteria | 8751 |
| 774 | Ga0209673_1000423 | 3300025273 | Bacteria | 73682 |
| 775 | Ga0209673_1000566 | 3300025273 | Bacteria | 59095 |
| 776 | Ga0209673_1000801 | 3300025273 | Bacteria | 41669 |
| 777 | Ga0209673_1006937 | 3300025273 | Bacteria | 5353 |
| 778 | Ga0209673_1013020 | 3300025273 | Bacteria | 3309 |
| 779 | Ga0209673_1013271 | 3300025273 | Bacteria | 3261 |
| 780 | Ga0209673_1013645 | 3300025273 | Bacteria | 3195 |
| 781 | Ga0209673_1046556 | 3300025273 | Bacteria | 1183 |
| 782 | Ga0209130_1000953 | 3300025284 | Bacteria | 22898 |
| 783 | Ga0209130_1001018 | 3300025284 | Bacteria | 21612 |
| 784 | Ga0209130_1001734 | 3300025284 | Bacteria | 13039 |
| 785 | Ga0209675_1000150 | 3300025291 | Bacteria | 92909 |
| 786 | Ga0209675_1001481 | 3300025291 | Bacteria | 13497 |
| 787 | Ga0209675_1001635 | 3300025291 | Bacteria | 12545 |
| 788 | Ga0209675_1002237 | 3300025291 | Bacteria | 10110 |
| 789 | Ga0209675_1002884 | 3300025291 | Bacteria | 8522 |
| 790 | Ga0209676_1000004 | 3300025292 | Bacteria | 1138360 |
| 791 | Ga0209676_1000735 | 3300025292 | Bacteria | 44818 |
| 792 | Ga0209676_1001743 | 3300025292 | Bacteria | 18592 |
| 793 | Ga0209676_1002326 | 3300025292 | Bacteria | 13761 |
| 794 | Ga0209676_1004231 | 3300025292 | Bacteria | 8115 |
| 795 | Ga0209676_1007213 | 3300025292 | Bacteria | 5289 |
| 796 | Ga0209676_1030459 | 3300025292 | Bacteria | 1649 |
| 797 | Ga0209025_1000057 | 3300025294 | Bacteria | 314601 |
| 798 | Ga0209025_1000217 | 3300025294 | Bacteria | 137909 |
| 799 | Ga0209025_1000278 | 3300025294 | Bacteria | 117718 |
| 800 | Ga0209025_1001179 | 3300025294 | Bacteria | 36980 |
| 801 | Ga0209025_1010012 | 3300025294 | Bacteria | 6495 |
| 802 | Ga0209025_1018495 | 3300025294 | Bacteria | 3941 |
| 803 | Ga0209025_1124121 | 3300025294 | Bacteria | 764 |
| 804 | Ga0209564_1000003 | 3300025295 | Bacteria | 1585848 |
| 805 | Ga0209564_1000046 | 3300025295 | Bacteria | 373787 |
| 806 | Ga0209564_1000915 | 3300025295 | Bacteria | 38566 |
| 807 | Ga0209564_1001044 | 3300025295 | Bacteria | 33893 |
| 808 | Ga0209564_1015210 | 3300025295 | Bacteria | 3147 |
| 809 | Ga0209564_1077190 | 3300025295 | Bacteria | 665 |
| 810 | Ga0209758_1000025 | 3300025297 | Bacteria | 586687 |
| 811 | Ga0209758_1000709 | 3300025297 | Bacteria | 49238 |
| 812 | Ga0209758_1002316 | 3300025297 | Bacteria | 19694 |
| 813 | Ga0209758_1020934 | 3300025297 | Bacteria | 3070 |
| 814 | Ga0209050_1000002 | 3300025298 | Bacteria | 1792849 |
| 815 | Ga0209050_1000861 | 3300025298 | Bacteria | 41048 |
| 816 | Ga0209050_1001823 | 3300025298 | Bacteria | 20745 |
| 817 | Ga0209050_1002866 | 3300025298 | Bacteria | 13651 |
| 818 | Ga0209050_1002874 | 3300025298 | Bacteria | 13626 |
| 819 | Ga0209050_1003318 | 3300025298 | Bacteria | 12018 |
| 820 | Ga0209050_1035133 | 3300025298 | Bacteria | 1487 |
| 821 | Ga0209050_1037278 | 3300025298 | Bacteria | 1405 |
| 822 | Ga0209050_1097324 | 3300025298 | Bacteria | 589 |
| 823 | Ga0209256_1000067 | 3300025299 | Bacteria | 246812 |
| 824 | Ga0209256_1000366 | 3300025299 | Bacteria | 72685 |
| 825 | Ga0209256_1005597 | 3300025299 | Bacteria | 7138 |
| 826 | Ga0209256_1008454 | 3300025299 | Bacteria | 4769 |
| 827 | Ga0209256_1041041 | 3300025299 | Bacteria | 1178 |
| 828 | Ga0209256_1042846 | 3300025299 | Bacteria | 1140 |
| 829 | Ga0209256_1094527 | 3300025299 | Bacteria | 629 |
| 830 | Ga0207426_1000001 | 3300025302 | Bacteria | 1341301 |
| 831 | Ga0207426_1000028 | 3300025302 | Bacteria | 483955 |
| 832 | Ga0207426_1020977 | 3300025302 | Bacteria | 2263 |
| 833 | Ga0209051_1000002 | 3300025303 | Bacteria | 1631846 |
| 834 | Ga0209051_1000049 | 3300025303 | Bacteria | 287483 |
| 835 | Ga0209051_1000096 | 3300025303 | Bacteria | 167399 |
| 836 | Ga0209051_1000532 | 3300025303 | Bacteria | 47250 |
| 837 | Ga0209051_1000913 | 3300025303 | Bacteria | 29387 |
| 838 | Ga0209051_1004959 | 3300025303 | Bacteria | 7955 |
| 839 | Ga0209051_1007617 | 3300025303 | Bacteria | 5892 |
| 840 | Ga0209051_1010944 | 3300025303 | Bacteria | 4527 |
| 841 | Ga0209051_1013466 | 3300025303 | Bacteria | 3892 |
| 842 | Ga0209051_1035263 | 3300025303 | Bacteria | 1864 |
| 843 | Ga0209051_1107638 | 3300025303 | Bacteria | 734 |
| 844 | Ga0209257_1000002 | 3300025304 | Bacteria | 1767052 |
| 845 | Ga0209257_1000072 | 3300025304 | Bacteria | 332791 |
| 846 | Ga0209257_1005501 | 3300025304 | Bacteria | 8849 |
| 847 | Ga0209257_1005948 | 3300025304 | Bacteria | 8192 |
| 848 | Ga0209257_1012640 | 3300025304 | Bacteria | 3871 |
| 849 | Ga0209257_1013234 | 3300025304 | Bacteria | 3698 |
| 850 | Ga0209257_1021343 | 3300025304 | Bacteria | 2356 |
| 851 | Ga0207697_10054088 | 3300025315 | Bacteria | 1663 |
| 852 | Ga0207697_10101513 | 3300025315 | Bacteria | 1226 |
| 853 | Ga0207697_10455412 | 3300025315 | Bacteria | 567 |
| 854 | Ga0207656_10012183 | 3300025321 | Bacteria | 3265 |
| 855 | Ga0207656_10029824 | 3300025321 | Bacteria | 2250 |
| 856 | Ga0207656_10071677 | 3300025321 | Bacteria | 1541 |
| 857 | Ga0207656_10111356 | 3300025321 | Bacteria | 1265 |
| 858 | Ga0207656_10111360 | 3300025321 | Bacteria | 1265 |
| 859 | Ga0207696_1000131 | 3300025711 | Bacteria | 132958 |
| 860 | Ga0207655_1000004 | 3300025728 | Bacteria | 1021221 |
| 861 | Ga0207655_1003340 | 3300025728 | Bacteria | 12017 |
| 862 | Ga0207655_1029730 | 3300025728 | Bacteria | 2552 |
| 863 | Ga0207655_1118431 | 3300025728 | Bacteria | 882 |
| 864 | Ga0207655_1236898 | 3300025728 | Bacteria | 524 |
| 865 | Ga0207713_1000052 | 3300025735 | Bacteria | 222663 |
| 866 | Ga0207713_1000084 | 3300025735 | Bacteria | 160822 |
| 867 | Ga0207713_1043333 | 3300025735 | Bacteria | 1860 |
| 868 | Ga0207682_10006629 | 3300025893 | Bacteria | 4655 |
| 869 | Ga0207682_10022477 | 3300025893 | Bacteria | 2485 |
| 870 | Ga0207682_10067253 | 3300025893 | Bacteria | 1512 |
| 871 | Ga0207682_10071200 | 3300025893 | Bacteria | 1474 |
| 872 | Ga0207682_10532095 | 3300025893 | Bacteria | 556 |
| 873 | Ga0207642_10037663 | 3300025899 | Bacteria | 2086 |
| 874 | Ga0207642_10743245 | 3300025899 | Bacteria | 621 |
| 875 | Ga0207688_10036837 | 3300025901 | Bacteria | 2712 |
| 876 | Ga0207688_10167683 | 3300025901 | Bacteria | 1305 |
| 877 | Ga0207688_10248005 | 3300025901 | Bacteria | 1078 |
| 878 | Ga0207680_10216266 | 3300025903 | Bacteria | 1312 |
| 879 | Ga0207647_10046340 | 3300025904 | Bacteria | 2710 |
| 880 | Ga0207647_10052312 | 3300025904 | Bacteria | 2521 |
| 881 | Ga0207685_10596594 | 3300025905 | Bacteria | 592 |
| 882 | Ga0207645_10003439 | 3300025907 | Bacteria | 12030 |
| 883 | Ga0207645_10015692 | 3300025907 | Bacteria | 5025 |
| 884 | Ga0207645_10030847 | 3300025907 | Bacteria | 3454 |
| 885 | Ga0207645_10066499 | 3300025907 | Bacteria | 2304 |
| 886 | Ga0207645_10205138 | 3300025907 | Bacteria | 1297 |
| 887 | Ga0207645_11133322 | 3300025907 | Bacteria | 527 |
| 888 | Ga0207643_10244189 | 3300025908 | Bacteria | 1104 |
| 889 | Ga0207705_10026548 | 3300025909 | Bacteria | 4130 |
| 890 | Ga0207705_10102916 | 3300025909 | Bacteria | 2103 |
| 891 | Ga0207705_10165193 | 3300025909 | Bacteria | 1664 |
| 892 | Ga0207705_10236422 | 3300025909 | Bacteria | 1391 |
| 893 | Ga0207705_10347626 | 3300025909 | Bacteria | 1142 |
| 894 | Ga0207705_10378081 | 3300025909 | Bacteria | 1094 |
| 895 | Ga0207705_11014738 | 3300025909 | Bacteria | 641 |
| 896 | Ga0207705_11017966 | 3300025909 | Bacteria | 640 |
| 897 | Ga0207684_10002530 | 3300025910 | Bacteria | 18373 |
| 898 | Ga0207684_10136233 | 3300025910 | Bacteria | 2109 |
| 899 | Ga0207684_10401714 | 3300025910 | Bacteria | 1178 |
| 900 | Ga0207654_10197100 | 3300025911 | Bacteria | 1324 |
| 901 | Ga0207654_10639853 | 3300025911 | Bacteria | 761 |
| 902 | Ga0207707_10024701 | 3300025912 | Bacteria | 5257 |
| 903 | Ga0207707_11140491 | 3300025912 | Bacteria | 634 |
| 904 | Ga0207707_11289473 | 3300025912 | Bacteria | 587 |
| 905 | Ga0207695_10030367 | 3300025913 | Bacteria | 5949 |
| 906 | Ga0207695_10177375 | 3300025913 | Bacteria | 2053 |
| 907 | Ga0207695_10204007 | 3300025913 | Bacteria | 1890 |
| 908 | Ga0207695_10267148 | 3300025913 | Bacteria | 1607 |
| 909 | Ga0207695_10430581 | 3300025913 | Bacteria | 1203 |
| 910 | Ga0207671_10010913 | 3300025914 | Bacteria | 7444 |
| 911 | Ga0207671_10134750 | 3300025914 | Bacteria | 1898 |
| 912 | Ga0207671_10143413 | 3300025914 | Bacteria | 1842 |
| 913 | Ga0207671_10356571 | 3300025914 | Bacteria | 1160 |
| 914 | Ga0207671_10883563 | 3300025914 | Bacteria | 707 |
| 915 | Ga0207663_10737599 | 3300025916 | Bacteria | 782 |
| 916 | Ga0207660_10491418 | 3300025917 | Bacteria | 995 |
| 917 | Ga0207662_10594733 | 3300025918 | Bacteria | 769 |
| 918 | Ga0207657_10000539 | 3300025919 | Bacteria | 40381 |
| 919 | Ga0207657_10016351 | 3300025919 | Bacteria | 7158 |
| 920 | Ga0207657_10063967 | 3300025919 | Bacteria | 3142 |
| 921 | Ga0207657_10095194 | 3300025919 | Bacteria | 2478 |
| 922 | Ga0207657_10154007 | 3300025919 | Bacteria | 1870 |
| 923 | Ga0207657_10160330 | 3300025919 | Bacteria | 1827 |
| 924 | Ga0207657_10342010 | 3300025919 | Bacteria | 1181 |
| 925 | Ga0207657_10951572 | 3300025919 | Bacteria | 660 |
| 926 | Ga0207649_10027765 | 3300025920 | Bacteria | 3326 |
| 927 | Ga0207649_10065254 | 3300025920 | Bacteria | 2304 |
| 928 | Ga0207649_10859077 | 3300025920 | Bacteria | 710 |
| 929 | Ga0207652_10164160 | 3300025921 | Bacteria | 1991 |
| 930 | Ga0207652_10273281 | 3300025921 | Bacteria | 1524 |
| 931 | Ga0207652_11186502 | 3300025921 | Bacteria | 665 |
| 932 | Ga0207646_10149795 | 3300025922 | Bacteria | 2104 |
| 933 | Ga0207681_10010347 | 3300025923 | Bacteria | 5708 |
| 934 | Ga0207681_10015245 | 3300025923 | Bacteria | 4792 |
| 935 | Ga0207681_10065307 | 3300025923 | Bacteria | 2515 |
| 936 | Ga0207681_10136055 | 3300025923 | Bacteria | 1823 |
| 937 | Ga0207681_11262814 | 3300025923 | Bacteria | 620 |
| 938 | Ga0207694_10065085 | 3300025924 | Bacteria | 2842 |
| 939 | Ga0207694_10110900 | 3300025924 | Bacteria | 2182 |
| 940 | Ga0207694_10147805 | 3300025924 | Bacteria | 1892 |
| 941 | Ga0207694_10323332 | 3300025924 | Bacteria | 1273 |
| 942 | Ga0207694_10663995 | 3300025924 | Bacteria | 879 |
| 943 | Ga0207694_11171087 | 3300025924 | Bacteria | 650 |
| 944 | Ga0207650_10001071 | 3300025925 | Bacteria | 20336 |
| 945 | Ga0207650_10033566 | 3300025925 | Bacteria | 3718 |
| 946 | Ga0207650_10208534 | 3300025925 | Bacteria | 1568 |
| 947 | Ga0207650_10233262 | 3300025925 | Bacteria | 1485 |
| 948 | Ga0207650_10457365 | 3300025925 | Bacteria | 1063 |
| 949 | Ga0207650_10596088 | 3300025925 | Bacteria | 929 |
| 950 | Ga0207650_10628582 | 3300025925 | Bacteria | 904 |
| 951 | Ga0207650_10865198 | 3300025925 | Bacteria | 767 |
| 952 | Ga0207659_10002589 | 3300025926 | Bacteria | 10770 |
| 953 | Ga0207659_10010915 | 3300025926 | Bacteria | 5721 |
| 954 | Ga0207659_10013311 | 3300025926 | Bacteria | 5263 |
| 955 | Ga0207659_10127689 | 3300025926 | Bacteria | 1958 |
| 956 | Ga0207659_10371230 | 3300025926 | Bacteria | 1191 |
| 957 | Ga0207659_10538064 | 3300025926 | Bacteria | 992 |
| 958 | Ga0207659_10721579 | 3300025926 | Bacteria | 854 |
| 959 | Ga0207687_10055314 | 3300025927 | Bacteria | 2780 |
| 960 | Ga0207687_10066030 | 3300025927 | Bacteria | 2570 |
| 961 | Ga0207687_10225398 | 3300025927 | Bacteria | 1478 |
| 962 | Ga0207687_10291600 | 3300025927 | Bacteria | 1311 |
| 963 | Ga0207687_11043346 | 3300025927 | Bacteria | 701 |
| 964 | Ga0207664_10020035 | 3300025929 | Bacteria | 4951 |
| 965 | Ga0207644_10002293 | 3300025931 | Bacteria | 12414 |
| 966 | Ga0207644_10005830 | 3300025931 | Bacteria | 8024 |
| 967 | Ga0207644_10008258 | 3300025931 | Bacteria | 6821 |
| 968 | Ga0207644_10033013 | 3300025931 | Bacteria | 3614 |
| 969 | Ga0207644_10066865 | 3300025931 | Bacteria | 2618 |
| 970 | Ga0207644_10181125 | 3300025931 | Bacteria | 1651 |
| 971 | Ga0207644_10451985 | 3300025931 | Bacteria | 1055 |
| 972 | Ga0207644_10582408 | 3300025931 | Bacteria | 928 |
| 973 | Ga0207644_10919969 | 3300025931 | Bacteria | 733 |
| 974 | Ga0207644_10967293 | 3300025931 | Bacteria | 714 |
| 975 | Ga0207690_10009822 | 3300025932 | Bacteria | 5686 |
| 976 | Ga0207690_10047094 | 3300025932 | Bacteria | 2859 |
| 977 | Ga0207690_10051966 | 3300025932 | Bacteria | 2743 |
| 978 | Ga0207690_10075669 | 3300025932 | Bacteria | 2335 |
| 979 | Ga0207690_10161082 | 3300025932 | Bacteria | 1672 |
| 980 | Ga0207690_10195198 | 3300025932 | Bacteria | 1534 |
| 981 | Ga0207690_10387241 | 3300025932 | Bacteria | 1112 |
| 982 | Ga0207690_10397108 | 3300025932 | Bacteria | 1099 |
| 983 | Ga0207706_10001856 | 3300025933 | Bacteria | 20689 |
| 984 | Ga0207706_10005010 | 3300025933 | Bacteria | 12370 |
| 985 | Ga0207706_10023334 | 3300025933 | Bacteria | 5557 |
| 986 | Ga0207706_10050415 | 3300025933 | Bacteria | 3678 |
| 987 | Ga0207706_10127657 | 3300025933 | Bacteria | 2236 |
| 988 | Ga0207706_10278780 | 3300025933 | Bacteria | 1458 |
| 989 | Ga0207706_10396119 | 3300025933 | Bacteria | 1197 |
| 990 | Ga0207706_10666473 | 3300025933 | Bacteria | 890 |
| 991 | Ga0207706_11275413 | 3300025933 | Bacteria | 608 |
| 992 | Ga0207686_10562429 | 3300025934 | Bacteria | 893 |
| 993 | Ga0207686_10687661 | 3300025934 | Bacteria | 812 |
| 994 | Ga0207709_10000348 | 3300025935 | Bacteria | 47582 |
| 995 | Ga0207709_10000556 | 3300025935 | Bacteria | 31885 |
| 996 | Ga0207709_10005637 | 3300025935 | Bacteria | 7077 |
| 997 | Ga0207709_10006258 | 3300025935 | Bacteria | 6689 |
| 998 | Ga0207709_10007492 | 3300025935 | Bacteria | 6075 |
| 999 | Ga0207709_10193284 | 3300025935 | Bacteria | 1447 |
| 1000 | Ga0207709_10803082 | 3300025935 | Bacteria | 759 |
| 1001 | Ga0207670_10036922 | 3300025936 | Bacteria | 3182 |
| 1002 | Ga0207669_10002735 | 3300025937 | Bacteria | 7556 |
| 1003 | Ga0207669_10163716 | 3300025937 | Bacteria | 1574 |
| 1004 | Ga0207669_10198881 | 3300025937 | Bacteria | 1453 |
| 1005 | Ga0207669_10549955 | 3300025937 | Bacteria | 931 |
| 1006 | Ga0207704_10061644 | 3300025938 | Bacteria | 2328 |
| 1007 | Ga0207704_10351102 | 3300025938 | Bacteria | 1148 |
| 1008 | Ga0207704_10439315 | 3300025938 | Bacteria | 1039 |
| 1009 | Ga0207691_10004533 | 3300025940 | Bacteria | 13439 |
| 1010 | Ga0207691_10005312 | 3300025940 | Bacteria | 12435 |
| 1011 | Ga0207691_10007653 | 3300025940 | Bacteria | 10396 |
| 1012 | Ga0207691_10057377 | 3300025940 | Bacteria | 3544 |
| 1013 | Ga0207691_10174786 | 3300025940 | Bacteria | 1879 |
| 1014 | Ga0207691_10327127 | 3300025940 | Bacteria | 1314 |
| 1015 | Ga0207691_10618110 | 3300025940 | Bacteria | 917 |
| 1016 | Ga0207691_10733465 | 3300025940 | Bacteria | 832 |
| 1017 | Ga0207691_11369505 | 3300025940 | Bacteria | 582 |
| 1018 | Ga0207711_10007461 | 3300025941 | Bacteria | 9150 |
| 1019 | Ga0207711_10013057 | 3300025941 | Bacteria | 6900 |
| 1020 | Ga0207711_10015303 | 3300025941 | Bacteria | 6367 |
| 1021 | Ga0207711_10078718 | 3300025941 | Bacteria | 2876 |
| 1022 | Ga0207711_10245986 | 3300025941 | Bacteria | 1641 |
| 1023 | Ga0207711_10375692 | 3300025941 | Bacteria | 1318 |
| 1024 | Ga0207711_11205800 | 3300025941 | Bacteria | 698 |
| 1025 | Ga0207711_11233896 | 3300025941 | Bacteria | 689 |
| 1026 | Ga0207711_11868024 | 3300025941 | Bacteria | 544 |
| 1027 | Ga0207689_10004291 | 3300025942 | Bacteria | 12973 |
| 1028 | Ga0207689_10018167 | 3300025942 | Bacteria | 5937 |
| 1029 | Ga0207689_10022168 | 3300025942 | Bacteria | 5341 |
| 1030 | Ga0207689_10051486 | 3300025942 | Bacteria | 3394 |
| 1031 | Ga0207689_10282689 | 3300025942 | Bacteria | 1374 |
| 1032 | Ga0207689_10371595 | 3300025942 | Bacteria | 1190 |
| 1033 | Ga0207689_10460278 | 3300025942 | Bacteria | 1064 |
| 1034 | Ga0207689_11056852 | 3300025942 | Bacteria | 685 |
| 1035 | Ga0207661_10069956 | 3300025944 | Bacteria | 2863 |
| 1036 | Ga0207661_10152654 | 3300025944 | Bacteria | 1997 |
| 1037 | Ga0207679_10037286 | 3300025945 | Bacteria | 3454 |
| 1038 | Ga0207679_10046527 | 3300025945 | Bacteria | 3146 |
| 1039 | Ga0207679_10151674 | 3300025945 | Bacteria | 1887 |
| 1040 | Ga0207679_10185328 | 3300025945 | Bacteria | 1725 |
| 1041 | Ga0207679_10322897 | 3300025945 | Bacteria | 1337 |
| 1042 | Ga0207679_10483534 | 3300025945 | Bacteria | 1103 |
| 1043 | Ga0207679_10684044 | 3300025945 | Bacteria | 930 |
| 1044 | Ga0207667_10016870 | 3300025949 | Bacteria | 8237 |
| 1045 | Ga0207667_10053981 | 3300025949 | Bacteria | 4227 |
| 1046 | Ga0207667_10080136 | 3300025949 | Bacteria | 3383 |
| 1047 | Ga0207667_10108428 | 3300025949 | Bacteria | 2865 |
| 1048 | Ga0207667_10116858 | 3300025949 | Bacteria | 2749 |
| 1049 | Ga0207667_10271910 | 3300025949 | Bacteria | 1732 |
| 1050 | Ga0207667_10836318 | 3300025949 | Bacteria | 915 |
| 1051 | Ga0207667_11999714 | 3300025949 | Bacteria | 540 |
| 1052 | Ga0207651_10003468 | 3300025960 | Bacteria | 7746 |
| 1053 | Ga0207651_10032840 | 3300025960 | Bacteria | 3339 |
| 1054 | Ga0207651_10041449 | 3300025960 | Bacteria | 3056 |
| 1055 | Ga0207651_10074451 | 3300025960 | Bacteria | 2418 |
| 1056 | Ga0207651_10078352 | 3300025960 | Bacteria | 2370 |
| 1057 | Ga0207651_10278866 | 3300025960 | Bacteria | 1380 |
| 1058 | Ga0207651_10336242 | 3300025960 | Bacteria | 1267 |
| 1059 | Ga0207651_10380602 | 3300025960 | Bacteria | 1196 |
| 1060 | Ga0207651_10989381 | 3300025960 | Bacteria | 751 |
| 1061 | Ga0207651_11035467 | 3300025960 | Bacteria | 734 |
| 1062 | Ga0207651_11180812 | 3300025960 | Bacteria | 687 |
| 1063 | Ga0207712_10016113 | 3300025961 | Bacteria | 4833 |
| 1064 | Ga0207712_10162453 | 3300025961 | Bacteria | 1737 |
| 1065 | Ga0207712_10485853 | 3300025961 | Bacteria | 1053 |
| 1066 | Ga0207712_11132805 | 3300025961 | Bacteria | 697 |
| 1067 | Ga0207668_10160980 | 3300025972 | Bacteria | 1749 |
| 1068 | Ga0207668_10185382 | 3300025972 | Bacteria | 1645 |
| 1069 | Ga0207668_10284338 | 3300025972 | Bacteria | 1358 |
| 1070 | Ga0207668_10564733 | 3300025972 | Bacteria | 987 |
| 1071 | Ga0207668_11103147 | 3300025972 | Bacteria | 711 |
| 1072 | Ga0207668_11177387 | 3300025972 | Bacteria | 688 |
| 1073 | Ga0207668_11208167 | 3300025972 | Bacteria | 679 |
| 1074 | Ga0207640_10001781 | 3300025981 | Bacteria | 11576 |
| 1075 | Ga0207640_10114521 | 3300025981 | Bacteria | 1919 |
| 1076 | Ga0207640_10276907 | 3300025981 | Bacteria | 1316 |
| 1077 | Ga0207640_10502366 | 3300025981 | Bacteria | 1010 |
| 1078 | Ga0207640_11005044 | 3300025981 | Bacteria | 734 |
| 1079 | Ga0207640_11475505 | 3300025981 | Bacteria | 611 |
| 1080 | Ga0207658_10005312 | 3300025986 | Bacteria | 8859 |
| 1081 | Ga0207658_10035630 | 3300025986 | Bacteria | 3565 |
| 1082 | Ga0207658_10069435 | 3300025986 | Bacteria | 2662 |
| 1083 | Ga0207658_10117580 | 3300025986 | Bacteria | 2113 |
| 1084 | Ga0207658_10134850 | 3300025986 | Bacteria | 1989 |
| 1085 | Ga0207658_10268119 | 3300025986 | Bacteria | 1458 |
| 1086 | Ga0207658_10278531 | 3300025986 | Bacteria | 1433 |
| 1087 | Ga0207658_11076938 | 3300025986 | Bacteria | 734 |
| 1088 | Ga0207677_10000972 | 3300026023 | Bacteria | 15863 |
| 1089 | Ga0207677_10001461 | 3300026023 | Bacteria | 12514 |
| 1090 | Ga0207677_10006577 | 3300026023 | Bacteria | 6377 |
| 1091 | Ga0207677_10568710 | 3300026023 | Bacteria | 991 |
| 1092 | Ga0207677_10695636 | 3300026023 | Bacteria | 902 |
| 1093 | Ga0207677_11868105 | 3300026023 | Bacteria | 558 |
| 1094 | Ga0207703_10012389 | 3300026035 | Bacteria | 6646 |
| 1095 | Ga0207703_10082733 | 3300026035 | Bacteria | 2680 |
| 1096 | Ga0207703_10621142 | 3300026035 | Bacteria | 1023 |
| 1097 | Ga0207703_10831053 | 3300026035 | Bacteria | 883 |
| 1098 | Ga0207703_11080904 | 3300026035 | Bacteria | 770 |
| 1099 | Ga0207639_10004119 | 3300026041 | Bacteria | 9804 |
| 1100 | Ga0207639_10032894 | 3300026041 | Bacteria | 3822 |
| 1101 | Ga0207639_10067958 | 3300026041 | Bacteria | 2775 |
| 1102 | Ga0207639_10215624 | 3300026041 | Bacteria | 1655 |
| 1103 | Ga0207639_10898220 | 3300026041 | Bacteria | 828 |
| 1104 | Ga0207639_10988179 | 3300026041 | Bacteria | 788 |
| 1105 | Ga0207678_10018317 | 3300026067 | Bacteria | 6150 |
| 1106 | Ga0207678_10073350 | 3300026067 | Bacteria | 2933 |
| 1107 | Ga0207678_10649783 | 3300026067 | Bacteria | 926 |
| 1108 | Ga0207678_10864781 | 3300026067 | Bacteria | 799 |
| 1109 | Ga0207678_11010811 | 3300026067 | Bacteria | 736 |
| 1110 | Ga0207678_11168927 | 3300026067 | Bacteria | 681 |
| 1111 | Ga0207678_11196387 | 3300026067 | Bacteria | 673 |
| 1112 | Ga0207678_11362173 | 3300026067 | Bacteria | 627 |
| 1113 | Ga0207678_11499097 | 3300026067 | Bacteria | 595 |
| 1114 | Ga0207708_10222353 | 3300026075 | Bacteria | 1513 |
| 1115 | Ga0207702_10000698 | 3300026078 | Bacteria | 36205 |
| 1116 | Ga0207702_10000732 | 3300026078 | Bacteria | 35124 |
| 1117 | Ga0207702_10001319 | 3300026078 | Bacteria | 24844 |
| 1118 | Ga0207702_10184699 | 3300026078 | Bacteria | 1922 |
| 1119 | Ga0207702_10277540 | 3300026078 | Bacteria | 1583 |
| 1120 | Ga0207702_10553839 | 3300026078 | Bacteria | 1125 |
| 1121 | Ga0207702_10797152 | 3300026078 | Bacteria | 934 |
| 1122 | Ga0207702_11018288 | 3300026078 | Bacteria | 822 |
| 1123 | Ga0207641_10003025 | 3300026088 | Bacteria | 15148 |
| 1124 | Ga0207641_10082621 | 3300026088 | Bacteria | 2791 |
| 1125 | Ga0207641_10096599 | 3300026088 | Bacteria | 2595 |
| 1126 | Ga0207641_10354578 | 3300026088 | Bacteria | 1399 |
| 1127 | Ga0207648_10000146 | 3300026089 | Bacteria | 70573 |
| 1128 | Ga0207648_10001822 | 3300026089 | Bacteria | 23296 |
| 1129 | Ga0207648_10003244 | 3300026089 | Bacteria | 17114 |
| 1130 | Ga0207648_10011303 | 3300026089 | Bacteria | 8416 |
| 1131 | Ga0207648_10013115 | 3300026089 | Bacteria | 7728 |
| 1132 | Ga0207648_10193560 | 3300026089 | Bacteria | 1803 |
| 1133 | Ga0207648_10265695 | 3300026089 | Bacteria | 1532 |
| 1134 | Ga0207648_10280515 | 3300026089 | Bacteria | 1490 |
| 1135 | Ga0207648_10309354 | 3300026089 | Bacteria | 1418 |
| 1136 | Ga0207648_10316866 | 3300026089 | Bacteria | 1401 |
| 1137 | Ga0207648_10525420 | 3300026089 | Bacteria | 1085 |
| 1138 | Ga0207648_10627607 | 3300026089 | Bacteria | 992 |
| 1139 | Ga0207648_11413271 | 3300026089 | Bacteria | 654 |
| 1140 | Ga0207676_10001000 | 3300026095 | Bacteria | 21763 |
| 1141 | Ga0207676_10007652 | 3300026095 | Bacteria | 7669 |
| 1142 | Ga0207676_10014293 | 3300026095 | Bacteria | 5708 |
| 1143 | Ga0207676_10214855 | 3300026095 | Bacteria | 1709 |
| 1144 | Ga0207676_10307788 | 3300026095 | Bacteria | 1449 |
| 1145 | Ga0207676_10592142 | 3300026095 | Bacteria | 1064 |
| 1146 | Ga0207676_11598846 | 3300026095 | Bacteria | 650 |
| 1147 | Ga0207676_11608865 | 3300026095 | Bacteria | 647 |
| 1148 | Ga0207674_10005362 | 3300026116 | Bacteria | 15251 |
| 1149 | Ga0207674_10012070 | 3300026116 | Bacteria | 9676 |
| 1150 | Ga0207674_10020685 | 3300026116 | Bacteria | 7102 |
| 1151 | Ga0207674_10083208 | 3300026116 | Bacteria | 3200 |
| 1152 | Ga0207674_10126264 | 3300026116 | Bacteria | 2524 |
| 1153 | Ga0207674_10203057 | 3300026116 | Bacteria | 1931 |
| 1154 | Ga0207674_10323642 | 3300026116 | Bacteria | 1491 |
| 1155 | Ga0207674_10340698 | 3300026116 | Bacteria | 1450 |
| 1156 | Ga0207674_10637731 | 3300026116 | Bacteria | 1029 |
| 1157 | Ga0207674_10929873 | 3300026116 | Bacteria | 838 |
| 1158 | Ga0207674_10956645 | 3300026116 | Bacteria | 825 |
| 1159 | Ga0207674_11239762 | 3300026116 | Bacteria | 715 |
| 1160 | Ga0207674_11559830 | 3300026116 | Bacteria | 629 |
| 1161 | Ga0207675_100000857 | 3300026118 | Bacteria | 30347 |
| 1162 | Ga0207675_100007272 | 3300026118 | Bacteria | 10465 |
| 1163 | Ga0207675_100048118 | 3300026118 | Bacteria | 3980 |
| 1164 | Ga0207675_101542020 | 3300026118 | Bacteria | 685 |
| 1165 | Ga0207675_101706059 | 3300026118 | Bacteria | 650 |
| 1166 | Ga0207675_102439470 | 3300026118 | Bacteria | 535 |
| 1167 | Ga0207683_10003588 | 3300026121 | Bacteria | 13534 |
| 1168 | Ga0207683_10025072 | 3300026121 | Bacteria | 5142 |
| 1169 | Ga0207683_10100629 | 3300026121 | Bacteria | 2580 |
| 1170 | Ga0207683_10237104 | 3300026121 | Bacteria | 1664 |
| 1171 | Ga0207683_10296833 | 3300026121 | Bacteria | 1478 |
| 1172 | Ga0207683_10389095 | 3300026121 | Bacteria | 1282 |
| 1173 | Ga0207683_11136446 | 3300026121 | Bacteria | 724 |
| 1174 | Ga0207683_11149581 | 3300026121 | Bacteria | 720 |
| 1175 | Ga0207698_10048848 | 3300026142 | Bacteria | 3215 |
| 1176 | Ga0207698_10059821 | 3300026142 | Bacteria | 2960 |
| 1177 | Ga0207698_10109749 | 3300026142 | Bacteria | 2309 |
| 1178 | Ga0207698_10112411 | 3300026142 | Bacteria | 2286 |
| 1179 | Ga0207698_10113315 | 3300026142 | Bacteria | 2278 |
| 1180 | Ga0207698_10130132 | 3300026142 | Bacteria | 2149 |
| 1181 | Ga0207698_10140855 | 3300026142 | Bacteria | 2078 |
| 1182 | Ga0207698_10319705 | 3300026142 | Bacteria | 1453 |
| 1183 | Ga0207698_10388622 | 3300026142 | Bacteria | 1330 |
| 1184 | Ga0207698_10457285 | 3300026142 | Bacteria | 1234 |
| 1185 | Ga0207698_10651216 | 3300026142 | Bacteria | 1043 |
| 1186 | Ga0207698_10777828 | 3300026142 | Bacteria | 958 |
| 1187 | Ga0207698_10994646 | 3300026142 | Bacteria | 849 |
| 1188 | Ga0207698_11196478 | 3300026142 | Bacteria | 774 |
| 1189 | Ga0207698_11490572 | 3300026142 | Bacteria | 692 |
| 1190 | Ga0207698_12714087 | 3300026142 | Bacteria | 504 |
| 1191 | Ga0209389_1067513 | 3300027296 | Bacteria | 2042 |
| 1192 | Ga0209371_1000218 | 3300027312 | Bacteria | 77448 |
| 1193 | Ga0209371_1009244 | 3300027312 | Bacteria | 3150 |
| 1194 | Ga0209981_1009284 | 3300027378 | Bacteria | 1344 |
| 1195 | Ga0209981_1046705 | 3300027378 | Bacteria | 652 |
| 1196 | Ga0209996_1001204 | 3300027395 | Bacteria | 3121 |
| 1197 | Ga0209995_1003268 | 3300027471 | Bacteria | 2582 |
| 1198 | Ga0209968_1000123 | 3300027526 | Bacteria | 13790 |
| 1199 | Ga0209999_1009109 | 3300027543 | Bacteria | 1794 |
| 1200 | Ga0209282_1002929 | 3300027666 | Bacteria | 10032 |
| 1201 | Ga0209966_1000001 | 3300027695 | Bacteria | 139125 |
| 1202 | Ga0209998_10020024 | 3300027717 | Bacteria | 1429 |
| 1203 | Ga0209998_10043006 | 3300027717 | Bacteria | 1030 |
| 1204 | Ga0209813_10018067 | 3300027866 | Bacteria | 1944 |
| 1205 | Ga0209813_10045904 | 3300027866 | Bacteria | 1347 |
| 1206 | Ga0209813_10144705 | 3300027866 | Bacteria | 847 |
| 1207 | Ga0209813_10227928 | 3300027866 | Bacteria | 700 |
| 1208 | Ga0209813_10335095 | 3300027866 | Bacteria | 595 |
| 1209 | Ga0209813_10356493 | 3300027866 | Bacteria | 580 |
| 1210 | Ga0209974_10001570 | 3300027876 | Bacteria | 8281 |
| 1211 | Ga0209974_10039516 | 3300027876 | Bacteria | 1569 |
| 1212 | Ga0209974_10133454 | 3300027876 | Bacteria | 887 |
| 1213 | Ga0207428_10775357 | 3300027907 | Bacteria | 682 |
| 1214 | Ga0268266_10081508 | 3300028379 | Bacteria | 2822 |
| 1215 | Ga0268266_10327068 | 3300028379 | Bacteria | 1436 |
| 1216 | Ga0268266_10466277 | 3300028379 | Bacteria | 1202 |
| 1217 | Ga0268266_10562082 | 3300028379 | Bacteria | 1094 |
| 1218 | Ga0268266_11245677 | 3300028379 | Bacteria | 719 |
| 1219 | Ga0268265_10008049 | 3300028380 | Bacteria | 7120 |
| 1220 | Ga0268265_10094734 | 3300028380 | Bacteria | 2395 |
| 1221 | Ga0268265_10395518 | 3300028380 | Bacteria | 1276 |
| 1222 | Ga0268264_10009130 | 3300028381 | Bacteria | 8221 |
| 1223 | Ga0268264_10073483 | 3300028381 | Bacteria | 2902 |
| 1224 | Ga0268264_10245697 | 3300028381 | Bacteria | 1660 |
| 1225 | Ga0268264_10264306 | 3300028381 | Bacteria | 1605 |
| 1226 | Ga0268264_10549097 | 3300028381 | Bacteria | 1133 |
| 1227 | Ga0268264_10757437 | 3300028381 | Bacteria | 968 |
| 1228 | Ga0265334_10122037 | 3300028573 | Bacteria | 931 |
| 1229 | Ga0265323_10040942 | 3300028653 | Bacteria | 1683 |
| 1230 | Ga0307517_10000805 | 3300028786 | Bacteria | 53822 |
| 1231 | Ga0307517_10077388 | 3300028786 | Bacteria | 2891 |
| 1232 | Ga0307517_10183915 | 3300028786 | Bacteria | 1342 |
| 1233 | Ga0307517_10195603 | 3300028786 | Bacteria | 1274 |
| 1234 | Ga0307517_10346790 | 3300028786 | Bacteria | 808 |
| 1235 | Ga0307517_10407601 | 3300028786 | Bacteria | 717 |
| 1236 | Ga0307515_10000020 | 3300028794 | Bacteria | 411735 |
| 1237 | Ga0307515_10000053 | 3300028794 | Bacteria | 266512 |
| 1238 | Ga0307515_10001032 | 3300028794 | Bacteria | 63662 |
| 1239 | Ga0307515_10002612 | 3300028794 | Bacteria | 38796 |
| 1240 | Ga0307515_10005265 | 3300028794 | Bacteria | 26299 |
| 1241 | Ga0307515_10014672 | 3300028794 | Bacteria | 14505 |
| 1242 | Ga0307515_10037926 | 3300028794 | Bacteria | 7729 |
| 1243 | Ga0307515_10045683 | 3300028794 | Bacteria | 6719 |
| 1244 | Ga0307515_10048358 | 3300028794 | Bacteria | 6432 |
| 1245 | Ga0307515_10084485 | 3300028794 | Bacteria | 4076 |
| 1246 | Ga0307515_10112003 | 3300028794 | Bacteria | 3178 |
| 1247 | Ga0307515_10413000 | 3300028794 | Bacteria | 972 |
| 1248 | Ga0307515_10588117 | 3300028794 | Bacteria | 723 |
| 1249 | Ga0265324_10227390 | 3300029957 | Bacteria | 633 |
| 1250 | Ga0268256_1000174 | 3300030500 | Bacteria | 77446 |
| 1251 | Ga0268256_1016030 | 3300030500 | Bacteria | 2162 |
| 1252 | Ga0268256_1021508 | 3300030500 | Bacteria | 1714 |
| 1253 | Ga0307512_10035617 | 3300030522 | Bacteria | 4237 |
| 1254 | Ga0307512_10044313 | 3300030522 | Bacteria | 3659 |
| 1255 | Ga0307512_10233285 | 3300030522 | Bacteria | 942 |
| 1256 | Ga0316177_1178071 | 3300030731 | Bacteria | 1134 |
| 1257 | Ga0316176_1020296 | 3300030732 | Bacteria | 2826 |
| 1258 | Ga0314311_1266168 | 3300030733 | Bacteria | 1423 |
| 1259 | Ga0316179_1063983 | 3300030734 | Bacteria | 1196 |
| 1260 | Ga0316178_1148277 | 3300030735 | Bacteria | 2926 |
| 1261 | Ga0316183_1017320 | 3300030742 | Bacteria | 4162 |
| 1262 | Ga0316181_1020992 | 3300030744 | Bacteria | 2041 |
| 1263 | Ga0316182_1299692 | 3300030745 | Bacteria | 2275 |
| 1264 | Ga0265327_10000158 | 3300031251 | Bacteria | 145905 |
| 1265 | Ga0265327_10000640 | 3300031251 | Bacteria | 56812 |
| 1266 | Ga0265327_10023188 | 3300031251 | Bacteria | 3682 |
| 1267 | Ga0265327_10227028 | 3300031251 | Bacteria | 838 |
| 1268 | Ga0265327_10316668 | 3300031251 | Bacteria | 685 |
| 1269 | Ga0265316_10236963 | 3300031344 | Bacteria | 1342 |
| 1270 | Ga0265316_11282330 | 3300031344 | Bacteria | 506 |
| 1271 | Ga0307513_10014068 | 3300031456 | Bacteria | 9795 |
| 1272 | Ga0307513_10119699 | 3300031456 | Bacteria | 2604 |
| 1273 | Ga0307513_10135699 | 3300031456 | Bacteria | 2396 |
| 1274 | Ga0307513_10158438 | 3300031456 | Bacteria | 2160 |
| 1275 | Ga0307513_10242399 | 3300031456 | Bacteria | 1606 |
| 1276 | Ga0307513_10323194 | 3300031456 | Bacteria | 1300 |
| 1277 | Ga0307513_10476072 | 3300031456 | Bacteria | 969 |
| 1278 | Ga0307513_10693839 | 3300031456 | Bacteria | 724 |
| 1279 | Ga0307509_10001946 | 3300031507 | Bacteria | 34096 |
| 1280 | Ga0307509_10002654 | 3300031507 | Bacteria | 28588 |
| 1281 | Ga0307509_10008897 | 3300031507 | Bacteria | 12664 |
| 1282 | Ga0307509_10140975 | 3300031507 | Bacteria | 2346 |
| 1283 | Ga0307509_10143796 | 3300031507 | Bacteria | 2315 |
| 1284 | Ga0307509_10202426 | 3300031507 | Bacteria | 1820 |
| 1285 | Ga0307509_10291208 | 3300031507 | Bacteria | 1387 |
| 1286 | Ga0307509_11005609 | 3300031507 | Bacteria | 501 |
| 1287 | Ga0307408_100008062 | 3300031548 | Bacteria | 6962 |
| 1288 | Ga0307408_100008200 | 3300031548 | Bacteria | 6899 |
| 1289 | Ga0307408_100047567 | 3300031548 | Bacteria | 3073 |
| 1290 | Ga0307408_100065038 | 3300031548 | Bacteria | 2673 |
| 1291 | Ga0307408_100076502 | 3300031548 | Bacteria | 2490 |
| 1292 | Ga0307408_100154143 | 3300031548 | Bacteria | 1817 |
| 1293 | Ga0307408_100214499 | 3300031548 | Bacteria | 1567 |
| 1294 | Ga0307408_100317795 | 3300031548 | Bacteria | 1310 |
| 1295 | Ga0307408_100610836 | 3300031548 | Bacteria | 970 |
| 1296 | Ga0307408_100968574 | 3300031548 | Bacteria | 782 |
| 1297 | Ga0307408_102219087 | 3300031548 | Bacteria | 531 |
| 1298 | Ga0307508_10000004 | 3300031616 | Bacteria | 287547 |
| 1299 | Ga0307508_10000078 | 3300031616 | Bacteria | 113416 |
| 1300 | Ga0307508_10002611 | 3300031616 | Bacteria | 18949 |
| 1301 | Ga0307508_10058330 | 3300031616 | Bacteria | 3416 |
| 1302 | Ga0307508_10097952 | 3300031616 | Bacteria | 2525 |
| 1303 | Ga0307508_10387871 | 3300031616 | Bacteria | 988 |
| 1304 | Ga0307508_10536118 | 3300031616 | Bacteria | 767 |
| 1305 | Ga0307514_10003397 | 3300031649 | Bacteria | 15360 |
| 1306 | Ga0307514_10122350 | 3300031649 | Bacteria | 1811 |
| 1307 | Ga0307514_10132041 | 3300031649 | Bacteria | 1717 |
| 1308 | Ga0316579_10367458 | 3300031691 | Bacteria | 695 |
| 1309 | Ga0307516_10000497 | 3300031730 | Bacteria | 52295 |
| 1310 | Ga0307516_10001023 | 3300031730 | Bacteria | 38802 |
| 1311 | Ga0307516_10017381 | 3300031730 | Bacteria | 7501 |
| 1312 | Ga0307516_10022278 | 3300031730 | Bacteria | 6508 |
| 1313 | Ga0307516_10022921 | 3300031730 | Bacteria | 6407 |
| 1314 | Ga0307516_10046323 | 3300031730 | Bacteria | 4291 |
| 1315 | Ga0307516_10156564 | 3300031730 | Bacteria | 2032 |
| 1316 | Ga0307516_10209567 | 3300031730 | Bacteria | 1664 |
| 1317 | Ga0307516_10402920 | 3300031730 | Bacteria | 1027 |
| 1318 | Ga0307516_10859608 | 3300031730 | Bacteria | 571 |
| 1319 | Ga0307516_11014043 | 3300031730 | Bacteria | 503 |
| 1320 | Ga0307405_10002891 | 3300031731 | Bacteria | 7731 |
| 1321 | Ga0307405_10033496 | 3300031731 | Bacteria | 3048 |
| 1322 | Ga0307405_10058525 | 3300031731 | Bacteria | 2425 |
| 1323 | Ga0307405_10072893 | 3300031731 | Bacteria | 2215 |
| 1324 | Ga0307405_10091624 | 3300031731 | Bacteria | 2014 |
| 1325 | Ga0307405_10145859 | 3300031731 | Bacteria | 1657 |
| 1326 | Ga0307405_12061651 | 3300031731 | Bacteria | 511 |
| 1327 | Ga0316577_10076331 | 3300031733 | Bacteria | 1871 |
| 1328 | Ga0307413_10018011 | 3300031824 | Bacteria | 3694 |
| 1329 | Ga0307413_10036799 | 3300031824 | Bacteria | 2821 |
| 1330 | Ga0307413_10221794 | 3300031824 | Bacteria | 1382 |
| 1331 | Ga0307413_10717891 | 3300031824 | Bacteria | 832 |
| 1332 | Ga0307413_11200767 | 3300031824 | Bacteria | 660 |
| 1333 | Ga0307413_11585218 | 3300031824 | Bacteria | 581 |
| 1334 | Ga0307410_10082470 | 3300031852 | Bacteria | 2262 |
| 1335 | Ga0307410_10124374 | 3300031852 | Bacteria | 1886 |
| 1336 | Ga0307410_10499673 | 3300031852 | Bacteria | 1000 |
| 1337 | Ga0307410_10565987 | 3300031852 | Bacteria | 944 |
| 1338 | Ga0307410_12130887 | 3300031852 | Bacteria | 502 |
| 1339 | Ga0307406_10007967 | 3300031901 | Bacteria | 5901 |
| 1340 | Ga0307406_10182693 | 3300031901 | Bacteria | 1528 |
| 1341 | Ga0307406_10189848 | 3300031901 | Bacteria | 1503 |
| 1342 | Ga0307406_10597273 | 3300031901 | Bacteria | 910 |
| 1343 | Ga0307406_11168192 | 3300031901 | Bacteria | 667 |
| 1344 | Ga0307406_11340675 | 3300031901 | Bacteria | 625 |
| 1345 | Ga0307407_10071891 | 3300031903 | Bacteria | 2061 |
| 1346 | Ga0307407_10307089 | 3300031903 | Bacteria | 1108 |
| 1347 | Ga0307407_10482758 | 3300031903 | Bacteria | 905 |
| 1348 | Ga0307407_11322006 | 3300031903 | Bacteria | 566 |
| 1349 | Ga0307412_10001384 | 3300031911 | Bacteria | 13466 |
| 1350 | Ga0307412_10003210 | 3300031911 | Bacteria | 9088 |
| 1351 | Ga0307412_10021895 | 3300031911 | Bacteria | 3910 |
| 1352 | Ga0307412_10034400 | 3300031911 | Bacteria | 3229 |
| 1353 | Ga0307412_10043071 | 3300031911 | Bacteria | 2938 |
| 1354 | Ga0307412_10043743 | 3300031911 | Bacteria | 2918 |
| 1355 | Ga0307412_10056266 | 3300031911 | Bacteria | 2621 |
| 1356 | Ga0307412_10156113 | 3300031911 | Bacteria | 1689 |
| 1357 | Ga0307412_10236021 | 3300031911 | Bacteria | 1411 |
| 1358 | Ga0307412_10356212 | 3300031911 | Bacteria | 1177 |
| 1359 | Ga0307412_10683024 | 3300031911 | Bacteria | 879 |
| 1360 | Ga0307412_10721909 | 3300031911 | Bacteria | 857 |
| 1361 | Ga0307412_10791088 | 3300031911 | Bacteria | 822 |
| 1362 | Ga0307412_11002241 | 3300031911 | Bacteria | 738 |
| 1363 | Ga0307412_11449973 | 3300031911 | Bacteria | 622 |
| 1364 | Ga0307409_100000086 | 3300031995 | Bacteria | 33256 |
| 1365 | Ga0307409_100024728 | 3300031995 | Bacteria | 4196 |
| 1366 | Ga0307409_100732557 | 3300031995 | Bacteria | 991 |
| 1367 | Ga0307409_101027605 | 3300031995 | Bacteria | 843 |
| 1368 | Ga0307409_101972378 | 3300031995 | Bacteria | 613 |
| 1369 | Ga0307409_102028809 | 3300031995 | Bacteria | 605 |
| 1370 | Ga0307409_102617248 | 3300031995 | Bacteria | 533 |
| 1371 | Ga0307409_102943023 | 3300031995 | Bacteria | 503 |
| 1372 | Ga0307416_100024835 | 3300032002 | Bacteria | 4382 |
| 1373 | Ga0307416_100051514 | 3300032002 | Bacteria | 3289 |
| 1374 | Ga0307416_100130486 | 3300032002 | Bacteria | 2261 |
| 1375 | Ga0307416_100323291 | 3300032002 | Bacteria | 1546 |
| 1376 | Ga0307416_100571575 | 3300032002 | Bacteria | 1206 |
| 1377 | Ga0307416_100623909 | 3300032002 | Bacteria | 1160 |
| 1378 | Ga0307416_101059411 | 3300032002 | Bacteria | 915 |
| 1379 | Ga0307416_101197589 | 3300032002 | Bacteria | 865 |
| 1380 | Ga0307416_101306335 | 3300032002 | Bacteria | 831 |
| 1381 | Ga0307416_101383634 | 3300032002 | Bacteria | 809 |
| 1382 | Ga0307416_101405940 | 3300032002 | Bacteria | 803 |
| 1383 | Ga0307414_10024960 | 3300032004 | Bacteria | 3820 |
| 1384 | Ga0307414_10067625 | 3300032004 | Bacteria | 2560 |
| 1385 | Ga0307414_10086711 | 3300032004 | Bacteria | 2311 |
| 1386 | Ga0307414_10111423 | 3300032004 | Bacteria | 2084 |
| 1387 | Ga0307414_10115418 | 3300032004 | Bacteria | 2053 |
| 1388 | Ga0307414_10174830 | 3300032004 | Bacteria | 1721 |
| 1389 | Ga0307414_11097499 | 3300032004 | Bacteria | 735 |
| 1390 | Ga0307414_11161104 | 3300032004 | Bacteria | 714 |
| 1391 | Ga0307411_10005193 | 3300032005 | Bacteria | 6369 |
| 1392 | Ga0307411_10063367 | 3300032005 | Bacteria | 2470 |
| 1393 | Ga0307411_10074309 | 3300032005 | Bacteria | 2316 |
| 1394 | Ga0307411_10104486 | 3300032005 | Bacteria | 2012 |
| 1395 | Ga0307411_10123397 | 3300032005 | Bacteria | 1879 |
| 1396 | Ga0307411_10180169 | 3300032005 | Bacteria | 1603 |
| 1397 | Ga0307411_10254323 | 3300032005 | Bacteria | 1383 |
| 1398 | Ga0307411_10613968 | 3300032005 | Bacteria | 937 |
| 1399 | Ga0307411_10995515 | 3300032005 | Bacteria | 750 |
| 1400 | Ga0307411_11988153 | 3300032005 | Bacteria | 542 |
| 1401 | Ga0307415_100000361 | 3300032126 | Bacteria | 19367 |
| 1402 | Ga0307415_100133882 | 3300032126 | Bacteria | 1881 |
| 1403 | Ga0307415_101088308 | 3300032126 | Bacteria | 748 |
| 1404 | Ga0316593_10026594 | 3300032168 | Bacteria | 1851 |
| 1405 | Ga0307507_10100794 | 3300033179 | Bacteria | 2418 |
| 1406 | Ga0307507_10130139 | 3300033179 | Bacteria | 1973 |
| 1407 | Ga0307510_10009306 | 3300033180 | Bacteria | 11707 |
| 1408 | Ga0307510_10017087 | 3300033180 | Bacteria | 8559 |
| 1409 | Ga0307510_10041763 | 3300033180 | Bacteria | 5008 |
| 1410 | Ga0307510_10135811 | 3300033180 | Bacteria | 2117 |
| 1411 | Ga0307510_10279920 | 3300033180 | Bacteria | 1139 |
| 1412 | Ga0307510_10367980 | 3300033180 | Bacteria | 885 |
| 1413 | Ga0373930_0026313 | 3300034816 | Bacteria | 1172 |
| 1414 | Ga0373959_0033468 | 3300034820 | Bacteria | 1049 |
| 1415 | Ga0373959_0090448 | 3300034820 | Bacteria | 717 |
| 1416 | Ga0373938_0081594 | 3300034957 | Bacteria | 788 |
| 1417 | Ga0373938_0110016 | 3300034957 | Bacteria | 701 |
| 1418 | Ga0373928_0132188 | 3300035084 | Bacteria | 678 |
| 1419 | Ga0373929_0032309 | 3300035085 | Bacteria | 1125 |
| 1420 | Ga0373940_0011192 | 3300035088 | Bacteria | 2127 |
| 1421 | Ga0373944_0177474 | 3300035089 | Bacteria | 762 |
| 1422 | Ga0373944_0193002 | 3300035089 | Bacteria | 735 |
| 1423 | Ga0373944_0194084 | 3300035089 | Bacteria | 733 |
| 1424 | Ga0373944_0249845 | 3300035089 | Bacteria | 654 |
| 1425 | Ga0373952_0050313 | 3300035092 | Bacteria | 991 |
| 1426 | Ga0373923_0304964 | 3300035111 | Bacteria | 754 |
| 1427 | Ga0373941_0224634 | 3300035115 | Bacteria | 723 |
| 1428 | Ga0373941_0340503 | 3300035115 | Bacteria | 608 |
| 1429 | Ga0373945_0142088 | 3300035116 | Bacteria | 968 |
| 1430 | Ga0373953_0129594 | 3300035117 | Bacteria | 1075 |
| 1431 | Ga0373943_0159516 | 3300035170 | Bacteria | 1227 |
| 1432 | Ga0373946_0039114 | 3300035171 | Bacteria | 1935 |
| 1433 | Ga0373955_0450700 | 3300035172 | Bacteria | 784 |
| 1434 | Ga0373942_0070650 | 3300035207 | Bacteria | 1019 |
| 1435 | Ga0373962_0312170 | 3300035242 | Bacteria | 560 |
| 1436 | Ga0373924_0528130 | 3300035410 | Bacteria | 531 |
| 1437 | Ga0373931_0009283 | 3300035691 | Bacteria | 4699 |
| 1438 | Ga0373931_0014386 | 3300035691 | Bacteria | 3866 |
| 1439 | Ga0373931_0026583 | 3300035691 | Bacteria | 2947 |
| 1440 | Ga0373935_0311811 | 3300035692 | Bacteria | 1114 |
| 1441 | Ga0373935_0523714 | 3300035692 | Bacteria | 862 |
| 1442 | Ga0373935_1408693 | 3300035692 | Bacteria | 521 |
| 1443 | Ga0373927_0009569 | 3300035695 | Bacteria | 6500 |
| 1444 | Ga0373927_0211207 | 3300035695 | Bacteria | 1275 |
| 1445 | Ga0373927_0240876 | 3300035695 | Bacteria | 1189 |
| 1446 | Ga0373933_1163731 | 3300035724 | Bacteria | 508 |
| 1447 | Ga0373947_0473855 | 3300035725 | Bacteria | 849 |
| 1448 | Ga0373947_0531919 | 3300035725 | Bacteria | 800 |
| 1449 | Ga0373947_0891802 | 3300035725 | Bacteria | 607 |
| 1450 | Ga0373937_0069375 | 3300036401 | Bacteria | 3250 |
| 1451 | Ga0373937_0381456 | 3300036401 | Bacteria | 1337 |
| 1452 | Ga0316582_0015066 | 3300036647 | Bacteria | 4407 |
| 1453 | Ga0316584_0092501 | 3300036712 | Bacteria | 2264 |
| 1454 | Ga0373925_0078641 | 3300037068 | Bacteria | 2505 |
| 1455 | Ga0373925_0242397 | 3300037068 | Bacteria | 1444 |
| 1456 | Ga0373925_0307578 | 3300037068 | Bacteria | 1281 |
| 1457 | Ga0373925_0330534 | 3300037068 | Bacteria | 1235 |
| 1458 | Ga0395899_0004720 | 3300037312 | Bacteria | 10633 |
| 1459 | Ga0395900_0000109 | 3300037418 | Bacteria | 146053 |
| 1460 | Ga0395900_0029684 | 3300037418 | Bacteria | 5610 |
| 1461 | Ga0395900_0118039 | 3300037418 | Bacteria | 2722 |
| 1462 | Ga0395900_1485775 | 3300037418 | Bacteria | 590 |
| 1463 | Ga0395898_0015056 | 3300037466 | Bacteria | 7939 |
| 1464 | Ga0395898_0037637 | 3300037466 | Bacteria | 4798 |
| 1465 | Ga0395898_0046059 | 3300037466 | Bacteria | 4284 |
| 1466 | Ga0395898_0297054 | 3300037466 | Bacteria | 1541 |
| 1467 | Ga0395905_0000488 | 3300037471 | Bacteria | 54703 |
| 1468 | Ga0395905_0011451 | 3300037471 | Bacteria | 8571 |
| 1469 | Ga0395905_0025592 | 3300037471 | Bacteria | 5565 |
| 1470 | Ga0395905_0034301 | 3300037471 | Bacteria | 4765 |
| 1471 | Ga0395905_0036014 | 3300037471 | Bacteria | 4647 |
| 1472 | Ga0395905_0166348 | 3300037471 | Bacteria | 2072 |
| 1473 | Ga0395905_0531124 | 3300037471 | Bacteria | 1077 |
| 1474 | Ga0395905_0585851 | 3300037471 | Bacteria | 1017 |
| 1475 | Ga0395905_0592545 | 3300037471 | Bacteria | 1010 |
| 1476 | Ga0316581_0021996 | 3300037588 | Bacteria | 1878 |
| 1477 | Ga0395901_0012844 | 3300038443 | Bacteria | 8495 |
| 1478 | Ga0395901_0985377 | 3300038443 | Bacteria | 820 |
| 1479 | Ga0436365_1178302 | 3300039437 | Bacteria | 757 |
| 1480 | Ga0436360_0258616 | 3300039438 | Bacteria | 1164 |
| 1481 | Ga0436361_0167979 | 3300039447 | Bacteria | 86419 |
| 1482 | Ga0436361_0214541 | 3300039447 | Bacteria | 41289 |
| 1483 | Ga0436361_0217332 | 3300039447 | Bacteria | 23737 |
| 1484 | Ga0436361_0359670 | 3300039447 | Bacteria | 47250 |
| 1485 | Ga0436361_0529504 | 3300039447 | Bacteria | 1143 |
| 1486 | Ga0436361_0683214 | 3300039447 | Bacteria | 2945 |
| 1487 | Ga0436361_0769709 | 3300039447 | Bacteria | 2872 |
| 1488 | Ga0436361_1056645 | 3300039447 | Bacteria | 2339 |
| 1489 | Ga0436361_1092359 | 3300039447 | Bacteria | 11490 |
| 1490 | Ga0436363_0880003 | 3300039450 | Bacteria | 583 |
| 1491 | Ga0436363_1113045 | 3300039450 | Bacteria | 1441 |
| 1492 | Ga0439436_0005082 | 3300041404 | Bacteria | 4029 |
| 1493 | Ga0439436_0017528 | 3300041404 | Bacteria | 2143 |
| 1494 | Ga0439436_0058755 | 3300041404 | Bacteria | 1078 |
| 1495 | Ga0439438_015929 | 3300041405 | Bacteria | 2197 |
| 1496 | Ga0439439_0000304 | 3300041406 | Bacteria | 7878 |
| 1497 | Ga0439439_0167384 | 3300041406 | Bacteria | 629 |
| 1498 | Ga0439447_041937 | 3300041407 | Bacteria | 1112 |
| 1499 | Ga0439453_0072178 | 3300041408 | Bacteria | 732 |
| 1500 | Ga0439461_0014042 | 3300041410 | Bacteria | 1517 |
| 1501 | Ga0439461_0092374 | 3300041410 | Bacteria | 727 |
| 1502 | Ga0439466_0002298 | 3300041411 | Bacteria | 7498 |
| 1503 | Ga0439466_0009551 | 3300041411 | Bacteria | 3625 |
| 1504 | Ga0439465_0003892 | 3300041413 | Bacteria | 4872 |
| 1505 | Ga0439465_0087386 | 3300041413 | Bacteria | 1063 |
| 1506 | Ga0439465_0183658 | 3300041413 | Bacteria | 757 |
| 1507 | Ga0439465_0382652 | 3300041413 | Bacteria | 534 |
| 1508 | Ga0451789_0160463 | 3300041443 | Bacteria | 5363 |
| 1509 | Ga0451791_1329588 | 3300041451 | Bacteria | 572 |
| 1510 | Ga0451793_0907941 | 3300041452 | Bacteria | 566 |
| 1511 | Ga0451793_1009248 | 3300041452 | Bacteria | 2201 |
| 1512 | Ga0451797_1109477 | 3300041453 | Bacteria | 1051 |
| 1513 | Ga0451795_0913388 | 3300041456 | Bacteria | 1183 |
| 1514 | Ga0451798_0882602 | 3300041458 | Bacteria | 4359 |
| 1515 | Ga0451798_1022954 | 3300041458 | Bacteria | 729 |
| 1516 | Ga0451800_0983364 | 3300041459 | Bacteria | 2433 |
| 1517 | Ga0451800_1592322 | 3300041459 | Bacteria | 1240 |
| 1518 | Ga0451802_0064922 | 3300041460 | Bacteria | 915 |
| 1519 | Ga0451806_649029 | 3300041462 | Bacteria | 543 |
| 1520 | Ga0451804_0858374 | 3300041463 | Bacteria | 908 |
| 1521 | Ga0451807_1165661 | 3300041486 | Bacteria | 1195 |
| 1522 | Ga0451807_2033827 | 3300041486 | Bacteria | 1337 |
| 1523 | Ga0451807_2607001 | 3300041486 | Bacteria | 720 |
| 1524 | Ga0451833_1194697 | 3300041491 | Bacteria | 1952 |
| 1525 | Ga0451839_0399468 | 3300041496 | Bacteria | 661 |
| 1526 | Ga0451839_0693068 | 3300041496 | Bacteria | 648 |
| 1527 | Ga0451839_0749505 | 3300041496 | Bacteria | 542 |
| 1528 | Ga0451841_0449173 | 3300041498 | Bacteria | 712 |
| 1529 | Ga0451845_0413049 | 3300041501 | Bacteria | 701 |
| 1530 | Ga0451847_0674285 | 3300041503 | Bacteria | 655 |
| 1531 | Ga0451851_0829363 | 3300041507 | Bacteria | 1397 |
| 1532 | Ga0451843_0383449 | 3300041509 | Bacteria | 675 |
| 1533 | Ga0451843_0510807 | 3300041509 | Bacteria | 552 |
| 1534 | Ga0451843_0908011 | 3300041509 | Bacteria | 835 |
| 1535 | Ga0451843_1432462 | 3300041509 | Bacteria | 545 |
| 1536 | Ga0451853_0990419 | 3300041512 | Bacteria | 1450 |
| 1537 | Ga0451853_1045547 | 3300041512 | Bacteria | 688 |
| 1538 | Ga0451853_1701460 | 3300041512 | Bacteria | 568 |
| 1539 | Ga0451853_1730775 | 3300041512 | Bacteria | 618 |
| 1540 | Ga0439431_0002568 | 3300041997 | Bacteria | 4008 |
| 1541 | Ga0439431_0103546 | 3300041997 | Bacteria | 784 |
| 1542 | Ga0439433_0022304 | 3300041999 | Bacteria | 1419 |
| 1543 | Ga0439433_0080513 | 3300041999 | Bacteria | 792 |
| 1544 | Ga0439442_003022 | 3300042002 | Bacteria | 3323 |
| 1545 | Ga0439442_031470 | 3300042002 | Bacteria | 1108 |
| 1546 | Ga0439442_133545 | 3300042002 | Bacteria | 547 |
| 1547 | Ga0439445_0021223 | 3300042004 | Bacteria | 1631 |
| 1548 | Ga0439445_0051253 | 3300042004 | Bacteria | 1115 |
| 1549 | Ga0439445_0258069 | 3300042004 | Bacteria | 521 |
| 1550 | Ga0439448_0000154 | 3300042005 | Bacteria | 13505 |
| 1551 | Ga0439448_0248931 | 3300042005 | Bacteria | 627 |
| 1552 | Ga0439432_003328 | 3300042006 | Bacteria | 5971 |
| 1553 | Ga0439432_150236 | 3300042006 | Bacteria | 683 |
| 1554 | Ga0439449_0002911 | 3300042007 | Bacteria | 6658 |
| 1555 | Ga0439449_0004348 | 3300042007 | Bacteria | 5469 |
| 1556 | Ga0439449_0142564 | 3300042007 | Bacteria | 892 |
| 1557 | Ga0439452_002322 | 3300042010 | Bacteria | 7083 |
| 1558 | Ga0439452_004417 | 3300042010 | Bacteria | 4721 |
| 1559 | Ga0439455_0004565 | 3300042012 | Bacteria | 2752 |
| 1560 | Ga0439455_0046089 | 3300042012 | Bacteria | 1129 |
| 1561 | Ga0439455_0092612 | 3300042012 | Bacteria | 830 |
| 1562 | Ga0439457_168515 | 3300042014 | Bacteria | 532 |
| 1563 | Ga0439462_0003593 | 3300042015 | Bacteria | 3733 |
| 1564 | Ga0450911_056827 | 3300042115 | Bacteria | 508 |
| 1565 | Ga0450919_000602 | 3300042121 | Bacteria | 4562 |
| 1566 | Ga0450919_011901 | 3300042121 | Bacteria | 988 |
| 1567 | Ga0450920_005125 | 3300042122 | Bacteria | 2325 |
| 1568 | Ga0450923_026479 | 3300042125 | Bacteria | 1162 |
| 1569 | Ga0450888_066290 | 3300042126 | Bacteria | 537 |
| 1570 | Ga0450890_016977 | 3300042127 | Bacteria | 966 |
| 1571 | Ga0450890_026369 | 3300042127 | Bacteria | 809 |
| 1572 | Ga0450890_034900 | 3300042127 | Bacteria | 728 |
| 1573 | Ga0450897_009986 | 3300042128 | Bacteria | 906 |
| 1574 | Ga0450894_013462 | 3300042131 | Bacteria | 1074 |
| 1575 | Ga0450898_049450 | 3300042134 | Bacteria | 810 |
| 1576 | Ga0450898_056288 | 3300042134 | Bacteria | 767 |
| 1577 | Ga0450899_009850 | 3300042135 | Bacteria | 1056 |
| 1578 | Ga0450899_011977 | 3300042135 | Bacteria | 972 |
| 1579 | Ga0450889_015950 | 3300042144 | Bacteria | 810 |
| 1580 | Ga0450906_022700 | 3300042145 | Bacteria | 1118 |
| 1581 | Ga0450907_048795 | 3300042146 | Bacteria | 727 |
| 1582 | Ga0439446_0196246 | 3300042156 | Bacteria | 680 |
| 1583 | Ga0439446_0203182 | 3300042156 | Bacteria | 670 |
| 1584 | Ga0450909_026534 | 3300042185 | Bacteria | 873 |
| 1585 | Ga0439434_0002020 | 3300042435 | Bacteria | 5865 |
| 1586 | Ga0439434_0004225 | 3300042435 | Bacteria | 4197 |
| 1587 | Ga0439434_0091011 | 3300042435 | Bacteria | 975 |
| 1588 | Ga0439459_0016027 | 3300042438 | Bacteria | 1381 |
| 1589 | Ga0450918_000607 | 3300042531 | Bacteria | 7684 |
| 1590 | Ga0450918_003867 | 3300042531 | Bacteria | 2757 |
| 1591 | Ga0450893_0027764 | 3300042532 | Bacteria | 999 |
| 1592 | Ga0451577_0006746 | 3300042876 | Bacteria | 11388 |
| 1593 | Ga0451577_0008963 | 3300042876 | Bacteria | 9673 |
| 1594 | Ga0451577_0065508 | 3300042876 | Bacteria | 3240 |
| 1595 | Ga0451577_0238241 | 3300042876 | Bacteria | 1646 |
| 1596 | Ga0451577_0404128 | 3300042876 | Bacteria | 1240 |
| 1597 | Ga0451577_0445720 | 3300042876 | Bacteria | 1175 |
| 1598 | Ga0451577_1015378 | 3300042876 | Bacteria | 744 |
| 1599 | Ga0451577_1580173 | 3300042876 | Bacteria | 579 |
| 1600 | Ga0451577_1823083 | 3300042876 | Bacteria | 534 |
| 1601 | Ga0466969_0000395 | 3300044656 | Bacteria | 23961 |
| 1602 | Ga0466969_0001952 | 3300044656 | Bacteria | 11030 |
| 1603 | Ga0466969_0008585 | 3300044656 | Bacteria | 5419 |
| 1604 | Ga0466969_0010813 | 3300044656 | Bacteria | 4834 |
| 1605 | Ga0466969_0027212 | 3300044656 | Bacteria | 2929 |
| 1606 | Ga0466972_0008024 | 3300044658 | Bacteria | 5291 |
| 1607 | Ga0466972_0013627 | 3300044658 | Bacteria | 4079 |
| 1608 | Ga0466972_0022412 | 3300044658 | Bacteria | 3146 |
| 1609 | Ga0466972_0038687 | 3300044658 | Bacteria | 2330 |
| 1610 | Ga0466972_0351804 | 3300044658 | Bacteria | 689 |
| 1611 | Ga0466980_0248074 | 3300044668 | Bacteria | 1107 |
| 1612 | Ga0453683_0001626 | 3300044673 | Bacteria | 18878 |
| 1613 | Ga0453683_0119199 | 3300044673 | Bacteria | 1661 |
| 1614 | Ga0453683_1211943 | 3300044673 | Bacteria | 506 |
| 1615 | Ga0466965_0027809 | 3300044683 | Bacteria | 2745 |
| 1616 | Ga0466965_0036578 | 3300044683 | Bacteria | 2409 |
| 1617 | Ga0466965_0041138 | 3300044683 | Bacteria | 2276 |
| 1618 | Ga0466965_0054005 | 3300044683 | Bacteria | 1997 |
| 1619 | Ga0466965_0254979 | 3300044683 | Bacteria | 942 |
| 1620 | Ga0466966_0099105 | 3300044684 | Bacteria | 1803 |
| 1621 | Ga0466966_0200822 | 3300044684 | Bacteria | 1206 |
| 1622 | Ga0466961_0005306 | 3300044693 | Bacteria | 8105 |
| 1623 | Ga0466961_0011241 | 3300044693 | Bacteria | 5722 |
| 1624 | Ga0466961_0035961 | 3300044693 | Bacteria | 3179 |
| 1625 | Ga0466961_0156934 | 3300044693 | Bacteria | 1419 |
| 1626 | Ga0466961_0204242 | 3300044693 | Bacteria | 1221 |
| 1627 | Ga0466961_0298460 | 3300044693 | Bacteria | 984 |
| 1628 | Ga0466963_0057018 | 3300044694 | Bacteria | 2601 |
| 1629 | Ga0466963_0125037 | 3300044694 | Bacteria | 1772 |
| 1630 | Ga0466963_0211748 | 3300044694 | Bacteria | 1356 |
| 1631 | Ga0466964_0031972 | 3300044706 | Bacteria | 2089 |
| 1632 | Ga0466964_0141395 | 3300044706 | Bacteria | 1106 |
| 1633 | Ga0466964_0155240 | 3300044706 | Bacteria | 1065 |
| 1634 | Ga0466964_0408670 | 3300044706 | Bacteria | 711 |
| 1635 | Ga0453684_0003638 | 3300044712 | Bacteria | 34257 |
| 1636 | Ga0453684_0088462 | 3300044712 | Bacteria | 3835 |
| 1637 | Ga0453684_0139796 | 3300044712 | Bacteria | 2894 |
| 1638 | Ga0453684_0172543 | 3300044712 | Bacteria | 2547 |
| 1639 | Ga0453684_0349930 | 3300044712 | Bacteria | 1666 |
| 1640 | Ga0453684_0483714 | 3300044712 | Bacteria | 1373 |
| 1641 | Ga0453684_0513278 | 3300044712 | Bacteria | 1325 |
| 1642 | Ga0453684_0606434 | 3300044712 | Bacteria | 1199 |
| 1643 | Ga0453684_1089263 | 3300044712 | Bacteria | 845 |
| 1644 | Ga0453684_1301134 | 3300044712 | Bacteria | 758 |
| 1645 | Ga0466971_0004739 | 3300044719 | Bacteria | 5884 |
| 1646 | Ga0466971_0189161 | 3300044719 | Bacteria | 969 |
| 1647 | Ga0466971_0269457 | 3300044719 | Bacteria | 814 |
| 1648 | Ga0466968_0059440 | 3300044735 | Bacteria | 1646 |
| 1649 | Ga0466968_0185307 | 3300044735 | Bacteria | 969 |
| 1650 | Ga0466968_0228024 | 3300044735 | Bacteria | 879 |
| 1651 | Ga0466968_0279379 | 3300044735 | Bacteria | 799 |
| 1652 | Ga0466970_0007521 | 3300044765 | Bacteria | 5464 |
| 1653 | Ga0466970_0060241 | 3300044765 | Bacteria | 2033 |
| 1654 | Ga0466970_0147824 | 3300044765 | Bacteria | 1297 |
| 1655 | Ga0466970_0450782 | 3300044765 | Bacteria | 737 |
| 1656 | Ga0466957_0014902 | 3300044842 | Bacteria | 4534 |
| 1657 | Ga0466957_0117828 | 3300044842 | Bacteria | 1690 |
| 1658 | Ga0466957_0166856 | 3300044842 | Bacteria | 1432 |
| 1659 | Ga0466957_0202241 | 3300044842 | Bacteria | 1305 |
| 1660 | Ga0466957_0268488 | 3300044842 | Bacteria | 1139 |
| 1661 | Ga0466957_0443444 | 3300044842 | Bacteria | 894 |
| 1662 | Ga0466960_0020318 | 3300044901 | Bacteria | 2940 |
| 1663 | Ga0466960_0114141 | 3300044901 | Bacteria | 1407 |
| 1664 | Ga0466960_0873204 | 3300044901 | Bacteria | 547 |
| 1665 | Ga0466959_0003919 | 3300045049 | Bacteria | 9882 |
| 1666 | Ga0466959_0087673 | 3300045049 | Bacteria | 2238 |
| 1667 | Ga0466959_0105260 | 3300045049 | Bacteria | 2017 |
| 1668 | Ga0466959_0111821 | 3300045049 | Bacteria | 1948 |
| 1669 | Ga0466959_0218492 | 3300045049 | Bacteria | 1322 |
| 1670 | Ga0466959_0368236 | 3300045049 | Bacteria | 979 |
| 1671 | Ga0451576_0000914 | 3300045051 | Bacteria | 55935 |
| 1672 | Ga0451576_0004476 | 3300045051 | Bacteria | 18097 |
| 1673 | Ga0451576_0014049 | 3300045051 | Bacteria | 8922 |
| 1674 | Ga0451576_0052912 | 3300045051 | Bacteria | 4254 |
| 1675 | Ga0451576_0122968 | 3300045051 | Bacteria | 2702 |
| 1676 | Ga0451576_0241548 | 3300045051 | Bacteria | 1887 |
| 1677 | Ga0451576_0467602 | 3300045051 | Bacteria | 1324 |
| 1678 | Ga0451576_0636156 | 3300045051 | Bacteria | 1121 |
| 1679 | Ga0451576_1358864 | 3300045051 | Bacteria | 740 |
| 1680 | Ga0466958_0074271 | 3300045836 | Bacteria | 2083 |
| 1681 | Ga0466958_0473553 | 3300045836 | Bacteria | 812 |
| 1682 | Ga0466967_0056668 | 3300045976 | Bacteria | 3456 |
| 1683 | Ga0466967_0075650 | 3300045976 | Bacteria | 3026 |
| 1684 | Ga0466967_1135311 | 3300045976 | Bacteria | 779 |
| 1685 | Ga0495627_007566 | 3300046453 | Bacteria | 4154 |
| 1686 | Ga0495592_0008709 | 3300046454 | Bacteria | 7615 |
| 1687 | Ga0495592_0015966 | 3300046454 | Bacteria | 5697 |
| 1688 | Ga0495603_0032423 | 3300046455 | Bacteria | 3143 |
| 1689 | Ga0495591_156730 | 3300046458 | Bacteria | 546 |
| 1690 | Ga0495629_0154872 | 3300046459 | Bacteria | 1593 |
| 1691 | Ga0495629_0381748 | 3300046459 | Bacteria | 959 |
| 1692 | Ga0495638_0051454 | 3300046460 | Bacteria | 2569 |
| 1693 | Ga0495638_0085327 | 3300046460 | Bacteria | 1910 |
| 1694 | Ga0495638_0208178 | 3300046460 | Bacteria | 1100 |
| 1695 | Ga0495651_0311118 | 3300046462 | Bacteria | 1053 |
| 1696 | Ga0495651_0691763 | 3300046462 | Bacteria | 636 |
| 1697 | Ga0495653_0115724 | 3300046463 | Bacteria | 1919 |
| 1698 | Ga0495650_0016331 | 3300046471 | Bacteria | 3765 |
| 1699 | Ga0495650_0191780 | 3300046471 | Bacteria | 714 |
| 1700 | Ga0495580_0145541 | 3300046472 | Bacteria | 1642 |
| 1701 | Ga0495582_0117129 | 3300046473 | Bacteria | 1499 |
| 1702 | Ga0495582_0542480 | 3300046473 | Bacteria | 673 |
| 1703 | Ga0495605_0023835 | 3300046474 | Bacteria | 3212 |
| 1704 | Ga0495605_0105856 | 3300046474 | Bacteria | 1288 |
| 1705 | Ga0495639_0017429 | 3300046475 | Bacteria | 3119 |
| 1706 | Ga0495639_0061533 | 3300046475 | Bacteria | 1721 |
| 1707 | Ga0495664_0132586 | 3300046477 | Bacteria | 1509 |
| 1708 | Ga0495584_0261560 | 3300046491 | Bacteria | 879 |
| 1709 | Ga0495585_0055375 | 3300046492 | Bacteria | 2192 |
| 1710 | Ga0495607_0399698 | 3300046501 | Bacteria | 625 |
| 1711 | Ga0495583_0015974 | 3300046506 | Bacteria | 4055 |
| 1712 | Ga0495606_0099657 | 3300046507 | Bacteria | 1771 |
| 1713 | Ga0495606_0112339 | 3300046507 | Bacteria | 1642 |
| 1714 | Ga0495606_0223399 | 3300046507 | Bacteria | 1060 |
| 1715 | Ga0495608_0178630 | 3300046511 | Bacteria | 1344 |
| 1716 | Ga0495610_0008701 | 3300046512 | Bacteria | 6532 |
| 1717 | Ga0495616_0006630 | 3300046513 | Bacteria | 6993 |
| 1718 | Ga0495618_0346612 | 3300046514 | Bacteria | 916 |
| 1719 | Ga0495620_0010437 | 3300046515 | Bacteria | 4901 |
| 1720 | Ga0495628_0140583 | 3300046516 | Bacteria | 1843 |
| 1721 | Ga0495631_0002748 | 3300046518 | Bacteria | 9757 |
| 1722 | Ga0495632_0009715 | 3300046519 | Bacteria | 5772 |
| 1723 | Ga0495632_0016885 | 3300046519 | Bacteria | 4045 |
| 1724 | Ga0495632_0173014 | 3300046519 | Bacteria | 991 |
| 1725 | Ga0495637_0020235 | 3300046520 | Bacteria | 3064 |
| 1726 | Ga0495648_0042223 | 3300046524 | Bacteria | 2871 |
| 1727 | Ga0495648_0148033 | 3300046524 | Bacteria | 1228 |
| 1728 | Ga0495648_0201241 | 3300046524 | Bacteria | 997 |
| 1729 | Ga0495648_0270304 | 3300046524 | Bacteria | 811 |
| 1730 | Ga0495666_0043869 | 3300046526 | Bacteria | 2160 |
| 1731 | Ga0495642_0013334 | 3300046528 | Bacteria | 3178 |
| 1732 | Ga0495642_0167757 | 3300046528 | Bacteria | 953 |
| 1733 | Ga0495642_0554511 | 3300046528 | Bacteria | 510 |
| 1734 | Ga0495654_0000550 | 3300046530 | Bacteria | 30238 |
| 1735 | Ga0495654_0043604 | 3300046530 | Bacteria | 2223 |
| 1736 | Ga0495640_0366968 | 3300046533 | Bacteria | 887 |
| 1737 | Ga0495586_0021373 | 3300046535 | Bacteria | 3449 |
| 1738 | Ga0495621_0002735 | 3300046539 | Bacteria | 4785 |
| 1739 | Ga0495621_0003885 | 3300046539 | Bacteria | 4149 |
| 1740 | Ga0495621_0160934 | 3300046539 | Bacteria | 888 |
| 1741 | Ga0495597_0000153 | 3300046542 | Bacteria | 61233 |
| 1742 | Ga0495597_0020188 | 3300046542 | Bacteria | 3107 |
| 1743 | Ga0495597_0383230 | 3300046542 | Bacteria | 536 |
| 1744 | Ga0495622_0088536 | 3300046557 | Bacteria | 1423 |
| 1745 | Ga0495622_0250621 | 3300046557 | Bacteria | 779 |
| 1746 | Ga0495656_0000929 | 3300046615 | Bacteria | 9473 |
| 1747 | Ga0495656_0062221 | 3300046615 | Bacteria | 1632 |
| 1748 | Ga0495656_0434962 | 3300046615 | Bacteria | 690 |
| 1749 | Ga0495668_0051073 | 3300046616 | Bacteria | 2290 |
| 1750 | Ga0495668_0360329 | 3300046616 | Bacteria | 798 |
| 1751 | Ga0495634_0625845 | 3300046642 | Bacteria | 623 |
| 1752 | Ga0495611_0175389 | 3300046648 | Bacteria | 1002 |
| 1753 | Ga0495625_0000714 | 3300046660 | Bacteria | 46916 |
| 1754 | Ga0495625_0010826 | 3300046660 | Bacteria | 7505 |
| 1755 | Ga0495625_0096602 | 3300046660 | Bacteria | 2035 |
| 1756 | Ga0495625_0108856 | 3300046660 | Bacteria | 1896 |
| 1757 | Ga0495625_0148101 | 3300046660 | Bacteria | 1579 |
| 1758 | Ga0495625_0627755 | 3300046660 | Bacteria | 642 |
| 1759 | Ga0495625_0850208 | 3300046660 | Bacteria | 527 |
| 1760 | Ga0495635_0463626 | 3300046663 | Bacteria | 837 |
| 1761 | Ga0495588_0076870 | 3300046674 | Bacteria | 1740 |
| 1762 | Ga0495623_0050249 | 3300046679 | Bacteria | 2641 |
| 1763 | Ga0495623_0587185 | 3300046679 | Bacteria | 580 |
| 1764 | Ga0495646_0031855 | 3300046680 | Bacteria | 3284 |
| 1765 | Ga0495647_0009386 | 3300046681 | Bacteria | 3313 |
| 1766 | Ga0495647_0010703 | 3300046681 | Bacteria | 3128 |
| 1767 | Ga0495647_0097247 | 3300046681 | Bacteria | 1215 |
| 1768 | Ga0495658_0201880 | 3300046683 | Bacteria | 1239 |
| 1769 | Ga0495658_0213479 | 3300046683 | Bacteria | 1206 |
| 1770 | Ga0495658_0300309 | 3300046683 | Bacteria | 1015 |
| 1771 | Ga0495658_0348305 | 3300046683 | Bacteria | 941 |
| 1772 | Ga0495658_0835723 | 3300046683 | Bacteria | 589 |
| 1773 | Ga0495613_0240571 | 3300046689 | Bacteria | 1266 |
| 1774 | Ga0495624_0514420 | 3300046690 | Bacteria | 716 |
| 1775 | Ga0495624_0517615 | 3300046690 | Bacteria | 713 |
| 1776 | Ga0495624_0905451 | 3300046690 | Bacteria | 519 |
| 1777 | Ga0495670_0151238 | 3300046691 | Bacteria | 1217 |
| 1778 | Ga0495670_0183285 | 3300046691 | Bacteria | 1106 |
| 1779 | Ga0495671_0019317 | 3300046692 | Bacteria | 3605 |
| 1780 | Ga0495671_0327995 | 3300046692 | Bacteria | 735 |
| 1781 | Ga0495649_0004353 | 3300046694 | Bacteria | 9282 |
| 1782 | Ga0495649_0084532 | 3300046694 | Bacteria | 1694 |
| 1783 | Ga0495589_0027163 | 3300046794 | Bacteria | 2895 |
| 1784 | Ga0495589_0137394 | 3300046794 | Bacteria | 1172 |
| 1785 | Ga0495660_0006585 | 3300046810 | Bacteria | 6863 |
| 1786 | Ga0495660_0084665 | 3300046810 | Bacteria | 1658 |
| 1787 | Ga0495660_0433749 | 3300046810 | Bacteria | 570 |
| 1788 | Ga0495581_0525553 | 3300047315 | Bacteria | 687 |
| 1789 | Ga0495604_0900102 | 3300047317 | Bacteria | 553 |
| 1790 | Ga0495636_0517764 | 3300047318 | Bacteria | 578 |
| 1791 | Ga0495674_0003080 | 3300047319 | Bacteria | 16205 |
| 1792 | Ga0495674_0025003 | 3300047319 | Bacteria | 5481 |
| 1793 | Ga0495674_0131454 | 3300047319 | Bacteria | 2109 |
| 1794 | Ga0495672_0000655 | 3300047320 | Bacteria | 38461 |
| 1795 | Ga0495672_0022880 | 3300047320 | Bacteria | 4054 |
| 1796 | Ga0495676_0007147 | 3300047321 | Bacteria | 10247 |
| 1797 | Ga0495687_001512 | 3300047443 | Bacteria | 21202 |
| 1798 | Ga0495687_002480 | 3300047443 | Bacteria | 14721 |
| 1799 | Ga0495687_047916 | 3300047443 | Bacteria | 1836 |
| 1800 | Ga0495677_0045384 | 3300047445 | Bacteria | 1612 |
| 1801 | Ga0495673_0026656 | 3300047469 | Bacteria | 2760 |
| 1802 | Ga0495684_0527155 | 3300047471 | Bacteria | 808 |
| 1803 | Ga0495686_0005600 | 3300047472 | Bacteria | 9866 |
| 1804 | Ga0495686_0008724 | 3300047472 | Bacteria | 7397 |
| 1805 | Ga0495593_0006672 | 3300047673 | Bacteria | 6755 |
| 1806 | Ga0495593_0060213 | 3300047673 | Bacteria | 1988 |
| 1807 | Ga0495593_0100100 | 3300047673 | Bacteria | 1487 |
| 1808 | Ga0495602_0226558 | 3300048088 | Bacteria | 1407 |
| 1809 | Ga0495614_0009932 | 3300048089 | Bacteria | 4201 |
| 1810 | Ga0495626_0051745 | 3300048091 | Bacteria | 1894 |
| 1811 | Ga0496100_0047259 | 3300048903 | Bacteria | 2772 |
| 1812 | Ga0496100_0673556 | 3300048903 | Bacteria | 806 |
| 1813 | Ga0496101_0021483 | 3300048904 | Bacteria | 4435 |
| 1814 | Ga0496101_0043750 | 3300048904 | Bacteria | 3201 |
| 1815 | Ga0496101_0504671 | 3300048904 | Bacteria | 956 |
| 1816 | Ga0496101_1055879 | 3300048904 | Bacteria | 638 |
| 1817 | Ga0496102_0013747 | 3300048905 | Bacteria | 7020 |
| 1818 | Ga0496102_0051832 | 3300048905 | Bacteria | 3738 |
| 1819 | Ga0496102_0109753 | 3300048905 | Bacteria | 2571 |
| 1820 | Ga0496102_0173558 | 3300048905 | Bacteria | 2029 |
| 1821 | Ga0496103_0006569 | 3300048906 | Bacteria | 6937 |
| 1822 | Ga0496103_0399580 | 3300048906 | Bacteria | 883 |
| 1823 | Ga0496104_0015973 | 3300048907 | Bacteria | 6813 |
| 1824 | Ga0496104_0270479 | 3300048907 | Bacteria | 1612 |
| 1825 | Ga0496104_0684598 | 3300048907 | Bacteria | 933 |
| 1826 | Ga0496104_1377640 | 3300048907 | Bacteria | 608 |
| 1827 | Ga0496105_0005071 | 3300048908 | Bacteria | 9977 |
| 1828 | Ga0496105_0030674 | 3300048908 | Bacteria | 4405 |
| 1829 | Ga0496105_0045888 | 3300048908 | Bacteria | 3605 |
| 1830 | Ga0496105_0241040 | 3300048908 | Bacteria | 1467 |
| 1831 | Ga0496105_0828454 | 3300048908 | Bacteria | 702 |
| 1832 | Ga0496105_0834771 | 3300048908 | Bacteria | 698 |
| 1833 | Ga0496105_0938940 | 3300048908 | Bacteria | 650 |
| 1834 | Ga0496105_0968325 | 3300048908 | Bacteria | 638 |
| 1835 | Ga0496106_0184459 | 3300048909 | Bacteria | 1657 |
| 1836 | Ga0496106_0540275 | 3300048909 | Bacteria | 935 |
| 1837 | Ga0496107_0144211 | 3300048910 | Bacteria | 1760 |
| 1838 | Ga0496108_0022590 | 3300048911 | Bacteria | 5173 |
| 1839 | Ga0496108_0061117 | 3300048911 | Bacteria | 3170 |
| 1840 | Ga0496108_0090344 | 3300048911 | Bacteria | 2604 |
| 1841 | Ga0496108_0260502 | 3300048911 | Bacteria | 1509 |
| 1842 | Ga0496108_0411333 | 3300048911 | Bacteria | 1181 |
| 1843 | Ga0496108_0580207 | 3300048911 | Bacteria | 977 |
| 1844 | Ga0496108_0731375 | 3300048911 | Bacteria | 857 |
| 1845 | Ga0496108_1024469 | 3300048911 | Bacteria | 704 |
| 1846 | Ga0496108_1396629 | 3300048911 | Bacteria | 586 |
| 1847 | Ga0496109_0074882 | 3300048912 | Bacteria | 3113 |
| 1848 | Ga0496109_0079105 | 3300048912 | Bacteria | 3028 |
| 1849 | Ga0496109_0253973 | 3300048912 | Bacteria | 1655 |
| 1850 | Ga0496109_0435780 | 3300048912 | Bacteria | 1238 |
| 1851 | Ga0496109_0438180 | 3300048912 | Bacteria | 1234 |
| 1852 | Ga0496109_0448801 | 3300048912 | Bacteria | 1218 |
| 1853 | Ga0496110_0010246 | 3300048913 | Bacteria | 7614 |
| 1854 | Ga0496110_0027229 | 3300048913 | Bacteria | 4899 |
| 1855 | Ga0496110_0031132 | 3300048913 | Bacteria | 4602 |
| 1856 | Ga0496110_0070427 | 3300048913 | Bacteria | 3099 |
| 1857 | Ga0496110_0102247 | 3300048913 | Bacteria | 2570 |
| 1858 | Ga0496110_0283289 | 3300048913 | Bacteria | 1509 |
| 1859 | Ga0496110_1587025 | 3300048913 | Bacteria | 564 |
| 1860 | Ga0496111_0149804 | 3300048914 | Bacteria | 1730 |
| 1861 | Ga0496111_0551367 | 3300048914 | Bacteria | 846 |
| 1862 | Ga0496112_0308348 | 3300048915 | Bacteria | 1528 |
| 1863 | Ga0496112_0316248 | 3300048915 | Bacteria | 1506 |
| 1864 | Ga0496112_0330744 | 3300048915 | Bacteria | 1467 |
| 1865 | Ga0496113_0009758 | 3300048916 | Bacteria | 6311 |
| 1866 | Ga0496113_0049458 | 3300048916 | Bacteria | 3130 |
| 1867 | Ga0496113_0777851 | 3300048916 | Bacteria | 761 |
| 1868 | Ga0496114_0079247 | 3300048917 | Bacteria | 2772 |
| 1869 | Ga0496114_1395569 | 3300048917 | Bacteria | 588 |
| 1870 | Ga0496115_0007123 | 3300048918 | Bacteria | 8212 |
| 1871 | Ga0496116_0004666 | 3300048919 | Bacteria | 12969 |
| 1872 | Ga0496116_0009886 | 3300048919 | Bacteria | 8068 |
| 1873 | Ga0496116_0017716 | 3300048919 | Bacteria | 5518 |
| 1874 | Ga0496116_0145930 | 3300048919 | Bacteria | 1322 |
| 1875 | Ga0496116_0337573 | 3300048919 | Bacteria | 696 |
| 1876 | Ga0496116_0477789 | 3300048919 | Bacteria | 525 |
| 1877 | Ga0496117_0020169 | 3300048920 | Bacteria | 5445 |
| 1878 | Ga0496117_0037073 | 3300048920 | Bacteria | 3637 |
| 1879 | Ga0496117_0075277 | 3300048920 | Bacteria | 2243 |
| 1880 | Ga0496117_0117343 | 3300048920 | Bacteria | 1643 |
| 1881 | Ga0496117_0489530 | 3300048920 | Bacteria | 599 |
| 1882 | Ga0496118_0007919 | 3300048921 | Bacteria | 11122 |
| 1883 | Ga0496118_0011718 | 3300048921 | Bacteria | 8523 |
| 1884 | Ga0496118_0015352 | 3300048921 | Bacteria | 7096 |
| 1885 | Ga0496118_0071859 | 3300048921 | Bacteria | 2488 |
| 1886 | Ga0496118_0186102 | 3300048921 | Bacteria | 1248 |
| 1887 | Ga0496119_0049882 | 3300048922 | Bacteria | 2584 |
| 1888 | Ga0496119_0063307 | 3300048922 | Bacteria | 2201 |
| 1889 | Ga0496119_0075863 | 3300048922 | Bacteria | 1952 |
| 1890 | Ga0496119_0228659 | 3300048922 | Bacteria | 948 |
| 1891 | Ga0496119_0367284 | 3300048922 | Bacteria | 693 |
| 1892 | Ga0496120_0011850 | 3300048923 | Bacteria | 5966 |
| 1893 | Ga0496120_0107456 | 3300048923 | Bacteria | 1463 |
| 1894 | Ga0496121_0000257 | 3300048924 | Bacteria | 112257 |
| 1895 | Ga0496121_0000478 | 3300048924 | Bacteria | 77761 |
| 1896 | Ga0496121_0110968 | 3300048924 | Bacteria | 2092 |
| 1897 | Ga0496121_0180297 | 3300048924 | Bacteria | 1525 |
| 1898 | Ga0496121_0223451 | 3300048924 | Bacteria | 1324 |
| 1899 | Ga0496121_0251144 | 3300048924 | Bacteria | 1226 |
| 1900 | Ga0496121_0251147 | 3300048924 | Bacteria | 1226 |
| 1901 | Ga0496121_0724773 | 3300048924 | Bacteria | 595 |
| 1902 | Ga0496122_0000077 | 3300048925 | Bacteria | 218099 |
| 1903 | Ga0496122_0000177 | 3300048925 | Bacteria | 151124 |
| 1904 | Ga0496122_0021150 | 3300048925 | Bacteria | 5837 |
| 1905 | Ga0496122_0056621 | 3300048925 | Bacteria | 2921 |
| 1906 | Ga0496122_0068323 | 3300048925 | Bacteria | 2552 |
| 1907 | Ga0496122_0078507 | 3300048925 | Bacteria | 2312 |
| 1908 | Ga0496122_0143523 | 3300048925 | Bacteria | 1489 |
| 1909 | Ga0496122_0171797 | 3300048925 | Bacteria | 1305 |
| 1910 | Ga0496123_0000050 | 3300048926 | Bacteria | 238021 |
| 1911 | Ga0496123_0003980 | 3300048926 | Bacteria | 16002 |
| 1912 | Ga0496123_0030980 | 3300048926 | Bacteria | 3902 |
| 1913 | Ga0496123_0055801 | 3300048926 | Bacteria | 2588 |
| 1914 | Ga0496123_0065568 | 3300048926 | Bacteria | 2307 |
| 1915 | Ga0496123_0194941 | 3300048926 | Bacteria | 1044 |
| 1916 | Ga0496124_0000036 | 3300048927 | Bacteria | 318032 |
| 1917 | Ga0496124_0002660 | 3300048927 | Bacteria | 22924 |
| 1918 | Ga0496124_0006878 | 3300048927 | Bacteria | 12232 |
| 1919 | Ga0496124_0059631 | 3300048927 | Bacteria | 3205 |
| 1920 | Ga0496124_0103335 | 3300048927 | Bacteria | 2305 |
| 1921 | Ga0496124_0154437 | 3300048927 | Bacteria | 1796 |
| 1922 | Ga0496124_0166248 | 3300048927 | Bacteria | 1714 |
| 1923 | Ga0496124_0242212 | 3300048927 | Bacteria | 1340 |
| 1924 | Ga0496124_0269123 | 3300048927 | Bacteria | 1249 |
| 1925 | Ga0496124_0320485 | 3300048927 | Bacteria | 1110 |
| 1926 | Ga0496124_0437038 | 3300048927 | Bacteria | 896 |
| 1927 | Ga0496124_0472814 | 3300048927 | Bacteria | 848 |
| 1928 | Ga0496125_0000146 | 3300048928 | Bacteria | 154919 |
| 1929 | Ga0496125_0021126 | 3300048928 | Bacteria | 6083 |
| 1930 | Ga0496125_0031217 | 3300048928 | Bacteria | 4751 |
| 1931 | Ga0496125_0043130 | 3300048928 | Bacteria | 3834 |
| 1932 | Ga0496125_0043843 | 3300048928 | Bacteria | 3791 |
| 1933 | Ga0496125_0080851 | 3300048928 | Bacteria | 2485 |
| 1934 | Ga0496125_0097356 | 3300048928 | Bacteria | 2180 |
| 1935 | Ga0496125_0210477 | 3300048928 | Bacteria | 1263 |
| 1936 | Ga0496125_0737410 | 3300048928 | Bacteria | 518 |
| 1937 | Ga0496126_0137352 | 3300048929 | Bacteria | 2107 |
| 1938 | Ga0496126_0156464 | 3300048929 | Bacteria | 1950 |
| 1939 | Ga0496126_0315190 | 3300048929 | Bacteria | 1287 |
| 1940 | Ga0496126_0497852 | 3300048929 | Bacteria | 974 |
| 1941 | Ga0501306_021570 | 3300049127 | Bacteria | 903 |
| 1942 | Ga0501310_015194 | 3300049130 | Bacteria | 911 |
| 1943 | Ga0495682_0014946 | 3300049460 | Bacteria | 2941 |
| 1944 | Ga0495682_0064665 | 3300049460 | Bacteria | 1319 |
| 1945 | Ga0501290_007970 | 3300049513 | Bacteria | 1334 |
| 1946 | Ga0501292_008734 | 3300049515 | Bacteria | 1489 |
| 1947 | Ga0501298_172416 | 3300049521 | Bacteria | 539 |
| 1948 | Ga0501300_009618 | 3300049523 | Bacteria | 1410 |
| 1949 | Ga0501301_015817 | 3300049524 | Bacteria | 677 |
| 1950 | Ga0501303_012601 | 3300049526 | Bacteria | 816 |
| 1951 | Ga0501312_045622 | 3300049528 | Bacteria | 727 |
| 1952 | Ga0501315_014423 | 3300049531 | Bacteria | 1001 |
| 1953 | Ga0501323_026474 | 3300049539 | Bacteria | 794 |
| 1954 | Ga0501032_0335137 | 3300049569 | Bacteria | 975 |
| 1955 | Ga0501033_0020756 | 3300049570 | Bacteria | 4963 |
| 1956 | Ga0501037_0834719 | 3300049573 | Bacteria | 607 |
| 1957 | Ga0501042_0909589 | 3300049578 | Bacteria | 641 |
| 1958 | Ga0501043_0000023 | 3300049579 | Bacteria | 154331 |
| 1959 | Ga0501043_0095479 | 3300049579 | Bacteria | 2337 |
| 1960 | Ga0501046_0000018 | 3300049580 | Bacteria | 220589 |
| 1961 | Ga0501047_0000020 | 3300049581 | Bacteria | 259377 |
| 1962 | Ga0501047_0019486 | 3300049581 | Bacteria | 6508 |
| 1963 | Ga0501047_0279819 | 3300049581 | Bacteria | 1513 |
| 1964 | Ga0501047_0287863 | 3300049581 | Bacteria | 1487 |
| 1965 | Ga0501048_0001064 | 3300049582 | Bacteria | 20552 |
| 1966 | Ga0501068_0794170 | 3300049584 | Bacteria | 621 |
| 1967 | Ga0501070_0220651 | 3300049586 | Bacteria | 1555 |
| 1968 | Ga0501074_1153505 | 3300049590 | Bacteria | 544 |
| 1969 | Ga0501198_000006 | 3300049649 | Bacteria | 129954 |
| 1970 | Ga0501206_022334 | 3300049653 | Bacteria | 907 |
| 1971 | Ga0501222_000007 | 3300049662 | Bacteria | 126703 |
| 1972 | Ga0501222_009041 | 3300049662 | Bacteria | 1319 |
| 1973 | Ga0501222_027554 | 3300049662 | Bacteria | 773 |
| 1974 | Ga0501249_019142 | 3300049679 | Bacteria | 1484 |
| 1975 | Ga0501257_067637 | 3300049686 | Bacteria | 909 |
| 1976 | Ga0501261_029283 | 3300049690 | Bacteria | 826 |
| 1977 | Ga0501221_074704 | 3300049704 | Bacteria | 806 |
| 1978 | Ga0501225_0022614 | 3300049705 | Bacteria | 1735 |
| 1979 | Ga0501080_0447141 | 3300049742 | Bacteria | 1159 |
| 1980 | Ga0501083_0743463 | 3300049744 | Bacteria | 638 |
| 1981 | Ga0501241_090622 | 3300049758 | Bacteria | 647 |
| 1982 | Ga0501262_000426 | 3300049759 | Bacteria | 5053 |
| 1983 | Ga0501262_004524 | 3300049759 | Bacteria | 1615 |
| 1984 | Ga0501265_006632 | 3300049762 | Bacteria | 1349 |
| 1985 | Ga0501035_0005419 | 3300049822 | Bacteria | 12063 |
| 1986 | Ga0501035_0014590 | 3300049822 | Bacteria | 7252 |
| 1987 | Ga0501035_0042955 | 3300049822 | Bacteria | 4075 |
| 1988 | Ga0501035_0640938 | 3300049822 | Bacteria | 862 |
| 1989 | Ga0501035_1512598 | 3300049822 | Bacteria | 511 |
| 1990 | Ga0501044_0000124 | 3300049823 | Bacteria | 92998 |
| 1991 | Ga0501044_0349267 | 3300049823 | Bacteria | 1399 |
| 1992 | nmdc:mga03683_129022_c1 | 3300050489 | Bacteria | 1130 |
| 1993 | nmdc:mga03683_13658_c1 | 3300050489 | Bacteria | 2993 |
| 1994 | nmdc:mga03683_15946_c1 | 3300050489 | Bacteria | 2813 |
| 1995 | nmdc:mga03683_25031_c1 | 3300050489 | Bacteria | 2340 |
| 1996 | nmdc:mga03683_257465_c1 | 3300050489 | Bacteria | 811 |
| 1997 | nmdc:mga03683_302734_c1 | 3300050489 | Bacteria | 750 |
| 1998 | nmdc:mga03683_35298_c1 | 3300050489 | Bacteria | 2028 |
| 1999 | nmdc:mga03683_36243_c1 | 3300050489 | Bacteria | 2006 |
| 2000 | nmdc:mga03683_403677_c1 | 3300050489 | Bacteria | 653 |
| 2001 | nmdc:mga03683_40783_c1 | 3300050489 | Bacteria | 1905 |
| 2002 | nmdc:mga03683_416764_c1 | 3300050489 | Bacteria | 643 |
| 2003 | nmdc:mga03683_52476_c1 | 3300050489 | Bacteria | 1704 |
| 2004 | nmdc:mga03683_64218_c1 | 3300050489 | Bacteria | 1557 |
| 2005 | nmdc:mga03n38_119129_c1 | 3300050490 | Bacteria | 1295 |
| 2006 | nmdc:mga03n38_150061_c1 | 3300050490 | Bacteria | 1172 |
| 2007 | nmdc:mga03n38_29739_c1 | 3300050490 | Bacteria | 2289 |
| 2008 | nmdc:mga03n38_413424_c1 | 3300050490 | Bacteria | 745 |
| 2009 | nmdc:mga03n38_464600_c1 | 3300050490 | Bacteria | 706 |
| 2010 | nmdc:mga03n38_518338_c1 | 3300050490 | Bacteria | 671 |
| 2011 | nmdc:mga03n38_67321_c1 | 3300050490 | Bacteria | 1648 |
| 2012 | nmdc:mga03n38_82759_c1 | 3300050490 | Bacteria | 1512 |
| 2013 | nmdc:mga00v17_178309_c1 | 3300050491 | Bacteria | 1371 |
| 2014 | nmdc:mga00v17_259459_c1 | 3300050491 | Bacteria | 1127 |
| 2015 | nmdc:mga00v17_29618_c1 | 3300050491 | Bacteria | 3214 |
| 2016 | nmdc:mga00v17_36194_c1 | 3300050491 | Bacteria | 2941 |
| 2017 | nmdc:mga00v17_80575_c1 | 3300050491 | Bacteria | 2032 |
| 2018 | nmdc:mga00v17_854253_c1 | 3300050491 | Bacteria | 578 |
| 2019 | nmdc:mga00v17_948565_c1 | 3300050491 | Bacteria | 543 |
| 2020 | nmdc:mga0yw44_17114_c1 | 3300050492 | Bacteria | 3936 |
| 2021 | nmdc:mga0yw44_2117_c1 | 3300050492 | Bacteria | 8316 |
| 2022 | nmdc:mga0yw44_568078_c1 | 3300050492 | Bacteria | 770 |
| 2023 | nmdc:mga0k408_10403_c1 | 3300050493 | Bacteria | 5031 |
| 2024 | nmdc:mga0k408_1042_c1 | 3300050493 | Bacteria | 15212 |
| 2025 | nmdc:mga0k408_113390_c1 | 3300050493 | Bacteria | 1270 |
| 2026 | nmdc:mga0k408_1409_c2 | 3300050493 | Bacteria | 9482 |
| 2027 | nmdc:mga0k408_184_c1 | 3300050493 | Bacteria | 32850 |
| 2028 | nmdc:mga0k408_21023_c1 | 3300050493 | Bacteria | 3663 |
| 2029 | nmdc:mga0k408_213388_c1 | 3300050493 | Bacteria | 1153 |
| 2030 | nmdc:mga0k408_218610_c1 | 3300050493 | Bacteria | 1138 |
| 2031 | nmdc:mga0k408_234464_c1 | 3300050493 | Bacteria | 1096 |
| 2032 | nmdc:mga0k408_24809_c1 | 3300050493 | Bacteria | 3093 |
| 2033 | nmdc:mga0k408_249873_c1 | 3300050493 | Bacteria | 1059 |
| 2034 | nmdc:mga0k408_258989_c1 | 3300050493 | Bacteria | 1039 |
| 2035 | nmdc:mga0k408_269183_c1 | 3300050493 | Bacteria | 1017 |
| 2036 | nmdc:mga0k408_287274_c1 | 3300050493 | Bacteria | 982 |
| 2037 | nmdc:mga0k408_289518_c1 | 3300050493 | Bacteria | 978 |
| 2038 | nmdc:mga0k408_308331_c1 | 3300050493 | Bacteria | 945 |
| 2039 | nmdc:mga0k408_318128_c1 | 3300050493 | Bacteria | 929 |
| 2040 | nmdc:mga0k408_319019_c1 | 3300050493 | Bacteria | 927 |
| 2041 | nmdc:mga0k408_3275_c1 | 3300050493 | Bacteria | 8570 |
| 2042 | nmdc:mga0k408_33719_c1 | 3300050493 | Bacteria | 2929 |
| 2043 | nmdc:mga0k408_33735_c1 | 3300050493 | Bacteria | 2928 |
| 2044 | nmdc:mga0k408_344847_c1 | 3300050493 | Bacteria | 888 |
| 2045 | nmdc:mga0k408_369265_c1 | 3300050493 | Bacteria | 855 |
| 2046 | nmdc:mga0k408_371103_c1 | 3300050493 | Bacteria | 853 |
| 2047 | nmdc:mga0k408_37772_c1 | 3300050493 | Bacteria | 2773 |
| 2048 | nmdc:mga0k408_38238_c2 | 3300050493 | Bacteria | 2386 |
| 2049 | nmdc:mga0k408_428840_c1 | 3300050493 | Bacteria | 786 |
| 2050 | nmdc:mga0k408_431_c1 | 3300050493 | Bacteria | 14862 |
| 2051 | nmdc:mga0k408_446061_c1 | 3300050493 | Bacteria | 769 |
| 2052 | nmdc:mga0k408_6723_c1 | 3300050493 | Bacteria | 6133 |
| 2053 | nmdc:mga0k408_73412_c1 | 3300050493 | Bacteria | 1998 |
| 2054 | nmdc:mga0k408_85145_c1 | 3300050493 | Bacteria | 1855 |
| 2055 | nmdc:mga0k408_922826_c1 | 3300050493 | Bacteria | 506 |
| 2056 | nmdc:mga0k408_98343_c1 | 3300050493 | Bacteria | 1724 |
| 2057 | nmdc:mga06z11_10830_c1 | 3300050494 | Bacteria | 3904 |
| 2058 | nmdc:mga06z11_150164_c1 | 3300050494 | Bacteria | 1324 |
| 2059 | nmdc:mga06z11_150172_c1 | 3300050494 | Bacteria | 1324 |
| 2060 | nmdc:mga06z11_15291_c1 | 3300050494 | Bacteria | 3422 |
| 2061 | nmdc:mga06z11_161766_c1 | 3300050494 | Bacteria | 1280 |
| 2062 | nmdc:mga06z11_524843_c1 | 3300050494 | Bacteria | 718 |
| 2063 | nmdc:mga06z11_617420_c1 | 3300050494 | Bacteria | 660 |
| 2064 | nmdc:mga06z11_783752_c1 | 3300050494 | Bacteria | 581 |
| 2065 | nmdc:mga04h51_165110_c1 | 3300050495 | Bacteria | 854 |
| 2066 | nmdc:mga04h51_183773_c1 | 3300050495 | Bacteria | 815 |
| 2067 | nmdc:mga04h51_486730_c1 | 3300050495 | Bacteria | 526 |
| 2068 | nmdc:mga04h51_50859_c1 | 3300050495 | Bacteria | 1390 |
| 2069 | nmdc:mga04h51_55031_c1 | 3300050495 | Bacteria | 1347 |
| 2070 | nmdc:mga07m45_134161_c1 | 3300050496 | Bacteria | 1433 |
| 2071 | nmdc:mga07m45_142225_c1 | 3300050496 | Bacteria | 1390 |
| 2072 | nmdc:mga07m45_143054_c1 | 3300050496 | Bacteria | 1386 |
| 2073 | nmdc:mga07m45_1476_c1 | 3300050496 | Bacteria | 10809 |
| 2074 | nmdc:mga07m45_15079_c1 | 3300050496 | Bacteria | 4127 |
| 2075 | nmdc:mga07m45_172943_c1 | 3300050496 | Bacteria | 1256 |
| 2076 | nmdc:mga07m45_185_c2 | 3300050496 | Bacteria | 20271 |
| 2077 | nmdc:mga07m45_188626_c1 | 3300050496 | Bacteria | 1199 |
| 2078 | nmdc:mga07m45_235204_c1 | 3300050496 | Bacteria | 1066 |
| 2079 | nmdc:mga07m45_33735_c1 | 3300050496 | Bacteria | 2844 |
| 2080 | nmdc:mga07m45_4156_c1 | 3300050496 | Bacteria | 7068 |
| 2081 | nmdc:mga07m45_42688_c1 | 3300050496 | Bacteria | 2543 |
| 2082 | nmdc:mga07m45_456517_c1 | 3300050496 | Bacteria | 741 |
| 2083 | nmdc:mga07m45_47374_c1 | 3300050496 | Bacteria | 2417 |
| 2084 | nmdc:mga07m45_51524_c1 | 3300050496 | Bacteria | 2321 |
| 2085 | nmdc:mga07m45_57467_c1 | 3300050496 | Bacteria | 2200 |
| 2086 | nmdc:mga07m45_63097_c1 | 3300050496 | Bacteria | 2101 |
| 2087 | nmdc:mga07m45_63_c1 | 3300050496 | Bacteria | 41859 |
| 2088 | nmdc:mga07m45_765786_c1 | 3300050496 | Bacteria | 554 |
| 2089 | nmdc:mga07m45_8991_c1 | 3300050496 | Bacteria | 5159 |
| 2090 | nmdc:mga07m45_89_c1 | 3300050496 | Bacteria | 34943 |
| 2091 | nmdc:mga05p37_224604_c1 | 3300050507 | Bacteria | 2265 |
| 2092 | nmdc:mga0qj67_513127_c1 | 3300050509 | Bacteria | 963 |
| 2093 | nmdc:mga08y16_1118147_c1 | 3300050511 | Bacteria | 762 |
| 2094 | nmdc:mga08y16_1203545_c1 | 3300050511 | Bacteria | 728 |
| 2095 | nmdc:mga0rr50_1478700_c1 | 3300050513 | Bacteria | 574 |
| 2096 | nmdc:mga0a205_1567267_c1 | 3300050515 | Bacteria | 507 |
| 2097 | nmdc:mga0sz30_255183_c1 | 3300050516 | Bacteria | 781 |
| 2098 | nmdc:mga0sz30_5833_c1 | 3300050516 | Bacteria | 4538 |
| 2099 | nmdc:mga0sz30_71021_c1 | 3300050516 | Bacteria | 1499 |
| 2100 | Ga0495601_0019173 | 3300053077 | Bacteria | 4170 |
| 2101 | Ga0500610_0013258 | 3300053079 | Bacteria | 3829 |
| 2102 | Ga0500635_0000141 | 3300053080 | Bacteria | 40938 |
| 2103 | Ga0500635_0174722 | 3300053080 | Bacteria | 828 |
| 2104 | Ga0495595_0027263 | 3300053084 | Bacteria | 2544 |
| 2105 | Ga0495619_0305846 | 3300053085 | Bacteria | 1101 |
| 2106 | Ga0500578_0012415 | 3300053086 | Bacteria | 5497 |
| 2107 | Ga0500578_0014379 | 3300053086 | Bacteria | 5091 |
| 2108 | Ga0500578_0269994 | 3300053086 | Bacteria | 1018 |
| 2109 | Ga0500578_0332177 | 3300053086 | Bacteria | 893 |
| 2110 | Ga0500643_010889 | 3300053087 | Bacteria | 3356 |
| 2111 | Ga0500643_059800 | 3300053087 | Bacteria | 1071 |
| 2112 | Ga0500644_0068624 | 3300053088 | Bacteria | 1271 |
| 2113 | Ga0500644_0203105 | 3300053088 | Bacteria | 820 |
| 2114 | Ga0500581_347294 | 3300053089 | Bacteria | 564 |
| 2115 | Ga0500646_0023313 | 3300053090 | Bacteria | 1659 |
| 2116 | Ga0500651_0000430 | 3300053093 | Bacteria | 22553 |
| 2117 | Ga0500651_0040824 | 3300053093 | Bacteria | 2924 |
| 2118 | Ga0500651_0062864 | 3300053093 | Bacteria | 2317 |
| 2119 | Ga0500651_0071886 | 3300053093 | Bacteria | 2152 |
| 2120 | Ga0500641_0051443 | 3300053096 | Bacteria | 1695 |
| 2121 | Ga0500641_0121902 | 3300053096 | Bacteria | 1124 |
| 2122 | Ga0500650_0137949 | 3300053098 | Bacteria | 1131 |
| 2123 | Ga0500562_013680 | 3300053108 | Bacteria | 2075 |
| 2124 | Ga0500562_033286 | 3300053108 | Bacteria | 1362 |
| 2125 | Ga0500571_000252 | 3300053110 | Bacteria | 20356 |
| 2126 | Ga0500593_000652 | 3300053117 | Bacteria | 13240 |
| 2127 | Ga0500594_0001047 | 3300053118 | Bacteria | 5924 |
| 2128 | Ga0500594_0007268 | 3300053118 | Bacteria | 2504 |
| 2129 | Ga0500595_084247 | 3300053119 | Bacteria | 927 |
| 2130 | Ga0500607_001874 | 3300053121 | Bacteria | 18035 |
| 2131 | Ga0500608_003111 | 3300053122 | Bacteria | 6160 |
| 2132 | Ga0500608_336011 | 3300053122 | Bacteria | 542 |
| 2133 | Ga0500614_143450 | 3300053123 | Bacteria | 716 |
| 2134 | Ga0500618_006166 | 3300053125 | Bacteria | 3547 |
| 2135 | Ga0500626_170970 | 3300053128 | Bacteria | 884 |
| 2136 | Ga0500628_001978 | 3300053129 | Bacteria | 3443 |
| 2137 | Ga0500642_0003789 | 3300053130 | Bacteria | 4632 |
| 2138 | Ga0500642_0343800 | 3300053130 | Bacteria | 664 |
| 2139 | Ga0500652_000307 | 3300053131 | Bacteria | 17714 |
| 2140 | Ga0500652_051518 | 3300053131 | Bacteria | 1682 |
| 2141 | Ga0500658_0000352 | 3300053134 | Bacteria | 20402 |
| 2142 | Ga0500658_0003377 | 3300053134 | Bacteria | 6041 |
| 2143 | Ga0500559_0000191 | 3300053136 | Bacteria | 49243 |
| 2144 | Ga0500559_0021313 | 3300053136 | Bacteria | 2746 |
| 2145 | Ga0500559_0169647 | 3300053136 | Bacteria | 1026 |
| 2146 | Ga0500559_0400613 | 3300053136 | Bacteria | 638 |
| 2147 | Ga0500568_0008116 | 3300053139 | Bacteria | 5090 |
| 2148 | Ga0500568_0010712 | 3300053139 | Bacteria | 4282 |
| 2149 | Ga0500568_0013994 | 3300053139 | Bacteria | 3636 |
| 2150 | Ga0500568_0023355 | 3300053139 | Bacteria | 2630 |
| 2151 | Ga0500577_0056692 | 3300053142 | Bacteria | 1492 |
| 2152 | Ga0500586_272474 | 3300053145 | Bacteria | 521 |
| 2153 | Ga0500600_0004796 | 3300053149 | Bacteria | 7946 |
| 2154 | Ga0500604_0005077 | 3300053151 | Bacteria | 3480 |
| 2155 | Ga0500616_0079455 | 3300053153 | Bacteria | 1651 |
| 2156 | Ga0500619_001373 | 3300053154 | Bacteria | 4281 |
| 2157 | Ga0500622_0000160 | 3300053156 | Bacteria | 70774 |
| 2158 | Ga0500622_0001454 | 3300053156 | Bacteria | 18928 |
| 2159 | Ga0500622_0002916 | 3300053156 | Bacteria | 11895 |
| 2160 | Ga0500622_0049393 | 3300053156 | Bacteria | 2169 |
| 2161 | Ga0500627_0082231 | 3300053158 | Bacteria | 1436 |
| 2162 | Ga0500627_0228641 | 3300053158 | Bacteria | 828 |
| 2163 | Ga0500627_0393109 | 3300053158 | Bacteria | 592 |
| 2164 | Ga0500634_0002470 | 3300053161 | Bacteria | 7808 |
| 2165 | Ga0500638_003518 | 3300053162 | Bacteria | 5815 |
| 2166 | Ga0500636_0000056 | 3300053177 | Bacteria | 53780 |
| 2167 | Ga0500636_0021960 | 3300053177 | Bacteria | 3777 |
| 2168 | Ga0500636_0176766 | 3300053177 | Bacteria | 1150 |
| 2169 | Ga0500637_0082707 | 3300053178 | Bacteria | 1855 |
| 2170 | Ga0500625_159704 | 3300053729 | Bacteria | 830 |
| 2171 | Ga0500645_006616 | 3300053730 | Bacteria | 4111 |
| 2172 | Ga0500645_130547 | 3300053730 | Bacteria | 698 |
| 2173 | Ga0590071_000819 | 3300059421 | Bacteria | 8680 |
| 2174 | Ga0590074_014194 | 3300059423 | Bacteria | 1347 |
| 2175 | Ga0590077_094099 | 3300059426 | Bacteria | 697 |
| 2176 | Ga0587107_039858 | 3300059652 | Bacteria | 754 |
| 2177 | Ga0466962_0023883 | 3300061719 | Bacteria | 2938 |
| 2178 | Ga0466962_0174104 | 3300061719 | Bacteria | 1048 |
| 2179 | Ga0466962_0613120 | 3300061719 | Bacteria | 555 |
| 2180 | 2501072656 | 2501025501 | Bacteria | 7768574 |
| 2181 | 2501080514 | 2501025502 | Bacteria | 9641094 |
| 2182 | 2501410538 | 2501025504 | Bacteria | 8008976 |
| 2183 | 2509129719 | 2508501125 | Bacteria | 7208311 |
| 2184 | 2510251509 | 2510065045 | Bacteria | 7761063 |
| 2185 | 2511087025 | 2510917013 | Bacteria | 9951648 |
| 2186 | 2511096994 | 2510917014 | Bacteria | 8296963 |
| 2187 | 2511103804 | 2510917015 | Bacteria | 7950052 |
| 2188 | 2512345533 | 2512047030 | Bacteria | 9031815 |
| 2189 | 2513226638 | 2513020051 | Bacteria | 6053213 |
| 2190 | 2513960104 | 2513237151 | Bacteria | 6309801 |
| 2191 | 2514048883 | 2513237166 | Bacteria | 10373764 |
| 2192 | 2515680819 | 2515154122 | Bacteria | 8609520 |
| 2193 | 2515690698 | 2515154123 | Bacteria | 6387382 |
| 2194 | 2516019471 | 2515154189 | Bacteria | 9629850 |
| 2195 | 2519459173 | 2519103095 | Bacteria | 6629912 |
| 2196 | 2527075488 | 2526164713 | Bacteria | 6780608 |
| 2197 | 2547372534 | 2547132103 | Bacteria | 5115736 |
| 2198 | 2555260046 | 2554235234 | Bacteria | 5762085 |
| 2199 | 2563058828 | 2562617112 | Bacteria | 10918404 |
| 2200 | 2585290247 | 2582581311 | Bacteria | 6763856 |
| 2201 | 2587730421 | 2585428057 | Bacteria | 6737412 |
| 2202 | 2587733182 | 2585428058 | Bacteria | 6853932 |
| 2203 | 2587755893 | 2585428062 | Bacteria | 6842168 |
| 2204 | 2588294396 | 2588253510 | Bacteria | 6901809 |
| 2205 | 2599412563 | 2599185169 | Bacteria | 5441380 |
| 2206 | 2599624963 | 2599185214 | Bacteria | 8209958 |
| 2207 | 2599672975 | 2599185226 | Bacteria | 8233575 |
| 2208 | 2599682575 | 2599185227 | Bacteria | 8246414 |
| 2209 | 2599694583 | 2599185229 | Bacteria | 8216126 |
| 2210 | 2599736774 | 2599185239 | Bacteria | 8686614 |
| 2211 | 2599744846 | 2599185240 | Bacteria | 7968121 |
| 2212 | 2599905002 | 2599185292 | Bacteria | 6290804 |
| 2213 | 2600205790 | 2599185355 | Bacteria | 7968906 |
| 2214 | 2600812107 | 2600255067 | Bacteria | 6795583 |
| 2215 | 2601524089 | 2600255254 | Bacteria | 5281859 |
| 2216 | 2601529243 | 2600255255 | Bacteria | 5282785 |
| 2217 | 2601616077 | 2600255280 | Bacteria | 5292309 |
| 2218 | 2601620802 | 2600255281 | Bacteria | 5288753 |
| 2219 | 2601644144 | 2600255287 | Bacteria | 5210468 |
| 2220 | 2601649199 | 2600255288 | Bacteria | 5282738 |
| 2221 | 2601654126 | 2600255289 | Bacteria | 5281907 |
| 2222 | 2601659548 | 2600255290 | Bacteria | 5282218 |
| 2223 | 2601663969 | 2600255291 | Bacteria | 5217298 |
| 2224 | 2601696926 | 2600255298 | Bacteria | 5215185 |
| 2225 | 2601701975 | 2600255299 | Bacteria | 5218662 |
| 2226 | 2601706870 | 2600255300 | Bacteria | 5287774 |
| 2227 | 2601712179 | 2600255301 | Bacteria | 5280532 |
| 2228 | 2601717387 | 2600255302 | Bacteria | 5288235 |
| 2229 | 2601722345 | 2600255303 | Bacteria | 5219315 |
| 2230 | 2601727315 | 2600255304 | Bacteria | 5283973 |
| 2231 | 2601732620 | 2600255305 | Bacteria | 5282329 |
| 2232 | 2601736865 | 2600255306 | Bacteria | 5281613 |
| 2233 | 2601743192 | 2600255307 | Bacteria | 5439064 |
| 2234 | 2601753986 | 2600255309 | Bacteria | 5431045 |
| 2235 | 2602021080 | 2600255392 | Bacteria | 5437392 |
| 2236 | 2603662127 | 2602042052 | Bacteria | 5215873 |
| 2237 | 2603667026 | 2602042053 | Bacteria | 5214361 |
| 2238 | 2603839739 | 2602042103 | Bacteria | 5284714 |
| 2239 | 2603844813 | 2602042104 | Bacteria | 5281639 |
| 2240 | 2603850180 | 2602042105 | Bacteria | 5282303 |
| 2241 | 2603854956 | 2602042106 | Bacteria | 5282744 |
| 2242 | 2603867704 | 2602042109 | Bacteria | 5152801 |
| 2243 | 2603872532 | 2602042110 | Bacteria | 5283285 |
| 2244 | 2603877838 | 2602042111 | Bacteria | 5212080 |
| 2245 | 2606050009 | 2603880178 | Bacteria | 5283018 |
| 2246 | 2606071669 | 2603880184 | Bacteria | 5217896 |
| 2247 | 2606147400 | 2603880202 | Bacteria | 5284684 |
| 2248 | 2606177899 | 2603880211 | Bacteria | 5284226 |
| 2249 | 2609909418 | 2609459761 | Bacteria | 5513740 |
| 2250 | 2637223893 | 2636415599 | Bacteria | 5718434 |
| 2251 | 2643860359 | 2643221569 | Bacteria | 6064337 |
| 2252 | 2643968983 | 2643221592 | Bacteria | 6608788 |
| 2253 | 2643979418 | 2643221594 | Bacteria | 5811388 |
| 2254 | 2644119906 | 2643221621 | Bacteria | 6212786 |
| 2255 | 2644144114 | 2643221625 | Bacteria | 6512927 |
| 2256 | 2644159347 | 2643221628 | Bacteria | 5745828 |
| 2257 | 2644249093 | 2643221644 | Bacteria | 6865017 |
| 2258 | 2644273234 | 2643221648 | Bacteria | 6521465 |
| 2259 | 2644304328 | 2643221654 | Bacteria | 5273570 |
| 2260 | 2644329274 | 2643221658 | Bacteria | 6064537 |
| 2261 | 2644337319 | 2643221660 | Bacteria | 4208257 |
| 2262 | 2644401147 | 2643221672 | Bacteria | 6322190 |
| 2263 | 2676405306 | 2675903046 | Bacteria | 5451247 |
| 2264 | 2676742975 | 2675903129 | Bacteria | 7964495 |
| 2265 | 2707099697 | 2706794495 | Bacteria | 4536932 |
| 2266 | 2713476518 | 2711768613 | Bacteria | 11048459 |
| 2267 | 2719640623 | 2718217991 | Bacteria | 7829542 |
| 2268 | 2723878533 | 2721755763 | Bacteria | 4464185 |
| 2269 | 2735818211 | 2734482258 | Unclassified | 2930739 |
| 2270 | 2738717409 | 2738541277 | Bacteria | 7458140 |
| 2271 | 2738818678 | 2738541296 | Bacteria | 7285013 |
| 2272 | 2738831165 | 2738541298 | Bacteria | 7286732 |
| 2273 | 2738872693 | 2738541306 | Bacteria | 7284992 |
| 2274 | 2738879013 | 2738541307 | Bacteria | 8606193 |
| 2275 | 2739184323 | 2738543002 | Bacteria | 7284546 |
| 2276 | 2739219292 | 2738543008 | Bacteria | 7282815 |
| 2277 | 2739248803 | 2738543013 | Bacteria | 5618633 |
| 2278 | 2739278095 | 2738543019 | Bacteria | 7459457 |
| 2279 | 2739612878 | 2739367655 | Bacteria | 4051151 |
| 2280 | 2746088695 | 2744054900 | Bacteria | 8399525 |
| 2281 | 2746097364 | 2744054901 | Bacteria | 8397047 |
| 2282 | 2753571427 | 2751185846 | Bacteria | 7242164 |
| 2283 | 2777023209 | 2775507074 | Bacteria | 5532402 |
| 2284 | 2791922655 | 2791354903 | Bacteria | 4937680 |
| 2285 | 2792836075 | 2791355137 | Bacteria | 9654227 |
| 2286 | 2808972722 | 2808606384 | Bacteria | 8474373 |
| 2287 | 2809007704 | 2808606390 | Bacteria | 8476311 |
| 2288 | 2809014756 | 2808606391 | Bacteria | 8308166 |
| 2289 | 2809035689 | 2808606395 | Bacteria | 6020352 |
| 2290 | 2817261462 | 2816332253 | Bacteria | 6764532 |
| 2291 | 2817279148 | 2816332256 | Bacteria | 6891714 |
| 2292 | 2817456252 | 2816332286 | Bacteria | 6853759 |
| 2293 | 2819596917 | 2818991446 | Bacteria | 7757362 |
| 2294 | 2819619972 | 2818991450 | Bacteria | 6962147 |
| 2295 | 2819631298 | 2818991452 | Bacteria | 8442785 |
| 2296 | 2831266000 | 2831265667 | Bacteria | 7184833 |
| 2297 | 2831870061 | 2831864461 | Bacteria | 6502356 |
| 2298 | 2834641800 | 2834641062 | Bacteria | 5559922 |
| 2299 | 2838057871 | 2838054893 | Bacteria | 7451788 |
| 2300 | 2842328626 | 2842324504 | Bacteria | 9364110 |
| 2301 | 2842352942 | 2842348783 | Bacteria | 9002918 |
| 2302 | 2842458713 | 2842454564 | Bacteria | 8730687 |
| 2303 | 2842681050 | 2842677519 | Bacteria | 5615038 |
| 2304 | 2843694552 | 2843690924 | Bacteria | 5169057 |
| 2305 | 2846542812 | 2846540461 | Bacteria | 5471451 |
| 2306 | 2852107325 | 2852103415 | Bacteria | 5193810 |
| 2307 | 2854602836 | 2854601825 | Bacteria | 4797592 |
| 2308 | 2857539036 | 2857537821 | Bacteria | 5248181 |
| 2309 | 2857546976 | 2857542790 | Bacteria | 5326616 |
| 2310 | 2858956146 | 2858950400 | Bacteria | 6783797 |
| 2311 | 2863427387 | 2863421361 | Bacteria | 7300805 |
| 2312 | 2870070855 | 2870068957 | Bacteria | 8925310 |
| 2313 | 2881414910 | 2881412998 | Bacteria | 6492157 |
| 2314 | 2881715984 | 2881714928 | Bacteria | 2469486 |
| 2315 | 2881928151 | 2881927736 | Bacteria | 3993927 |
| 2316 | 2883093065 | 2883087390 | Bacteria | 9532701 |
| 2317 | 2884087641 | 2884086401 | Bacteria | 5005459 |
| 2318 | 2885197427 | 2885192300 | Bacteria | 5882526 |
| 2319 | 2885203659 | 2885198086 | Bacteria | 7212419 |
| 2320 | 2885216991 | 2885211737 | Bacteria | 7212420 |
| 2321 | 2885272977 | 2885270888 | Bacteria | 9831543 |
| 2322 | 2886849521 | 2886848708 | Bacteria | 5632523 |
| 2323 | 2895516583 | 2895511927 | Bacteria | 6802080 |
| 2324 | 2899930341 | 2899924645 | Bacteria | 7487985 |
| 2325 | 2900053258 | 2900051742 | Bacteria | 4985156 |
| 2326 | 2900634255 | 2900634093 | Bacteria | 10263517 |
| 2327 | 2902683727 | 2902682994 | Bacteria | 8951596 |
| 2328 | 2904438014 | 2904434214 | Bacteria | 6230908 |
| 2329 | 2904455129 | 2904449895 | Bacteria | 6927402 |
| 2330 | 2904457545 | 2904456579 | Bacteria | 6819253 |
| 2331 | 2904480507 | 2904479285 | Bacteria | 5073931 |
| 2332 | 2904484565 | 2904483920 | Bacteria | 7545285 |
| 2333 | 2904517859 | 2904513164 | Bacteria | 5476410 |
| 2334 | 2904543703 | 2904541872 | Bacteria | 8915136 |
| 2335 | 2904570006 | 2904564687 | Bacteria | 7609577 |
| 2336 | 2904576083 | 2904571731 | Bacteria | 7608790 |
| 2337 | 2904624210 | 2904615490 | Bacteria | 10047340 |
| 2338 | 2919111170 | 2919108558 | Bacteria | 5897419 |
| 2339 | 2919466901 | 2919462493 | Bacteria | 5817112 |
| 2340 | 2919531471 | 2919527303 | Bacteria | 7718827 |
| 2341 | 2919704690 | 2919704043 | Bacteria | 5560311 |
| 2342 | 2921652672 | 2921643360 | Bacteria | 11448031 |
| 2343 | 2928039454 | 2928037797 | Bacteria | 7273642 |
| 2344 | 2928044941 | 2928044640 | Bacteria | 7271509 |
| 2345 | 2928052742 | 2928051484 | Bacteria | 7773759 |
| 2346 | 2928064584 | 2928064002 | Bacteria | 7419480 |
| 2347 | 2928075000 | 2928070936 | Bacteria | 8062541 |
| 2348 | 2928088181 | 2928084124 | Bacteria | 7159212 |
| 2349 | 2928110535 | 2928108538 | Bacteria | 7360024 |
| 2350 | 2928116402 | 2928115317 | Bacteria | 6477646 |
| 2351 | 2928140051 | 2928135762 | Bacteria | 7259641 |
| 2352 | 2928171570 | 2928170801 | Bacteria | 8785406 |
| 2353 | 2928505543 | 2928503688 | Bacteria | 7268108 |
| 2354 | 2928542570 | 2928536128 | Bacteria | 7657547 |
| 2355 | 2929162745 | 2929160207 | Bacteria | 9075316 |
| 2356 | 2929527410 | 2929520902 | Bacteria | 6765052 |
| 2357 | 2935625487 | 2935625433 | Bacteria | 5042964 |
| 2358 | 2939570200 | 2939568625 | Bacteria | 4542555 |
| 2359 | 2939618774 | 2939617950 | Bacteria | 4820956 |
| 2360 | 2939631728 | 2939631187 | Bacteria | 6118131 |
| 2361 | 2939642757 | 2939642701 | Bacteria | 4475280 |
| 2362 | 2941485628 | |||
| 2363 | 2945876552 | 2945874760 | Bacteria | 5527237 |
| 2364 | 2945911258 | 2945909444 | Bacteria | 7065066 |
| 2365 | 2945937378 | 2945934425 | Bacteria | 7444609 |
| 2366 | 2945947273 | 2945945610 | Bacteria | 5951079 |
| 2367 | 2945977706 | 2945972063 | Bacteria | 6086495 |
| 2368 | 2945986454 | 2945984333 | Bacteria | 7358892 |
| 2369 | 2954772688 | 2954767861 | Bacteria | 5535784 |
| 2370 | 2969080905 | 2969079654 | Bacteria | 5439582 |
| 2371 | 2971822304 | 2971820967 | Bacteria | 5823634 |
| 2372 | 2974439579 | 2974435778 | Bacteria | 4876478 |
| 2373 | 2984563367 | 2984559226 | Bacteria | 5683096 |
| 2374 | 2984596101 | 2984595703 | Bacteria | 5682994 |
| 2375 | 2990705928 | 2990703756 | Bacteria | 7715990 |
| 2376 | 2998345739 | 2998344455 | Bacteria | 4222996 |
| 2377 | 3000378162 | 3000376612 | Bacteria | 4705565 |
| 2378 | 642425583 | 641736151 | Bacteria | 7477263 |
| 2379 | 642418902 | 641736154 | Bacteria | 7689995 |
| 2380 | 642593236 | 642555112 | Bacteria | 8676562 |
| 2381 | 642622133 | 642555113 | Bacteria | 8214658 |
| 2382 | 8018846959 | 8018845410 | Bacteria | 8933938 |
| 2383 | 8019504888 | 8019504834 | Bacteria | 4819156 |
| 2384 | 8020813612 | 8020807995 | Bacteria | 6801506 |
| 2385 | 8020944920 | 8020938398 | Bacteria | 7472757 |
| 2386 | 8020945497 | 8020945358 | Bacteria | 8467355 |
| 2387 | 8020957043 | 8020953355 | Bacteria | 7439080 |
| 2388 | 8021122099 | 8021120328 | Bacteria | 8782274 |
| 2389 | 8039102598 | 8039098773 | Bacteria | 6602928 |
| 2390 | 8040172810 | 8040167225 | Bacteria | 6542727 |
| 2391 | 8040173719 | 8040173305 | Bacteria | 6827067 |
| 2392 | 8055228235 | 8055225921 | Bacteria | 3341787 |
| 2393 | 8055268962 | 8055266321 | Bacteria | 7999742 |
| 2394 | 8055302054 | 8055301274 | Bacteria | 8587385 |
| 2395 | 8055694809 | 8055693939 | Bacteria | 4772047 |
| 2396 | Ga0070662_100019784 | |||
| 2397 | SwRhRL2b_contig_1415115 | |||
| 2398 | JGI24740J21852_10005200 | |||
| 2399 | JGI24739J22299_10033552 | |||
| 2400 | JGI24739J22299_10040520 | |||
| 2401 | JGI24737J22298_10022183 | |||
| 2402 | JGI24735J21928_10043643 | |||
| 2403 | JGI24744J21845_10047460 | |||
| 2404 | JGI25156J39149_1000200 | |||
| 2405 | JGI25156J39149_1001430 | |||
| 2406 | JGI25156J39149_1004572 | |||
| 2407 | JGI25156J39149_1007679 | |||
| 2408 | JGI25156J39149_1020932 | |||
| 2409 | JGI25154J39366_1000288 | |||
| 2410 | JGI25154J39366_1000649 | |||
| 2411 | JGI25157J39369_1000095 | |||
| 2412 | JGI25152J39213_1001922 | |||
| 2413 | JGI25152J39213_1004308 | |||
| 2414 | JGI25150J39212_1027828 | |||
| 2415 | JGI25159J45721_1010035 | |||
| 2416 | JGI25159J45721_1010105 | |||
| 2417 | JGI25151J46595_10000262 | |||
| 2418 | JGI25151J46595_10001813 | |||
| 2419 | JGI25151J46595_10023911 | |||
| 2420 | JGI25151J46595_10030757 | |||
| 2421 | JGI25153J46596_10001361 | |||
| 2422 | JGI25153J46596_10020746 | |||
| 2423 | rootH1_10061749 | |||
| 2424 | rootH2_10002329 | |||
| 2425 | rootH2_10166799 | |||
| 2426 | rootL2_10000441 | |||
| 2427 | rootL2_10237090 | |||
| 2428 | rootH1_10049462 | |||
| 2429 | rootH1_10068787 | |||
| 2430 | JGI26128J50194_1001209 | |||
| 2431 | Ga0006562J51391_1061692 | |||
| 2432 | Ga0055538_1004535 | |||
| 2433 | Ga0055539_1000688 | |||
| 2434 | Ga0055539_1001465 | |||
| 2435 | Ga0055539_1014267 | |||
| 2436 | Ga0055533_1000100 | |||
| 2437 | Ga0055533_1006422 | |||
| 2438 | Ga0055532_1002241 | |||
| 2439 | Ga0055532_1003811 | |||
| 2440 | Ga0055525_1000011 | |||
| 2441 | Ga0055525_1001558 | |||
| 2442 | Ga0055535_1001571 | |||
| 2443 | Ga0055535_1001668 | |||
| 2444 | Ga0055542_1000027 | |||
| 2445 | Ga0055542_1002307 | |||
| 2446 | Ga0055529_1001099 | |||
| 2447 | Ga0055529_1001608 | |||
| 2448 | Ga0055526_1005479 | |||
| 2449 | Ga0055526_1013218 | |||
| 2450 | Ga0055537_1000193 | |||
| 2451 | Ga0055524_1002870 | |||
| 2452 | Ga0055524_1015745 | |||
| 2453 | Ga0055536_1000726 | |||
| 2454 | Ga0055536_1003097 | |||
| 2455 | Ga0055536_1007352 | |||
| 2456 | Ga0055536_1015208 | |||
| 2457 | Ga0055536_1048677 | |||
| 2458 | Ga0055534_1000186 | |||
| 2459 | Ga0055534_1002158 | |||
| 2460 | Ga0055534_1023929 | |||
| 2461 | Ga0055528_1073688 | |||
| 2462 | Ga0055530_10000754 | |||
| 2463 | Ga0055530_10008221 | |||
| 2464 | Ga0055530_10030912 | |||
| 2465 | Ga0055530_10073206 | |||
| 2466 | Ga0055540_1002266 | |||
| 2467 | Ga0055540_1002894 | |||
| 2468 | Ga0055540_1004211 | |||
| 2469 | Ga0055540_1005185 | |||
| 2470 | Ga0055540_1010868 | |||
| 2471 | Ga0055531_10000985 | |||
| 2472 | Ga0055531_10002017 | |||
| 2473 | Ga0055531_10013088 | |||
| 2474 | Ga0055531_10054307 | |||
| 2475 | Ga0055531_10065267 | |||
| 2476 | Ga0055541_1000908 | |||
| 2477 | Ga0065165_1000613 | |||
| 2478 | Ga0065165_1055167 | |||
| 2479 | Ga0065714_10078829 | |||
| 2480 | Ga0065714_10187930 | |||
| 2481 | Ga0065704_10079876 | |||
| 2482 | Ga0065704_10094721 | |||
| 2483 | Ga0065704_10315903 | |||
| 2484 | Ga0065712_10111357 | |||
| 2485 | Ga0065715_10214645 | |||
| 2486 | Ga0065715_10427078 | |||
| 2487 | Ga0065715_10978353 | |||
| 2488 | Ga0065707_10081939 | |||
| 2489 | Ga0070658_10028554 | |||
| 2490 | Ga0070658_10607777 | |||
| 2491 | Ga0070658_11588604 | |||
| 2492 | Ga0070676_10023135 | |||
| 2493 | Ga0070676_10024406 | |||
| 2494 | Ga0070676_10062029 | |||
| 2495 | Ga0070676_10137992 | |||
| 2496 | Ga0070676_10199487 | |||
| 2497 | Ga0070676_11612860 | |||
| 2498 | Ga0070683_100007089 | |||
| 2499 | Ga0070683_100161279 | |||
| 2500 | Ga0070690_100558986 | |||
| 2501 | Ga0070690_101013982 | |||
| 2502 | Ga0070690_101151193 | |||
| 2503 | Ga0070670_100001125 | |||
| 2504 | Ga0070670_100046529 | |||
| 2505 | Ga0070670_100096992 | |||
| 2506 | Ga0070670_100454984 | |||
| 2507 | Ga0070670_100472434 | |||
| 2508 | Ga0070677_10004970 | |||
| 2509 | Ga0070677_10053445 | |||
| 2510 | Ga0070677_10106704 | |||
| 2511 | Ga0070677_10469173 | |||
| 2512 | Ga0068869_100001634 | |||
| 2513 | Ga0068869_100011402 | |||
| 2514 | Ga0068869_100186279 | |||
| 2515 | Ga0068869_100186727 | |||
| 2516 | Ga0070666_10027432 | |||
| 2517 | Ga0070666_10385928 | |||
| 2518 | Ga0070680_100096787 | |||
| 2519 | Ga0070680_100200062 | |||
| 2520 | Ga0070682_100287160 | |||
| 2521 | Ga0070682_100362998 | |||
| 2522 | Ga0068868_100006467 | |||
| 2523 | Ga0068868_100007731 | |||
| 2524 | Ga0068868_100025309 | |||
| 2525 | Ga0068868_100065185 | |||
| 2526 | Ga0068868_100118510 | |||
| 2527 | Ga0068868_101187791 | |||
| 2528 | Ga0068868_101773706 | |||
| 2529 | Ga0070660_100057666 | |||
| 2530 | Ga0070660_100060030 | |||
| 2531 | Ga0070660_100064464 | |||
| 2532 | Ga0070660_100084433 | |||
| 2533 | Ga0070660_100100400 | |||
| 2534 | Ga0070660_100421144 | |||
| 2535 | Ga0070660_100487769 | |||
| 2536 | Ga0070689_100051808 | |||
| 2537 | Ga0070689_101720046 | |||
| 2538 | Ga0070691_10511035 | |||
| 2539 | Ga0070691_10702540 | |||
| 2540 | Ga0070687_100030647 | |||
| 2541 | Ga0070687_100101179 | |||
| 2542 | Ga0070661_100006518 | |||
| 2543 | Ga0070661_100048491 | |||
| 2544 | Ga0070661_100171509 | |||
| 2545 | Ga0070668_100181696 | |||
| 2546 | Ga0070668_100317949 | |||
| 2547 | Ga0070668_100685438 | |||
| 2548 | Ga0070668_100787852 | |||
| 2549 | Ga0070669_100021660 | |||
| 2550 | Ga0070669_100094234 | |||
| 2551 | Ga0070669_100160968 | |||
| 2552 | Ga0070669_100256084 | |||
| 2553 | Ga0070669_100256428 | |||
| 2554 | Ga0070669_100521925 | |||
| 2555 | Ga0070669_100936393 | |||
| 2556 | Ga0070669_101719900 | |||
| 2557 | Ga0070675_100000735 | |||
| 2558 | Ga0070675_100004598 | |||
| 2559 | Ga0070675_100015112 | |||
| 2560 | Ga0070675_100207836 | |||
| 2561 | Ga0070675_100693446 | |||
| 2562 | Ga0070671_100001944 | |||
| 2563 | Ga0070671_100005456 | |||
| 2564 | Ga0070671_100022352 | |||
| 2565 | Ga0070671_100046866 | |||
| 2566 | Ga0070671_100081043 | |||
| 2567 | Ga0070671_100161322 | |||
| 2568 | Ga0070671_100195282 | |||
| 2569 | Ga0070671_100511880 | |||
| 2570 | Ga0070671_100848462 | |||
| 2571 | Ga0070674_100013900 | |||
| 2572 | Ga0070674_100236533 | |||
| 2573 | Ga0070674_100393943 | |||
| 2574 | Ga0070674_100558089 | |||
| 2575 | Ga0070674_100572738 | |||
| 2576 | Ga0070674_101435039 | |||
| 2577 | Ga0070673_100023482 | |||
| 2578 | Ga0070673_100066105 | |||
| 2579 | Ga0070673_100071444 | |||
| 2580 | Ga0070673_100132605 | |||
| 2581 | Ga0070673_100167182 | |||
| 2582 | Ga0070673_101028246 | |||
| 2583 | Ga0070673_101089811 | |||
| 2584 | Ga0070673_101167683 | |||
| 2585 | Ga0070673_101976188 | |||
| 2586 | Ga0070688_101394628 | |||
| 2587 | Ga0070659_100003967 | |||
| 2588 | Ga0070659_100008273 | |||
| 2589 | Ga0070659_100025101 | |||
| 2590 | Ga0070659_100063404 | |||
| 2591 | Ga0070659_100227135 | |||
| 2592 | Ga0070659_100239306 | |||
| 2593 | Ga0070659_100776578 | |||
| 2594 | Ga0070659_100897242 | |||
| 2595 | Ga0070659_101989550 | |||
| 2596 | Ga0070667_100006642 | |||
| 2597 | Ga0070667_100021358 | |||
| 2598 | Ga0070667_100032736 | |||
| 2599 | Ga0070667_100065683 | |||
| 2600 | Ga0070667_100157606 | |||
| 2601 | Ga0070667_100177885 | |||
| 2602 | Ga0070667_100358733 | |||
| 2603 | Ga0070667_100500355 | |||
| 2604 | Ga0070711_101059401 | |||
| 2605 | Ga0070705_101672577 | |||
| 2606 | Ga0070700_100009387 | |||
| 2607 | Ga0070694_101409094 | |||
| 2608 | Ga0070708_100234856 | |||
| 2609 | Ga0070663_100037434 | |||
| 2610 | Ga0070663_100087596 | |||
| 2611 | Ga0070678_100024742 | |||
| 2612 | Ga0070678_100035395 | |||
| 2613 | Ga0070678_100077032 | |||
| 2614 | Ga0070678_100309688 | |||
| 2615 | Ga0070678_100343197 | |||
| 2616 | Ga0070678_100580319 | |||
| 2617 | Ga0070678_101064826 | |||
| 2618 | Ga0070678_101213316 | |||
| 2619 | Ga0070678_101541364 | |||
| 2620 | Ga0070662_100009726 | |||
| 2621 | Ga0070662_100011762 | |||
| 2622 | Ga0070662_100320690 | |||
| 2623 | Ga0070662_100597588 | |||
| 2624 | Ga0070662_100649418 | |||
| 2625 | Ga0070681_10680870 | |||
| 2626 | Ga0070681_11479174 | |||
| 2627 | Ga0068867_100000085 | |||
| 2628 | Ga0068867_100004130 | |||
| 2629 | Ga0068867_100008539 | |||
| 2630 | Ga0068867_100013868 | |||
| 2631 | Ga0068867_100105705 | |||
| 2632 | Ga0068867_100115384 | |||
| 2633 | Ga0068867_100197479 | |||
| 2634 | Ga0068867_100322526 | |||
| 2635 | Ga0068867_100575423 | |||
| 2636 | Ga0068867_100597927 | |||
| 2637 | Ga0070685_10597373 | |||
| 2638 | Ga0070706_100000822 | |||
| 2639 | Ga0070706_100156252 | |||
| 2640 | Ga0070707_100631562 | |||
| 2641 | Ga0070707_100926753 | |||
| 2642 | Ga0070699_101304060 | |||
| 2643 | Ga0070684_100002981 | |||
| 2644 | Ga0070684_100170273 | |||
| 2645 | Ga0070684_100300695 | |||
| 2646 | Ga0068853_100057775 | |||
| 2647 | Ga0068853_100149756 | |||
| 2648 | Ga0068853_100157572 | |||
| 2649 | Ga0068853_100222162 | |||
| 2650 | Ga0068853_100375749 | |||
| 2651 | Ga0070672_100000244 | |||
| 2652 | Ga0070672_100005577 | |||
| 2653 | Ga0070672_100008576 | |||
| 2654 | Ga0070672_100010686 | |||
| 2655 | Ga0070672_100125840 | |||
| 2656 | Ga0070672_100350090 | |||
| 2657 | Ga0070672_100377133 | |||
| 2658 | Ga0070672_100592457 | |||
| 2659 | Ga0070686_100295769 | |||
| 2660 | Ga0070695_100421502 | |||
| 2661 | Ga0070693_100355385 | |||
| 2662 | Ga0070693_100570766 | |||
| 2663 | Ga0070665_100006131 | |||
| 2664 | Ga0070665_100107301 | |||
| 2665 | Ga0070665_100225136 | |||
| 2666 | Ga0070665_100573091 | |||
| 2667 | Ga0070665_102492028 | |||
| 2668 | Ga0068855_100030205 | |||
| 2669 | Ga0068855_100125071 | |||
| 2670 | Ga0068855_100166273 | |||
| 2671 | Ga0068855_100176007 | |||
| 2672 | Ga0068855_100191710 | |||
| 2673 | Ga0068855_100395419 | |||
| 2674 | Ga0068855_101423419 | |||
| 2675 | Ga0068855_101437348 | |||
| 2676 | Ga0070664_100021750 | |||
| 2677 | Ga0070664_100037096 | |||
| 2678 | Ga0070664_100050836 | |||
| 2679 | Ga0070664_100179981 | |||
| 2680 | Ga0070664_100319026 | |||
| 2681 | Ga0070664_100451978 | |||
| 2682 | Ga0070664_100552726 | |||
| 2683 | Ga0068857_100018728 | |||
| 2684 | Ga0068857_100045340 | |||
| 2685 | Ga0068857_100115387 | |||
| 2686 | Ga0068857_100426752 | |||
| 2687 | Ga0068857_100600050 | |||
| 2688 | Ga0068857_100787047 | |||
| 2689 | Ga0068857_100845678 | |||
| 2690 | Ga0068857_101495090 | |||
| 2691 | Ga0068854_100002508 | |||
| 2692 | Ga0068854_100006996 | |||
| 2693 | Ga0068854_100080379 | |||
| 2694 | Ga0068854_100096393 | |||
| 2695 | Ga0068854_100130539 | |||
| 2696 | Ga0068854_100375269 | |||
| 2697 | Ga0068854_100384051 | |||
| 2698 | Ga0068854_100527821 | |||
| 2699 | Ga0068854_100754653 | |||
| 2700 | Ga0068856_100013314 | |||
| 2701 | Ga0068856_100022023 | |||
| 2702 | Ga0068856_100043233 | |||
| 2703 | Ga0068856_100098167 | |||
| 2704 | Ga0068856_100521922 | |||
| 2705 | Ga0068856_100707698 | |||
| 2706 | Ga0070702_100122681 | |||
| 2707 | Ga0068852_100008757 | |||
| 2708 | Ga0068852_100076296 | |||
| 2709 | Ga0068852_100109246 | |||
| 2710 | Ga0068852_100126238 | |||
| 2711 | Ga0068852_100162554 | |||
| 2712 | Ga0068852_100177678 | |||
| 2713 | Ga0068852_100206166 | |||
| 2714 | Ga0068852_100252479 | |||
| 2715 | Ga0068852_100295609 | |||
| 2716 | Ga0068852_101055902 | |||
| 2717 | Ga0068852_102076170 | |||
| 2718 | Ga0068859_100032096 | |||
| 2719 | Ga0068859_100222130 | |||
| 2720 | Ga0068859_100437590 | |||
| 2721 | Ga0068859_100539851 | |||
| 2722 | Ga0068859_100586895 | |||
| 2723 | Ga0068859_101977742 | |||
| 2724 | Ga0068864_100011590 | |||
| 2725 | Ga0068864_100015868 | |||
| 2726 | Ga0068864_100032380 | |||
| 2727 | Ga0068864_100078599 | |||
| 2728 | Ga0068866_10035274 | |||
| 2729 | Ga0068866_10245943 | |||
| 2730 | Ga0068861_100000582 | |||
| 2731 | Ga0068861_100000677 | |||
| 2732 | Ga0068861_100119213 | |||
| 2733 | Ga0068851_10005711 | |||
| 2734 | Ga0068851_10079563 | |||
| 2735 | Ga0068851_10086935 | |||
| 2736 | Ga0068851_10112479 | |||
| 2737 | Ga0068851_10405114 | |||
| 2738 | Ga0068851_10606699 | |||
| 2739 | Ga0068870_10205411 | |||
| 2740 | Ga0068870_10257640 | |||
| 2741 | Ga0068870_10540408 | |||
| 2742 | Ga0068870_10725988 | |||
| 2743 | Ga0068870_11226770 | |||
| 2744 | Ga0068863_100004173 | |||
| 2745 | Ga0068863_100082398 | |||
| 2746 | Ga0068863_100093622 | |||
| 2747 | Ga0068863_100357715 | |||
| 2748 | Ga0068858_100000560 | |||
| 2749 | Ga0068858_100037529 | |||
| 2750 | Ga0068858_100057084 | |||
| 2751 | Ga0068858_100397457 | |||
| 2752 | Ga0068858_100780252 | |||
| 2753 | Ga0068858_101140323 | |||
| 2754 | Ga0068860_100002632 | |||
| 2755 | Ga0068860_100061216 | |||
| 2756 | Ga0068860_100240537 | |||
| 2757 | Ga0068860_100341603 | |||
| 2758 | Ga0068860_101736591 | |||
| 2759 | Ga0068862_100010198 | |||
| 2760 | Ga0068862_100070096 | |||
| 2761 | Ga0068862_100823561 | |||
| 2762 | Ga0068862_101997397 | |||
| 2763 | Ga0081455_10232278 | |||
| 2764 | Ga0075365_10004297 | |||
| 2765 | Ga0075365_10029244 | |||
| 2766 | Ga0075368_10015003 | |||
| 2767 | Ga0075368_10025640 | |||
| 2768 | Ga0075368_10089158 | |||
| 2769 | Ga0075368_10110095 | |||
| 2770 | Ga0075368_10120838 | |||
| 2771 | Ga0075368_10127894 | |||
| 2772 | Ga0075368_10233661 | |||
| 2773 | Ga0075368_10483754 | |||
| 2774 | Ga0075363_100001372 | |||
| 2775 | Ga0075363_100011135 | |||
| 2776 | Ga0075363_100036596 | |||
| 2777 | Ga0075363_100083784 | |||
| 2778 | Ga0075363_100083793 | |||
| 2779 | Ga0075363_100135138 | |||
| 2780 | Ga0075363_100145033 | |||
| 2781 | Ga0075363_100245793 | |||
| 2782 | Ga0075363_100532557 | |||
| 2783 | Ga0075363_100642870 | |||
| 2784 | Ga0075364_10012528 | |||
| 2785 | Ga0075364_10016278 | |||
| 2786 | Ga0075364_10085088 | |||
| 2787 | Ga0075364_10100218 | |||
| 2788 | Ga0075364_10393356 | |||
| 2789 | Ga0075364_10433501 | |||
| 2790 | Ga0075364_10457758 | |||
| 2791 | Ga0075364_10624434 | |||
| 2792 | Ga0075364_10754383 | |||
| 2793 | Ga0075432_10150260 | |||
| 2794 | Ga0075362_10005070 | |||
| 2795 | Ga0075362_10006907 | |||
| 2796 | Ga0075362_10006970 | |||
| 2797 | Ga0075362_10018421 | |||
| 2798 | Ga0075362_10024484 | |||
| 2799 | Ga0075362_10114760 | |||
| 2800 | Ga0075362_10125632 | |||
| 2801 | Ga0075362_10135822 | |||
| 2802 | Ga0075362_10150654 | |||
| 2803 | Ga0075362_10288997 | |||
| 2804 | Ga0075362_10299394 | |||
| 2805 | Ga0075362_10536063 | |||
| 2806 | Ga0075362_10589544 | |||
| 2807 | Ga0075367_10005547 | |||
| 2808 | Ga0075367_10012600 | |||
| 2809 | Ga0075367_10026352 | |||
| 2810 | Ga0075367_10036496 | |||
| 2811 | Ga0075367_10037500 | |||
| 2812 | Ga0075367_10062713 | |||
| 2813 | Ga0075367_10069417 | |||
| 2814 | Ga0075367_10111626 | |||
| 2815 | Ga0075367_10574567 | |||
| 2816 | Ga0075367_10846119 | |||
| 2817 | Ga0075369_10001852 | |||
| 2818 | Ga0075369_10095160 | |||
| 2819 | Ga0075369_10097573 | |||
| 2820 | Ga0075369_10136040 | |||
| 2821 | Ga0075366_10001677 | |||
| 2822 | Ga0075366_10002935 | |||
| 2823 | Ga0075366_10003541 | |||
| 2824 | Ga0075366_10004492 | |||
| 2825 | Ga0075366_10005743 | |||
| 2826 | Ga0075366_10009910 | |||
| 2827 | Ga0075366_10010575 | |||
| 2828 | Ga0075366_10011468 | |||
| 2829 | Ga0075366_10013487 | |||
| 2830 | Ga0075366_10033053 | |||
| 2831 | Ga0075366_10034984 | |||
| 2832 | Ga0075366_10043108 | |||
| 2833 | Ga0075366_10048738 | |||
| 2834 | Ga0075366_10051847 | |||
| 2835 | Ga0075366_10052964 | |||
| 2836 | Ga0075366_10091551 | |||
| 2837 | Ga0075366_10096603 | |||
| 2838 | Ga0075366_10101808 | |||
| 2839 | Ga0075366_10106830 | |||
| 2840 | Ga0075366_10148761 | |||
| 2841 | Ga0075366_10155628 | |||
| 2842 | Ga0075366_10196689 | |||
| 2843 | Ga0075366_10201532 | |||
| 2844 | Ga0075366_10219966 | |||
| 2845 | Ga0075366_10257032 | |||
| 2846 | Ga0075366_10278101 | |||
| 2847 | Ga0075366_10284664 | |||
| 2848 | Ga0075366_10307972 | |||
| 2849 | Ga0075366_10319902 | |||
| 2850 | Ga0075366_10389133 | |||
| 2851 | Ga0075366_10441189 | |||
| 2852 | Ga0075366_10879797 | |||
| 2853 | Ga0075366_11018047 | |||
| 2854 | Ga0097621_100011918 | |||
| 2855 | Ga0097621_100040679 | |||
| 2856 | Ga0097621_100064071 | |||
| 2857 | Ga0097621_100107140 | |||
| 2858 | Ga0097621_100134827 | |||
| 2859 | Ga0097621_100137354 | |||
| 2860 | Ga0097621_100498620 | |||
| 2861 | Ga0097621_101343929 | |||
| 2862 | Ga0075370_10000124 | |||
| 2863 | Ga0075370_10000159 | |||
| 2864 | Ga0075370_10001473 | |||
| 2865 | Ga0075370_10003561 | |||
| 2866 | Ga0075370_10004375 | |||
| 2867 | Ga0075370_10008986 | |||
| 2868 | Ga0075370_10011875 | |||
| 2869 | Ga0075370_10012982 | |||
| 2870 | Ga0075370_10018684 | |||
| 2871 | Ga0075370_10024332 | |||
| 2872 | Ga0075370_10031609 | |||
| 2873 | Ga0075370_10041223 | |||
| 2874 | Ga0075370_10044762 | |||
| 2875 | Ga0075370_10049244 | |||
| 2876 | Ga0075370_10081886 | |||
| 2877 | Ga0075370_10083339 | |||
| 2878 | Ga0075370_10103526 | |||
| 2879 | Ga0075370_10150489 | |||
| 2880 | Ga0075370_10170120 | |||
| 2881 | Ga0075370_10539614 | |||
| 2882 | Ga0075370_10877565 | |||
| 2883 | Ga0068871_100044806 | |||
| 2884 | Ga0068871_100108518 | |||
| 2885 | Ga0068871_100526870 | |||
| 2886 | Ga0075429_101499775 | |||
| 2887 | Ga0068865_100040309 | |||
| 2888 | Ga0068865_100058476 | |||
| 2889 | Ga0068865_100168495 | |||
| 2890 | Ga0068865_100459002 | |||
| 2891 | Ga0068865_100749447 | |||
| 2892 | Ga0097620_100032096 | |||
| 2893 | Ga0097620_100222131 | |||
| 2894 | Ga0097620_100437573 | |||
| 2895 | Ga0097620_100539782 | |||
| 2896 | Ga0097620_100586914 | |||
| 2897 | Ga0097620_101977887 | |||
| 2898 | Ga0099823_1058477 | |||
| 2899 | Ga0099826_10029080 | |||
| 2900 | Ga0099826_10131993 | |||
| 2901 | Ga0075435_100640821 | |||
| 2902 | Ga0105251_10002173 | |||
| 2903 | Ga0105251_10017441 | |||
| 2904 | Ga0105251_10058772 | |||
| 2905 | Ga0105244_10000329 | |||
| 2906 | Ga0105244_10001834 | |||
| 2907 | Ga0105244_10024925 | |||
| 2908 | Ga0105244_10037053 | |||
| 2909 | Ga0105244_10368012 | |||
| 2910 | Ga0105250_10000105 | |||
| 2911 | Ga0105250_10129259 | |||
| 2912 | Ga0105240_10017700 | |||
| 2913 | Ga0105240_10020431 | |||
| 2914 | Ga0105240_10022278 | |||
| 2915 | Ga0105240_10336480 | |||
| 2916 | Ga0105240_11672081 | |||
| 2917 | Ga0111539_11096507 | |||
| 2918 | Ga0111539_11532128 | |||
| 2919 | Ga0111539_12951320 | |||
| 2920 | Ga0105245_10150078 | |||
| 2921 | Ga0105245_10172687 | |||
| 2922 | Ga0105245_10245508 | |||
| 2923 | Ga0105245_10485053 | |||
| 2924 | Ga0105245_10669374 | |||
| 2925 | Ga0105245_11204771 | |||
| 2926 | Ga0105245_11594832 | |||
| 2927 | Ga0105247_10441827 | |||
| 2928 | Ga0105247_11257926 | |||
| 2929 | Ga0114129_10051750 | |||
| 2930 | Ga0105243_10000486 | |||
| 2931 | Ga0105243_10003231 | |||
| 2932 | Ga0105243_10003279 | |||
| 2933 | Ga0105243_10021379 | |||
| 2934 | Ga0105243_10105356 | |||
| 2935 | Ga0105243_10120855 | |||
| 2936 | Ga0105243_10335147 | |||
| 2937 | Ga0105243_10415518 | |||
| 2938 | Ga0105243_11059092 | |||
| 2939 | Ga0105243_11142834 | |||
| 2940 | Ga0105243_12170737 | |||
| 2941 | Ga0105241_10003239 | |||
| 2942 | Ga0105241_10401883 | |||
| 2943 | Ga0105241_10724360 | |||
| 2944 | Ga0105241_10935623 | |||
| 2945 | Ga0105241_11873201 | |||
| 2946 | Ga0105241_12604394 | |||
| 2947 | Ga0105242_10961652 | |||
| 2948 | Ga0105242_11425078 | |||
| 2949 | Ga0105248_10000445 | |||
| 2950 | Ga0105248_10017866 | |||
| 2951 | Ga0105248_10025421 | |||
| 2952 | Ga0105248_10046075 | |||
| 2953 | Ga0105248_10409042 | |||
| 2954 | Ga0105248_10728412 | |||
| 2955 | Ga0105248_11419170 | |||
| 2956 | Ga0105248_11874896 | |||
| 2957 | Ga0105248_12224160 | |||
| 2958 | Ga0105237_10000548 | |||
| 2959 | Ga0105237_10015839 | |||
| 2960 | Ga0105237_10182787 | |||
| 2961 | Ga0105237_10231058 | |||
| 2962 | Ga0105237_10341422 | |||
| 2963 | Ga0105237_10445838 | |||
| 2964 | Ga0105237_10738902 | |||
| 2965 | Ga0105237_10923354 | |||
| 2966 | Ga0105238_10020973 | |||
| 2967 | Ga0105238_10136657 | |||
| 2968 | Ga0105238_10161939 | |||
| 2969 | Ga0105238_10650503 | |||
| 2970 | Ga0105249_10038755 | |||
| 2971 | Ga0105249_10052334 | |||
| 2972 | Ga0105249_10177219 | |||
| 2973 | Ga0105249_10318349 | |||
| 2974 | Ga0105249_10336225 | |||
| 2975 | Ga0105249_13095095 | |||
| 2976 | Ga0105239_10001569 | |||
| 2977 | Ga0105239_10052411 | |||
| 2978 | Ga0105239_10174209 | |||
| 2979 | Ga0105239_10274852 | |||
| 2980 | Ga0105239_10280880 | |||
| 2981 | Ga0105239_10777111 | |||
| 2982 | Ga0105239_13137326 | |||
| 2983 | Ga0105246_10007754 | |||
| 2984 | Ga0105246_10200957 | |||
| 2985 | Ga0105246_10375419 | |||
| 2986 | Ga0105246_11159263 | |||
| 2987 | Ga0105246_11783863 | |||
| 2988 | Ga0157322_1021901 | |||
| 2989 | Ga0157319_1000006 | |||
| 2990 | Ga0157347_1003675 | |||
| 2991 | Ga0157339_1024310 | |||
| 2992 | Ga0157342_1018967 | |||
| 2993 | Ga0157327_1046646 | |||
| 2994 | Ga0157373_10004477 | |||
| 2995 | Ga0157373_10005848 | |||
| 2996 | Ga0157373_10037609 | |||
| 2997 | Ga0157373_10103380 | |||
| 2998 | Ga0157373_10115188 | |||
| 2999 | Ga0157373_10151556 | |||
| 3000 | Ga0157371_10099143 | |||
| 3001 | Ga0157371_10255462 | |||
| 3002 | Ga0157371_10616305 | |||
| 3003 | Ga0157371_10722570 | |||
| 3004 | Ga0157371_11100124 | |||
| 3005 | Ga0157370_10001046 | |||
| 3006 | Ga0157370_10014128 | |||
| 3007 | Ga0157370_10217371 | |||
| 3008 | Ga0157370_10312903 | |||
| 3009 | Ga0157370_10353690 | |||
| 3010 | Ga0157370_10923045 | |||
| 3011 | Ga0157369_10000981 | |||
| 3012 | Ga0157369_10014051 | |||
| 3013 | Ga0157369_10017535 | |||
| 3014 | Ga0157369_10019561 | |||
| 3015 | Ga0157369_10374804 | |||
| 3016 | Ga0157369_10397815 | |||
| 3017 | Ga0157369_11428250 | |||
| 3018 | Ga0157374_10000032 | |||
| 3019 | Ga0157374_10005865 | |||
| 3020 | Ga0157374_10014186 | |||
| 3021 | Ga0157374_10145876 | |||
| 3022 | Ga0157374_10277004 | |||
| 3023 | Ga0157374_10380304 | |||
| 3024 | Ga0157374_10419587 | |||
| 3025 | Ga0157378_10000558 | |||
| 3026 | Ga0157378_10481027 | |||
| 3027 | Ga0157378_10511813 | |||
| 3028 | Ga0157378_10831066 | |||
| 3029 | Ga0157378_10835110 | |||
| 3030 | Ga0157378_11412386 | |||
| 3031 | Ga0157378_11729265 | |||
| 3032 | Ga0157378_11757097 | |||
| 3033 | Ga0157378_12632226 | |||
| 3034 | Ga0157378_12638068 | |||
| 3035 | Ga0163162_10005747 | |||
| 3036 | Ga0163162_10045656 | |||
| 3037 | Ga0163162_10109110 | |||
| 3038 | Ga0163162_10223961 | |||
| 3039 | Ga0163162_10232252 | |||
| 3040 | Ga0163162_10609804 | |||
| 3041 | Ga0163162_11187961 | |||
| 3042 | Ga0157372_10019251 | |||
| 3043 | Ga0157372_10188302 | |||
| 3044 | Ga0157372_10276126 | |||
| 3045 | Ga0157372_10372342 | |||
| 3046 | Ga0157372_10388386 | |||
| 3047 | Ga0157372_10712918 | |||
| 3048 | Ga0157372_11133255 | |||
| 3049 | Ga0157372_11258917 | |||
| 3050 | Ga0157375_10013127 | |||
| 3051 | Ga0157375_10031297 | |||
| 3052 | Ga0157375_10059867 | |||
| 3053 | Ga0157375_10068447 | |||
| 3054 | Ga0157375_10106464 | |||
| 3055 | Ga0157375_10119991 | |||
| 3056 | Ga0157375_10187002 | |||
| 3057 | Ga0157375_10325666 | |||
| 3058 | Ga0157375_10548459 | |||
| 3059 | Ga0157375_10723557 | |||
| 3060 | Ga0157375_11604339 | |||
| 3061 | Ga0163163_10129383 | |||
| 3062 | Ga0163163_10272395 | |||
| 3063 | Ga0163163_10817455 | |||
| 3064 | Ga0163163_11322412 | |||
| 3065 | Ga0157380_10053803 | |||
| 3066 | Ga0157380_10228832 | |||
| 3067 | Ga0157380_10320589 | |||
| 3068 | Ga0157380_10571025 | |||
| 3069 | Ga0157380_11716265 | |||
| 3070 | Ga0157380_12956872 | |||
| 3071 | Ga0182008_10001960 | |||
| 3072 | Ga0182008_10009359 | |||
| 3073 | Ga0182008_10116948 | |||
| 3074 | Ga0182008_10431370 | |||
| 3075 | Ga0182008_10983333 | |||
| 3076 | Ga0157377_10000028 | |||
| 3077 | Ga0157377_10077811 | |||
| 3078 | Ga0157379_10035995 | |||
| 3079 | Ga0157379_10043963 | |||
| 3080 | Ga0157379_10051052 | |||
| 3081 | Ga0157379_10107677 | |||
| 3082 | Ga0157379_10142242 | |||
| 3083 | Ga0157379_10181011 | |||
| 3084 | Ga0157379_10242497 | |||
| 3085 | Ga0157379_10290484 | |||
| 3086 | Ga0157379_11078161 | |||
| 3087 | Ga0157376_10009600 | |||
| 3088 | Ga0157376_10048381 | |||
| 3089 | Ga0157376_10092691 | |||
| 3090 | Ga0157376_10187310 | |||
| 3091 | Ga0157376_10576089 | |||
| 3092 | Ga0157376_10671608 | |||
| 3093 | Ga0157376_11200374 | |||
| 3094 | Ga0157376_11914755 | |||
| 3095 | Ga0182006_1001354 | |||
| 3096 | Ga0182006_1010741 | |||
| 3097 | Ga0182006_1011055 | |||
| 3098 | Ga0182006_1030375 | |||
| 3099 | Ga0182006_1071057 | |||
| 3100 | Ga0182007_10001767 | |||
| 3101 | Ga0182007_10021863 | |||
| 3102 | Ga0182007_10111558 | |||
| 3103 | Ga0182007_10270552 | |||
| 3104 | Ga0182005_1029694 | |||
| 3105 | Ga0182005_1091376 | |||
| 3106 | Ga0182005_1297163 | |||
| 3107 | Ga0163161_10001250 | |||
| 3108 | Ga0163161_10023133 | |||
| 3109 | Ga0163161_10048400 | |||
| 3110 | Ga0163161_10196275 | |||
| 3111 | Ga0163161_10216770 | |||
| 3112 | Ga0163161_10669334 | |||
| 3113 | Ga0163161_10675892 | |||
| 3114 | Ga0206355_1269035 | |||
| 3115 | Ga0206352_10797362 | |||
| 3116 | Ga0213872_10000011 | |||
| 3117 | Ga0213872_10000043 | |||
| 3118 | Ga0213872_10000272 | |||
| 3119 | Ga0213872_10040543 | |||
| 3120 | Ga0213872_10060109 | |||
| 3121 | Ga0213872_10074479 | |||
| 3122 | Ga0213872_10075054 | |||
| 3123 | Ga0213872_10227793 | |||
| 3124 | Ga0213876_10287255 | |||
| 3125 | Ga0209435_125931 | |||
| 3126 | Ga0209436_101446 | |||
| 3127 | Ga0209784_100938 | |||
| 3128 | Ga0209566_100561 | |||
| 3129 | Ga0209674_100003 | |||
| 3130 | Ga0209674_100122 | |||
| 3131 | Ga0209672_100191 | |||
| 3132 | Ga0209672_100222 | |||
| 3133 | Ga0209147_100435 | |||
| 3134 | Ga0209563_100005 | |||
| 3135 | Ga0209563_100017 | |||
| 3136 | Ga0209563_103222 | |||
| 3137 | Ga0209258_100048 | |||
| 3138 | Ga0209258_100559 | |||
| 3139 | Ga0209258_102813 | |||
| 3140 | Ga0207425_1000786 | |||
| 3141 | Ga0207425_1003597 | |||
| 3142 | Ga0209646_1000022 | |||
| 3143 | Ga0209646_1000271 | |||
| 3144 | Ga0209026_1000085 | |||
| 3145 | Ga0209026_1004183 | |||
| 3146 | Ga0209677_101546 | |||
| 3147 | Ga0209677_101615 | |||
| 3148 | Ga0209677_103383 | |||
| 3149 | Ga0209148_1000021 | |||
| 3150 | Ga0209148_1000040 | |||
| 3151 | Ga0209148_1012316 | |||
| 3152 | Ga0209759_1000068 | |||
| 3153 | Ga0209759_1001746 | |||
| 3154 | Ga0209759_1001796 | |||
| 3155 | Ga0209759_1002047 | |||
| 3156 | Ga0209759_1021973 | |||
| 3157 | Ga0209759_1031313 | |||
| 3158 | Ga0209129_1000007 | |||
| 3159 | Ga0209129_1000369 | |||
| 3160 | Ga0209129_1001205 | |||
| 3161 | Ga0209129_1024238 | |||
| 3162 | Ga0209565_1000153 | |||
| 3163 | Ga0209565_1001390 | |||
| 3164 | Ga0209565_1003425 | |||
| 3165 | Ga0209565_1078898 | |||
| 3166 | Ga0209455_1000643 | |||
| 3167 | Ga0209455_1001880 | |||
| 3168 | Ga0209673_1000423 | |||
| 3169 | Ga0209673_1000566 | |||
| 3170 | Ga0209673_1000801 | |||
| 3171 | Ga0209673_1006937 | |||
| 3172 | Ga0209673_1013020 | |||
| 3173 | Ga0209673_1013271 | |||
| 3174 | Ga0209673_1013645 | |||
| 3175 | Ga0209673_1046556 | |||
| 3176 | Ga0209130_1000953 | |||
| 3177 | Ga0209130_1001018 | |||
| 3178 | Ga0209130_1001734 | |||
| 3179 | Ga0209675_1000150 | |||
| 3180 | Ga0209675_1001481 | |||
| 3181 | Ga0209675_1001635 | |||
| 3182 | Ga0209675_1002237 | |||
| 3183 | Ga0209675_1002884 | |||
| 3184 | Ga0209676_1000004 | |||
| 3185 | Ga0209676_1000735 | |||
| 3186 | Ga0209676_1001743 | |||
| 3187 | Ga0209676_1002326 | |||
| 3188 | Ga0209676_1004231 | |||
| 3189 | Ga0209676_1007213 | |||
| 3190 | Ga0209676_1030459 | |||
| 3191 | Ga0209025_1000057 | |||
| 3192 | Ga0209025_1000217 | |||
| 3193 | Ga0209025_1000278 | |||
| 3194 | Ga0209025_1001179 | |||
| 3195 | Ga0209025_1010012 | |||
| 3196 | Ga0209025_1018495 | |||
| 3197 | Ga0209025_1124121 | |||
| 3198 | Ga0209564_1000003 | |||
| 3199 | Ga0209564_1000046 | |||
| 3200 | Ga0209564_1000915 | |||
| 3201 | Ga0209564_1001044 | |||
| 3202 | Ga0209564_1015210 | |||
| 3203 | Ga0209564_1077190 | |||
| 3204 | Ga0209758_1000025 | |||
| 3205 | Ga0209758_1000709 | |||
| 3206 | Ga0209758_1002316 | |||
| 3207 | Ga0209758_1020934 | |||
| 3208 | Ga0209050_1000002 | |||
| 3209 | Ga0209050_1000861 | |||
| 3210 | Ga0209050_1001823 | |||
| 3211 | Ga0209050_1002866 | |||
| 3212 | Ga0209050_1002874 | |||
| 3213 | Ga0209050_1003318 | |||
| 3214 | Ga0209050_1035133 | |||
| 3215 | Ga0209050_1037278 | |||
| 3216 | Ga0209050_1097324 | |||
| 3217 | Ga0209256_1000067 | |||
| 3218 | Ga0209256_1000366 | |||
| 3219 | Ga0209256_1005597 | |||
| 3220 | Ga0209256_1008454 | |||
| 3221 | Ga0209256_1041041 | |||
| 3222 | Ga0209256_1042846 | |||
| 3223 | Ga0209256_1094527 | |||
| 3224 | Ga0207426_1000001 | |||
| 3225 | Ga0207426_1000028 | |||
| 3226 | Ga0207426_1020977 | |||
| 3227 | Ga0209051_1000002 | |||
| 3228 | Ga0209051_1000049 | |||
| 3229 | Ga0209051_1000096 | |||
| 3230 | Ga0209051_1000532 | |||
| 3231 | Ga0209051_1000913 | |||
| 3232 | Ga0209051_1004959 | |||
| 3233 | Ga0209051_1007617 | |||
| 3234 | Ga0209051_1010944 | |||
| 3235 | Ga0209051_1013466 | |||
| 3236 | Ga0209051_1035263 | |||
| 3237 | Ga0209051_1107638 | |||
| 3238 | Ga0209257_1000002 | |||
| 3239 | Ga0209257_1000072 | |||
| 3240 | Ga0209257_1005501 | |||
| 3241 | Ga0209257_1005948 | |||
| 3242 | Ga0209257_1012640 | |||
| 3243 | Ga0209257_1013234 | |||
| 3244 | Ga0209257_1021343 | |||
| 3245 | Ga0207697_10054088 | |||
| 3246 | Ga0207697_10101513 | |||
| 3247 | Ga0207697_10455412 | |||
| 3248 | Ga0207656_10012183 | |||
| 3249 | Ga0207656_10029824 | |||
| 3250 | Ga0207656_10071677 | |||
| 3251 | Ga0207656_10111356 | |||
| 3252 | Ga0207656_10111360 | |||
| 3253 | Ga0207696_1000131 | |||
| 3254 | Ga0207655_1000004 | |||
| 3255 | Ga0207655_1003340 | |||
| 3256 | Ga0207655_1029730 | |||
| 3257 | Ga0207655_1118431 | |||
| 3258 | Ga0207655_1236898 | |||
| 3259 | Ga0207713_1000052 | |||
| 3260 | Ga0207713_1000084 | |||
| 3261 | Ga0207713_1043333 | |||
| 3262 | Ga0207682_10006629 | |||
| 3263 | Ga0207682_10022477 | |||
| 3264 | Ga0207682_10067253 | |||
| 3265 | Ga0207682_10071200 | |||
| 3266 | Ga0207682_10532095 | |||
| 3267 | Ga0207642_10037663 | |||
| 3268 | Ga0207642_10743245 | |||
| 3269 | Ga0207688_10036837 | |||
| 3270 | Ga0207688_10167683 | |||
| 3271 | Ga0207688_10248005 | |||
| 3272 | Ga0207680_10216266 | |||
| 3273 | Ga0207647_10046340 | |||
| 3274 | Ga0207647_10052312 | |||
| 3275 | Ga0207685_10596594 | |||
| 3276 | Ga0207645_10003439 | |||
| 3277 | Ga0207645_10015692 | |||
| 3278 | Ga0207645_10030847 | |||
| 3279 | Ga0207645_10066499 | |||
| 3280 | Ga0207645_10205138 | |||
| 3281 | Ga0207645_11133322 | |||
| 3282 | Ga0207643_10244189 | |||
| 3283 | Ga0207705_10026548 | |||
| 3284 | Ga0207705_10102916 | |||
| 3285 | Ga0207705_10165193 | |||
| 3286 | Ga0207705_10236422 | |||
| 3287 | Ga0207705_10347626 | |||
| 3288 | Ga0207705_10378081 | |||
| 3289 | Ga0207705_11014738 | |||
| 3290 | Ga0207705_11017966 | |||
| 3291 | Ga0207684_10002530 | |||
| 3292 | Ga0207684_10136233 | |||
| 3293 | Ga0207684_10401714 | |||
| 3294 | Ga0207654_10197100 | |||
| 3295 | Ga0207654_10639853 | |||
| 3296 | Ga0207707_10024701 | |||
| 3297 | Ga0207707_11140491 | |||
| 3298 | Ga0207707_11289473 | |||
| 3299 | Ga0207695_10030367 | |||
| 3300 | Ga0207695_10177375 | |||
| 3301 | Ga0207695_10204007 | |||
| 3302 | Ga0207695_10267148 | |||
| 3303 | Ga0207695_10430581 | |||
| 3304 | Ga0207671_10010913 | |||
| 3305 | Ga0207671_10134750 | |||
| 3306 | Ga0207671_10143413 | |||
| 3307 | Ga0207671_10356571 | |||
| 3308 | Ga0207671_10883563 | |||
| 3309 | Ga0207663_10737599 | |||
| 3310 | Ga0207660_10491418 | |||
| 3311 | Ga0207662_10594733 | |||
| 3312 | Ga0207657_10000539 | |||
| 3313 | Ga0207657_10016351 | |||
| 3314 | Ga0207657_10063967 | |||
| 3315 | Ga0207657_10095194 | |||
| 3316 | Ga0207657_10154007 | |||
| 3317 | Ga0207657_10160330 | |||
| 3318 | Ga0207657_10342010 | |||
| 3319 | Ga0207657_10951572 | |||
| 3320 | Ga0207649_10027765 | |||
| 3321 | Ga0207649_10065254 | |||
| 3322 | Ga0207649_10859077 | |||
| 3323 | Ga0207652_10164160 | |||
| 3324 | Ga0207652_10273281 | |||
| 3325 | Ga0207652_11186502 | |||
| 3326 | Ga0207646_10149795 | |||
| 3327 | Ga0207681_10010347 | |||
| 3328 | Ga0207681_10015245 | |||
| 3329 | Ga0207681_10065307 | |||
| 3330 | Ga0207681_10136055 | |||
| 3331 | Ga0207681_11262814 | |||
| 3332 | Ga0207694_10065085 | |||
| 3333 | Ga0207694_10110900 | |||
| 3334 | Ga0207694_10147805 | |||
| 3335 | Ga0207694_10323332 | |||
| 3336 | Ga0207694_10663995 | |||
| 3337 | Ga0207694_11171087 | |||
| 3338 | Ga0207650_10001071 | |||
| 3339 | Ga0207650_10033566 | |||
| 3340 | Ga0207650_10208534 | |||
| 3341 | Ga0207650_10233262 | |||
| 3342 | Ga0207650_10457365 | |||
| 3343 | Ga0207650_10596088 | |||
| 3344 | Ga0207650_10628582 | |||
| 3345 | Ga0207650_10865198 | |||
| 3346 | Ga0207659_10002589 | |||
| 3347 | Ga0207659_10010915 | |||
| 3348 | Ga0207659_10013311 | |||
| 3349 | Ga0207659_10127689 | |||
| 3350 | Ga0207659_10371230 | |||
| 3351 | Ga0207659_10538064 | |||
| 3352 | Ga0207659_10721579 | |||
| 3353 | Ga0207687_10055314 | |||
| 3354 | Ga0207687_10066030 | |||
| 3355 | Ga0207687_10225398 | |||
| 3356 | Ga0207687_10291600 | |||
| 3357 | Ga0207687_11043346 | |||
| 3358 | Ga0207664_10020035 | |||
| 3359 | Ga0207644_10002293 | |||
| 3360 | Ga0207644_10005830 | |||
| 3361 | Ga0207644_10008258 | |||
| 3362 | Ga0207644_10033013 | |||
| 3363 | Ga0207644_10066865 | |||
| 3364 | Ga0207644_10181125 | |||
| 3365 | Ga0207644_10451985 | |||
| 3366 | Ga0207644_10582408 | |||
| 3367 | Ga0207644_10919969 | |||
| 3368 | Ga0207644_10967293 | |||
| 3369 | Ga0207690_10009822 | |||
| 3370 | Ga0207690_10047094 | |||
| 3371 | Ga0207690_10051966 | |||
| 3372 | Ga0207690_10075669 | |||
| 3373 | Ga0207690_10161082 | |||
| 3374 | Ga0207690_10195198 | |||
| 3375 | Ga0207690_10387241 | |||
| 3376 | Ga0207690_10397108 | |||
| 3377 | Ga0207706_10001856 | |||
| 3378 | Ga0207706_10005010 | |||
| 3379 | Ga0207706_10023334 | |||
| 3380 | Ga0207706_10050415 | |||
| 3381 | Ga0207706_10127657 | |||
| 3382 | Ga0207706_10278780 | |||
| 3383 | Ga0207706_10396119 | |||
| 3384 | Ga0207706_10666473 | |||
| 3385 | Ga0207706_11275413 | |||
| 3386 | Ga0207686_10562429 | |||
| 3387 | Ga0207686_10687661 | |||
| 3388 | Ga0207709_10000348 | |||
| 3389 | Ga0207709_10000556 | |||
| 3390 | Ga0207709_10005637 | |||
| 3391 | Ga0207709_10006258 | |||
| 3392 | Ga0207709_10007492 | |||
| 3393 | Ga0207709_10193284 | |||
| 3394 | Ga0207709_10803082 | |||
| 3395 | Ga0207670_10036922 | |||
| 3396 | Ga0207669_10002735 | |||
| 3397 | Ga0207669_10163716 | |||
| 3398 | Ga0207669_10198881 | |||
| 3399 | Ga0207669_10549955 | |||
| 3400 | Ga0207704_10061644 | |||
| 3401 | Ga0207704_10351102 | |||
| 3402 | Ga0207704_10439315 | |||
| 3403 | Ga0207691_10004533 | |||
| 3404 | Ga0207691_10005312 | |||
| 3405 | Ga0207691_10007653 | |||
| 3406 | Ga0207691_10057377 | |||
| 3407 | Ga0207691_10174786 | |||
| 3408 | Ga0207691_10327127 | |||
| 3409 | Ga0207691_10618110 | |||
| 3410 | Ga0207691_10733465 | |||
| 3411 | Ga0207691_11369505 | |||
| 3412 | Ga0207711_10007461 | |||
| 3413 | Ga0207711_10013057 | |||
| 3414 | Ga0207711_10015303 | |||
| 3415 | Ga0207711_10078718 | |||
| 3416 | Ga0207711_10245986 | |||
| 3417 | Ga0207711_10375692 | |||
| 3418 | Ga0207711_11205800 | |||
| 3419 | Ga0207711_11233896 | |||
| 3420 | Ga0207711_11868024 | |||
| 3421 | Ga0207689_10004291 | |||
| 3422 | Ga0207689_10018167 | |||
| 3423 | Ga0207689_10022168 | |||
| 3424 | Ga0207689_10051486 | |||
| 3425 | Ga0207689_10282689 | |||
| 3426 | Ga0207689_10371595 | |||
| 3427 | Ga0207689_10460278 | |||
| 3428 | Ga0207689_11056852 | |||
| 3429 | Ga0207661_10069956 | |||
| 3430 | Ga0207661_10152654 | |||
| 3431 | Ga0207679_10037286 | |||
| 3432 | Ga0207679_10046527 | |||
| 3433 | Ga0207679_10151674 | |||
| 3434 | Ga0207679_10185328 | |||
| 3435 | Ga0207679_10322897 | |||
| 3436 | Ga0207679_10483534 | |||
| 3437 | Ga0207679_10684044 | |||
| 3438 | Ga0207667_10016870 | |||
| 3439 | Ga0207667_10053981 | |||
| 3440 | Ga0207667_10080136 | |||
| 3441 | Ga0207667_10108428 | |||
| 3442 | Ga0207667_10116858 | |||
| 3443 | Ga0207667_10271910 | |||
| 3444 | Ga0207667_10836318 | |||
| 3445 | Ga0207667_11999714 | |||
| 3446 | Ga0207651_10003468 | |||
| 3447 | Ga0207651_10032840 | |||
| 3448 | Ga0207651_10041449 | |||
| 3449 | Ga0207651_10074451 | |||
| 3450 | Ga0207651_10078352 | |||
| 3451 | Ga0207651_10278866 | |||
| 3452 | Ga0207651_10336242 | |||
| 3453 | Ga0207651_10380602 | |||
| 3454 | Ga0207651_10989381 | |||
| 3455 | Ga0207651_11035467 | |||
| 3456 | Ga0207651_11180812 | |||
| 3457 | Ga0207712_10016113 | |||
| 3458 | Ga0207712_10162453 | |||
| 3459 | Ga0207712_10485853 | |||
| 3460 | Ga0207712_11132805 | |||
| 3461 | Ga0207668_10160980 | |||
| 3462 | Ga0207668_10185382 | |||
| 3463 | Ga0207668_10284338 | |||
| 3464 | Ga0207668_10564733 | |||
| 3465 | Ga0207668_11103147 | |||
| 3466 | Ga0207668_11177387 | |||
| 3467 | Ga0207668_11208167 | |||
| 3468 | Ga0207640_10001781 | |||
| 3469 | Ga0207640_10114521 | |||
| 3470 | Ga0207640_10276907 | |||
| 3471 | Ga0207640_10502366 | |||
| 3472 | Ga0207640_11005044 | |||
| 3473 | Ga0207640_11475505 | |||
| 3474 | Ga0207658_10005312 | |||
| 3475 | Ga0207658_10035630 | |||
| 3476 | Ga0207658_10069435 | |||
| 3477 | Ga0207658_10117580 | |||
| 3478 | Ga0207658_10134850 | |||
| 3479 | Ga0207658_10268119 | |||
| 3480 | Ga0207658_10278531 | |||
| 3481 | Ga0207658_11076938 | |||
| 3482 | Ga0207677_10000972 | |||
| 3483 | Ga0207677_10001461 | |||
| 3484 | Ga0207677_10006577 | |||
| 3485 | Ga0207677_10568710 | |||
| 3486 | Ga0207677_10695636 | |||
| 3487 | Ga0207677_11868105 | |||
| 3488 | Ga0207703_10012389 | |||
| 3489 | Ga0207703_10082733 | |||
| 3490 | Ga0207703_10621142 | |||
| 3491 | Ga0207703_10831053 | |||
| 3492 | Ga0207703_11080904 | |||
| 3493 | Ga0207639_10004119 | |||
| 3494 | Ga0207639_10032894 | |||
| 3495 | Ga0207639_10067958 | |||
| 3496 | Ga0207639_10215624 | |||
| 3497 | Ga0207639_10898220 | |||
| 3498 | Ga0207639_10988179 | |||
| 3499 | Ga0207678_10018317 | |||
| 3500 | Ga0207678_10073350 | |||
| 3501 | Ga0207678_10649783 | |||
| 3502 | Ga0207678_10864781 | |||
| 3503 | Ga0207678_11010811 | |||
| 3504 | Ga0207678_11168927 | |||
| 3505 | Ga0207678_11196387 | |||
| 3506 | Ga0207678_11362173 | |||
| 3507 | Ga0207678_11499097 | |||
| 3508 | Ga0207708_10222353 | |||
| 3509 | Ga0207702_10000698 | |||
| 3510 | Ga0207702_10000732 | |||
| 3511 | Ga0207702_10001319 | |||
| 3512 | Ga0207702_10184699 | |||
| 3513 | Ga0207702_10277540 | |||
| 3514 | Ga0207702_10553839 | |||
| 3515 | Ga0207702_10797152 | |||
| 3516 | Ga0207702_11018288 | |||
| 3517 | Ga0207641_10003025 | |||
| 3518 | Ga0207641_10082621 | |||
| 3519 | Ga0207641_10096599 | |||
| 3520 | Ga0207641_10354578 | |||
| 3521 | Ga0207648_10000146 | |||
| 3522 | Ga0207648_10001822 | |||
| 3523 | Ga0207648_10003244 | |||
| 3524 | Ga0207648_10011303 | |||
| 3525 | Ga0207648_10013115 | |||
| 3526 | Ga0207648_10193560 | |||
| 3527 | Ga0207648_10265695 | |||
| 3528 | Ga0207648_10280515 | |||
| 3529 | Ga0207648_10309354 | |||
| 3530 | Ga0207648_10316866 | |||
| 3531 | Ga0207648_10525420 | |||
| 3532 | Ga0207648_10627607 | |||
| 3533 | Ga0207648_11413271 | |||
| 3534 | Ga0207676_10001000 | |||
| 3535 | Ga0207676_10007652 | |||
| 3536 | Ga0207676_10014293 | |||
| 3537 | Ga0207676_10214855 | |||
| 3538 | Ga0207676_10307788 | |||
| 3539 | Ga0207676_10592142 | |||
| 3540 | Ga0207676_11598846 | |||
| 3541 | Ga0207676_11608865 | |||
| 3542 | Ga0207674_10005362 | |||
| 3543 | Ga0207674_10012070 | |||
| 3544 | Ga0207674_10020685 | |||
| 3545 | Ga0207674_10083208 | |||
| 3546 | Ga0207674_10126264 | |||
| 3547 | Ga0207674_10203057 | |||
| 3548 | Ga0207674_10323642 | |||
| 3549 | Ga0207674_10340698 | |||
| 3550 | Ga0207674_10637731 | |||
| 3551 | Ga0207674_10929873 | |||
| 3552 | Ga0207674_10956645 | |||
| 3553 | Ga0207674_11239762 | |||
| 3554 | Ga0207674_11559830 | |||
| 3555 | Ga0207675_100000857 | |||
| 3556 | Ga0207675_100007272 | |||
| 3557 | Ga0207675_100048118 | |||
| 3558 | Ga0207675_101542020 | |||
| 3559 | Ga0207675_101706059 | |||
| 3560 | Ga0207675_102439470 | |||
| 3561 | Ga0207683_10003588 | |||
| 3562 | Ga0207683_10025072 | |||
| 3563 | Ga0207683_10100629 | |||
| 3564 | Ga0207683_10237104 | |||
| 3565 | Ga0207683_10296833 | |||
| 3566 | Ga0207683_10389095 | |||
| 3567 | Ga0207683_11136446 | |||
| 3568 | Ga0207683_11149581 | |||
| 3569 | Ga0207698_10048848 | |||
| 3570 | Ga0207698_10059821 | |||
| 3571 | Ga0207698_10109749 | |||
| 3572 | Ga0207698_10112411 | |||
| 3573 | Ga0207698_10113315 | |||
| 3574 | Ga0207698_10130132 | |||
| 3575 | Ga0207698_10140855 | |||
| 3576 | Ga0207698_10319705 | |||
| 3577 | Ga0207698_10388622 | |||
| 3578 | Ga0207698_10457285 | |||
| 3579 | Ga0207698_10651216 | |||
| 3580 | Ga0207698_10777828 | |||
| 3581 | Ga0207698_10994646 | |||
| 3582 | Ga0207698_11196478 | |||
| 3583 | Ga0207698_11490572 | |||
| 3584 | Ga0207698_12714087 | |||
| 3585 | Ga0209389_1067513 | |||
| 3586 | Ga0209371_1000218 | |||
| 3587 | Ga0209371_1009244 | |||
| 3588 | Ga0209981_1009284 | |||
| 3589 | Ga0209981_1046705 | |||
| 3590 | Ga0209996_1001204 | |||
| 3591 | Ga0209995_1003268 | |||
| 3592 | Ga0209968_1000123 | |||
| 3593 | Ga0209999_1009109 | |||
| 3594 | Ga0209282_1002929 | |||
| 3595 | Ga0209966_1000001 | |||
| 3596 | Ga0209998_10020024 | |||
| 3597 | Ga0209998_10043006 | |||
| 3598 | Ga0209813_10018067 | |||
| 3599 | Ga0209813_10045904 | |||
| 3600 | Ga0209813_10144705 | |||
| 3601 | Ga0209813_10227928 | |||
| 3602 | Ga0209813_10335095 | |||
| 3603 | Ga0209813_10356493 | |||
| 3604 | Ga0209974_10001570 | |||
| 3605 | Ga0209974_10039516 | |||
| 3606 | Ga0209974_10133454 | |||
| 3607 | Ga0207428_10775357 | |||
| 3608 | Ga0268266_10081508 | |||
| 3609 | Ga0268266_10327068 | |||
| 3610 | Ga0268266_10466277 | |||
| 3611 | Ga0268266_10562082 | |||
| 3612 | Ga0268266_11245677 | |||
| 3613 | Ga0268265_10008049 | |||
| 3614 | Ga0268265_10094734 | |||
| 3615 | Ga0268265_10395518 | |||
| 3616 | Ga0268264_10009130 | |||
| 3617 | Ga0268264_10073483 | |||
| 3618 | Ga0268264_10245697 | |||
| 3619 | Ga0268264_10264306 | |||
| 3620 | Ga0268264_10549097 | |||
| 3621 | Ga0268264_10757437 | |||
| 3622 | Ga0265334_10122037 | |||
| 3623 | Ga0265323_10040942 | |||
| 3624 | Ga0307517_10000805 | |||
| 3625 | Ga0307517_10077388 | |||
| 3626 | Ga0307517_10183915 | |||
| 3627 | Ga0307517_10195603 | |||
| 3628 | Ga0307517_10346790 | |||
| 3629 | Ga0307517_10407601 | |||
| 3630 | Ga0307515_10000020 | |||
| 3631 | Ga0307515_10000053 | |||
| 3632 | Ga0307515_10001032 | |||
| 3633 | Ga0307515_10002612 | |||
| 3634 | Ga0307515_10005265 | |||
| 3635 | Ga0307515_10014672 | |||
| 3636 | Ga0307515_10037926 | |||
| 3637 | Ga0307515_10045683 | |||
| 3638 | Ga0307515_10048358 | |||
| 3639 | Ga0307515_10084485 | |||
| 3640 | Ga0307515_10112003 | |||
| 3641 | Ga0307515_10413000 | |||
| 3642 | Ga0307515_10588117 | |||
| 3643 | Ga0265324_10227390 | |||
| 3644 | Ga0268256_1000174 | |||
| 3645 | Ga0268256_1016030 | |||
| 3646 | Ga0268256_1021508 | |||
| 3647 | Ga0307512_10035617 | |||
| 3648 | Ga0307512_10044313 | |||
| 3649 | Ga0307512_10233285 | |||
| 3650 | Ga0316177_1178071 | |||
| 3651 | Ga0316176_1020296 | |||
| 3652 | Ga0314311_1266168 | |||
| 3653 | Ga0316179_1063983 | |||
| 3654 | Ga0316178_1148277 | |||
| 3655 | Ga0316183_1017320 | |||
| 3656 | Ga0316181_1020992 | |||
| 3657 | Ga0316182_1299692 | |||
| 3658 | Ga0265327_10000158 | |||
| 3659 | Ga0265327_10000640 | |||
| 3660 | Ga0265327_10023188 | |||
| 3661 | Ga0265327_10227028 | |||
| 3662 | Ga0265327_10316668 | |||
| 3663 | Ga0265316_10236963 | |||
| 3664 | Ga0265316_11282330 | |||
| 3665 | Ga0307513_10014068 | |||
| 3666 | Ga0307513_10119699 | |||
| 3667 | Ga0307513_10135699 | |||
| 3668 | Ga0307513_10158438 | |||
| 3669 | Ga0307513_10242399 | |||
| 3670 | Ga0307513_10323194 | |||
| 3671 | Ga0307513_10476072 | |||
| 3672 | Ga0307513_10693839 | |||
| 3673 | Ga0307509_10001946 | |||
| 3674 | Ga0307509_10002654 | |||
| 3675 | Ga0307509_10008897 | |||
| 3676 | Ga0307509_10140975 | |||
| 3677 | Ga0307509_10143796 | |||
| 3678 | Ga0307509_10202426 | |||
| 3679 | Ga0307509_10291208 | |||
| 3680 | Ga0307509_11005609 | |||
| 3681 | Ga0307408_100008062 | |||
| 3682 | Ga0307408_100008200 | |||
| 3683 | Ga0307408_100047567 | |||
| 3684 | Ga0307408_100065038 | |||
| 3685 | Ga0307408_100076502 | |||
| 3686 | Ga0307408_100154143 | |||
| 3687 | Ga0307408_100214499 | |||
| 3688 | Ga0307408_100317795 | |||
| 3689 | Ga0307408_100610836 | |||
| 3690 | Ga0307408_100968574 | |||
| 3691 | Ga0307408_102219087 | |||
| 3692 | Ga0307508_10000004 | |||
| 3693 | Ga0307508_10000078 | |||
| 3694 | Ga0307508_10002611 | |||
| 3695 | Ga0307508_10058330 | |||
| 3696 | Ga0307508_10097952 | |||
| 3697 | Ga0307508_10387871 | |||
| 3698 | Ga0307508_10536118 | |||
| 3699 | Ga0307514_10003397 | |||
| 3700 | Ga0307514_10122350 | |||
| 3701 | Ga0307514_10132041 | |||
| 3702 | Ga0316579_10367458 | |||
| 3703 | Ga0307516_10000497 | |||
| 3704 | Ga0307516_10001023 | |||
| 3705 | Ga0307516_10017381 | |||
| 3706 | Ga0307516_10022278 | |||
| 3707 | Ga0307516_10022921 | |||
| 3708 | Ga0307516_10046323 | |||
| 3709 | Ga0307516_10156564 | |||
| 3710 | Ga0307516_10209567 | |||
| 3711 | Ga0307516_10402920 | |||
| 3712 | Ga0307516_10859608 | |||
| 3713 | Ga0307516_11014043 | |||
| 3714 | Ga0307405_10002891 | |||
| 3715 | Ga0307405_10033496 | |||
| 3716 | Ga0307405_10058525 | |||
| 3717 | Ga0307405_10072893 | |||
| 3718 | Ga0307405_10091624 | |||
| 3719 | Ga0307405_10145859 | |||
| 3720 | Ga0307405_12061651 | |||
| 3721 | Ga0316577_10076331 | |||
| 3722 | Ga0307413_10018011 | |||
| 3723 | Ga0307413_10036799 | |||
| 3724 | Ga0307413_10221794 | |||
| 3725 | Ga0307413_10717891 | |||
| 3726 | Ga0307413_11200767 | |||
| 3727 | Ga0307413_11585218 | |||
| 3728 | Ga0307410_10082470 | |||
| 3729 | Ga0307410_10124374 | |||
| 3730 | Ga0307410_10499673 | |||
| 3731 | Ga0307410_10565987 | |||
| 3732 | Ga0307410_12130887 | |||
| 3733 | Ga0307406_10007967 | |||
| 3734 | Ga0307406_10182693 | |||
| 3735 | Ga0307406_10189848 | |||
| 3736 | Ga0307406_10597273 | |||
| 3737 | Ga0307406_11168192 | |||
| 3738 | Ga0307406_11340675 | |||
| 3739 | Ga0307407_10071891 | |||
| 3740 | Ga0307407_10307089 | |||
| 3741 | Ga0307407_10482758 | |||
| 3742 | Ga0307407_11322006 | |||
| 3743 | Ga0307412_10001384 | |||
| 3744 | Ga0307412_10003210 | |||
| 3745 | Ga0307412_10021895 | |||
| 3746 | Ga0307412_10034400 | |||
| 3747 | Ga0307412_10043071 | |||
| 3748 | Ga0307412_10043743 | |||
| 3749 | Ga0307412_10056266 | |||
| 3750 | Ga0307412_10156113 | |||
| 3751 | Ga0307412_10236021 | |||
| 3752 | Ga0307412_10356212 | |||
| 3753 | Ga0307412_10683024 | |||
| 3754 | Ga0307412_10721909 | |||
| 3755 | Ga0307412_10791088 | |||
| 3756 | Ga0307412_11002241 | |||
| 3757 | Ga0307412_11449973 | |||
| 3758 | Ga0307409_100000086 | |||
| 3759 | Ga0307409_100024728 | |||
| 3760 | Ga0307409_100732557 | |||
| 3761 | Ga0307409_101027605 | |||
| 3762 | Ga0307409_101972378 | |||
| 3763 | Ga0307409_102028809 | |||
| 3764 | Ga0307409_102617248 | |||
| 3765 | Ga0307409_102943023 | |||
| 3766 | Ga0307416_100024835 | |||
| 3767 | Ga0307416_100051514 | |||
| 3768 | Ga0307416_100130486 | |||
| 3769 | Ga0307416_100323291 | |||
| 3770 | Ga0307416_100571575 | |||
| 3771 | Ga0307416_100623909 | |||
| 3772 | Ga0307416_101059411 | |||
| 3773 | Ga0307416_101197589 | |||
| 3774 | Ga0307416_101306335 | |||
| 3775 | Ga0307416_101383634 | |||
| 3776 | Ga0307416_101405940 | |||
| 3777 | Ga0307414_10024960 | |||
| 3778 | Ga0307414_10067625 | |||
| 3779 | Ga0307414_10086711 | |||
| 3780 | Ga0307414_10111423 | |||
| 3781 | Ga0307414_10115418 | |||
| 3782 | Ga0307414_10174830 | |||
| 3783 | Ga0307414_11097499 | |||
| 3784 | Ga0307414_11161104 | |||
| 3785 | Ga0307411_10005193 | |||
| 3786 | Ga0307411_10063367 | |||
| 3787 | Ga0307411_10074309 | |||
| 3788 | Ga0307411_10104486 | |||
| 3789 | Ga0307411_10123397 | |||
| 3790 | Ga0307411_10180169 | |||
| 3791 | Ga0307411_10254323 | |||
| 3792 | Ga0307411_10613968 | |||
| 3793 | Ga0307411_10995515 | |||
| 3794 | Ga0307411_11988153 | |||
| 3795 | Ga0307415_100000361 | |||
| 3796 | Ga0307415_100133882 | |||
| 3797 | Ga0307415_101088308 | |||
| 3798 | Ga0316593_10026594 | |||
| 3799 | Ga0307507_10100794 | |||
| 3800 | Ga0307507_10130139 | |||
| 3801 | Ga0307510_10009306 | |||
| 3802 | Ga0307510_10017087 | |||
| 3803 | Ga0307510_10041763 | |||
| 3804 | Ga0307510_10135811 | |||
| 3805 | Ga0307510_10279920 | |||
| 3806 | Ga0307510_10367980 | |||
| 3807 | Ga0373930_0026313 | |||
| 3808 | Ga0373959_0033468 | |||
| 3809 | Ga0373959_0090448 | |||
| 3810 | Ga0373938_0081594 | |||
| 3811 | Ga0373938_0110016 | |||
| 3812 | Ga0373928_0132188 | |||
| 3813 | Ga0373929_0032309 | |||
| 3814 | Ga0373940_0011192 | |||
| 3815 | Ga0373944_0177474 | |||
| 3816 | Ga0373944_0193002 | |||
| 3817 | Ga0373944_0194084 | |||
| 3818 | Ga0373944_0249845 | |||
| 3819 | Ga0373952_0050313 | |||
| 3820 | Ga0373923_0304964 | |||
| 3821 | Ga0373941_0224634 | |||
| 3822 | Ga0373941_0340503 | |||
| 3823 | Ga0373945_0142088 | |||
| 3824 | Ga0373953_0129594 | |||
| 3825 | Ga0373943_0159516 | |||
| 3826 | Ga0373946_0039114 | |||
| 3827 | Ga0373955_0450700 | |||
| 3828 | Ga0373942_0070650 | |||
| 3829 | Ga0373962_0312170 | |||
| 3830 | Ga0373924_0528130 | |||
| 3831 | Ga0373931_0009283 | |||
| 3832 | Ga0373931_0014386 | |||
| 3833 | Ga0373931_0026583 | |||
| 3834 | Ga0373935_0311811 | |||
| 3835 | Ga0373935_0523714 | |||
| 3836 | Ga0373935_1408693 | |||
| 3837 | Ga0373927_0009569 | |||
| 3838 | Ga0373927_0211207 | |||
| 3839 | Ga0373927_0240876 | |||
| 3840 | Ga0373933_1163731 | |||
| 3841 | Ga0373947_0473855 | |||
| 3842 | Ga0373947_0531919 | |||
| 3843 | Ga0373947_0891802 | |||
| 3844 | Ga0373937_0069375 | |||
| 3845 | Ga0373937_0381456 | |||
| 3846 | Ga0316582_0015066 | |||
| 3847 | Ga0316584_0092501 | |||
| 3848 | Ga0373925_0078641 | |||
| 3849 | Ga0373925_0242397 | |||
| 3850 | Ga0373925_0307578 | |||
| 3851 | Ga0373925_0330534 | |||
| 3852 | Ga0395899_0004720 | |||
| 3853 | Ga0395900_0000109 | |||
| 3854 | Ga0395900_0029684 | |||
| 3855 | Ga0395900_0118039 | |||
| 3856 | Ga0395900_1485775 | |||
| 3857 | Ga0395898_0015056 | |||
| 3858 | Ga0395898_0037637 | |||
| 3859 | Ga0395898_0046059 | |||
| 3860 | Ga0395898_0297054 | |||
| 3861 | Ga0395905_0000488 | |||
| 3862 | Ga0395905_0011451 | |||
| 3863 | Ga0395905_0025592 | |||
| 3864 | Ga0395905_0034301 | |||
| 3865 | Ga0395905_0036014 | |||
| 3866 | Ga0395905_0166348 | |||
| 3867 | Ga0395905_0531124 | |||
| 3868 | Ga0395905_0585851 | |||
| 3869 | Ga0395905_0592545 | |||
| 3870 | Ga0316581_0021996 | |||
| 3871 | Ga0395901_0012844 | |||
| 3872 | Ga0395901_0985377 | |||
| 3873 | Ga0436365_1178302 | |||
| 3874 | Ga0436360_0258616 | |||
| 3875 | Ga0436361_0167979 | |||
| 3876 | Ga0436361_0214541 | |||
| 3877 | Ga0436361_0217332 | |||
| 3878 | Ga0436361_0359670 | |||
| 3879 | Ga0436361_0529504 | |||
| 3880 | Ga0436361_0683214 | |||
| 3881 | Ga0436361_0769709 | |||
| 3882 | Ga0436361_1056645 | |||
| 3883 | Ga0436361_1092359 | |||
| 3884 | Ga0436363_0880003 | |||
| 3885 | Ga0436363_1113045 | |||
| 3886 | Ga0439436_0005082 | |||
| 3887 | Ga0439436_0017528 | |||
| 3888 | Ga0439436_0058755 | |||
| 3889 | Ga0439438_015929 | |||
| 3890 | Ga0439439_0000304 | |||
| 3891 | Ga0439439_0167384 | |||
| 3892 | Ga0439447_041937 | |||
| 3893 | Ga0439453_0072178 | |||
| 3894 | Ga0439461_0014042 | |||
| 3895 | Ga0439461_0092374 | |||
| 3896 | Ga0439466_0002298 | |||
| 3897 | Ga0439466_0009551 | |||
| 3898 | Ga0439465_0003892 | |||
| 3899 | Ga0439465_0087386 | |||
| 3900 | Ga0439465_0183658 | |||
| 3901 | Ga0439465_0382652 | |||
| 3902 | Ga0451789_0160463 | |||
| 3903 | Ga0451791_1329588 | |||
| 3904 | Ga0451793_0907941 | |||
| 3905 | Ga0451793_1009248 | |||
| 3906 | Ga0451797_1109477 | |||
| 3907 | Ga0451795_0913388 | |||
| 3908 | Ga0451798_0882602 | |||
| 3909 | Ga0451798_1022954 | |||
| 3910 | Ga0451800_0983364 | |||
| 3911 | Ga0451800_1592322 | |||
| 3912 | Ga0451802_0064922 | |||
| 3913 | Ga0451806_649029 | |||
| 3914 | Ga0451804_0858374 | |||
| 3915 | Ga0451807_1165661 | |||
| 3916 | Ga0451807_2033827 | |||
| 3917 | Ga0451807_2607001 | |||
| 3918 | Ga0451833_1194697 | |||
| 3919 | Ga0451839_0399468 | |||
| 3920 | Ga0451839_0693068 | |||
| 3921 | Ga0451839_0749505 | |||
| 3922 | Ga0451841_0449173 | |||
| 3923 | Ga0451845_0413049 | |||
| 3924 | Ga0451847_0674285 | |||
| 3925 | Ga0451851_0829363 | |||
| 3926 | Ga0451843_0383449 | |||
| 3927 | Ga0451843_0510807 | |||
| 3928 | Ga0451843_0908011 | |||
| 3929 | Ga0451843_1432462 | |||
| 3930 | Ga0451853_0990419 | |||
| 3931 | Ga0451853_1045547 | |||
| 3932 | Ga0451853_1701460 | |||
| 3933 | Ga0451853_1730775 | |||
| 3934 | Ga0439431_0002568 | |||
| 3935 | Ga0439431_0103546 | |||
| 3936 | Ga0439433_0022304 | |||
| 3937 | Ga0439433_0080513 | |||
| 3938 | Ga0439442_003022 | |||
| 3939 | Ga0439442_031470 | |||
| 3940 | Ga0439442_133545 | |||
| 3941 | Ga0439445_0021223 | |||
| 3942 | Ga0439445_0051253 | |||
| 3943 | Ga0439445_0258069 | |||
| 3944 | Ga0439448_0000154 | |||
| 3945 | Ga0439448_0248931 | |||
| 3946 | Ga0439432_003328 | |||
| 3947 | Ga0439432_150236 | |||
| 3948 | Ga0439449_0002911 | |||
| 3949 | Ga0439449_0004348 | |||
| 3950 | Ga0439449_0142564 | |||
| 3951 | Ga0439452_002322 | |||
| 3952 | Ga0439452_004417 | |||
| 3953 | Ga0439455_0004565 | |||
| 3954 | Ga0439455_0046089 | |||
| 3955 | Ga0439455_0092612 | |||
| 3956 | Ga0439457_168515 | |||
| 3957 | Ga0439462_0003593 | |||
| 3958 | Ga0450911_056827 | |||
| 3959 | Ga0450919_000602 | |||
| 3960 | Ga0450919_011901 | |||
| 3961 | Ga0450920_005125 | |||
| 3962 | Ga0450923_026479 | |||
| 3963 | Ga0450888_066290 | |||
| 3964 | Ga0450890_016977 | |||
| 3965 | Ga0450890_026369 | |||
| 3966 | Ga0450890_034900 | |||
| 3967 | Ga0450897_009986 | |||
| 3968 | Ga0450894_013462 | |||
| 3969 | Ga0450898_049450 | |||
| 3970 | Ga0450898_056288 | |||
| 3971 | Ga0450899_009850 | |||
| 3972 | Ga0450899_011977 | |||
| 3973 | Ga0450889_015950 | |||
| 3974 | Ga0450906_022700 | |||
| 3975 | Ga0450907_048795 | |||
| 3976 | Ga0439446_0196246 | |||
| 3977 | Ga0439446_0203182 | |||
| 3978 | Ga0450909_026534 | |||
| 3979 | Ga0439434_0002020 | |||
| 3980 | Ga0439434_0004225 | |||
| 3981 | Ga0439434_0091011 | |||
| 3982 | Ga0439459_0016027 | |||
| 3983 | Ga0450918_000607 | |||
| 3984 | Ga0450918_003867 | |||
| 3985 | Ga0450893_0027764 | |||
| 3986 | Ga0451577_0006746 | |||
| 3987 | Ga0451577_0008963 | |||
| 3988 | Ga0451577_0065508 | |||
| 3989 | Ga0451577_0238241 | |||
| 3990 | Ga0451577_0404128 | |||
| 3991 | Ga0451577_0445720 | |||
| 3992 | Ga0451577_1015378 | |||
| 3993 | Ga0451577_1580173 | |||
| 3994 | Ga0451577_1823083 | |||
| 3995 | Ga0466969_0000395 | |||
| 3996 | Ga0466969_0001952 | |||
| 3997 | Ga0466969_0008585 | |||
| 3998 | Ga0466969_0010813 | |||
| 3999 | Ga0466969_0027212 | |||
| 4000 | Ga0466972_0008024 | |||
| 4001 | Ga0466972_0013627 | |||
| 4002 | Ga0466972_0022412 | |||
| 4003 | Ga0466972_0038687 | |||
| 4004 | Ga0466972_0351804 | |||
| 4005 | Ga0466980_0248074 | |||
| 4006 | Ga0453683_0001626 | |||
| 4007 | Ga0453683_0119199 | |||
| 4008 | Ga0453683_1211943 | |||
| 4009 | Ga0466965_0027809 | |||
| 4010 | Ga0466965_0036578 | |||
| 4011 | Ga0466965_0041138 | |||
| 4012 | Ga0466965_0054005 | |||
| 4013 | Ga0466965_0254979 | |||
| 4014 | Ga0466966_0099105 | |||
| 4015 | Ga0466966_0200822 | |||
| 4016 | Ga0466961_0005306 | |||
| 4017 | Ga0466961_0011241 | |||
| 4018 | Ga0466961_0035961 | |||
| 4019 | Ga0466961_0156934 | |||
| 4020 | Ga0466961_0204242 | |||
| 4021 | Ga0466961_0298460 | |||
| 4022 | Ga0466963_0057018 | |||
| 4023 | Ga0466963_0125037 | |||
| 4024 | Ga0466963_0211748 | |||
| 4025 | Ga0466964_0031972 | |||
| 4026 | Ga0466964_0141395 | |||
| 4027 | Ga0466964_0155240 | |||
| 4028 | Ga0466964_0408670 | |||
| 4029 | Ga0453684_0003638 | |||
| 4030 | Ga0453684_0088462 | |||
| 4031 | Ga0453684_0139796 | |||
| 4032 | Ga0453684_0172543 | |||
| 4033 | Ga0453684_0349930 | |||
| 4034 | Ga0453684_0483714 | |||
| 4035 | Ga0453684_0513278 | |||
| 4036 | Ga0453684_0606434 | |||
| 4037 | Ga0453684_1089263 | |||
| 4038 | Ga0453684_1301134 | |||
| 4039 | Ga0466971_0004739 | |||
| 4040 | Ga0466971_0189161 | |||
| 4041 | Ga0466971_0269457 | |||
| 4042 | Ga0466968_0059440 | |||
| 4043 | Ga0466968_0185307 | |||
| 4044 | Ga0466968_0228024 | |||
| 4045 | Ga0466968_0279379 | |||
| 4046 | Ga0466970_0007521 | |||
| 4047 | Ga0466970_0060241 | |||
| 4048 | Ga0466970_0147824 | |||
| 4049 | Ga0466970_0450782 | |||
| 4050 | Ga0466957_0014902 | |||
| 4051 | Ga0466957_0117828 | |||
| 4052 | Ga0466957_0166856 | |||
| 4053 | Ga0466957_0202241 | |||
| 4054 | Ga0466957_0268488 | |||
| 4055 | Ga0466957_0443444 | |||
| 4056 | Ga0466960_0020318 | |||
| 4057 | Ga0466960_0114141 | |||
| 4058 | Ga0466960_0873204 | |||
| 4059 | Ga0466959_0003919 | |||
| 4060 | Ga0466959_0087673 | |||
| 4061 | Ga0466959_0105260 | |||
| 4062 | Ga0466959_0111821 | |||
| 4063 | Ga0466959_0218492 | |||
| 4064 | Ga0466959_0368236 | |||
| 4065 | Ga0451576_0000914 | |||
| 4066 | Ga0451576_0004476 | |||
| 4067 | Ga0451576_0014049 | |||
| 4068 | Ga0451576_0052912 | |||
| 4069 | Ga0451576_0122968 | |||
| 4070 | Ga0451576_0241548 | |||
| 4071 | Ga0451576_0467602 | |||
| 4072 | Ga0451576_0636156 | |||
| 4073 | Ga0451576_1358864 | |||
| 4074 | Ga0466958_0074271 | |||
| 4075 | Ga0466958_0473553 | |||
| 4076 | Ga0466967_0056668 | |||
| 4077 | Ga0466967_0075650 | |||
| 4078 | Ga0466967_1135311 | |||
| 4079 | Ga0495627_007566 | |||
| 4080 | Ga0495592_0008709 | |||
| 4081 | Ga0495592_0015966 | |||
| 4082 | Ga0495603_0032423 | |||
| 4083 | Ga0495591_156730 | |||
| 4084 | Ga0495629_0154872 | |||
| 4085 | Ga0495629_0381748 | |||
| 4086 | Ga0495638_0051454 | |||
| 4087 | Ga0495638_0085327 | |||
| 4088 | Ga0495638_0208178 | |||
| 4089 | Ga0495651_0311118 | |||
| 4090 | Ga0495651_0691763 | |||
| 4091 | Ga0495653_0115724 | |||
| 4092 | Ga0495650_0016331 | |||
| 4093 | Ga0495650_0191780 | |||
| 4094 | Ga0495580_0145541 | |||
| 4095 | Ga0495582_0117129 | |||
| 4096 | Ga0495582_0542480 | |||
| 4097 | Ga0495605_0023835 | |||
| 4098 | Ga0495605_0105856 | |||
| 4099 | Ga0495639_0017429 | |||
| 4100 | Ga0495639_0061533 | |||
| 4101 | Ga0495664_0132586 | |||
| 4102 | Ga0495584_0261560 | |||
| 4103 | Ga0495585_0055375 | |||
| 4104 | Ga0495607_0399698 | |||
| 4105 | Ga0495583_0015974 | |||
| 4106 | Ga0495606_0099657 | |||
| 4107 | Ga0495606_0112339 | |||
| 4108 | Ga0495606_0223399 | |||
| 4109 | Ga0495608_0178630 | |||
| 4110 | Ga0495610_0008701 | |||
| 4111 | Ga0495616_0006630 | |||
| 4112 | Ga0495618_0346612 | |||
| 4113 | Ga0495620_0010437 | |||
| 4114 | Ga0495628_0140583 | |||
| 4115 | Ga0495631_0002748 | |||
| 4116 | Ga0495632_0009715 | |||
| 4117 | Ga0495632_0016885 | |||
| 4118 | Ga0495632_0173014 | |||
| 4119 | Ga0495637_0020235 | |||
| 4120 | Ga0495648_0042223 | |||
| 4121 | Ga0495648_0148033 | |||
| 4122 | Ga0495648_0201241 | |||
| 4123 | Ga0495648_0270304 | |||
| 4124 | Ga0495666_0043869 | |||
| 4125 | Ga0495642_0013334 | |||
| 4126 | Ga0495642_0167757 | |||
| 4127 | Ga0495642_0554511 | |||
| 4128 | Ga0495654_0000550 | |||
| 4129 | Ga0495654_0043604 | |||
| 4130 | Ga0495640_0366968 | |||
| 4131 | Ga0495586_0021373 | |||
| 4132 | Ga0495621_0002735 | |||
| 4133 | Ga0495621_0003885 | |||
| 4134 | Ga0495621_0160934 | |||
| 4135 | Ga0495597_0000153 | |||
| 4136 | Ga0495597_0020188 | |||
| 4137 | Ga0495597_0383230 | |||
| 4138 | Ga0495622_0088536 | |||
| 4139 | Ga0495622_0250621 | |||
| 4140 | Ga0495656_0000929 | |||
| 4141 | Ga0495656_0062221 | |||
| 4142 | Ga0495656_0434962 | |||
| 4143 | Ga0495668_0051073 | |||
| 4144 | Ga0495668_0360329 | |||
| 4145 | Ga0495634_0625845 | |||
| 4146 | Ga0495611_0175389 | |||
| 4147 | Ga0495625_0000714 | |||
| 4148 | Ga0495625_0010826 | |||
| 4149 | Ga0495625_0096602 | |||
| 4150 | Ga0495625_0108856 | |||
| 4151 | Ga0495625_0148101 | |||
| 4152 | Ga0495625_0627755 | |||
| 4153 | Ga0495625_0850208 | |||
| 4154 | Ga0495635_0463626 | |||
| 4155 | Ga0495588_0076870 | |||
| 4156 | Ga0495623_0050249 | |||
| 4157 | Ga0495623_0587185 | |||
| 4158 | Ga0495646_0031855 | |||
| 4159 | Ga0495647_0009386 | |||
| 4160 | Ga0495647_0010703 | |||
| 4161 | Ga0495647_0097247 | |||
| 4162 | Ga0495658_0201880 | |||
| 4163 | Ga0495658_0213479 | |||
| 4164 | Ga0495658_0300309 | |||
| 4165 | Ga0495658_0348305 | |||
| 4166 | Ga0495658_0835723 | |||
| 4167 | Ga0495613_0240571 | |||
| 4168 | Ga0495624_0514420 | |||
| 4169 | Ga0495624_0517615 | |||
| 4170 | Ga0495624_0905451 | |||
| 4171 | Ga0495670_0151238 | |||
| 4172 | Ga0495670_0183285 | |||
| 4173 | Ga0495671_0019317 | |||
| 4174 | Ga0495671_0327995 | |||
| 4175 | Ga0495649_0004353 | |||
| 4176 | Ga0495649_0084532 | |||
| 4177 | Ga0495589_0027163 | |||
| 4178 | Ga0495589_0137394 | |||
| 4179 | Ga0495660_0006585 | |||
| 4180 | Ga0495660_0084665 | |||
| 4181 | Ga0495660_0433749 | |||
| 4182 | Ga0495581_0525553 | |||
| 4183 | Ga0495604_0900102 | |||
| 4184 | Ga0495636_0517764 | |||
| 4185 | Ga0495674_0003080 | |||
| 4186 | Ga0495674_0025003 | |||
| 4187 | Ga0495674_0131454 | |||
| 4188 | Ga0495672_0000655 | |||
| 4189 | Ga0495672_0022880 | |||
| 4190 | Ga0495676_0007147 | |||
| 4191 | Ga0495687_001512 | |||
| 4192 | Ga0495687_002480 | |||
| 4193 | Ga0495687_047916 | |||
| 4194 | Ga0495677_0045384 | |||
| 4195 | Ga0495673_0026656 | |||
| 4196 | Ga0495684_0527155 | |||
| 4197 | Ga0495686_0005600 | |||
| 4198 | Ga0495686_0008724 | |||
| 4199 | Ga0495593_0006672 | |||
| 4200 | Ga0495593_0060213 | |||
| 4201 | Ga0495593_0100100 | |||
| 4202 | Ga0495602_0226558 | |||
| 4203 | Ga0495614_0009932 | |||
| 4204 | Ga0495626_0051745 | |||
| 4205 | Ga0496100_0047259 | |||
| 4206 | Ga0496100_0673556 | |||
| 4207 | Ga0496101_0021483 | |||
| 4208 | Ga0496101_0043750 | |||
| 4209 | Ga0496101_0504671 | |||
| 4210 | Ga0496101_1055879 | |||
| 4211 | Ga0496102_0013747 | |||
| 4212 | Ga0496102_0051832 | |||
| 4213 | Ga0496102_0109753 | |||
| 4214 | Ga0496102_0173558 | |||
| 4215 | Ga0496103_0006569 | |||
| 4216 | Ga0496103_0399580 | |||
| 4217 | Ga0496104_0015973 | |||
| 4218 | Ga0496104_0270479 | |||
| 4219 | Ga0496104_0684598 | |||
| 4220 | Ga0496104_1377640 | |||
| 4221 | Ga0496105_0005071 | |||
| 4222 | Ga0496105_0030674 | |||
| 4223 | Ga0496105_0045888 | |||
| 4224 | Ga0496105_0241040 | |||
| 4225 | Ga0496105_0828454 | |||
| 4226 | Ga0496105_0834771 | |||
| 4227 | Ga0496105_0938940 | |||
| 4228 | Ga0496105_0968325 | |||
| 4229 | Ga0496106_0184459 | |||
| 4230 | Ga0496106_0540275 | |||
| 4231 | Ga0496107_0144211 | |||
| 4232 | Ga0496108_0022590 | |||
| 4233 | Ga0496108_0061117 | |||
| 4234 | Ga0496108_0090344 | |||
| 4235 | Ga0496108_0260502 | |||
| 4236 | Ga0496108_0411333 | |||
| 4237 | Ga0496108_0580207 | |||
| 4238 | Ga0496108_0731375 | |||
| 4239 | Ga0496108_1024469 | |||
| 4240 | Ga0496108_1396629 | |||
| 4241 | Ga0496109_0074882 | |||
| 4242 | Ga0496109_0079105 | |||
| 4243 | Ga0496109_0253973 | |||
| 4244 | Ga0496109_0435780 | |||
| 4245 | Ga0496109_0438180 | |||
| 4246 | Ga0496109_0448801 | |||
| 4247 | Ga0496110_0010246 | |||
| 4248 | Ga0496110_0027229 | |||
| 4249 | Ga0496110_0031132 | |||
| 4250 | Ga0496110_0070427 | |||
| 4251 | Ga0496110_0102247 | |||
| 4252 | Ga0496110_0283289 | |||
| 4253 | Ga0496110_1587025 | |||
| 4254 | Ga0496111_0149804 | |||
| 4255 | Ga0496111_0551367 | |||
| 4256 | Ga0496112_0308348 | |||
| 4257 | Ga0496112_0316248 | |||
| 4258 | Ga0496112_0330744 | |||
| 4259 | Ga0496113_0009758 | |||
| 4260 | Ga0496113_0049458 | |||
| 4261 | Ga0496113_0777851 | |||
| 4262 | Ga0496114_0079247 | |||
| 4263 | Ga0496114_1395569 | |||
| 4264 | Ga0496115_0007123 | |||
| 4265 | Ga0496116_0004666 | |||
| 4266 | Ga0496116_0009886 | |||
| 4267 | Ga0496116_0017716 | |||
| 4268 | Ga0496116_0145930 | |||
| 4269 | Ga0496116_0337573 | |||
| 4270 | Ga0496116_0477789 | |||
| 4271 | Ga0496117_0020169 | |||
| 4272 | Ga0496117_0037073 | |||
| 4273 | Ga0496117_0075277 | |||
| 4274 | Ga0496117_0117343 | |||
| 4275 | Ga0496117_0489530 | |||
| 4276 | Ga0496118_0007919 | |||
| 4277 | Ga0496118_0011718 | |||
| 4278 | Ga0496118_0015352 | |||
| 4279 | Ga0496118_0071859 | |||
| 4280 | Ga0496118_0186102 | |||
| 4281 | Ga0496119_0049882 | |||
| 4282 | Ga0496119_0063307 | |||
| 4283 | Ga0496119_0075863 | |||
| 4284 | Ga0496119_0228659 | |||
| 4285 | Ga0496119_0367284 | |||
| 4286 | Ga0496120_0011850 | |||
| 4287 | Ga0496120_0107456 | |||
| 4288 | Ga0496121_0000257 | |||
| 4289 | Ga0496121_0000478 | |||
| 4290 | Ga0496121_0110968 | |||
| 4291 | Ga0496121_0180297 | |||
| 4292 | Ga0496121_0223451 | |||
| 4293 | Ga0496121_0251144 | |||
| 4294 | Ga0496121_0251147 | |||
| 4295 | Ga0496121_0724773 | |||
| 4296 | Ga0496122_0000077 | |||
| 4297 | Ga0496122_0000177 | |||
| 4298 | Ga0496122_0021150 | |||
| 4299 | Ga0496122_0056621 | |||
| 4300 | Ga0496122_0068323 | |||
| 4301 | Ga0496122_0078507 | |||
| 4302 | Ga0496122_0143523 | |||
| 4303 | Ga0496122_0171797 | |||
| 4304 | Ga0496123_0000050 | |||
| 4305 | Ga0496123_0003980 | |||
| 4306 | Ga0496123_0030980 | |||
| 4307 | Ga0496123_0055801 | |||
| 4308 | Ga0496123_0065568 | |||
| 4309 | Ga0496123_0194941 | |||
| 4310 | Ga0496124_0000036 | |||
| 4311 | Ga0496124_0002660 | |||
| 4312 | Ga0496124_0006878 | |||
| 4313 | Ga0496124_0059631 | |||
| 4314 | Ga0496124_0103335 | |||
| 4315 | Ga0496124_0154437 | |||
| 4316 | Ga0496124_0166248 | |||
| 4317 | Ga0496124_0242212 | |||
| 4318 | Ga0496124_0269123 | |||
| 4319 | Ga0496124_0320485 | |||
| 4320 | Ga0496124_0437038 | |||
| 4321 | Ga0496124_0472814 | |||
| 4322 | Ga0496125_0000146 | |||
| 4323 | Ga0496125_0021126 | |||
| 4324 | Ga0496125_0031217 | |||
| 4325 | Ga0496125_0043130 | |||
| 4326 | Ga0496125_0043843 | |||
| 4327 | Ga0496125_0080851 | |||
| 4328 | Ga0496125_0097356 | |||
| 4329 | Ga0496125_0210477 | |||
| 4330 | Ga0496125_0737410 | |||
| 4331 | Ga0496126_0137352 | |||
| 4332 | Ga0496126_0156464 | |||
| 4333 | Ga0496126_0315190 | |||
| 4334 | Ga0496126_0497852 | |||
| 4335 | Ga0501306_021570 | |||
| 4336 | Ga0501310_015194 | |||
| 4337 | Ga0495682_0014946 | |||
| 4338 | Ga0495682_0064665 | |||
| 4339 | Ga0501290_007970 | |||
| 4340 | Ga0501292_008734 | |||
| 4341 | Ga0501298_172416 | |||
| 4342 | Ga0501300_009618 | |||
| 4343 | Ga0501301_015817 | |||
| 4344 | Ga0501303_012601 | |||
| 4345 | Ga0501312_045622 | |||
| 4346 | Ga0501315_014423 | |||
| 4347 | Ga0501323_026474 | |||
| 4348 | Ga0501032_0335137 | |||
| 4349 | Ga0501033_0020756 | |||
| 4350 | Ga0501037_0834719 | |||
| 4351 | Ga0501042_0909589 | |||
| 4352 | Ga0501043_0000023 | |||
| 4353 | Ga0501043_0095479 | |||
| 4354 | Ga0501046_0000018 | |||
| 4355 | Ga0501047_0000020 | |||
| 4356 | Ga0501047_0019486 | |||
| 4357 | Ga0501047_0279819 | |||
| 4358 | Ga0501047_0287863 | |||
| 4359 | Ga0501048_0001064 | |||
| 4360 | Ga0501068_0794170 | |||
| 4361 | Ga0501070_0220651 | |||
| 4362 | Ga0501074_1153505 | |||
| 4363 | Ga0501198_000006 | |||
| 4364 | Ga0501206_022334 | |||
| 4365 | Ga0501222_000007 | |||
| 4366 | Ga0501222_009041 | |||
| 4367 | Ga0501222_027554 | |||
| 4368 | Ga0501249_019142 | |||
| 4369 | Ga0501257_067637 | |||
| 4370 | Ga0501261_029283 | |||
| 4371 | Ga0501221_074704 | |||
| 4372 | Ga0501225_0022614 | |||
| 4373 | Ga0501080_0447141 | |||
| 4374 | Ga0501083_0743463 | |||
| 4375 | Ga0501241_090622 | |||
| 4376 | Ga0501262_000426 | |||
| 4377 | Ga0501262_004524 | |||
| 4378 | Ga0501265_006632 | |||
| 4379 | Ga0501035_0005419 | |||
| 4380 | Ga0501035_0014590 | |||
| 4381 | Ga0501035_0042955 | |||
| 4382 | Ga0501035_0640938 | |||
| 4383 | Ga0501035_1512598 | |||
| 4384 | Ga0501044_0000124 | |||
| 4385 | Ga0501044_0349267 | |||
| 4386 | nmdc:mga03683_129022_c1 | |||
| 4387 | nmdc:mga03683_13658_c1 | |||
| 4388 | nmdc:mga03683_15946_c1 | |||
| 4389 | nmdc:mga03683_25031_c1 | |||
| 4390 | nmdc:mga03683_257465_c1 | |||
| 4391 | nmdc:mga03683_302734_c1 | |||
| 4392 | nmdc:mga03683_35298_c1 | |||
| 4393 | nmdc:mga03683_36243_c1 | |||
| 4394 | nmdc:mga03683_403677_c1 | |||
| 4395 | nmdc:mga03683_40783_c1 | |||
| 4396 | nmdc:mga03683_416764_c1 | |||
| 4397 | nmdc:mga03683_52476_c1 | |||
| 4398 | nmdc:mga03683_64218_c1 | |||
| 4399 | nmdc:mga03n38_119129_c1 | |||
| 4400 | nmdc:mga03n38_150061_c1 | |||
| 4401 | nmdc:mga03n38_29739_c1 | |||
| 4402 | nmdc:mga03n38_413424_c1 | |||
| 4403 | nmdc:mga03n38_464600_c1 | |||
| 4404 | nmdc:mga03n38_518338_c1 | |||
| 4405 | nmdc:mga03n38_67321_c1 | |||
| 4406 | nmdc:mga03n38_82759_c1 | |||
| 4407 | nmdc:mga00v17_178309_c1 | |||
| 4408 | nmdc:mga00v17_259459_c1 | |||
| 4409 | nmdc:mga00v17_29618_c1 | |||
| 4410 | nmdc:mga00v17_36194_c1 | |||
| 4411 | nmdc:mga00v17_80575_c1 | |||
| 4412 | nmdc:mga00v17_854253_c1 | |||
| 4413 | nmdc:mga00v17_948565_c1 | |||
| 4414 | nmdc:mga0yw44_17114_c1 | |||
| 4415 | nmdc:mga0yw44_2117_c1 | |||
| 4416 | nmdc:mga0yw44_568078_c1 | |||
| 4417 | nmdc:mga0k408_10403_c1 | |||
| 4418 | nmdc:mga0k408_1042_c1 | |||
| 4419 | nmdc:mga0k408_113390_c1 | |||
| 4420 | nmdc:mga0k408_1409_c2 | |||
| 4421 | nmdc:mga0k408_184_c1 | |||
| 4422 | nmdc:mga0k408_21023_c1 | |||
| 4423 | nmdc:mga0k408_213388_c1 | |||
| 4424 | nmdc:mga0k408_218610_c1 | |||
| 4425 | nmdc:mga0k408_234464_c1 | |||
| 4426 | nmdc:mga0k408_24809_c1 | |||
| 4427 | nmdc:mga0k408_249873_c1 | |||
| 4428 | nmdc:mga0k408_258989_c1 | |||
| 4429 | nmdc:mga0k408_269183_c1 | |||
| 4430 | nmdc:mga0k408_287274_c1 | |||
| 4431 | nmdc:mga0k408_289518_c1 | |||
| 4432 | nmdc:mga0k408_308331_c1 | |||
| 4433 | nmdc:mga0k408_318128_c1 | |||
| 4434 | nmdc:mga0k408_319019_c1 | |||
| 4435 | nmdc:mga0k408_3275_c1 | |||
| 4436 | nmdc:mga0k408_33719_c1 | |||
| 4437 | nmdc:mga0k408_33735_c1 | |||
| 4438 | nmdc:mga0k408_344847_c1 | |||
| 4439 | nmdc:mga0k408_369265_c1 | |||
| 4440 | nmdc:mga0k408_371103_c1 | |||
| 4441 | nmdc:mga0k408_37772_c1 | |||
| 4442 | nmdc:mga0k408_38238_c2 | |||
| 4443 | nmdc:mga0k408_428840_c1 | |||
| 4444 | nmdc:mga0k408_431_c1 | |||
| 4445 | nmdc:mga0k408_446061_c1 | |||
| 4446 | nmdc:mga0k408_6723_c1 | |||
| 4447 | nmdc:mga0k408_73412_c1 | |||
| 4448 | nmdc:mga0k408_85145_c1 | |||
| 4449 | nmdc:mga0k408_922826_c1 | |||
| 4450 | nmdc:mga0k408_98343_c1 | |||
| 4451 | nmdc:mga06z11_10830_c1 | |||
| 4452 | nmdc:mga06z11_150164_c1 | |||
| 4453 | nmdc:mga06z11_150172_c1 | |||
| 4454 | nmdc:mga06z11_15291_c1 | |||
| 4455 | nmdc:mga06z11_161766_c1 | |||
| 4456 | nmdc:mga06z11_524843_c1 | |||
| 4457 | nmdc:mga06z11_617420_c1 | |||
| 4458 | nmdc:mga06z11_783752_c1 | |||
| 4459 | nmdc:mga04h51_165110_c1 | |||
| 4460 | nmdc:mga04h51_183773_c1 | |||
| 4461 | nmdc:mga04h51_486730_c1 | |||
| 4462 | nmdc:mga04h51_50859_c1 | |||
| 4463 | nmdc:mga04h51_55031_c1 | |||
| 4464 | nmdc:mga07m45_134161_c1 | |||
| 4465 | nmdc:mga07m45_142225_c1 | |||
| 4466 | nmdc:mga07m45_143054_c1 | |||
| 4467 | nmdc:mga07m45_1476_c1 | |||
| 4468 | nmdc:mga07m45_15079_c1 | |||
| 4469 | nmdc:mga07m45_172943_c1 | |||
| 4470 | nmdc:mga07m45_185_c2 | |||
| 4471 | nmdc:mga07m45_188626_c1 | |||
| 4472 | nmdc:mga07m45_235204_c1 | |||
| 4473 | nmdc:mga07m45_33735_c1 | |||
| 4474 | nmdc:mga07m45_4156_c1 | |||
| 4475 | nmdc:mga07m45_42688_c1 | |||
| 4476 | nmdc:mga07m45_456517_c1 | |||
| 4477 | nmdc:mga07m45_47374_c1 | |||
| 4478 | nmdc:mga07m45_51524_c1 | |||
| 4479 | nmdc:mga07m45_57467_c1 | |||
| 4480 | nmdc:mga07m45_63097_c1 | |||
| 4481 | nmdc:mga07m45_63_c1 | |||
| 4482 | nmdc:mga07m45_765786_c1 | |||
| 4483 | nmdc:mga07m45_8991_c1 | |||
| 4484 | nmdc:mga07m45_89_c1 | |||
| 4485 | nmdc:mga05p37_224604_c1 | |||
| 4486 | nmdc:mga0qj67_513127_c1 | |||
| 4487 | nmdc:mga08y16_1118147_c1 | |||
| 4488 | nmdc:mga08y16_1203545_c1 | |||
| 4489 | nmdc:mga0rr50_1478700_c1 | |||
| 4490 | nmdc:mga0a205_1567267_c1 | |||
| 4491 | nmdc:mga0sz30_255183_c1 | |||
| 4492 | nmdc:mga0sz30_5833_c1 | |||
| 4493 | nmdc:mga0sz30_71021_c1 | |||
| 4494 | Ga0495601_0019173 | |||
| 4495 | Ga0500610_0013258 | |||
| 4496 | Ga0500635_0000141 | |||
| 4497 | Ga0500635_0174722 | |||
| 4498 | Ga0495595_0027263 | |||
| 4499 | Ga0495619_0305846 | |||
| 4500 | Ga0500578_0012415 | |||
| 4501 | Ga0500578_0014379 | |||
| 4502 | Ga0500578_0269994 | |||
| 4503 | Ga0500578_0332177 | |||
| 4504 | Ga0500643_010889 | |||
| 4505 | Ga0500643_059800 | |||
| 4506 | Ga0500644_0068624 | |||
| 4507 | Ga0500644_0203105 | |||
| 4508 | Ga0500581_347294 | |||
| 4509 | Ga0500646_0023313 | |||
| 4510 | Ga0500651_0000430 | |||
| 4511 | Ga0500651_0040824 | |||
| 4512 | Ga0500651_0062864 | |||
| 4513 | Ga0500651_0071886 | |||
| 4514 | Ga0500641_0051443 | |||
| 4515 | Ga0500641_0121902 | |||
| 4516 | Ga0500650_0137949 | |||
| 4517 | Ga0500562_013680 | |||
| 4518 | Ga0500562_033286 | |||
| 4519 | Ga0500571_000252 | |||
| 4520 | Ga0500593_000652 | |||
| 4521 | Ga0500594_0001047 | |||
| 4522 | Ga0500594_0007268 | |||
| 4523 | Ga0500595_084247 | |||
| 4524 | Ga0500607_001874 | |||
| 4525 | Ga0500608_003111 | |||
| 4526 | Ga0500608_336011 | |||
| 4527 | Ga0500614_143450 | |||
| 4528 | Ga0500618_006166 | |||
| 4529 | Ga0500626_170970 | |||
| 4530 | Ga0500628_001978 | |||
| 4531 | Ga0500642_0003789 | |||
| 4532 | Ga0500642_0343800 | |||
| 4533 | Ga0500652_000307 | |||
| 4534 | Ga0500652_051518 | |||
| 4535 | Ga0500658_0000352 | |||
| 4536 | Ga0500658_0003377 | |||
| 4537 | Ga0500559_0000191 | |||
| 4538 | Ga0500559_0021313 | |||
| 4539 | Ga0500559_0169647 | |||
| 4540 | Ga0500559_0400613 | |||
| 4541 | Ga0500568_0008116 | |||
| 4542 | Ga0500568_0010712 | |||
| 4543 | Ga0500568_0013994 | |||
| 4544 | Ga0500568_0023355 | |||
| 4545 | Ga0500577_0056692 | |||
| 4546 | Ga0500586_272474 | |||
| 4547 | Ga0500600_0004796 | |||
| 4548 | Ga0500604_0005077 | |||
| 4549 | Ga0500616_0079455 | |||
| 4550 | Ga0500619_001373 | |||
| 4551 | Ga0500622_0000160 | |||
| 4552 | Ga0500622_0001454 | |||
| 4553 | Ga0500622_0002916 | |||
| 4554 | Ga0500622_0049393 | |||
| 4555 | Ga0500627_0082231 | |||
| 4556 | Ga0500627_0228641 | |||
| 4557 | Ga0500627_0393109 | |||
| 4558 | Ga0500634_0002470 | |||
| 4559 | Ga0500638_003518 | |||
| 4560 | Ga0500636_0000056 | |||
| 4561 | Ga0500636_0021960 | |||
| 4562 | Ga0500636_0176766 | |||
| 4563 | Ga0500637_0082707 | |||
| 4564 | Ga0500625_159704 | |||
| 4565 | Ga0500645_006616 | |||
| 4566 | Ga0500645_130547 | |||
| 4567 | Ga0590071_000819 | |||
| 4568 | Ga0590074_014194 | |||
| 4569 | Ga0590077_094099 | |||
| 4570 | Ga0587107_039858 | |||
| 4571 | Ga0466962_0023883 | |||
| 4572 | Ga0466962_0174104 | |||
| 4573 | Ga0466962_0613120 | |||
| 4574 | 2501072656 | |||
| 4575 | 2501080514 | |||
| 4576 | 2501410538 | |||
| 4577 | 2509129719 | |||
| 4578 | 2510251509 | |||
| 4579 | 2511087025 | |||
| 4580 | 2511096994 | |||
| 4581 | 2511103804 | |||
| 4582 | 2512345533 | |||
| 4583 | 2513226638 | |||
| 4584 | 2513960104 | |||
| 4585 | 2514048883 | |||
| 4586 | 2515680819 | |||
| 4587 | 2515690698 | |||
| 4588 | 2516019471 | |||
| 4589 | 2519459173 | |||
| 4590 | 2527075488 | |||
| 4591 | 2547372534 | |||
| 4592 | 2555260046 | |||
| 4593 | 2563058828 | |||
| 4594 | 2585290247 | |||
| 4595 | 2587730421 | |||
| 4596 | 2587733182 | |||
| 4597 | 2587755893 | |||
| 4598 | 2588294396 | |||
| 4599 | 2599412563 | |||
| 4600 | 2599624963 | |||
| 4601 | 2599672975 | |||
| 4602 | 2599682575 | |||
| 4603 | 2599694583 | |||
| 4604 | 2599736774 | |||
| 4605 | 2599744846 | |||
| 4606 | 2599905002 | |||
| 4607 | 2600205790 | |||
| 4608 | 2600812107 | |||
| 4609 | 2601524089 | |||
| 4610 | 2601529243 | |||
| 4611 | 2601616077 | |||
| 4612 | 2601620802 | |||
| 4613 | 2601644144 | |||
| 4614 | 2601649199 | |||
| 4615 | 2601654126 | |||
| 4616 | 2601659548 | |||
| 4617 | 2601663969 | |||
| 4618 | 2601696926 | |||
| 4619 | 2601701975 | |||
| 4620 | 2601706870 | |||
| 4621 | 2601712179 | |||
| 4622 | 2601717387 | |||
| 4623 | 2601722345 | |||
| 4624 | 2601727315 | |||
| 4625 | 2601732620 | |||
| 4626 | 2601736865 | |||
| 4627 | 2601743192 | |||
| 4628 | 2601753986 | |||
| 4629 | 2602021080 | |||
| 4630 | 2603662127 | |||
| 4631 | 2603667026 | |||
| 4632 | 2603839739 | |||
| 4633 | 2603844813 | |||
| 4634 | 2603850180 | |||
| 4635 | 2603854956 | |||
| 4636 | 2603867704 | |||
| 4637 | 2603872532 | |||
| 4638 | 2603877838 | |||
| 4639 | 2606050009 | |||
| 4640 | 2606071669 | |||
| 4641 | 2606147400 | |||
| 4642 | 2606177899 | |||
| 4643 | 2609909418 | |||
| 4644 | 2637223893 | |||
| 4645 | 2643860359 | |||
| 4646 | 2643968983 | |||
| 4647 | 2643979418 | |||
| 4648 | 2644119906 | |||
| 4649 | 2644144114 | |||
| 4650 | 2644159347 | |||
| 4651 | 2644249093 | |||
| 4652 | 2644273234 | |||
| 4653 | 2644304328 | |||
| 4654 | 2644329274 | |||
| 4655 | 2644337319 | |||
| 4656 | 2644401147 | |||
| 4657 | 2676405306 | |||
| 4658 | 2676742975 | |||
| 4659 | 2707099697 | |||
| 4660 | 2713476518 | |||
| 4661 | 2719640623 | |||
| 4662 | 2723878533 | |||
| 4663 | 2735818211 | |||
| 4664 | 2738717409 | |||
| 4665 | 2738818678 | |||
| 4666 | 2738831165 | |||
| 4667 | 2738872693 | |||
| 4668 | 2738879013 | |||
| 4669 | 2739184323 | |||
| 4670 | 2739219292 | |||
| 4671 | 2739248803 | |||
| 4672 | 2739278095 | |||
| 4673 | 2739612878 | |||
| 4674 | 2746088695 | |||
| 4675 | 2746097364 | |||
| 4676 | 2753571427 | |||
| 4677 | 2777023209 | |||
| 4678 | 2791922655 | |||
| 4679 | 2792836075 | |||
| 4680 | 2808972722 | |||
| 4681 | 2809007704 | |||
| 4682 | 2809014756 | |||
| 4683 | 2809035689 | |||
| 4684 | 2817261462 | |||
| 4685 | 2817279148 | |||
| 4686 | 2817456252 | |||
| 4687 | 2819596917 | |||
| 4688 | 2819619972 | |||
| 4689 | 2819631298 | |||
| 4690 | 2831266000 | |||
| 4691 | 2831870061 | |||
| 4692 | 2834641800 | |||
| 4693 | 2838057871 | |||
| 4694 | 2842328626 | |||
| 4695 | 2842352942 | |||
| 4696 | 2842458713 | |||
| 4697 | 2842681050 | |||
| 4698 | 2843694552 | |||
| 4699 | 2846542812 | |||
| 4700 | 2852107325 | |||
| 4701 | 2854602836 | |||
| 4702 | 2857539036 | |||
| 4703 | 2857546976 | |||
| 4704 | 2858956146 | |||
| 4705 | 2863427387 | |||
| 4706 | 2870070855 | |||
| 4707 | 2881414910 | |||
| 4708 | 2881715984 | |||
| 4709 | 2881928151 | |||
| 4710 | 2883093065 | |||
| 4711 | 2884087641 | |||
| 4712 | 2885197427 | |||
| 4713 | 2885203659 | |||
| 4714 | 2885216991 | |||
| 4715 | 2885272977 | |||
| 4716 | 2886849521 | |||
| 4717 | 2895516583 | |||
| 4718 | 2899930341 | |||
| 4719 | 2900053258 | |||
| 4720 | 2900634255 | |||
| 4721 | 2902683727 | |||
| 4722 | 2904438014 | |||
| 4723 | 2904455129 | |||
| 4724 | 2904457545 | |||
| 4725 | 2904480507 | |||
| 4726 | 2904484565 | |||
| 4727 | 2904517859 | |||
| 4728 | 2904543703 | |||
| 4729 | 2904570006 | |||
| 4730 | 2904576083 | |||
| 4731 | 2904624210 | |||
| 4732 | 2919111170 | |||
| 4733 | 2919466901 | |||
| 4734 | 2919531471 | |||
| 4735 | 2919704690 | |||
| 4736 | 2921652672 | |||
| 4737 | 2928039454 | |||
| 4738 | 2928044941 | |||
| 4739 | 2928052742 | |||
| 4740 | 2928064584 | |||
| 4741 | 2928075000 | |||
| 4742 | 2928088181 | |||
| 4743 | 2928110535 | |||
| 4744 | 2928116402 | |||
| 4745 | 2928140051 | |||
| 4746 | 2928171570 | |||
| 4747 | 2928505543 | |||
| 4748 | 2928542570 | |||
| 4749 | 2929162745 | |||
| 4750 | 2929527410 | |||
| 4751 | 2935625487 | |||
| 4752 | 2939570200 | |||
| 4753 | 2939618774 | |||
| 4754 | 2939631728 | |||
| 4755 | 2939642757 | |||
| 4756 | 2941485628 | |||
| 4757 | 2945876552 | |||
| 4758 | 2945911258 | |||
| 4759 | 2945937378 | |||
| 4760 | 2945947273 | |||
| 4761 | 2945977706 | |||
| 4762 | 2945986454 | |||
| 4763 | 2954772688 | |||
| 4764 | 2969080905 | |||
| 4765 | 2971822304 | |||
| 4766 | 2974439579 | |||
| 4767 | 2984563367 | |||
| 4768 | 2984596101 | |||
| 4769 | 2990705928 | |||
| 4770 | 2998345739 | |||
| 4771 | 3000378162 | |||
| 4772 | 642425583 | |||
| 4773 | 642418902 | |||
| 4774 | 642593236 | |||
| 4775 | 642622133 | |||
| 4776 | 8018846959 | |||
| 4777 | 8019504888 | |||
| 4778 | 8020813612 | |||
| 4779 | 8020944920 | |||
| 4780 | 8020945497 | |||
| 4781 | 8020957043 | |||
| 4782 | 8021122099 | |||
| 4783 | 8039102598 | |||
| 4784 | 8040172810 | |||
| 4785 | 8040173719 | |||
| 4786 | 8055228235 | |||
| 4787 | 8055268962 | |||
| 4788 | 8055302054 | |||
| 4789 | 8055694809 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1i7h-assembly3.cif.gz_C | crystal sturcuture of fdx | 0.9753 | 2 | 108 |
| 1i7h-assembly3.cif.gz_C | crystal sturcuture of fdx | 0.9577 | 2 | 108 |
| 3ah7-assembly1.cif.gz_A-2 | crystal structure of the isc-like [2fe-2s] ferredoxin (fdxb) from pseudomonas putida jcm 20004 | 0.9543 | 1 | 107 |
| 3ah7-assembly1.cif.gz_A-2 | crystal structure of the isc-like [2fe-2s] ferredoxin (fdxb) from pseudomonas putida jcm 20004 | 0.9292 | 1 | 107 |
| 3n9y-assembly1.cif.gz_C | crystal structure of human cyp11a1 in complex with cholesterol | 0.8668 | 26 | 89 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1i7hA00 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9679 | 2 | 110 | 3.10.20.30 |
| 1i7hA00 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9593 | 2 | 110 | 3.10.20.30 |
| af_Q9CPW2_55_168_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.867 | 2 | 107 | 3.10.20.30 |
| af_A4I756_34_144_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.8637 | 2 | 104 | 3.10.20.30 |
| 4ltuB00 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.8604 | 2 | 104 | 3.10.20.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6L9CCH0-F1-model_v4 | deleted | 0.9842 | 1 | 91 |
|
| AF-Q89A15-F1-model_v4 | 2Fe-2S ferredoxin | 0.9767 | 1 | 107 |
GO:0005829
GO:0009055 GO:0046872 GO:0051537 GO:0140647 |
| AF-A0A6L5CA48-F1-model_v4 | deleted | 0.9763 | 45 | 101 |
|
| AF-A0A6L9CCH0-F1-model_v4 | deleted | 0.9736 | 1 | 91 |
|
| AF-A0A455TAU1-F1-model_v4 | 2Fe-2S ferredoxin | 0.9729 | 1 | 107 |
GO:0005829
GO:0009055 GO:0051537 GO:0140647 |