F496772

General Info

Members Datasets Scaffolds Average Seq Length
2394 848 4789 112

Family's Representative Sequence

Representative Sequence 3300005457|Ga0070662_100019784|Ga0070662_1000197845
Length 128
Sequence MRWRVAASKRFEGIPTVPIIKILPHPEYCPKGATVEAPSGTSICEALLENDIPIEHACEMSCACTTCHVVVREGFNSLGEMDESEEDLLDRAWGLEPNSRLSCQAILSNQDVTIEIPKYSINHAKENH

Samples

Sample ID Description Type Environment
1 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
9 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
10 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
11 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
12 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
13 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
14 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
15 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
16 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
17 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
18 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
19 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
20 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
21 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
22 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
23 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
24 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
25 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
26 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
27 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
28 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
29 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
30 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
31 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
32 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
33 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
34 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
35 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
36 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
37 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
38 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
39 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
40 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
41 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
42 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
43 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
44 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
45 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
46 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
47 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
48 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
49 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
50 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
51 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
52 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
53 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
54 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
55 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
56 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
57 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
58 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
59 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
60 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
61 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
62 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
63 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
64 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
65 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
66 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
67 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
68 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
69 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
70 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
71 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
72 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
73 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
74 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
75 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
76 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
77 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
78 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
79 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
80 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
81 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
82 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
83 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
84 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
85 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
86 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
87 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
88 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
89 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
90 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
91 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
92 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
93 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
94 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
95 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
96 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
97 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
98 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
99 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
100 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
101 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
102 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
103 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
104 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
105 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
106 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
107 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
108 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
109 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
110 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
111 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
112 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
113 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
114 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
115 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
116 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
117 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
118 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
119 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
120 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
121 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
122 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
123 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
124 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
125 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
126 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
127 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
128 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
129 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
130 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
131 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
132 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
133 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
134 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
135 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
136 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
137 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
138 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
139 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
140 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
141 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
142 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
143 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
144 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
145 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
146 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
147 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
148 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
149 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
150 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
151 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
152 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
153 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
154 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
155 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
156 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
157 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
158 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
159 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
160 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
161 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
162 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
163 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
164 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
165 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
166 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
167 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
168 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
169 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
170 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
171 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
172 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
173 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
174 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
175 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
177 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
183 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
184 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
185 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
186 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
187 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
188 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
189 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
190 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
191 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
192 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
193 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
194 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
195 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
196 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
197 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
198 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
199 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
200 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
201 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
202 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
203 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
268 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
269 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
270 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
271 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
272 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
273 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
274 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
275 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
276 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
277 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
278 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
279 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
280 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
282 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
283 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
284 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
285 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
286 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
287 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
288 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
289 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
290 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
291 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
292 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
293 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
294 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
295 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
296 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
297 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
298 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
299 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
300 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
301 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
302 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
303 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
304 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
305 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
306 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
307 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
308 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
309 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
310 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
311 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
312 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
313 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
314 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
315 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
316 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
317 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
318 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
319 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
320 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
321 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
322 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
323 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
324 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
325 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
326 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
327 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
328 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
329 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
330 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
331 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
332 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
333 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
334 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
335 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
336 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
337 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
338 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
339 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
340 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
341 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
342 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
343 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
344 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
345 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
346 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
347 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
348 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
349 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
350 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
351 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
352 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
353 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
354 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
355 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
356 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
357 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
358 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
359 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
360 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
361 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
362 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
363 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
364 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
365 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
366 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
367 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
368 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
369 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
370 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
371 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
372 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
373 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
374 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
375 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
376 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
377 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
378 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
379 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
380 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
381 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
382 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
383 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
384 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
385 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
386 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
387 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
388 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
389 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
390 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
391 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
392 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
393 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
394 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
395 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
396 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
397 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
398 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
399 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
400 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
401 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
402 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
403 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
404 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
405 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
406 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
407 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
408 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
409 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
410 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
411 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
412 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
413 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
414 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
415 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
416 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
417 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
418 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
419 3300044668 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3E2 Metagenome Unclassified
420 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
421 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
422 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
423 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
424 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
425 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
426 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
427 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
428 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
429 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
430 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
431 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
432 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
433 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
434 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
435 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
436 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
437 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
438 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
439 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
440 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
441 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
442 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
443 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
444 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
445 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
446 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
447 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
448 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
449 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
450 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
451 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
452 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
453 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
454 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
455 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
456 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
457 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
458 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
459 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
460 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
461 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
462 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
463 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
464 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
465 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
466 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
467 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
468 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
469 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
470 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
471 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
472 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
473 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
474 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
475 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
476 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
477 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
478 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
479 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
480 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
481 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
482 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
483 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
484 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
485 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
486 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
487 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
488 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
489 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
490 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
491 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
492 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
493 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
494 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
495 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
496 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
497 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
498 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
499 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
500 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
501 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
502 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
503 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
504 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
505 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
506 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
507 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
508 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
509 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
510 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
511 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
512 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
513 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
514 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
515 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
516 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
517 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
518 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
519 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
520 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
521 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
522 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
523 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
524 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
525 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
526 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
527 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
528 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
529 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
530 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
531 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
532 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
533 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
534 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
535 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
536 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
537 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
538 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
539 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
540 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
541 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
542 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
543 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
544 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
545 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
546 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
547 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
548 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
549 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
550 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
551 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
552 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
553 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
554 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
555 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
556 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
557 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
558 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
559 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
560 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
561 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
562 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
563 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
564 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
565 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
566 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
567 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
568 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
569 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
570 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
571 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
572 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
573 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
574 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
575 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
576 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
577 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
578 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
579 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
580 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
581 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
582 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
583 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
584 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
585 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
586 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
587 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
588 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
589 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
590 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
591 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
592 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
593 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
594 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
595 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
596 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
597 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
598 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
599 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
600 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
601 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
602 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
603 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
604 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
605 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
606 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
607 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
608 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
609 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
610 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
611 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
612 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
613 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
614 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
615 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
616 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
617 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
618 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
619 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
620 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
621 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
622 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
623 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
624 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
625 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
626 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
627 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
628 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
629 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
630 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
631 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
632 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
633 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
634 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
635 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
636 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
637 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
638 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
639 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
640 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
641 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
642 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
643 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
644 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
645 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
646 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
647 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
648 2519103095 Burkholderia sp. KJ006 Isolate Nodule
649 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
650 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
651 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
652 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
653 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
654 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
655 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
656 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
657 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
658 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
659 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
660 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
661 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
662 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
663 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
664 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
665 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
666 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
667 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
668 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
669 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
670 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
671 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
672 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
673 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
674 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
675 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
676 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
677 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
678 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
679 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
680 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
681 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
682 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
683 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
684 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
685 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
686 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
687 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
688 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
689 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
690 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
691 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
692 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
693 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
694 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
695 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
696 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
697 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
698 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
699 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
700 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
701 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
702 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
703 2636415599 Klebsiella variicola DX120E Isolate Unclassified
704 2643221569 Achromobacter sp. Root565 Isolate Unclassified
705 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
706 2643221594 Achromobacter sp. Root170 Isolate Unclassified
707 2643221621 Achromobacter sp. Root83 Isolate Unclassified
708 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
709 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
710 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
711 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
712 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
713 2643221658 Variovorax sp. Root411 Isolate Unclassified
714 2643221660 Methylibium sp. Root1272 Isolate Unclassified
715 2643221672 Variovorax sp. Root434 Isolate Unclassified
716 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
717 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
718 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
719 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
720 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
721 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
722 2734482258 Glomeribacter sp. phylotype 3 Isolate Unclassified
723 2738541277 Variovorax sp. GV051 Isolate Unclassified
724 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
725 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
726 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
727 2738541307 Variovorax sp. GV008 Isolate Unclassified
728 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
729 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
730 2738543013 Variovorax sp. BT01 Isolate Unclassified
731 2738543019 Variovorax sp. GV040 Isolate Unclassified
732 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
733 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
734 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
735 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
736 2775507074 Klebsiella sp. D5A Isolate Unclassified
737 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
738 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
739 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
740 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
741 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
742 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
743 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
744 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
745 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
746 2818991446 Variovorax sp. 1180 Isolate Unclassified
747 2818991450 Burkholderia sp. 604 Isolate Unclassified
748 2818991452 Burkholderia cepacia 561 Isolate Unclassified
749 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
750 2831864461 Roseateles noduli HZ7 Isolate Nodule
751 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
752 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
753 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
754 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
755 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
756 2842677519 Variovorax sp. R-72495 Isolate Unclassified
757 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
758 2846540461 Photorhabdus luminescens HIM3 Isolate Rhizosphere
759 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
760 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
761 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
762 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
763 2858950400 Achromobacter sp. K91 Isolate Unclassified
764 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
765 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
766 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
767 2881714928 Pseudidiomarina mangrovi ZQ330 Isolate Rhizosphere
768 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
769 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
770 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
771 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
772 2885198086 Variovorax sp. 679 Isolate Unclassified
773 2885211737 Variovorax sp. 553 Isolate Unclassified
774 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
775 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
776 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
777 2899924645 Variovorax sp. 369 Isolate Unclassified
778 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
779 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
780 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
781 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
782 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
783 2904456579 Variovorax sp. 2002 Isolate Unclassified
784 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
785 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
786 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
787 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
788 2904564687 Burkholderia sp. 571 Isolate Unclassified
789 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
790 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
791 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
792 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
793 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
794 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
795 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
796 2928037797 Variovorax sp. 1126 Isolate Unclassified
797 2928044640 Variovorax sp. 1128 Isolate Unclassified
798 2928051484 Variovorax sp. 1133 Isolate Unclassified
799 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
800 2928070936 Variovorax gossypii 1167 Isolate Unclassified
801 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
802 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
803 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
804 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
805 2928170801 Burkholderia sp. 572 Isolate Unclassified
806 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
807 2928536128 Burkholderia sola 565 Isolate Unclassified
808 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
809 2929520902 Variovorax beijingensis 502 Isolate Unclassified
810 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
811 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
812 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
813 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
814 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
815 2941479691
816 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
817 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
818 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
819 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
820 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
821 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
822 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
823 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
824 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
825 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
826 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
827 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
828 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
829 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
830 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
831 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
832 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
833 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
834 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
835 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
836 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
837 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
838 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
839 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
840 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
841 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
842 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
843 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
844 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
845 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere
846 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
847 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule
848 8055693939 Hafnia alvei A23BA Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.56
Metatranscriptomes 0.42
Isolates 9.02

Biome Distribution

Category Percentage (%)
Aerial Root 0.08
Bulb 0
Endosphere 19.05
Nodule 1
Rhizoplane 5.1
Rhizosphere 63.58
Stem 0
Stem Tuber 0.08
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070662_100019784 3300005457 Bacteria 4577
2 SwRhRL2b_contig_1415115 2162886007 Bacteria 1282
3 JGI24740J21852_10005200 3300001979 Bacteria 5524
4 JGI24739J22299_10033552 3300001989 Bacteria 1755
5 JGI24739J22299_10040520 3300001989 Bacteria 1554
6 JGI24737J22298_10022183 3300001990 Bacteria 2017
7 JGI24735J21928_10043643 3300002067 Bacteria 1303
8 JGI24744J21845_10047460 3300002077 Bacteria 795
9 JGI25156J39149_1000200 3300002705 Bacteria 41286
10 JGI25156J39149_1001430 3300002705 Bacteria 10139
11 JGI25156J39149_1004572 3300002705 Bacteria 4182
12 JGI25156J39149_1007679 3300002705 Bacteria 2799
13 JGI25156J39149_1020932 3300002705 Bacteria 1139
14 JGI25154J39366_1000288 3300002738 Bacteria 30264
15 JGI25154J39366_1000649 3300002738 Bacteria 16270
16 JGI25157J39369_1000095 3300002741 Bacteria 74770
17 JGI25152J39213_1001922 3300002773 Bacteria 8286
18 JGI25152J39213_1004308 3300002773 Bacteria 4530
19 JGI25150J39212_1027828 3300002774 Bacteria 806
20 JGI25159J45721_1010035 3300002987 Bacteria 2447
21 JGI25159J45721_1010105 3300002987 Bacteria 2433
22 JGI25151J46595_10000262 3300003187 Bacteria 61170
23 JGI25151J46595_10001813 3300003187 Bacteria 13787
24 JGI25151J46595_10023911 3300003187 Bacteria 2508
25 JGI25151J46595_10030757 3300003187 Bacteria 2107
26 JGI25153J46596_10001361 3300003215 Bacteria 14627
27 JGI25153J46596_10020746 3300003215 Bacteria 2474
28 rootH1_10061749 3300003316 Bacteria 1861
29 rootH2_10002329 3300003320 Bacteria 1251
30 rootH2_10166799 3300003320 Bacteria 1243
31 rootL2_10000441 3300003322 Bacteria 16020
32 rootL2_10237090 3300003322 Bacteria 2024
33 rootH1_10049462 3300003316 Bacteria 3729
34 rootH1_10049462 3300003323 Bacteria 1783
35 rootH1_10068787 3300003323 Bacteria 2523
36 JGI26128J50194_1001209 3300003347 Bacteria 1609
37 Ga0006562J51391_1061692 3300003578 Bacteria 950
38 Ga0055538_1004535 3300003751 Bacteria 1562
39 Ga0055539_1000688 3300003752 Bacteria 8766
40 Ga0055539_1001465 3300003752 Bacteria 4360
41 Ga0055539_1014267 3300003752 Bacteria 970
42 Ga0055533_1000100 3300003756 Bacteria 111692
43 Ga0055533_1006422 3300003756 Bacteria 1735
44 Ga0055532_1002241 3300003758 Bacteria 4232
45 Ga0055532_1003811 3300003758 Bacteria 2445
46 Ga0055525_1000011 3300003759 Bacteria 503124
47 Ga0055525_1001558 3300003759 Bacteria 3787
48 Ga0055535_1001571 3300003761 Bacteria 11046
49 Ga0055535_1001668 3300003761 Bacteria 10206
50 Ga0055542_1000027 3300003762 Bacteria 254819
51 Ga0055542_1002307 3300003762 Bacteria 6568
52 Ga0055529_1001099 3300003763 Bacteria 12159
53 Ga0055529_1001608 3300003763 Bacteria 6106
54 Ga0055526_1005479 3300003771 Bacteria 7286
55 Ga0055526_1013218 3300003771 Bacteria 3512
56 Ga0055537_1000193 3300003773 Bacteria 45640
57 Ga0055524_1002870 3300003775 Bacteria 8638
58 Ga0055524_1015745 3300003775 Bacteria 2744
59 Ga0055536_1000726 3300003781 Bacteria 22133
60 Ga0055536_1003097 3300003781 Bacteria 9048
61 Ga0055536_1007352 3300003781 Bacteria 4949
62 Ga0055536_1015208 3300003781 Bacteria 2648
63 Ga0055536_1048677 3300003781 Bacteria 946
64 Ga0055534_1000186 3300003784 Bacteria 45640
65 Ga0055534_1002158 3300003784 Bacteria 7033
66 Ga0055534_1023929 3300003784 Bacteria 995
67 Ga0055528_1073688 3300003790 Bacteria 612
68 Ga0055530_10000754 3300003791 Bacteria 26927
69 Ga0055530_10008221 3300003791 Bacteria 4219
70 Ga0055530_10030912 3300003791 Bacteria 1412
71 Ga0055530_10073206 3300003791 Bacteria 734
72 Ga0055540_1002266 3300003792 Bacteria 10370
73 Ga0055540_1002894 3300003792 Bacteria 8695
74 Ga0055540_1004211 3300003792 Bacteria 6608
75 Ga0055540_1005185 3300003792 Bacteria 5590
76 Ga0055540_1010868 3300003792 Bacteria 2993
77 Ga0055531_10000985 3300003794 Bacteria 22675
78 Ga0055531_10002017 3300003794 Bacteria 14071
79 Ga0055531_10013088 3300003794 Bacteria 3851
80 Ga0055531_10054307 3300003794 Bacteria 1028
81 Ga0055531_10065267 3300003794 Bacteria 866
82 Ga0055541_1000908 3300003841 Bacteria 7082
83 Ga0065165_1000613 3300005262 Bacteria 51836
84 Ga0065165_1055167 3300005262 Bacteria 1110
85 Ga0065714_10078829 3300005288 Bacteria 2558
86 Ga0065714_10187930 3300005288 Bacteria 930
87 Ga0065704_10079876 3300005289 Bacteria 4051
88 Ga0065704_10094721 3300005289 Bacteria 2528
89 Ga0065704_10315903 3300005289 Bacteria 861
90 Ga0065712_10111357 3300005290 Bacteria 1819
91 Ga0065715_10214645 3300005293 Bacteria 1298
92 Ga0065715_10427078 3300005293 Bacteria 851
93 Ga0065715_10978353 3300005293 Bacteria 551
94 Ga0065707_10081939 3300005295 Bacteria 28637
95 Ga0070658_10028554 3300005327 Bacteria 4480
96 Ga0070658_10607777 3300005327 Bacteria 948
97 Ga0070658_11588604 3300005327 Bacteria 567
98 Ga0070676_10023135 3300005328 Bacteria 3491
99 Ga0070676_10024406 3300005328 Bacteria 3406
100 Ga0070676_10062029 3300005328 Bacteria 2223
101 Ga0070676_10137992 3300005328 Bacteria 1549
102 Ga0070676_10199487 3300005328 Bacteria 1311
103 Ga0070676_11612860 3300005328 Bacteria 502
104 Ga0070683_100007089 3300005329 Bacteria 9442
105 Ga0070683_100161279 3300005329 Bacteria 2127
106 Ga0070690_100558986 3300005330 Bacteria 863
107 Ga0070690_101013982 3300005330 Bacteria 654
108 Ga0070690_101151193 3300005330 Bacteria 617
109 Ga0070670_100001125 3300005331 Bacteria 21269
110 Ga0070670_100046529 3300005331 Bacteria 3731
111 Ga0070670_100096992 3300005331 Bacteria 2536
112 Ga0070670_100454984 3300005331 Bacteria 1135
113 Ga0070670_100472434 3300005331 Bacteria 1113
114 Ga0070677_10004970 3300005333 Bacteria 4368
115 Ga0070677_10053445 3300005333 Bacteria 1642
116 Ga0070677_10106704 3300005333 Bacteria 1244
117 Ga0070677_10469173 3300005333 Bacteria 677
118 Ga0068869_100001634 3300005334 Bacteria 13365
119 Ga0068869_100011402 3300005334 Bacteria 5828
120 Ga0068869_100186279 3300005334 Bacteria 1630
121 Ga0068869_100186727 3300005334 Bacteria 1628
122 Ga0070666_10027432 3300005335 Bacteria 3730
123 Ga0070666_10385928 3300005335 Bacteria 1006
124 Ga0070680_100096787 3300005336 Bacteria 2447
125 Ga0070680_100200062 3300005336 Bacteria 1685
126 Ga0070682_100287160 3300005337 Bacteria 1202
127 Ga0070682_100362998 3300005337 Bacteria 1084
128 Ga0068868_100006467 3300005338 Bacteria 8293
129 Ga0068868_100007731 3300005338 Bacteria 7671
130 Ga0068868_100025309 3300005338 Bacteria 4513
131 Ga0068868_100065185 3300005338 Bacteria 2893
132 Ga0068868_100118510 3300005338 Bacteria 2158
133 Ga0068868_101187791 3300005338 Bacteria 705
134 Ga0068868_101773706 3300005338 Bacteria 583
135 Ga0070660_100057666 3300005339 Bacteria 3009
136 Ga0070660_100060030 3300005339 Bacteria 2950
137 Ga0070660_100064464 3300005339 Bacteria 2850
138 Ga0070660_100084433 3300005339 Bacteria 2496
139 Ga0070660_100100400 3300005339 Bacteria 2292
140 Ga0070660_100421144 3300005339 Bacteria 1106
141 Ga0070660_100487769 3300005339 Bacteria 1024
142 Ga0070689_100051808 3300005340 Bacteria 3173
143 Ga0070689_101720046 3300005340 Bacteria 571
144 Ga0070691_10511035 3300005341 Bacteria 696
145 Ga0070691_10702540 3300005341 Bacteria 607
146 Ga0070687_100030647 3300005343 Bacteria 2631
147 Ga0070687_100101179 3300005343 Bacteria 1614
148 Ga0070661_100006518 3300005344 Bacteria 8054
149 Ga0070661_100048491 3300005344 Bacteria 3109
150 Ga0070661_100171509 3300005344 Bacteria 1647
151 Ga0070668_100181696 3300005347 Bacteria 1718
152 Ga0070668_100317949 3300005347 Bacteria 1310
153 Ga0070668_100685438 3300005347 Bacteria 903
154 Ga0070668_100787852 3300005347 Bacteria 844
155 Ga0070669_100021660 3300005353 Bacteria 4593
156 Ga0070669_100094234 3300005353 Bacteria 2250
157 Ga0070669_100160968 3300005353 Bacteria 1744
158 Ga0070669_100256084 3300005353 Bacteria 1395
159 Ga0070669_100256428 3300005353 Bacteria 1394
160 Ga0070669_100521925 3300005353 Bacteria 987
161 Ga0070669_100936393 3300005353 Bacteria 741
162 Ga0070669_101719900 3300005353 Bacteria 547
163 Ga0070675_100000735 3300005354 Bacteria 22835
164 Ga0070675_100004598 3300005354 Bacteria 10540
165 Ga0070675_100015112 3300005354 Bacteria 6098
166 Ga0070675_100207836 3300005354 Bacteria 1701
167 Ga0070675_100693446 3300005354 Bacteria 927
168 Ga0070671_100001944 3300005355 Bacteria 15849
169 Ga0070671_100005456 3300005355 Bacteria 10154
170 Ga0070671_100022352 3300005355 Bacteria 5165
171 Ga0070671_100046866 3300005355 Bacteria 3595
172 Ga0070671_100081043 3300005355 Bacteria 2714
173 Ga0070671_100161322 3300005355 Bacteria 1895
174 Ga0070671_100195282 3300005355 Bacteria 1716
175 Ga0070671_100511880 3300005355 Bacteria 1033
176 Ga0070671_100848462 3300005355 Bacteria 797
177 Ga0070674_100013900 3300005356 Bacteria 4990
178 Ga0070674_100236533 3300005356 Bacteria 1428
179 Ga0070674_100393943 3300005356 Bacteria 1130
180 Ga0070674_100558089 3300005356 Bacteria 962
181 Ga0070674_100572738 3300005356 Bacteria 950
182 Ga0070674_101435039 3300005356 Bacteria 619
183 Ga0070673_100023482 3300005364 Bacteria 4506
184 Ga0070673_100066105 3300005364 Bacteria 2887
185 Ga0070673_100071444 3300005364 Bacteria 2789
186 Ga0070673_100132605 3300005364 Bacteria 2093
187 Ga0070673_100167182 3300005364 Bacteria 1875
188 Ga0070673_101028246 3300005364 Bacteria 768
189 Ga0070673_101089811 3300005364 Bacteria 746
190 Ga0070673_101167683 3300005364 Bacteria 721
191 Ga0070673_101976188 3300005364 Bacteria 553
192 Ga0070688_101394628 3300005365 Bacteria 568
193 Ga0070659_100003967 3300005366 Bacteria 10534
194 Ga0070659_100008273 3300005366 Bacteria 7595
195 Ga0070659_100025101 3300005366 Bacteria 4575
196 Ga0070659_100063404 3300005366 Bacteria 2924
197 Ga0070659_100227135 3300005366 Bacteria 1542
198 Ga0070659_100239306 3300005366 Bacteria 1501
199 Ga0070659_100776578 3300005366 Bacteria 832
200 Ga0070659_100897242 3300005366 Bacteria 774
201 Ga0070659_101989550 3300005366 Bacteria 522
202 Ga0070667_100006642 3300005367 Bacteria 9617
203 Ga0070667_100021358 3300005367 Bacteria 5376
204 Ga0070667_100032736 3300005367 Bacteria 4337
205 Ga0070667_100065683 3300005367 Bacteria 3081
206 Ga0070667_100157606 3300005367 Bacteria 1998
207 Ga0070667_100177885 3300005367 Bacteria 1880
208 Ga0070667_100358733 3300005367 Bacteria 1321
209 Ga0070667_100500355 3300005367 Bacteria 1114
210 Ga0070711_101059401 3300005439 Bacteria 697
211 Ga0070705_101672577 3300005440 Bacteria 537
212 Ga0070700_100009387 3300005441 Bacteria 5367
213 Ga0070694_101409094 3300005444 Bacteria 588
214 Ga0070708_100234856 3300005445 Bacteria 1721
215 Ga0070663_100037434 3300005455 Bacteria 3378
216 Ga0070663_100087596 3300005455 Bacteria 2302
217 Ga0070678_100024742 3300005456 Bacteria 4026
218 Ga0070678_100035395 3300005456 Bacteria 3485
219 Ga0070678_100077032 3300005456 Bacteria 2514
220 Ga0070678_100309688 3300005456 Bacteria 1345
221 Ga0070678_100343197 3300005456 Bacteria 1282
222 Ga0070678_100580319 3300005456 Bacteria 999
223 Ga0070678_101064826 3300005456 Bacteria 745
224 Ga0070678_101213316 3300005456 Bacteria 700
225 Ga0070678_101541364 3300005456 Bacteria 623
226 Ga0070662_100009726 3300005457 Bacteria 6293
227 Ga0070662_100011762 3300005457 Bacteria 5781
228 Ga0070662_100320690 3300005457 Bacteria 1263
229 Ga0070662_100597588 3300005457 Bacteria 928
230 Ga0070662_100649418 3300005457 Bacteria 890
231 Ga0070681_10680870 3300005458 Bacteria 944
232 Ga0070681_11479174 3300005458 Bacteria 604
233 Ga0068867_100000085 3300005459 Bacteria 58473
234 Ga0068867_100004130 3300005459 Bacteria 10199
235 Ga0068867_100008539 3300005459 Bacteria 7229
236 Ga0068867_100013868 3300005459 Bacteria 5705
237 Ga0068867_100105705 3300005459 Bacteria 2155
238 Ga0068867_100115384 3300005459 Bacteria 2068
239 Ga0068867_100197479 3300005459 Bacteria 1609
240 Ga0068867_100322526 3300005459 Bacteria 1280
241 Ga0068867_100575423 3300005459 Bacteria 979
242 Ga0068867_100597927 3300005459 Bacteria 962
243 Ga0070685_10597373 3300005466 Bacteria 794
244 Ga0070706_100000822 3300005467 Bacteria 34270
245 Ga0070706_100156252 3300005467 Bacteria 2129
246 Ga0070707_100631562 3300005468 Bacteria 1034
247 Ga0070707_100926753 3300005468 Bacteria 836
248 Ga0070699_101304060 3300005518 Bacteria 666
249 Ga0070684_100002981 3300005535 Bacteria 12599
250 Ga0070684_100170273 3300005535 Bacteria 1978
251 Ga0070684_100300695 3300005535 Bacteria 1472
252 Ga0068853_100057775 3300005539 Bacteria 3349
253 Ga0068853_100149756 3300005539 Bacteria 2100
254 Ga0068853_100157572 3300005539 Bacteria 2046
255 Ga0068853_100222162 3300005539 Bacteria 1726
256 Ga0068853_100375749 3300005539 Bacteria 1326
257 Ga0070672_100000244 3300005543 Bacteria 30475
258 Ga0070672_100005577 3300005543 Bacteria 8364
259 Ga0070672_100008576 3300005543 Bacteria 7001
260 Ga0070672_100010686 3300005543 Bacteria 6377
261 Ga0070672_100125840 3300005543 Bacteria 2102
262 Ga0070672_100350090 3300005543 Bacteria 1259
263 Ga0070672_100377133 3300005543 Bacteria 1213
264 Ga0070672_100592457 3300005543 Bacteria 965
265 Ga0070686_100295769 3300005544 Bacteria 1199
266 Ga0070695_100421502 3300005545 Bacteria 1016
267 Ga0070693_100355385 3300005547 Bacteria 1004
268 Ga0070693_100570766 3300005547 Bacteria 813
269 Ga0070665_100006131 3300005548 Bacteria 12289
270 Ga0070665_100107301 3300005548 Bacteria 2795
271 Ga0070665_100225136 3300005548 Bacteria 1876
272 Ga0070665_100573091 3300005548 Bacteria 1142
273 Ga0070665_102492028 3300005548 Bacteria 519
274 Ga0068855_100030205 3300005563 Bacteria 6482
275 Ga0068855_100125071 3300005563 Bacteria 2941
276 Ga0068855_100166273 3300005563 Bacteria 2500
277 Ga0068855_100176007 3300005563 Bacteria 2421
278 Ga0068855_100191710 3300005563 Bacteria 2305
279 Ga0068855_100395419 3300005563 Bacteria 1516
280 Ga0068855_101423419 3300005563 Bacteria 714
281 Ga0068855_101437348 3300005563 Bacteria 710
282 Ga0070664_100021750 3300005564 Bacteria 5289
283 Ga0070664_100037096 3300005564 Bacteria 4096
284 Ga0070664_100050836 3300005564 Bacteria 3509
285 Ga0070664_100179981 3300005564 Bacteria 1879
286 Ga0070664_100319026 3300005564 Bacteria 1407
287 Ga0070664_100451978 3300005564 Bacteria 1180
288 Ga0070664_100552726 3300005564 Bacteria 1064
289 Ga0068857_100018728 3300005577 Bacteria 6076
290 Ga0068857_100045340 3300005577 Bacteria 3900
291 Ga0068857_100115387 3300005577 Bacteria 2415
292 Ga0068857_100426752 3300005577 Bacteria 1237
293 Ga0068857_100600050 3300005577 Bacteria 1041
294 Ga0068857_100787047 3300005577 Bacteria 908
295 Ga0068857_100845678 3300005577 Bacteria 875
296 Ga0068857_101495090 3300005577 Bacteria 658
297 Ga0068854_100002508 3300005578 Bacteria 11387
298 Ga0068854_100006996 3300005578 Bacteria 7195
299 Ga0068854_100080379 3300005578 Bacteria 2405
300 Ga0068854_100096393 3300005578 Bacteria 2210
301 Ga0068854_100130539 3300005578 Bacteria 1918
302 Ga0068854_100375269 3300005578 Bacteria 1170
303 Ga0068854_100384051 3300005578 Bacteria 1158
304 Ga0068854_100527821 3300005578 Bacteria 998
305 Ga0068854_100754653 3300005578 Bacteria 844
306 Ga0068856_100013314 3300005614 Bacteria 7966
307 Ga0068856_100022023 3300005614 Bacteria 6197
308 Ga0068856_100043233 3300005614 Bacteria 4433
309 Ga0068856_100098167 3300005614 Bacteria 2919
310 Ga0068856_100521922 3300005614 Bacteria 1209
311 Ga0068856_100707698 3300005614 Bacteria 1028
312 Ga0070702_100122681 3300005615 Bacteria 1629
313 Ga0068852_100008757 3300005616 Bacteria 7484
314 Ga0068852_100076296 3300005616 Bacteria 2959
315 Ga0068852_100109246 3300005616 Bacteria 2511
316 Ga0068852_100126238 3300005616 Bacteria 2350
317 Ga0068852_100162554 3300005616 Bacteria 2086
318 Ga0068852_100177678 3300005616 Bacteria 2000
319 Ga0068852_100206166 3300005616 Bacteria 1863
320 Ga0068852_100252479 3300005616 Bacteria 1690
321 Ga0068852_100295609 3300005616 Bacteria 1566
322 Ga0068852_101055902 3300005616 Bacteria 832
323 Ga0068852_102076170 3300005616 Bacteria 590
324 Ga0068859_100032096 3300005617 Bacteria 5275
325 Ga0068859_100222130 3300005617 Bacteria 1977
326 Ga0068859_100437590 3300005617 Bacteria 1404
327 Ga0068859_100539851 3300005617 Bacteria 1261
328 Ga0068859_100586895 3300005617 Bacteria 1208
329 Ga0068859_101977742 3300005617 Bacteria 644
330 Ga0068864_100011590 3300005618 Bacteria 7281
331 Ga0068864_100015868 3300005618 Bacteria 6268
332 Ga0068864_100032380 3300005618 Bacteria 4442
333 Ga0068864_100078599 3300005618 Bacteria 2887
334 Ga0068866_10035274 3300005718 Bacteria 2442
335 Ga0068866_10245943 3300005718 Bacteria 1092
336 Ga0068861_100000582 3300005719 Bacteria 21639
337 Ga0068861_100000677 3300005719 Bacteria 20324
338 Ga0068861_100119213 3300005719 Bacteria 2126
339 Ga0068851_10005711 3300005834 Bacteria 5657
340 Ga0068851_10079563 3300005834 Bacteria 1710
341 Ga0068851_10086935 3300005834 Bacteria 1641
342 Ga0068851_10112479 3300005834 Bacteria 1455
343 Ga0068851_10405114 3300005834 Bacteria 803
344 Ga0068851_10606699 3300005834 Bacteria 667
345 Ga0068870_10205411 3300005840 Bacteria 1197
346 Ga0068870_10257640 3300005840 Bacteria 1084
347 Ga0068870_10540408 3300005840 Bacteria 783
348 Ga0068870_10725988 3300005840 Bacteria 688
349 Ga0068870_11226770 3300005840 Bacteria 544
350 Ga0068863_100004173 3300005841 Bacteria 14266
351 Ga0068863_100082398 3300005841 Bacteria 3049
352 Ga0068863_100093622 3300005841 Bacteria 2851
353 Ga0068863_100357715 3300005841 Bacteria 1423
354 Ga0068858_100000560 3300005842 Bacteria 38798
355 Ga0068858_100037529 3300005842 Bacteria 4494
356 Ga0068858_100057084 3300005842 Bacteria 3608
357 Ga0068858_100397457 3300005842 Bacteria 1324
358 Ga0068858_100780252 3300005842 Bacteria 932
359 Ga0068858_101140323 3300005842 Bacteria 766
360 Ga0068860_100002632 3300005843 Bacteria 18674
361 Ga0068860_100061216 3300005843 Bacteria 3577
362 Ga0068860_100240537 3300005843 Bacteria 1761
363 Ga0068860_100341603 3300005843 Bacteria 1472
364 Ga0068860_101736591 3300005843 Bacteria 646
365 Ga0068862_100010198 3300005844 Bacteria 7752
366 Ga0068862_100070096 3300005844 Bacteria 3026
367 Ga0068862_100823561 3300005844 Bacteria 908
368 Ga0068862_101997397 3300005844 Bacteria 590
369 Ga0081455_10232278 3300005937 Bacteria 1360
370 Ga0075365_10004297 3300006038 Bacteria 7518
371 Ga0075365_10029244 3300006038 Bacteria 3520
372 Ga0075368_10015003 3300006042 Bacteria 2868
373 Ga0075368_10025640 3300006042 Bacteria 2262
374 Ga0075368_10089158 3300006042 Bacteria 1261
375 Ga0075368_10110095 3300006042 Bacteria 1135
376 Ga0075368_10120838 3300006042 Bacteria 1085
377 Ga0075368_10127894 3300006042 Bacteria 1055
378 Ga0075368_10233661 3300006042 Bacteria 783
379 Ga0075368_10483754 3300006042 Bacteria 551
380 Ga0075363_100001372 3300006048 Bacteria 9171
381 Ga0075363_100011135 3300006048 Bacteria 4299
382 Ga0075363_100036596 3300006048 Bacteria 2575
383 Ga0075363_100083784 3300006048 Bacteria 1747
384 Ga0075363_100083793 3300006048 Bacteria 1747
385 Ga0075363_100135138 3300006048 Bacteria 1385
386 Ga0075363_100145033 3300006048 Bacteria 1338
387 Ga0075363_100245793 3300006048 Bacteria 1029
388 Ga0075363_100532557 3300006048 Bacteria 700
389 Ga0075363_100642870 3300006048 Bacteria 638
390 Ga0075364_10012528 3300006051 Bacteria 5191
391 Ga0075364_10016278 3300006051 Bacteria 4625
392 Ga0075364_10085088 3300006051 Bacteria 2094
393 Ga0075364_10100218 3300006051 Bacteria 1928
394 Ga0075364_10393356 3300006051 Bacteria 946
395 Ga0075364_10433501 3300006051 Bacteria 898
396 Ga0075364_10457758 3300006051 Bacteria 872
397 Ga0075364_10624434 3300006051 Bacteria 736
398 Ga0075364_10754383 3300006051 Bacteria 664
399 Ga0075432_10150260 3300006058 Bacteria 894
400 Ga0075362_10005070 3300006177 Bacteria 4788
401 Ga0075362_10006907 3300006177 Bacteria 4255
402 Ga0075362_10006970 3300006177 Bacteria 4243
403 Ga0075362_10018421 3300006177 Bacteria 2888
404 Ga0075362_10024484 3300006177 Bacteria 2561
405 Ga0075362_10114760 3300006177 Bacteria 1271
406 Ga0075362_10125632 3300006177 Bacteria 1217
407 Ga0075362_10135822 3300006177 Bacteria 1173
408 Ga0075362_10150654 3300006177 Bacteria 1116
409 Ga0075362_10288997 3300006177 Bacteria 812
410 Ga0075362_10299394 3300006177 Bacteria 798
411 Ga0075362_10536063 3300006177 Bacteria 601
412 Ga0075362_10589544 3300006177 Bacteria 574
413 Ga0075367_10005547 3300006178 Bacteria 6284
414 Ga0075367_10012600 3300006178 Bacteria 4517
415 Ga0075367_10026352 3300006178 Bacteria 3297
416 Ga0075367_10036496 3300006178 Bacteria 2851
417 Ga0075367_10037500 3300006178 Bacteria 2817
418 Ga0075367_10062713 3300006178 Bacteria 2221
419 Ga0075367_10069417 3300006178 Bacteria 2116
420 Ga0075367_10111626 3300006178 Bacteria 1678
421 Ga0075367_10574567 3300006178 Bacteria 716
422 Ga0075367_10846119 3300006178 Bacteria 583
423 Ga0075369_10001852 3300006186 Bacteria 7383
424 Ga0075369_10095160 3300006186 Bacteria 1332
425 Ga0075369_10097573 3300006186 Bacteria 1316
426 Ga0075369_10136040 3300006186 Bacteria 1119
427 Ga0075366_10001677 3300006195 Bacteria 11115
428 Ga0075366_10002935 3300006195 Bacteria 8866
429 Ga0075366_10003541 3300006195 Bacteria 8255
430 Ga0075366_10004492 3300006195 Bacteria 7483
431 Ga0075366_10005743 3300006195 Bacteria 6734
432 Ga0075366_10009910 3300006195 Bacteria 5332
433 Ga0075366_10010575 3300006195 Bacteria 5180
434 Ga0075366_10011468 3300006195 Bacteria 5006
435 Ga0075366_10013487 3300006195 Bacteria 4654
436 Ga0075366_10033053 3300006195 Bacteria 3046
437 Ga0075366_10034984 3300006195 Bacteria 2961
438 Ga0075366_10043108 3300006195 Bacteria 2672
439 Ga0075366_10048738 3300006195 Bacteria 2513
440 Ga0075366_10051847 3300006195 Bacteria 2438
441 Ga0075366_10052964 3300006195 Bacteria 2411
442 Ga0075366_10091551 3300006195 Bacteria 1822
443 Ga0075366_10096603 3300006195 Bacteria 1771
444 Ga0075366_10101808 3300006195 Bacteria 1724
445 Ga0075366_10106830 3300006195 Bacteria 1683
446 Ga0075366_10148761 3300006195 Bacteria 1418
447 Ga0075366_10155628 3300006195 Bacteria 1384
448 Ga0075366_10196689 3300006195 Bacteria 1226
449 Ga0075366_10201532 3300006195 Bacteria 1211
450 Ga0075366_10219966 3300006195 Bacteria 1157
451 Ga0075366_10257032 3300006195 Bacteria 1066
452 Ga0075366_10278101 3300006195 Bacteria 1023
453 Ga0075366_10284664 3300006195 Bacteria 1010
454 Ga0075366_10307972 3300006195 Bacteria 969
455 Ga0075366_10319902 3300006195 Bacteria 950
456 Ga0075366_10389133 3300006195 Bacteria 858
457 Ga0075366_10441189 3300006195 Bacteria 803
458 Ga0075366_10879797 3300006195 Bacteria 558
459 Ga0075366_11018047 3300006195 Bacteria 517
460 Ga0097621_100011918 3300006237 Bacteria 6430
461 Ga0097621_100040679 3300006237 Bacteria 3738
462 Ga0097621_100064071 3300006237 Bacteria 3022
463 Ga0097621_100107140 3300006237 Bacteria 2358
464 Ga0097621_100134827 3300006237 Bacteria 2105
465 Ga0097621_100137354 3300006237 Bacteria 2086
466 Ga0097621_100498620 3300006237 Bacteria 1103
467 Ga0097621_101343929 3300006237 Bacteria 676
468 Ga0075370_10000124 3300006353 Bacteria 25565
469 Ga0075370_10000159 3300006353 Bacteria 22949
470 Ga0075370_10001473 3300006353 Bacteria 10252
471 Ga0075370_10003561 3300006353 Bacteria 7444
472 Ga0075370_10004375 3300006353 Bacteria 6848
473 Ga0075370_10008986 3300006353 Bacteria 5167
474 Ga0075370_10011875 3300006353 Bacteria 4586
475 Ga0075370_10012982 3300006353 Bacteria 4418
476 Ga0075370_10018684 3300006353 Bacteria 3762
477 Ga0075370_10024332 3300006353 Bacteria 3344
478 Ga0075370_10031609 3300006353 Bacteria 2955
479 Ga0075370_10041223 3300006353 Bacteria 2606
480 Ga0075370_10044762 3300006353 Bacteria 2502
481 Ga0075370_10049244 3300006353 Bacteria 2388
482 Ga0075370_10081886 3300006353 Bacteria 1855
483 Ga0075370_10083339 3300006353 Bacteria 1839
484 Ga0075370_10103526 3300006353 Bacteria 1649
485 Ga0075370_10150489 3300006353 Bacteria 1364
486 Ga0075370_10170120 3300006353 Bacteria 1281
487 Ga0075370_10539614 3300006353 Bacteria 705
488 Ga0075370_10877565 3300006353 Bacteria 548
489 Ga0068871_100044806 3300006358 Bacteria 3559
490 Ga0068871_100108518 3300006358 Bacteria 2333
491 Ga0068871_100526870 3300006358 Bacteria 1068
492 Ga0075429_101499775 3300006880 Bacteria 587
493 Ga0068865_100040309 3300006881 Bacteria 3172
494 Ga0068865_100058476 3300006881 Bacteria 2693
495 Ga0068865_100168495 3300006881 Bacteria 1677
496 Ga0068865_100459002 3300006881 Bacteria 1055
497 Ga0068865_100749447 3300006881 Bacteria 839
498 Ga0097620_100032096 3300006931 Bacteria 5275
499 Ga0097620_100222131 3300006931 Bacteria 1977
500 Ga0097620_100437573 3300006931 Bacteria 1404
501 Ga0097620_100539782 3300006931 Bacteria 1261
502 Ga0097620_100586914 3300006931 Bacteria 1208
503 Ga0097620_101977887 3300006931 Bacteria 644
504 Ga0099823_1058477 3300006944 Bacteria 2082
505 Ga0099826_10029080 3300006948 Bacteria 4032
506 Ga0099826_10131993 3300006948 Bacteria 1455
507 Ga0075435_100640821 3300007076 Bacteria 922
508 Ga0105251_10002173 3300009011 Bacteria 15740
509 Ga0105251_10017441 3300009011 Bacteria 3847
510 Ga0105251_10058772 3300009011 Bacteria 1815
511 Ga0105244_10000329 3300009036 Bacteria 45045
512 Ga0105244_10001834 3300009036 Bacteria 16612
513 Ga0105244_10024925 3300009036 Bacteria 3258
514 Ga0105244_10037053 3300009036 Bacteria 2551
515 Ga0105244_10368012 3300009036 Bacteria 662
516 Ga0105250_10000105 3300009092 Bacteria 75608
517 Ga0105250_10129259 3300009092 Bacteria 1042
518 Ga0105240_10017700 3300009093 Bacteria 9595
519 Ga0105240_10020431 3300009093 Bacteria 8833
520 Ga0105240_10022278 3300009093 Bacteria 8403
521 Ga0105240_10336480 3300009093 Bacteria 1716
522 Ga0105240_11672081 3300009093 Bacteria 665
523 Ga0111539_11096507 3300009094 Bacteria 925
524 Ga0111539_11532128 3300009094 Bacteria 773
525 Ga0111539_12951320 3300009094 Bacteria 550
526 Ga0105245_10150078 3300009098 Bacteria 2203
527 Ga0105245_10172687 3300009098 Bacteria 2059
528 Ga0105245_10245508 3300009098 Bacteria 1738
529 Ga0105245_10485053 3300009098 Bacteria 1250
530 Ga0105245_10669374 3300009098 Bacteria 1069
531 Ga0105245_11204771 3300009098 Bacteria 805
532 Ga0105245_11594832 3300009098 Bacteria 704
533 Ga0105247_10441827 3300009101 Bacteria 936
534 Ga0105247_11257926 3300009101 Bacteria 592
535 Ga0114129_10051750 3300009147 Bacteria 5765
536 Ga0105243_10000486 3300009148 Bacteria 40508
537 Ga0105243_10003231 3300009148 Bacteria 13312
538 Ga0105243_10003279 3300009148 Bacteria 13149
539 Ga0105243_10021379 3300009148 Bacteria 4910
540 Ga0105243_10105356 3300009148 Bacteria 2349
541 Ga0105243_10120855 3300009148 Bacteria 2208
542 Ga0105243_10335147 3300009148 Bacteria 1383
543 Ga0105243_10415518 3300009148 Bacteria 1253
544 Ga0105243_11059092 3300009148 Bacteria 817
545 Ga0105243_11142834 3300009148 Bacteria 789
546 Ga0105243_12170737 3300009148 Bacteria 592
547 Ga0105241_10003239 3300009174 Bacteria 12103
548 Ga0105241_10401883 3300009174 Bacteria 1202
549 Ga0105241_10724360 3300009174 Bacteria 910
550 Ga0105241_10935623 3300009174 Bacteria 807
551 Ga0105241_11873201 3300009174 Bacteria 587
552 Ga0105241_12604394 3300009174 Bacteria 508
553 Ga0105242_10961652 3300009176 Bacteria 859
554 Ga0105242_11425078 3300009176 Bacteria 721
555 Ga0105248_10000445 3300009177 Bacteria 46980
556 Ga0105248_10017866 3300009177 Bacteria 7827
557 Ga0105248_10025421 3300009177 Bacteria 6583
558 Ga0105248_10046075 3300009177 Bacteria 4887
559 Ga0105248_10409042 3300009177 Bacteria 1528
560 Ga0105248_10728412 3300009177 Bacteria 1119
561 Ga0105248_11419170 3300009177 Bacteria 786
562 Ga0105248_11874896 3300009177 Bacteria 680
563 Ga0105248_12224160 3300009177 Bacteria 624
564 Ga0105237_10000548 3300009545 Bacteria 52739
565 Ga0105237_10015839 3300009545 Bacteria 7841
566 Ga0105237_10182787 3300009545 Bacteria 2097
567 Ga0105237_10231058 3300009545 Bacteria 1851
568 Ga0105237_10341422 3300009545 Bacteria 1502
569 Ga0105237_10445838 3300009545 Bacteria 1300
570 Ga0105237_10738902 3300009545 Bacteria 990
571 Ga0105237_10923354 3300009545 Bacteria 880
572 Ga0105238_10020973 3300009551 Bacteria 6657
573 Ga0105238_10136657 3300009551 Bacteria 2429
574 Ga0105238_10161939 3300009551 Bacteria 2213
575 Ga0105238_10650503 3300009551 Bacteria 1064
576 Ga0105249_10038755 3300009553 Bacteria 4325
577 Ga0105249_10052334 3300009553 Bacteria 3728
578 Ga0105249_10177219 3300009553 Bacteria 2071
579 Ga0105249_10318349 3300009553 Bacteria 1566
580 Ga0105249_10336225 3300009553 Bacteria 1525
581 Ga0105249_13095095 3300009553 Bacteria 534
582 Ga0105239_10001569 3300010375 Bacteria 30171
583 Ga0105239_10052411 3300010375 Bacteria 4474
584 Ga0105239_10174209 3300010375 Bacteria 2406
585 Ga0105239_10274852 3300010375 Bacteria 1895
586 Ga0105239_10280880 3300010375 Bacteria 1874
587 Ga0105239_10777111 3300010375 Bacteria 1097
588 Ga0105239_13137326 3300010375 Bacteria 538
589 Ga0105246_10007754 3300011119 Bacteria 6590
590 Ga0105246_10200957 3300011119 Bacteria 1549
591 Ga0105246_10375419 3300011119 Bacteria 1173
592 Ga0105246_11159263 3300011119 Bacteria 709
593 Ga0105246_11783863 3300011119 Bacteria 587
594 Ga0157322_1021901 3300012490 Bacteria 622
595 Ga0157319_1000006 3300012497 Bacteria 361506
596 Ga0157347_1003675 3300012502 Bacteria 1389
597 Ga0157339_1024310 3300012505 Bacteria 667
598 Ga0157342_1018967 3300012507 Bacteria 784
599 Ga0157327_1046646 3300012512 Bacteria 602
600 Ga0157373_10004477 3300013100 Bacteria 10519
601 Ga0157373_10005848 3300013100 Bacteria 9205
602 Ga0157373_10037609 3300013100 Bacteria 3469
603 Ga0157373_10103380 3300013100 Bacteria 2004
604 Ga0157373_10115188 3300013100 Bacteria 1890
605 Ga0157373_10151556 3300013100 Bacteria 1631
606 Ga0157371_10099143 3300013102 Bacteria 2066
607 Ga0157371_10255462 3300013102 Bacteria 1262
608 Ga0157371_10616305 3300013102 Bacteria 808
609 Ga0157371_10722570 3300013102 Bacteria 747
610 Ga0157371_11100124 3300013102 Bacteria 609
611 Ga0157370_10001046 3300013104 Bacteria 34825
612 Ga0157370_10014128 3300013104 Bacteria 8189
613 Ga0157370_10217371 3300013104 Bacteria 1771
614 Ga0157370_10312903 3300013104 Bacteria 1449
615 Ga0157370_10353690 3300013104 Bacteria 1354
616 Ga0157370_10923045 3300013104 Bacteria 792
617 Ga0157369_10000981 3300013105 Bacteria 36190
618 Ga0157369_10014051 3300013105 Bacteria 9045
619 Ga0157369_10017535 3300013105 Bacteria 8045
620 Ga0157369_10019561 3300013105 Bacteria 7576
621 Ga0157369_10374804 3300013105 Bacteria 1477
622 Ga0157369_10397815 3300013105 Bacteria 1429
623 Ga0157369_11428250 3300013105 Bacteria 704
624 Ga0157374_10000032 3300013296 Bacteria 202485
625 Ga0157374_10005865 3300013296 Bacteria 10372
626 Ga0157374_10014186 3300013296 Bacteria 6967
627 Ga0157374_10145876 3300013296 Bacteria 2299
628 Ga0157374_10277004 3300013296 Bacteria 1655
629 Ga0157374_10380304 3300013296 Bacteria 1406
630 Ga0157374_10419587 3300013296 Bacteria 1337
631 Ga0157378_10000558 3300013297 Bacteria 35454
632 Ga0157378_10481027 3300013297 Bacteria 1237
633 Ga0157378_10511813 3300013297 Bacteria 1201
634 Ga0157378_10831066 3300013297 Bacteria 951
635 Ga0157378_10835110 3300013297 Bacteria 949
636 Ga0157378_11412386 3300013297 Bacteria 739
637 Ga0157378_11729265 3300013297 Bacteria 673
638 Ga0157378_11757097 3300013297 Bacteria 668
639 Ga0157378_12632226 3300013297 Bacteria 555
640 Ga0157378_12638068 3300013297 Bacteria 555
641 Ga0163162_10005747 3300013306 Bacteria 11998
642 Ga0163162_10045656 3300013306 Bacteria 4389
643 Ga0163162_10109110 3300013306 Bacteria 2864
644 Ga0163162_10223961 3300013306 Bacteria 2010
645 Ga0163162_10232252 3300013306 Bacteria 1975
646 Ga0163162_10609804 3300013306 Bacteria 1217
647 Ga0163162_11187961 3300013306 Bacteria 865
648 Ga0157372_10019251 3300013307 Bacteria 7351
649 Ga0157372_10188302 3300013307 Bacteria 2390
650 Ga0157372_10276126 3300013307 Bacteria 1953
651 Ga0157372_10372342 3300013307 Bacteria 1664
652 Ga0157372_10388386 3300013307 Bacteria 1626
653 Ga0157372_10712918 3300013307 Bacteria 1167
654 Ga0157372_11133255 3300013307 Bacteria 905
655 Ga0157372_11258917 3300013307 Bacteria 854
656 Ga0157375_10013127 3300013308 Bacteria 7361
657 Ga0157375_10031297 3300013308 Bacteria 5027
658 Ga0157375_10059867 3300013308 Bacteria 3774
659 Ga0157375_10068447 3300013308 Bacteria 3552
660 Ga0157375_10106464 3300013308 Bacteria 2896
661 Ga0157375_10119991 3300013308 Bacteria 2738
662 Ga0157375_10187002 3300013308 Bacteria 2225
663 Ga0157375_10325666 3300013308 Bacteria 1701
664 Ga0157375_10548459 3300013308 Bacteria 1318
665 Ga0157375_10723557 3300013308 Bacteria 1148
666 Ga0157375_11604339 3300013308 Bacteria 769
667 Ga0163163_10129383 3300014325 Bacteria 2565
668 Ga0163163_10272395 3300014325 Bacteria 1744
669 Ga0163163_10817455 3300014325 Bacteria 995
670 Ga0163163_11322412 3300014325 Bacteria 783
671 Ga0157380_10053803 3300014326 Bacteria 3192
672 Ga0157380_10228832 3300014326 Bacteria 1668
673 Ga0157380_10320589 3300014326 Bacteria 1436
674 Ga0157380_10571025 3300014326 Bacteria 1113
675 Ga0157380_11716265 3300014326 Bacteria 686
676 Ga0157380_12956872 3300014326 Bacteria 541
677 Ga0182008_10001960 3300014497 Bacteria 13217
678 Ga0182008_10009359 3300014497 Bacteria 5292
679 Ga0182008_10116948 3300014497 Bacteria 1323
680 Ga0182008_10431370 3300014497 Bacteria 713
681 Ga0182008_10983333 3300014497 Bacteria 502
682 Ga0157377_10000028 3300014745 Bacteria 134810
683 Ga0157377_10077811 3300014745 Bacteria 1932
684 Ga0157379_10035995 3300014968 Bacteria 4414
685 Ga0157379_10043963 3300014968 Bacteria 3989
686 Ga0157379_10051052 3300014968 Bacteria 3694
687 Ga0157379_10107677 3300014968 Bacteria 2502
688 Ga0157379_10142242 3300014968 Bacteria 2163
689 Ga0157379_10181011 3300014968 Bacteria 1904
690 Ga0157379_10242497 3300014968 Bacteria 1635
691 Ga0157379_10290484 3300014968 Bacteria 1489
692 Ga0157379_11078161 3300014968 Bacteria 769
693 Ga0157376_10009600 3300014969 Bacteria 7037
694 Ga0157376_10048381 3300014969 Bacteria 3516
695 Ga0157376_10092691 3300014969 Bacteria 2620
696 Ga0157376_10187310 3300014969 Bacteria 1895
697 Ga0157376_10576089 3300014969 Bacteria 1117
698 Ga0157376_10671608 3300014969 Bacteria 1039
699 Ga0157376_11200374 3300014969 Bacteria 787
700 Ga0157376_11914755 3300014969 Bacteria 630
701 Ga0182006_1001354 3300015261 Bacteria 14997
702 Ga0182006_1010741 3300015261 Bacteria 4056
703 Ga0182006_1011055 3300015261 Bacteria 3985
704 Ga0182006_1030375 3300015261 Bacteria 2184
705 Ga0182006_1071057 3300015261 Bacteria 1291
706 Ga0182007_10001767 3300015262 Bacteria 11326
707 Ga0182007_10021863 3300015262 Bacteria 2265
708 Ga0182007_10111558 3300015262 Bacteria 910
709 Ga0182007_10270552 3300015262 Bacteria 615
710 Ga0182005_1029694 3300015265 Bacteria 1491
711 Ga0182005_1091376 3300015265 Bacteria 847
712 Ga0182005_1297163 3300015265 Bacteria 509
713 Ga0163161_10001250 3300017792 Bacteria 19010
714 Ga0163161_10023133 3300017792 Bacteria 4380
715 Ga0163161_10048400 3300017792 Bacteria 3070
716 Ga0163161_10196275 3300017792 Bacteria 1554
717 Ga0163161_10216770 3300017792 Bacteria 1481
718 Ga0163161_10669334 3300017792 Bacteria 862
719 Ga0163161_10675892 3300017792 Bacteria 858
720 Ga0206355_1269035 3300020076 Bacteria 762
721 Ga0206352_10797362 3300020078 Bacteria 510
722 Ga0213872_10000011 3300021361 Bacteria 194139
723 Ga0213872_10000043 3300021361 Bacteria 117678
724 Ga0213872_10000272 3300021361 Bacteria 44319
725 Ga0213872_10040543 3300021361 Bacteria 2126
726 Ga0213872_10060109 3300021361 Bacteria 1719
727 Ga0213872_10074479 3300021361 Bacteria 1528
728 Ga0213872_10075054 3300021361 Bacteria 1522
729 Ga0213872_10227793 3300021361 Bacteria 791
730 Ga0213876_10287255 3300021384 Bacteria 874
731 Ga0209435_125931 3300025206 Bacteria 545
732 Ga0209436_101446 3300025208 Bacteria 8293
733 Ga0209784_100938 3300025224 Bacteria 5660
734 Ga0209566_100561 3300025225 Bacteria 24375
735 Ga0209674_100003 3300025226 Bacteria 2196646
736 Ga0209674_100122 3300025226 Bacteria 131720
737 Ga0209672_100191 3300025228 Bacteria 49747
738 Ga0209672_100222 3300025228 Bacteria 44005
739 Ga0209147_100435 3300025229 Bacteria 26860
740 Ga0209563_100005 3300025230 Bacteria 1774893
741 Ga0209563_100017 3300025230 Bacteria 796449
742 Ga0209563_103222 3300025230 Bacteria 3436
743 Ga0209258_100048 3300025242 Bacteria 365881
744 Ga0209258_100559 3300025242 Bacteria 32575
745 Ga0209258_102813 3300025242 Bacteria 4173
746 Ga0207425_1000786 3300025245 Bacteria 16194
747 Ga0207425_1003597 3300025245 Bacteria 4906
748 Ga0209646_1000022 3300025246 Bacteria 446621
749 Ga0209646_1000271 3300025246 Bacteria 47713
750 Ga0209026_1000085 3300025250 Bacteria 185778
751 Ga0209026_1004183 3300025250 Bacteria 4407
752 Ga0209677_101546 3300025253 Bacteria 9813
753 Ga0209677_101615 3300025253 Bacteria 9505
754 Ga0209677_103383 3300025253 Bacteria 5220
755 Ga0209148_1000021 3300025254 Bacteria 714645
756 Ga0209148_1000040 3300025254 Bacteria 473531
757 Ga0209148_1012316 3300025254 Bacteria 1567
758 Ga0209759_1000068 3300025256 Bacteria 183479
759 Ga0209759_1001746 3300025256 Bacteria 11158
760 Ga0209759_1001796 3300025256 Bacteria 10868
761 Ga0209759_1002047 3300025256 Bacteria 9476
762 Ga0209759_1021973 3300025256 Bacteria 1437
763 Ga0209759_1031313 3300025256 Bacteria 1037
764 Ga0209129_1000007 3300025258 Bacteria 771325
765 Ga0209129_1000369 3300025258 Bacteria 36698
766 Ga0209129_1001205 3300025258 Bacteria 14869
767 Ga0209129_1024238 3300025258 Bacteria 1070
768 Ga0209565_1000153 3300025263 Bacteria 92909
769 Ga0209565_1001390 3300025263 Bacteria 10816
770 Ga0209565_1003425 3300025263 Bacteria 5136
771 Ga0209565_1078898 3300025263 Bacteria 544
772 Ga0209455_1000643 3300025272 Bacteria 21407
773 Ga0209455_1001880 3300025272 Bacteria 8751
774 Ga0209673_1000423 3300025273 Bacteria 73682
775 Ga0209673_1000566 3300025273 Bacteria 59095
776 Ga0209673_1000801 3300025273 Bacteria 41669
777 Ga0209673_1006937 3300025273 Bacteria 5353
778 Ga0209673_1013020 3300025273 Bacteria 3309
779 Ga0209673_1013271 3300025273 Bacteria 3261
780 Ga0209673_1013645 3300025273 Bacteria 3195
781 Ga0209673_1046556 3300025273 Bacteria 1183
782 Ga0209130_1000953 3300025284 Bacteria 22898
783 Ga0209130_1001018 3300025284 Bacteria 21612
784 Ga0209130_1001734 3300025284 Bacteria 13039
785 Ga0209675_1000150 3300025291 Bacteria 92909
786 Ga0209675_1001481 3300025291 Bacteria 13497
787 Ga0209675_1001635 3300025291 Bacteria 12545
788 Ga0209675_1002237 3300025291 Bacteria 10110
789 Ga0209675_1002884 3300025291 Bacteria 8522
790 Ga0209676_1000004 3300025292 Bacteria 1138360
791 Ga0209676_1000735 3300025292 Bacteria 44818
792 Ga0209676_1001743 3300025292 Bacteria 18592
793 Ga0209676_1002326 3300025292 Bacteria 13761
794 Ga0209676_1004231 3300025292 Bacteria 8115
795 Ga0209676_1007213 3300025292 Bacteria 5289
796 Ga0209676_1030459 3300025292 Bacteria 1649
797 Ga0209025_1000057 3300025294 Bacteria 314601
798 Ga0209025_1000217 3300025294 Bacteria 137909
799 Ga0209025_1000278 3300025294 Bacteria 117718
800 Ga0209025_1001179 3300025294 Bacteria 36980
801 Ga0209025_1010012 3300025294 Bacteria 6495
802 Ga0209025_1018495 3300025294 Bacteria 3941
803 Ga0209025_1124121 3300025294 Bacteria 764
804 Ga0209564_1000003 3300025295 Bacteria 1585848
805 Ga0209564_1000046 3300025295 Bacteria 373787
806 Ga0209564_1000915 3300025295 Bacteria 38566
807 Ga0209564_1001044 3300025295 Bacteria 33893
808 Ga0209564_1015210 3300025295 Bacteria 3147
809 Ga0209564_1077190 3300025295 Bacteria 665
810 Ga0209758_1000025 3300025297 Bacteria 586687
811 Ga0209758_1000709 3300025297 Bacteria 49238
812 Ga0209758_1002316 3300025297 Bacteria 19694
813 Ga0209758_1020934 3300025297 Bacteria 3070
814 Ga0209050_1000002 3300025298 Bacteria 1792849
815 Ga0209050_1000861 3300025298 Bacteria 41048
816 Ga0209050_1001823 3300025298 Bacteria 20745
817 Ga0209050_1002866 3300025298 Bacteria 13651
818 Ga0209050_1002874 3300025298 Bacteria 13626
819 Ga0209050_1003318 3300025298 Bacteria 12018
820 Ga0209050_1035133 3300025298 Bacteria 1487
821 Ga0209050_1037278 3300025298 Bacteria 1405
822 Ga0209050_1097324 3300025298 Bacteria 589
823 Ga0209256_1000067 3300025299 Bacteria 246812
824 Ga0209256_1000366 3300025299 Bacteria 72685
825 Ga0209256_1005597 3300025299 Bacteria 7138
826 Ga0209256_1008454 3300025299 Bacteria 4769
827 Ga0209256_1041041 3300025299 Bacteria 1178
828 Ga0209256_1042846 3300025299 Bacteria 1140
829 Ga0209256_1094527 3300025299 Bacteria 629
830 Ga0207426_1000001 3300025302 Bacteria 1341301
831 Ga0207426_1000028 3300025302 Bacteria 483955
832 Ga0207426_1020977 3300025302 Bacteria 2263
833 Ga0209051_1000002 3300025303 Bacteria 1631846
834 Ga0209051_1000049 3300025303 Bacteria 287483
835 Ga0209051_1000096 3300025303 Bacteria 167399
836 Ga0209051_1000532 3300025303 Bacteria 47250
837 Ga0209051_1000913 3300025303 Bacteria 29387
838 Ga0209051_1004959 3300025303 Bacteria 7955
839 Ga0209051_1007617 3300025303 Bacteria 5892
840 Ga0209051_1010944 3300025303 Bacteria 4527
841 Ga0209051_1013466 3300025303 Bacteria 3892
842 Ga0209051_1035263 3300025303 Bacteria 1864
843 Ga0209051_1107638 3300025303 Bacteria 734
844 Ga0209257_1000002 3300025304 Bacteria 1767052
845 Ga0209257_1000072 3300025304 Bacteria 332791
846 Ga0209257_1005501 3300025304 Bacteria 8849
847 Ga0209257_1005948 3300025304 Bacteria 8192
848 Ga0209257_1012640 3300025304 Bacteria 3871
849 Ga0209257_1013234 3300025304 Bacteria 3698
850 Ga0209257_1021343 3300025304 Bacteria 2356
851 Ga0207697_10054088 3300025315 Bacteria 1663
852 Ga0207697_10101513 3300025315 Bacteria 1226
853 Ga0207697_10455412 3300025315 Bacteria 567
854 Ga0207656_10012183 3300025321 Bacteria 3265
855 Ga0207656_10029824 3300025321 Bacteria 2250
856 Ga0207656_10071677 3300025321 Bacteria 1541
857 Ga0207656_10111356 3300025321 Bacteria 1265
858 Ga0207656_10111360 3300025321 Bacteria 1265
859 Ga0207696_1000131 3300025711 Bacteria 132958
860 Ga0207655_1000004 3300025728 Bacteria 1021221
861 Ga0207655_1003340 3300025728 Bacteria 12017
862 Ga0207655_1029730 3300025728 Bacteria 2552
863 Ga0207655_1118431 3300025728 Bacteria 882
864 Ga0207655_1236898 3300025728 Bacteria 524
865 Ga0207713_1000052 3300025735 Bacteria 222663
866 Ga0207713_1000084 3300025735 Bacteria 160822
867 Ga0207713_1043333 3300025735 Bacteria 1860
868 Ga0207682_10006629 3300025893 Bacteria 4655
869 Ga0207682_10022477 3300025893 Bacteria 2485
870 Ga0207682_10067253 3300025893 Bacteria 1512
871 Ga0207682_10071200 3300025893 Bacteria 1474
872 Ga0207682_10532095 3300025893 Bacteria 556
873 Ga0207642_10037663 3300025899 Bacteria 2086
874 Ga0207642_10743245 3300025899 Bacteria 621
875 Ga0207688_10036837 3300025901 Bacteria 2712
876 Ga0207688_10167683 3300025901 Bacteria 1305
877 Ga0207688_10248005 3300025901 Bacteria 1078
878 Ga0207680_10216266 3300025903 Bacteria 1312
879 Ga0207647_10046340 3300025904 Bacteria 2710
880 Ga0207647_10052312 3300025904 Bacteria 2521
881 Ga0207685_10596594 3300025905 Bacteria 592
882 Ga0207645_10003439 3300025907 Bacteria 12030
883 Ga0207645_10015692 3300025907 Bacteria 5025
884 Ga0207645_10030847 3300025907 Bacteria 3454
885 Ga0207645_10066499 3300025907 Bacteria 2304
886 Ga0207645_10205138 3300025907 Bacteria 1297
887 Ga0207645_11133322 3300025907 Bacteria 527
888 Ga0207643_10244189 3300025908 Bacteria 1104
889 Ga0207705_10026548 3300025909 Bacteria 4130
890 Ga0207705_10102916 3300025909 Bacteria 2103
891 Ga0207705_10165193 3300025909 Bacteria 1664
892 Ga0207705_10236422 3300025909 Bacteria 1391
893 Ga0207705_10347626 3300025909 Bacteria 1142
894 Ga0207705_10378081 3300025909 Bacteria 1094
895 Ga0207705_11014738 3300025909 Bacteria 641
896 Ga0207705_11017966 3300025909 Bacteria 640
897 Ga0207684_10002530 3300025910 Bacteria 18373
898 Ga0207684_10136233 3300025910 Bacteria 2109
899 Ga0207684_10401714 3300025910 Bacteria 1178
900 Ga0207654_10197100 3300025911 Bacteria 1324
901 Ga0207654_10639853 3300025911 Bacteria 761
902 Ga0207707_10024701 3300025912 Bacteria 5257
903 Ga0207707_11140491 3300025912 Bacteria 634
904 Ga0207707_11289473 3300025912 Bacteria 587
905 Ga0207695_10030367 3300025913 Bacteria 5949
906 Ga0207695_10177375 3300025913 Bacteria 2053
907 Ga0207695_10204007 3300025913 Bacteria 1890
908 Ga0207695_10267148 3300025913 Bacteria 1607
909 Ga0207695_10430581 3300025913 Bacteria 1203
910 Ga0207671_10010913 3300025914 Bacteria 7444
911 Ga0207671_10134750 3300025914 Bacteria 1898
912 Ga0207671_10143413 3300025914 Bacteria 1842
913 Ga0207671_10356571 3300025914 Bacteria 1160
914 Ga0207671_10883563 3300025914 Bacteria 707
915 Ga0207663_10737599 3300025916 Bacteria 782
916 Ga0207660_10491418 3300025917 Bacteria 995
917 Ga0207662_10594733 3300025918 Bacteria 769
918 Ga0207657_10000539 3300025919 Bacteria 40381
919 Ga0207657_10016351 3300025919 Bacteria 7158
920 Ga0207657_10063967 3300025919 Bacteria 3142
921 Ga0207657_10095194 3300025919 Bacteria 2478
922 Ga0207657_10154007 3300025919 Bacteria 1870
923 Ga0207657_10160330 3300025919 Bacteria 1827
924 Ga0207657_10342010 3300025919 Bacteria 1181
925 Ga0207657_10951572 3300025919 Bacteria 660
926 Ga0207649_10027765 3300025920 Bacteria 3326
927 Ga0207649_10065254 3300025920 Bacteria 2304
928 Ga0207649_10859077 3300025920 Bacteria 710
929 Ga0207652_10164160 3300025921 Bacteria 1991
930 Ga0207652_10273281 3300025921 Bacteria 1524
931 Ga0207652_11186502 3300025921 Bacteria 665
932 Ga0207646_10149795 3300025922 Bacteria 2104
933 Ga0207681_10010347 3300025923 Bacteria 5708
934 Ga0207681_10015245 3300025923 Bacteria 4792
935 Ga0207681_10065307 3300025923 Bacteria 2515
936 Ga0207681_10136055 3300025923 Bacteria 1823
937 Ga0207681_11262814 3300025923 Bacteria 620
938 Ga0207694_10065085 3300025924 Bacteria 2842
939 Ga0207694_10110900 3300025924 Bacteria 2182
940 Ga0207694_10147805 3300025924 Bacteria 1892
941 Ga0207694_10323332 3300025924 Bacteria 1273
942 Ga0207694_10663995 3300025924 Bacteria 879
943 Ga0207694_11171087 3300025924 Bacteria 650
944 Ga0207650_10001071 3300025925 Bacteria 20336
945 Ga0207650_10033566 3300025925 Bacteria 3718
946 Ga0207650_10208534 3300025925 Bacteria 1568
947 Ga0207650_10233262 3300025925 Bacteria 1485
948 Ga0207650_10457365 3300025925 Bacteria 1063
949 Ga0207650_10596088 3300025925 Bacteria 929
950 Ga0207650_10628582 3300025925 Bacteria 904
951 Ga0207650_10865198 3300025925 Bacteria 767
952 Ga0207659_10002589 3300025926 Bacteria 10770
953 Ga0207659_10010915 3300025926 Bacteria 5721
954 Ga0207659_10013311 3300025926 Bacteria 5263
955 Ga0207659_10127689 3300025926 Bacteria 1958
956 Ga0207659_10371230 3300025926 Bacteria 1191
957 Ga0207659_10538064 3300025926 Bacteria 992
958 Ga0207659_10721579 3300025926 Bacteria 854
959 Ga0207687_10055314 3300025927 Bacteria 2780
960 Ga0207687_10066030 3300025927 Bacteria 2570
961 Ga0207687_10225398 3300025927 Bacteria 1478
962 Ga0207687_10291600 3300025927 Bacteria 1311
963 Ga0207687_11043346 3300025927 Bacteria 701
964 Ga0207664_10020035 3300025929 Bacteria 4951
965 Ga0207644_10002293 3300025931 Bacteria 12414
966 Ga0207644_10005830 3300025931 Bacteria 8024
967 Ga0207644_10008258 3300025931 Bacteria 6821
968 Ga0207644_10033013 3300025931 Bacteria 3614
969 Ga0207644_10066865 3300025931 Bacteria 2618
970 Ga0207644_10181125 3300025931 Bacteria 1651
971 Ga0207644_10451985 3300025931 Bacteria 1055
972 Ga0207644_10582408 3300025931 Bacteria 928
973 Ga0207644_10919969 3300025931 Bacteria 733
974 Ga0207644_10967293 3300025931 Bacteria 714
975 Ga0207690_10009822 3300025932 Bacteria 5686
976 Ga0207690_10047094 3300025932 Bacteria 2859
977 Ga0207690_10051966 3300025932 Bacteria 2743
978 Ga0207690_10075669 3300025932 Bacteria 2335
979 Ga0207690_10161082 3300025932 Bacteria 1672
980 Ga0207690_10195198 3300025932 Bacteria 1534
981 Ga0207690_10387241 3300025932 Bacteria 1112
982 Ga0207690_10397108 3300025932 Bacteria 1099
983 Ga0207706_10001856 3300025933 Bacteria 20689
984 Ga0207706_10005010 3300025933 Bacteria 12370
985 Ga0207706_10023334 3300025933 Bacteria 5557
986 Ga0207706_10050415 3300025933 Bacteria 3678
987 Ga0207706_10127657 3300025933 Bacteria 2236
988 Ga0207706_10278780 3300025933 Bacteria 1458
989 Ga0207706_10396119 3300025933 Bacteria 1197
990 Ga0207706_10666473 3300025933 Bacteria 890
991 Ga0207706_11275413 3300025933 Bacteria 608
992 Ga0207686_10562429 3300025934 Bacteria 893
993 Ga0207686_10687661 3300025934 Bacteria 812
994 Ga0207709_10000348 3300025935 Bacteria 47582
995 Ga0207709_10000556 3300025935 Bacteria 31885
996 Ga0207709_10005637 3300025935 Bacteria 7077
997 Ga0207709_10006258 3300025935 Bacteria 6689
998 Ga0207709_10007492 3300025935 Bacteria 6075
999 Ga0207709_10193284 3300025935 Bacteria 1447
1000 Ga0207709_10803082 3300025935 Bacteria 759
1001 Ga0207670_10036922 3300025936 Bacteria 3182
1002 Ga0207669_10002735 3300025937 Bacteria 7556
1003 Ga0207669_10163716 3300025937 Bacteria 1574
1004 Ga0207669_10198881 3300025937 Bacteria 1453
1005 Ga0207669_10549955 3300025937 Bacteria 931
1006 Ga0207704_10061644 3300025938 Bacteria 2328
1007 Ga0207704_10351102 3300025938 Bacteria 1148
1008 Ga0207704_10439315 3300025938 Bacteria 1039
1009 Ga0207691_10004533 3300025940 Bacteria 13439
1010 Ga0207691_10005312 3300025940 Bacteria 12435
1011 Ga0207691_10007653 3300025940 Bacteria 10396
1012 Ga0207691_10057377 3300025940 Bacteria 3544
1013 Ga0207691_10174786 3300025940 Bacteria 1879
1014 Ga0207691_10327127 3300025940 Bacteria 1314
1015 Ga0207691_10618110 3300025940 Bacteria 917
1016 Ga0207691_10733465 3300025940 Bacteria 832
1017 Ga0207691_11369505 3300025940 Bacteria 582
1018 Ga0207711_10007461 3300025941 Bacteria 9150
1019 Ga0207711_10013057 3300025941 Bacteria 6900
1020 Ga0207711_10015303 3300025941 Bacteria 6367
1021 Ga0207711_10078718 3300025941 Bacteria 2876
1022 Ga0207711_10245986 3300025941 Bacteria 1641
1023 Ga0207711_10375692 3300025941 Bacteria 1318
1024 Ga0207711_11205800 3300025941 Bacteria 698
1025 Ga0207711_11233896 3300025941 Bacteria 689
1026 Ga0207711_11868024 3300025941 Bacteria 544
1027 Ga0207689_10004291 3300025942 Bacteria 12973
1028 Ga0207689_10018167 3300025942 Bacteria 5937
1029 Ga0207689_10022168 3300025942 Bacteria 5341
1030 Ga0207689_10051486 3300025942 Bacteria 3394
1031 Ga0207689_10282689 3300025942 Bacteria 1374
1032 Ga0207689_10371595 3300025942 Bacteria 1190
1033 Ga0207689_10460278 3300025942 Bacteria 1064
1034 Ga0207689_11056852 3300025942 Bacteria 685
1035 Ga0207661_10069956 3300025944 Bacteria 2863
1036 Ga0207661_10152654 3300025944 Bacteria 1997
1037 Ga0207679_10037286 3300025945 Bacteria 3454
1038 Ga0207679_10046527 3300025945 Bacteria 3146
1039 Ga0207679_10151674 3300025945 Bacteria 1887
1040 Ga0207679_10185328 3300025945 Bacteria 1725
1041 Ga0207679_10322897 3300025945 Bacteria 1337
1042 Ga0207679_10483534 3300025945 Bacteria 1103
1043 Ga0207679_10684044 3300025945 Bacteria 930
1044 Ga0207667_10016870 3300025949 Bacteria 8237
1045 Ga0207667_10053981 3300025949 Bacteria 4227
1046 Ga0207667_10080136 3300025949 Bacteria 3383
1047 Ga0207667_10108428 3300025949 Bacteria 2865
1048 Ga0207667_10116858 3300025949 Bacteria 2749
1049 Ga0207667_10271910 3300025949 Bacteria 1732
1050 Ga0207667_10836318 3300025949 Bacteria 915
1051 Ga0207667_11999714 3300025949 Bacteria 540
1052 Ga0207651_10003468 3300025960 Bacteria 7746
1053 Ga0207651_10032840 3300025960 Bacteria 3339
1054 Ga0207651_10041449 3300025960 Bacteria 3056
1055 Ga0207651_10074451 3300025960 Bacteria 2418
1056 Ga0207651_10078352 3300025960 Bacteria 2370
1057 Ga0207651_10278866 3300025960 Bacteria 1380
1058 Ga0207651_10336242 3300025960 Bacteria 1267
1059 Ga0207651_10380602 3300025960 Bacteria 1196
1060 Ga0207651_10989381 3300025960 Bacteria 751
1061 Ga0207651_11035467 3300025960 Bacteria 734
1062 Ga0207651_11180812 3300025960 Bacteria 687
1063 Ga0207712_10016113 3300025961 Bacteria 4833
1064 Ga0207712_10162453 3300025961 Bacteria 1737
1065 Ga0207712_10485853 3300025961 Bacteria 1053
1066 Ga0207712_11132805 3300025961 Bacteria 697
1067 Ga0207668_10160980 3300025972 Bacteria 1749
1068 Ga0207668_10185382 3300025972 Bacteria 1645
1069 Ga0207668_10284338 3300025972 Bacteria 1358
1070 Ga0207668_10564733 3300025972 Bacteria 987
1071 Ga0207668_11103147 3300025972 Bacteria 711
1072 Ga0207668_11177387 3300025972 Bacteria 688
1073 Ga0207668_11208167 3300025972 Bacteria 679
1074 Ga0207640_10001781 3300025981 Bacteria 11576
1075 Ga0207640_10114521 3300025981 Bacteria 1919
1076 Ga0207640_10276907 3300025981 Bacteria 1316
1077 Ga0207640_10502366 3300025981 Bacteria 1010
1078 Ga0207640_11005044 3300025981 Bacteria 734
1079 Ga0207640_11475505 3300025981 Bacteria 611
1080 Ga0207658_10005312 3300025986 Bacteria 8859
1081 Ga0207658_10035630 3300025986 Bacteria 3565
1082 Ga0207658_10069435 3300025986 Bacteria 2662
1083 Ga0207658_10117580 3300025986 Bacteria 2113
1084 Ga0207658_10134850 3300025986 Bacteria 1989
1085 Ga0207658_10268119 3300025986 Bacteria 1458
1086 Ga0207658_10278531 3300025986 Bacteria 1433
1087 Ga0207658_11076938 3300025986 Bacteria 734
1088 Ga0207677_10000972 3300026023 Bacteria 15863
1089 Ga0207677_10001461 3300026023 Bacteria 12514
1090 Ga0207677_10006577 3300026023 Bacteria 6377
1091 Ga0207677_10568710 3300026023 Bacteria 991
1092 Ga0207677_10695636 3300026023 Bacteria 902
1093 Ga0207677_11868105 3300026023 Bacteria 558
1094 Ga0207703_10012389 3300026035 Bacteria 6646
1095 Ga0207703_10082733 3300026035 Bacteria 2680
1096 Ga0207703_10621142 3300026035 Bacteria 1023
1097 Ga0207703_10831053 3300026035 Bacteria 883
1098 Ga0207703_11080904 3300026035 Bacteria 770
1099 Ga0207639_10004119 3300026041 Bacteria 9804
1100 Ga0207639_10032894 3300026041 Bacteria 3822
1101 Ga0207639_10067958 3300026041 Bacteria 2775
1102 Ga0207639_10215624 3300026041 Bacteria 1655
1103 Ga0207639_10898220 3300026041 Bacteria 828
1104 Ga0207639_10988179 3300026041 Bacteria 788
1105 Ga0207678_10018317 3300026067 Bacteria 6150
1106 Ga0207678_10073350 3300026067 Bacteria 2933
1107 Ga0207678_10649783 3300026067 Bacteria 926
1108 Ga0207678_10864781 3300026067 Bacteria 799
1109 Ga0207678_11010811 3300026067 Bacteria 736
1110 Ga0207678_11168927 3300026067 Bacteria 681
1111 Ga0207678_11196387 3300026067 Bacteria 673
1112 Ga0207678_11362173 3300026067 Bacteria 627
1113 Ga0207678_11499097 3300026067 Bacteria 595
1114 Ga0207708_10222353 3300026075 Bacteria 1513
1115 Ga0207702_10000698 3300026078 Bacteria 36205
1116 Ga0207702_10000732 3300026078 Bacteria 35124
1117 Ga0207702_10001319 3300026078 Bacteria 24844
1118 Ga0207702_10184699 3300026078 Bacteria 1922
1119 Ga0207702_10277540 3300026078 Bacteria 1583
1120 Ga0207702_10553839 3300026078 Bacteria 1125
1121 Ga0207702_10797152 3300026078 Bacteria 934
1122 Ga0207702_11018288 3300026078 Bacteria 822
1123 Ga0207641_10003025 3300026088 Bacteria 15148
1124 Ga0207641_10082621 3300026088 Bacteria 2791
1125 Ga0207641_10096599 3300026088 Bacteria 2595
1126 Ga0207641_10354578 3300026088 Bacteria 1399
1127 Ga0207648_10000146 3300026089 Bacteria 70573
1128 Ga0207648_10001822 3300026089 Bacteria 23296
1129 Ga0207648_10003244 3300026089 Bacteria 17114
1130 Ga0207648_10011303 3300026089 Bacteria 8416
1131 Ga0207648_10013115 3300026089 Bacteria 7728
1132 Ga0207648_10193560 3300026089 Bacteria 1803
1133 Ga0207648_10265695 3300026089 Bacteria 1532
1134 Ga0207648_10280515 3300026089 Bacteria 1490
1135 Ga0207648_10309354 3300026089 Bacteria 1418
1136 Ga0207648_10316866 3300026089 Bacteria 1401
1137 Ga0207648_10525420 3300026089 Bacteria 1085
1138 Ga0207648_10627607 3300026089 Bacteria 992
1139 Ga0207648_11413271 3300026089 Bacteria 654
1140 Ga0207676_10001000 3300026095 Bacteria 21763
1141 Ga0207676_10007652 3300026095 Bacteria 7669
1142 Ga0207676_10014293 3300026095 Bacteria 5708
1143 Ga0207676_10214855 3300026095 Bacteria 1709
1144 Ga0207676_10307788 3300026095 Bacteria 1449
1145 Ga0207676_10592142 3300026095 Bacteria 1064
1146 Ga0207676_11598846 3300026095 Bacteria 650
1147 Ga0207676_11608865 3300026095 Bacteria 647
1148 Ga0207674_10005362 3300026116 Bacteria 15251
1149 Ga0207674_10012070 3300026116 Bacteria 9676
1150 Ga0207674_10020685 3300026116 Bacteria 7102
1151 Ga0207674_10083208 3300026116 Bacteria 3200
1152 Ga0207674_10126264 3300026116 Bacteria 2524
1153 Ga0207674_10203057 3300026116 Bacteria 1931
1154 Ga0207674_10323642 3300026116 Bacteria 1491
1155 Ga0207674_10340698 3300026116 Bacteria 1450
1156 Ga0207674_10637731 3300026116 Bacteria 1029
1157 Ga0207674_10929873 3300026116 Bacteria 838
1158 Ga0207674_10956645 3300026116 Bacteria 825
1159 Ga0207674_11239762 3300026116 Bacteria 715
1160 Ga0207674_11559830 3300026116 Bacteria 629
1161 Ga0207675_100000857 3300026118 Bacteria 30347
1162 Ga0207675_100007272 3300026118 Bacteria 10465
1163 Ga0207675_100048118 3300026118 Bacteria 3980
1164 Ga0207675_101542020 3300026118 Bacteria 685
1165 Ga0207675_101706059 3300026118 Bacteria 650
1166 Ga0207675_102439470 3300026118 Bacteria 535
1167 Ga0207683_10003588 3300026121 Bacteria 13534
1168 Ga0207683_10025072 3300026121 Bacteria 5142
1169 Ga0207683_10100629 3300026121 Bacteria 2580
1170 Ga0207683_10237104 3300026121 Bacteria 1664
1171 Ga0207683_10296833 3300026121 Bacteria 1478
1172 Ga0207683_10389095 3300026121 Bacteria 1282
1173 Ga0207683_11136446 3300026121 Bacteria 724
1174 Ga0207683_11149581 3300026121 Bacteria 720
1175 Ga0207698_10048848 3300026142 Bacteria 3215
1176 Ga0207698_10059821 3300026142 Bacteria 2960
1177 Ga0207698_10109749 3300026142 Bacteria 2309
1178 Ga0207698_10112411 3300026142 Bacteria 2286
1179 Ga0207698_10113315 3300026142 Bacteria 2278
1180 Ga0207698_10130132 3300026142 Bacteria 2149
1181 Ga0207698_10140855 3300026142 Bacteria 2078
1182 Ga0207698_10319705 3300026142 Bacteria 1453
1183 Ga0207698_10388622 3300026142 Bacteria 1330
1184 Ga0207698_10457285 3300026142 Bacteria 1234
1185 Ga0207698_10651216 3300026142 Bacteria 1043
1186 Ga0207698_10777828 3300026142 Bacteria 958
1187 Ga0207698_10994646 3300026142 Bacteria 849
1188 Ga0207698_11196478 3300026142 Bacteria 774
1189 Ga0207698_11490572 3300026142 Bacteria 692
1190 Ga0207698_12714087 3300026142 Bacteria 504
1191 Ga0209389_1067513 3300027296 Bacteria 2042
1192 Ga0209371_1000218 3300027312 Bacteria 77448
1193 Ga0209371_1009244 3300027312 Bacteria 3150
1194 Ga0209981_1009284 3300027378 Bacteria 1344
1195 Ga0209981_1046705 3300027378 Bacteria 652
1196 Ga0209996_1001204 3300027395 Bacteria 3121
1197 Ga0209995_1003268 3300027471 Bacteria 2582
1198 Ga0209968_1000123 3300027526 Bacteria 13790
1199 Ga0209999_1009109 3300027543 Bacteria 1794
1200 Ga0209282_1002929 3300027666 Bacteria 10032
1201 Ga0209966_1000001 3300027695 Bacteria 139125
1202 Ga0209998_10020024 3300027717 Bacteria 1429
1203 Ga0209998_10043006 3300027717 Bacteria 1030
1204 Ga0209813_10018067 3300027866 Bacteria 1944
1205 Ga0209813_10045904 3300027866 Bacteria 1347
1206 Ga0209813_10144705 3300027866 Bacteria 847
1207 Ga0209813_10227928 3300027866 Bacteria 700
1208 Ga0209813_10335095 3300027866 Bacteria 595
1209 Ga0209813_10356493 3300027866 Bacteria 580
1210 Ga0209974_10001570 3300027876 Bacteria 8281
1211 Ga0209974_10039516 3300027876 Bacteria 1569
1212 Ga0209974_10133454 3300027876 Bacteria 887
1213 Ga0207428_10775357 3300027907 Bacteria 682
1214 Ga0268266_10081508 3300028379 Bacteria 2822
1215 Ga0268266_10327068 3300028379 Bacteria 1436
1216 Ga0268266_10466277 3300028379 Bacteria 1202
1217 Ga0268266_10562082 3300028379 Bacteria 1094
1218 Ga0268266_11245677 3300028379 Bacteria 719
1219 Ga0268265_10008049 3300028380 Bacteria 7120
1220 Ga0268265_10094734 3300028380 Bacteria 2395
1221 Ga0268265_10395518 3300028380 Bacteria 1276
1222 Ga0268264_10009130 3300028381 Bacteria 8221
1223 Ga0268264_10073483 3300028381 Bacteria 2902
1224 Ga0268264_10245697 3300028381 Bacteria 1660
1225 Ga0268264_10264306 3300028381 Bacteria 1605
1226 Ga0268264_10549097 3300028381 Bacteria 1133
1227 Ga0268264_10757437 3300028381 Bacteria 968
1228 Ga0265334_10122037 3300028573 Bacteria 931
1229 Ga0265323_10040942 3300028653 Bacteria 1683
1230 Ga0307517_10000805 3300028786 Bacteria 53822
1231 Ga0307517_10077388 3300028786 Bacteria 2891
1232 Ga0307517_10183915 3300028786 Bacteria 1342
1233 Ga0307517_10195603 3300028786 Bacteria 1274
1234 Ga0307517_10346790 3300028786 Bacteria 808
1235 Ga0307517_10407601 3300028786 Bacteria 717
1236 Ga0307515_10000020 3300028794 Bacteria 411735
1237 Ga0307515_10000053 3300028794 Bacteria 266512
1238 Ga0307515_10001032 3300028794 Bacteria 63662
1239 Ga0307515_10002612 3300028794 Bacteria 38796
1240 Ga0307515_10005265 3300028794 Bacteria 26299
1241 Ga0307515_10014672 3300028794 Bacteria 14505
1242 Ga0307515_10037926 3300028794 Bacteria 7729
1243 Ga0307515_10045683 3300028794 Bacteria 6719
1244 Ga0307515_10048358 3300028794 Bacteria 6432
1245 Ga0307515_10084485 3300028794 Bacteria 4076
1246 Ga0307515_10112003 3300028794 Bacteria 3178
1247 Ga0307515_10413000 3300028794 Bacteria 972
1248 Ga0307515_10588117 3300028794 Bacteria 723
1249 Ga0265324_10227390 3300029957 Bacteria 633
1250 Ga0268256_1000174 3300030500 Bacteria 77446
1251 Ga0268256_1016030 3300030500 Bacteria 2162
1252 Ga0268256_1021508 3300030500 Bacteria 1714
1253 Ga0307512_10035617 3300030522 Bacteria 4237
1254 Ga0307512_10044313 3300030522 Bacteria 3659
1255 Ga0307512_10233285 3300030522 Bacteria 942
1256 Ga0316177_1178071 3300030731 Bacteria 1134
1257 Ga0316176_1020296 3300030732 Bacteria 2826
1258 Ga0314311_1266168 3300030733 Bacteria 1423
1259 Ga0316179_1063983 3300030734 Bacteria 1196
1260 Ga0316178_1148277 3300030735 Bacteria 2926
1261 Ga0316183_1017320 3300030742 Bacteria 4162
1262 Ga0316181_1020992 3300030744 Bacteria 2041
1263 Ga0316182_1299692 3300030745 Bacteria 2275
1264 Ga0265327_10000158 3300031251 Bacteria 145905
1265 Ga0265327_10000640 3300031251 Bacteria 56812
1266 Ga0265327_10023188 3300031251 Bacteria 3682
1267 Ga0265327_10227028 3300031251 Bacteria 838
1268 Ga0265327_10316668 3300031251 Bacteria 685
1269 Ga0265316_10236963 3300031344 Bacteria 1342
1270 Ga0265316_11282330 3300031344 Bacteria 506
1271 Ga0307513_10014068 3300031456 Bacteria 9795
1272 Ga0307513_10119699 3300031456 Bacteria 2604
1273 Ga0307513_10135699 3300031456 Bacteria 2396
1274 Ga0307513_10158438 3300031456 Bacteria 2160
1275 Ga0307513_10242399 3300031456 Bacteria 1606
1276 Ga0307513_10323194 3300031456 Bacteria 1300
1277 Ga0307513_10476072 3300031456 Bacteria 969
1278 Ga0307513_10693839 3300031456 Bacteria 724
1279 Ga0307509_10001946 3300031507 Bacteria 34096
1280 Ga0307509_10002654 3300031507 Bacteria 28588
1281 Ga0307509_10008897 3300031507 Bacteria 12664
1282 Ga0307509_10140975 3300031507 Bacteria 2346
1283 Ga0307509_10143796 3300031507 Bacteria 2315
1284 Ga0307509_10202426 3300031507 Bacteria 1820
1285 Ga0307509_10291208 3300031507 Bacteria 1387
1286 Ga0307509_11005609 3300031507 Bacteria 501
1287 Ga0307408_100008062 3300031548 Bacteria 6962
1288 Ga0307408_100008200 3300031548 Bacteria 6899
1289 Ga0307408_100047567 3300031548 Bacteria 3073
1290 Ga0307408_100065038 3300031548 Bacteria 2673
1291 Ga0307408_100076502 3300031548 Bacteria 2490
1292 Ga0307408_100154143 3300031548 Bacteria 1817
1293 Ga0307408_100214499 3300031548 Bacteria 1567
1294 Ga0307408_100317795 3300031548 Bacteria 1310
1295 Ga0307408_100610836 3300031548 Bacteria 970
1296 Ga0307408_100968574 3300031548 Bacteria 782
1297 Ga0307408_102219087 3300031548 Bacteria 531
1298 Ga0307508_10000004 3300031616 Bacteria 287547
1299 Ga0307508_10000078 3300031616 Bacteria 113416
1300 Ga0307508_10002611 3300031616 Bacteria 18949
1301 Ga0307508_10058330 3300031616 Bacteria 3416
1302 Ga0307508_10097952 3300031616 Bacteria 2525
1303 Ga0307508_10387871 3300031616 Bacteria 988
1304 Ga0307508_10536118 3300031616 Bacteria 767
1305 Ga0307514_10003397 3300031649 Bacteria 15360
1306 Ga0307514_10122350 3300031649 Bacteria 1811
1307 Ga0307514_10132041 3300031649 Bacteria 1717
1308 Ga0316579_10367458 3300031691 Bacteria 695
1309 Ga0307516_10000497 3300031730 Bacteria 52295
1310 Ga0307516_10001023 3300031730 Bacteria 38802
1311 Ga0307516_10017381 3300031730 Bacteria 7501
1312 Ga0307516_10022278 3300031730 Bacteria 6508
1313 Ga0307516_10022921 3300031730 Bacteria 6407
1314 Ga0307516_10046323 3300031730 Bacteria 4291
1315 Ga0307516_10156564 3300031730 Bacteria 2032
1316 Ga0307516_10209567 3300031730 Bacteria 1664
1317 Ga0307516_10402920 3300031730 Bacteria 1027
1318 Ga0307516_10859608 3300031730 Bacteria 571
1319 Ga0307516_11014043 3300031730 Bacteria 503
1320 Ga0307405_10002891 3300031731 Bacteria 7731
1321 Ga0307405_10033496 3300031731 Bacteria 3048
1322 Ga0307405_10058525 3300031731 Bacteria 2425
1323 Ga0307405_10072893 3300031731 Bacteria 2215
1324 Ga0307405_10091624 3300031731 Bacteria 2014
1325 Ga0307405_10145859 3300031731 Bacteria 1657
1326 Ga0307405_12061651 3300031731 Bacteria 511
1327 Ga0316577_10076331 3300031733 Bacteria 1871
1328 Ga0307413_10018011 3300031824 Bacteria 3694
1329 Ga0307413_10036799 3300031824 Bacteria 2821
1330 Ga0307413_10221794 3300031824 Bacteria 1382
1331 Ga0307413_10717891 3300031824 Bacteria 832
1332 Ga0307413_11200767 3300031824 Bacteria 660
1333 Ga0307413_11585218 3300031824 Bacteria 581
1334 Ga0307410_10082470 3300031852 Bacteria 2262
1335 Ga0307410_10124374 3300031852 Bacteria 1886
1336 Ga0307410_10499673 3300031852 Bacteria 1000
1337 Ga0307410_10565987 3300031852 Bacteria 944
1338 Ga0307410_12130887 3300031852 Bacteria 502
1339 Ga0307406_10007967 3300031901 Bacteria 5901
1340 Ga0307406_10182693 3300031901 Bacteria 1528
1341 Ga0307406_10189848 3300031901 Bacteria 1503
1342 Ga0307406_10597273 3300031901 Bacteria 910
1343 Ga0307406_11168192 3300031901 Bacteria 667
1344 Ga0307406_11340675 3300031901 Bacteria 625
1345 Ga0307407_10071891 3300031903 Bacteria 2061
1346 Ga0307407_10307089 3300031903 Bacteria 1108
1347 Ga0307407_10482758 3300031903 Bacteria 905
1348 Ga0307407_11322006 3300031903 Bacteria 566
1349 Ga0307412_10001384 3300031911 Bacteria 13466
1350 Ga0307412_10003210 3300031911 Bacteria 9088
1351 Ga0307412_10021895 3300031911 Bacteria 3910
1352 Ga0307412_10034400 3300031911 Bacteria 3229
1353 Ga0307412_10043071 3300031911 Bacteria 2938
1354 Ga0307412_10043743 3300031911 Bacteria 2918
1355 Ga0307412_10056266 3300031911 Bacteria 2621
1356 Ga0307412_10156113 3300031911 Bacteria 1689
1357 Ga0307412_10236021 3300031911 Bacteria 1411
1358 Ga0307412_10356212 3300031911 Bacteria 1177
1359 Ga0307412_10683024 3300031911 Bacteria 879
1360 Ga0307412_10721909 3300031911 Bacteria 857
1361 Ga0307412_10791088 3300031911 Bacteria 822
1362 Ga0307412_11002241 3300031911 Bacteria 738
1363 Ga0307412_11449973 3300031911 Bacteria 622
1364 Ga0307409_100000086 3300031995 Bacteria 33256
1365 Ga0307409_100024728 3300031995 Bacteria 4196
1366 Ga0307409_100732557 3300031995 Bacteria 991
1367 Ga0307409_101027605 3300031995 Bacteria 843
1368 Ga0307409_101972378 3300031995 Bacteria 613
1369 Ga0307409_102028809 3300031995 Bacteria 605
1370 Ga0307409_102617248 3300031995 Bacteria 533
1371 Ga0307409_102943023 3300031995 Bacteria 503
1372 Ga0307416_100024835 3300032002 Bacteria 4382
1373 Ga0307416_100051514 3300032002 Bacteria 3289
1374 Ga0307416_100130486 3300032002 Bacteria 2261
1375 Ga0307416_100323291 3300032002 Bacteria 1546
1376 Ga0307416_100571575 3300032002 Bacteria 1206
1377 Ga0307416_100623909 3300032002 Bacteria 1160
1378 Ga0307416_101059411 3300032002 Bacteria 915
1379 Ga0307416_101197589 3300032002 Bacteria 865
1380 Ga0307416_101306335 3300032002 Bacteria 831
1381 Ga0307416_101383634 3300032002 Bacteria 809
1382 Ga0307416_101405940 3300032002 Bacteria 803
1383 Ga0307414_10024960 3300032004 Bacteria 3820
1384 Ga0307414_10067625 3300032004 Bacteria 2560
1385 Ga0307414_10086711 3300032004 Bacteria 2311
1386 Ga0307414_10111423 3300032004 Bacteria 2084
1387 Ga0307414_10115418 3300032004 Bacteria 2053
1388 Ga0307414_10174830 3300032004 Bacteria 1721
1389 Ga0307414_11097499 3300032004 Bacteria 735
1390 Ga0307414_11161104 3300032004 Bacteria 714
1391 Ga0307411_10005193 3300032005 Bacteria 6369
1392 Ga0307411_10063367 3300032005 Bacteria 2470
1393 Ga0307411_10074309 3300032005 Bacteria 2316
1394 Ga0307411_10104486 3300032005 Bacteria 2012
1395 Ga0307411_10123397 3300032005 Bacteria 1879
1396 Ga0307411_10180169 3300032005 Bacteria 1603
1397 Ga0307411_10254323 3300032005 Bacteria 1383
1398 Ga0307411_10613968 3300032005 Bacteria 937
1399 Ga0307411_10995515 3300032005 Bacteria 750
1400 Ga0307411_11988153 3300032005 Bacteria 542
1401 Ga0307415_100000361 3300032126 Bacteria 19367
1402 Ga0307415_100133882 3300032126 Bacteria 1881
1403 Ga0307415_101088308 3300032126 Bacteria 748
1404 Ga0316593_10026594 3300032168 Bacteria 1851
1405 Ga0307507_10100794 3300033179 Bacteria 2418
1406 Ga0307507_10130139 3300033179 Bacteria 1973
1407 Ga0307510_10009306 3300033180 Bacteria 11707
1408 Ga0307510_10017087 3300033180 Bacteria 8559
1409 Ga0307510_10041763 3300033180 Bacteria 5008
1410 Ga0307510_10135811 3300033180 Bacteria 2117
1411 Ga0307510_10279920 3300033180 Bacteria 1139
1412 Ga0307510_10367980 3300033180 Bacteria 885
1413 Ga0373930_0026313 3300034816 Bacteria 1172
1414 Ga0373959_0033468 3300034820 Bacteria 1049
1415 Ga0373959_0090448 3300034820 Bacteria 717
1416 Ga0373938_0081594 3300034957 Bacteria 788
1417 Ga0373938_0110016 3300034957 Bacteria 701
1418 Ga0373928_0132188 3300035084 Bacteria 678
1419 Ga0373929_0032309 3300035085 Bacteria 1125
1420 Ga0373940_0011192 3300035088 Bacteria 2127
1421 Ga0373944_0177474 3300035089 Bacteria 762
1422 Ga0373944_0193002 3300035089 Bacteria 735
1423 Ga0373944_0194084 3300035089 Bacteria 733
1424 Ga0373944_0249845 3300035089 Bacteria 654
1425 Ga0373952_0050313 3300035092 Bacteria 991
1426 Ga0373923_0304964 3300035111 Bacteria 754
1427 Ga0373941_0224634 3300035115 Bacteria 723
1428 Ga0373941_0340503 3300035115 Bacteria 608
1429 Ga0373945_0142088 3300035116 Bacteria 968
1430 Ga0373953_0129594 3300035117 Bacteria 1075
1431 Ga0373943_0159516 3300035170 Bacteria 1227
1432 Ga0373946_0039114 3300035171 Bacteria 1935
1433 Ga0373955_0450700 3300035172 Bacteria 784
1434 Ga0373942_0070650 3300035207 Bacteria 1019
1435 Ga0373962_0312170 3300035242 Bacteria 560
1436 Ga0373924_0528130 3300035410 Bacteria 531
1437 Ga0373931_0009283 3300035691 Bacteria 4699
1438 Ga0373931_0014386 3300035691 Bacteria 3866
1439 Ga0373931_0026583 3300035691 Bacteria 2947
1440 Ga0373935_0311811 3300035692 Bacteria 1114
1441 Ga0373935_0523714 3300035692 Bacteria 862
1442 Ga0373935_1408693 3300035692 Bacteria 521
1443 Ga0373927_0009569 3300035695 Bacteria 6500
1444 Ga0373927_0211207 3300035695 Bacteria 1275
1445 Ga0373927_0240876 3300035695 Bacteria 1189
1446 Ga0373933_1163731 3300035724 Bacteria 508
1447 Ga0373947_0473855 3300035725 Bacteria 849
1448 Ga0373947_0531919 3300035725 Bacteria 800
1449 Ga0373947_0891802 3300035725 Bacteria 607
1450 Ga0373937_0069375 3300036401 Bacteria 3250
1451 Ga0373937_0381456 3300036401 Bacteria 1337
1452 Ga0316582_0015066 3300036647 Bacteria 4407
1453 Ga0316584_0092501 3300036712 Bacteria 2264
1454 Ga0373925_0078641 3300037068 Bacteria 2505
1455 Ga0373925_0242397 3300037068 Bacteria 1444
1456 Ga0373925_0307578 3300037068 Bacteria 1281
1457 Ga0373925_0330534 3300037068 Bacteria 1235
1458 Ga0395899_0004720 3300037312 Bacteria 10633
1459 Ga0395900_0000109 3300037418 Bacteria 146053
1460 Ga0395900_0029684 3300037418 Bacteria 5610
1461 Ga0395900_0118039 3300037418 Bacteria 2722
1462 Ga0395900_1485775 3300037418 Bacteria 590
1463 Ga0395898_0015056 3300037466 Bacteria 7939
1464 Ga0395898_0037637 3300037466 Bacteria 4798
1465 Ga0395898_0046059 3300037466 Bacteria 4284
1466 Ga0395898_0297054 3300037466 Bacteria 1541
1467 Ga0395905_0000488 3300037471 Bacteria 54703
1468 Ga0395905_0011451 3300037471 Bacteria 8571
1469 Ga0395905_0025592 3300037471 Bacteria 5565
1470 Ga0395905_0034301 3300037471 Bacteria 4765
1471 Ga0395905_0036014 3300037471 Bacteria 4647
1472 Ga0395905_0166348 3300037471 Bacteria 2072
1473 Ga0395905_0531124 3300037471 Bacteria 1077
1474 Ga0395905_0585851 3300037471 Bacteria 1017
1475 Ga0395905_0592545 3300037471 Bacteria 1010
1476 Ga0316581_0021996 3300037588 Bacteria 1878
1477 Ga0395901_0012844 3300038443 Bacteria 8495
1478 Ga0395901_0985377 3300038443 Bacteria 820
1479 Ga0436365_1178302 3300039437 Bacteria 757
1480 Ga0436360_0258616 3300039438 Bacteria 1164
1481 Ga0436361_0167979 3300039447 Bacteria 86419
1482 Ga0436361_0214541 3300039447 Bacteria 41289
1483 Ga0436361_0217332 3300039447 Bacteria 23737
1484 Ga0436361_0359670 3300039447 Bacteria 47250
1485 Ga0436361_0529504 3300039447 Bacteria 1143
1486 Ga0436361_0683214 3300039447 Bacteria 2945
1487 Ga0436361_0769709 3300039447 Bacteria 2872
1488 Ga0436361_1056645 3300039447 Bacteria 2339
1489 Ga0436361_1092359 3300039447 Bacteria 11490
1490 Ga0436363_0880003 3300039450 Bacteria 583
1491 Ga0436363_1113045 3300039450 Bacteria 1441
1492 Ga0439436_0005082 3300041404 Bacteria 4029
1493 Ga0439436_0017528 3300041404 Bacteria 2143
1494 Ga0439436_0058755 3300041404 Bacteria 1078
1495 Ga0439438_015929 3300041405 Bacteria 2197
1496 Ga0439439_0000304 3300041406 Bacteria 7878
1497 Ga0439439_0167384 3300041406 Bacteria 629
1498 Ga0439447_041937 3300041407 Bacteria 1112
1499 Ga0439453_0072178 3300041408 Bacteria 732
1500 Ga0439461_0014042 3300041410 Bacteria 1517
1501 Ga0439461_0092374 3300041410 Bacteria 727
1502 Ga0439466_0002298 3300041411 Bacteria 7498
1503 Ga0439466_0009551 3300041411 Bacteria 3625
1504 Ga0439465_0003892 3300041413 Bacteria 4872
1505 Ga0439465_0087386 3300041413 Bacteria 1063
1506 Ga0439465_0183658 3300041413 Bacteria 757
1507 Ga0439465_0382652 3300041413 Bacteria 534
1508 Ga0451789_0160463 3300041443 Bacteria 5363
1509 Ga0451791_1329588 3300041451 Bacteria 572
1510 Ga0451793_0907941 3300041452 Bacteria 566
1511 Ga0451793_1009248 3300041452 Bacteria 2201
1512 Ga0451797_1109477 3300041453 Bacteria 1051
1513 Ga0451795_0913388 3300041456 Bacteria 1183
1514 Ga0451798_0882602 3300041458 Bacteria 4359
1515 Ga0451798_1022954 3300041458 Bacteria 729
1516 Ga0451800_0983364 3300041459 Bacteria 2433
1517 Ga0451800_1592322 3300041459 Bacteria 1240
1518 Ga0451802_0064922 3300041460 Bacteria 915
1519 Ga0451806_649029 3300041462 Bacteria 543
1520 Ga0451804_0858374 3300041463 Bacteria 908
1521 Ga0451807_1165661 3300041486 Bacteria 1195
1522 Ga0451807_2033827 3300041486 Bacteria 1337
1523 Ga0451807_2607001 3300041486 Bacteria 720
1524 Ga0451833_1194697 3300041491 Bacteria 1952
1525 Ga0451839_0399468 3300041496 Bacteria 661
1526 Ga0451839_0693068 3300041496 Bacteria 648
1527 Ga0451839_0749505 3300041496 Bacteria 542
1528 Ga0451841_0449173 3300041498 Bacteria 712
1529 Ga0451845_0413049 3300041501 Bacteria 701
1530 Ga0451847_0674285 3300041503 Bacteria 655
1531 Ga0451851_0829363 3300041507 Bacteria 1397
1532 Ga0451843_0383449 3300041509 Bacteria 675
1533 Ga0451843_0510807 3300041509 Bacteria 552
1534 Ga0451843_0908011 3300041509 Bacteria 835
1535 Ga0451843_1432462 3300041509 Bacteria 545
1536 Ga0451853_0990419 3300041512 Bacteria 1450
1537 Ga0451853_1045547 3300041512 Bacteria 688
1538 Ga0451853_1701460 3300041512 Bacteria 568
1539 Ga0451853_1730775 3300041512 Bacteria 618
1540 Ga0439431_0002568 3300041997 Bacteria 4008
1541 Ga0439431_0103546 3300041997 Bacteria 784
1542 Ga0439433_0022304 3300041999 Bacteria 1419
1543 Ga0439433_0080513 3300041999 Bacteria 792
1544 Ga0439442_003022 3300042002 Bacteria 3323
1545 Ga0439442_031470 3300042002 Bacteria 1108
1546 Ga0439442_133545 3300042002 Bacteria 547
1547 Ga0439445_0021223 3300042004 Bacteria 1631
1548 Ga0439445_0051253 3300042004 Bacteria 1115
1549 Ga0439445_0258069 3300042004 Bacteria 521
1550 Ga0439448_0000154 3300042005 Bacteria 13505
1551 Ga0439448_0248931 3300042005 Bacteria 627
1552 Ga0439432_003328 3300042006 Bacteria 5971
1553 Ga0439432_150236 3300042006 Bacteria 683
1554 Ga0439449_0002911 3300042007 Bacteria 6658
1555 Ga0439449_0004348 3300042007 Bacteria 5469
1556 Ga0439449_0142564 3300042007 Bacteria 892
1557 Ga0439452_002322 3300042010 Bacteria 7083
1558 Ga0439452_004417 3300042010 Bacteria 4721
1559 Ga0439455_0004565 3300042012 Bacteria 2752
1560 Ga0439455_0046089 3300042012 Bacteria 1129
1561 Ga0439455_0092612 3300042012 Bacteria 830
1562 Ga0439457_168515 3300042014 Bacteria 532
1563 Ga0439462_0003593 3300042015 Bacteria 3733
1564 Ga0450911_056827 3300042115 Bacteria 508
1565 Ga0450919_000602 3300042121 Bacteria 4562
1566 Ga0450919_011901 3300042121 Bacteria 988
1567 Ga0450920_005125 3300042122 Bacteria 2325
1568 Ga0450923_026479 3300042125 Bacteria 1162
1569 Ga0450888_066290 3300042126 Bacteria 537
1570 Ga0450890_016977 3300042127 Bacteria 966
1571 Ga0450890_026369 3300042127 Bacteria 809
1572 Ga0450890_034900 3300042127 Bacteria 728
1573 Ga0450897_009986 3300042128 Bacteria 906
1574 Ga0450894_013462 3300042131 Bacteria 1074
1575 Ga0450898_049450 3300042134 Bacteria 810
1576 Ga0450898_056288 3300042134 Bacteria 767
1577 Ga0450899_009850 3300042135 Bacteria 1056
1578 Ga0450899_011977 3300042135 Bacteria 972
1579 Ga0450889_015950 3300042144 Bacteria 810
1580 Ga0450906_022700 3300042145 Bacteria 1118
1581 Ga0450907_048795 3300042146 Bacteria 727
1582 Ga0439446_0196246 3300042156 Bacteria 680
1583 Ga0439446_0203182 3300042156 Bacteria 670
1584 Ga0450909_026534 3300042185 Bacteria 873
1585 Ga0439434_0002020 3300042435 Bacteria 5865
1586 Ga0439434_0004225 3300042435 Bacteria 4197
1587 Ga0439434_0091011 3300042435 Bacteria 975
1588 Ga0439459_0016027 3300042438 Bacteria 1381
1589 Ga0450918_000607 3300042531 Bacteria 7684
1590 Ga0450918_003867 3300042531 Bacteria 2757
1591 Ga0450893_0027764 3300042532 Bacteria 999
1592 Ga0451577_0006746 3300042876 Bacteria 11388
1593 Ga0451577_0008963 3300042876 Bacteria 9673
1594 Ga0451577_0065508 3300042876 Bacteria 3240
1595 Ga0451577_0238241 3300042876 Bacteria 1646
1596 Ga0451577_0404128 3300042876 Bacteria 1240
1597 Ga0451577_0445720 3300042876 Bacteria 1175
1598 Ga0451577_1015378 3300042876 Bacteria 744
1599 Ga0451577_1580173 3300042876 Bacteria 579
1600 Ga0451577_1823083 3300042876 Bacteria 534
1601 Ga0466969_0000395 3300044656 Bacteria 23961
1602 Ga0466969_0001952 3300044656 Bacteria 11030
1603 Ga0466969_0008585 3300044656 Bacteria 5419
1604 Ga0466969_0010813 3300044656 Bacteria 4834
1605 Ga0466969_0027212 3300044656 Bacteria 2929
1606 Ga0466972_0008024 3300044658 Bacteria 5291
1607 Ga0466972_0013627 3300044658 Bacteria 4079
1608 Ga0466972_0022412 3300044658 Bacteria 3146
1609 Ga0466972_0038687 3300044658 Bacteria 2330
1610 Ga0466972_0351804 3300044658 Bacteria 689
1611 Ga0466980_0248074 3300044668 Bacteria 1107
1612 Ga0453683_0001626 3300044673 Bacteria 18878
1613 Ga0453683_0119199 3300044673 Bacteria 1661
1614 Ga0453683_1211943 3300044673 Bacteria 506
1615 Ga0466965_0027809 3300044683 Bacteria 2745
1616 Ga0466965_0036578 3300044683 Bacteria 2409
1617 Ga0466965_0041138 3300044683 Bacteria 2276
1618 Ga0466965_0054005 3300044683 Bacteria 1997
1619 Ga0466965_0254979 3300044683 Bacteria 942
1620 Ga0466966_0099105 3300044684 Bacteria 1803
1621 Ga0466966_0200822 3300044684 Bacteria 1206
1622 Ga0466961_0005306 3300044693 Bacteria 8105
1623 Ga0466961_0011241 3300044693 Bacteria 5722
1624 Ga0466961_0035961 3300044693 Bacteria 3179
1625 Ga0466961_0156934 3300044693 Bacteria 1419
1626 Ga0466961_0204242 3300044693 Bacteria 1221
1627 Ga0466961_0298460 3300044693 Bacteria 984
1628 Ga0466963_0057018 3300044694 Bacteria 2601
1629 Ga0466963_0125037 3300044694 Bacteria 1772
1630 Ga0466963_0211748 3300044694 Bacteria 1356
1631 Ga0466964_0031972 3300044706 Bacteria 2089
1632 Ga0466964_0141395 3300044706 Bacteria 1106
1633 Ga0466964_0155240 3300044706 Bacteria 1065
1634 Ga0466964_0408670 3300044706 Bacteria 711
1635 Ga0453684_0003638 3300044712 Bacteria 34257
1636 Ga0453684_0088462 3300044712 Bacteria 3835
1637 Ga0453684_0139796 3300044712 Bacteria 2894
1638 Ga0453684_0172543 3300044712 Bacteria 2547
1639 Ga0453684_0349930 3300044712 Bacteria 1666
1640 Ga0453684_0483714 3300044712 Bacteria 1373
1641 Ga0453684_0513278 3300044712 Bacteria 1325
1642 Ga0453684_0606434 3300044712 Bacteria 1199
1643 Ga0453684_1089263 3300044712 Bacteria 845
1644 Ga0453684_1301134 3300044712 Bacteria 758
1645 Ga0466971_0004739 3300044719 Bacteria 5884
1646 Ga0466971_0189161 3300044719 Bacteria 969
1647 Ga0466971_0269457 3300044719 Bacteria 814
1648 Ga0466968_0059440 3300044735 Bacteria 1646
1649 Ga0466968_0185307 3300044735 Bacteria 969
1650 Ga0466968_0228024 3300044735 Bacteria 879
1651 Ga0466968_0279379 3300044735 Bacteria 799
1652 Ga0466970_0007521 3300044765 Bacteria 5464
1653 Ga0466970_0060241 3300044765 Bacteria 2033
1654 Ga0466970_0147824 3300044765 Bacteria 1297
1655 Ga0466970_0450782 3300044765 Bacteria 737
1656 Ga0466957_0014902 3300044842 Bacteria 4534
1657 Ga0466957_0117828 3300044842 Bacteria 1690
1658 Ga0466957_0166856 3300044842 Bacteria 1432
1659 Ga0466957_0202241 3300044842 Bacteria 1305
1660 Ga0466957_0268488 3300044842 Bacteria 1139
1661 Ga0466957_0443444 3300044842 Bacteria 894
1662 Ga0466960_0020318 3300044901 Bacteria 2940
1663 Ga0466960_0114141 3300044901 Bacteria 1407
1664 Ga0466960_0873204 3300044901 Bacteria 547
1665 Ga0466959_0003919 3300045049 Bacteria 9882
1666 Ga0466959_0087673 3300045049 Bacteria 2238
1667 Ga0466959_0105260 3300045049 Bacteria 2017
1668 Ga0466959_0111821 3300045049 Bacteria 1948
1669 Ga0466959_0218492 3300045049 Bacteria 1322
1670 Ga0466959_0368236 3300045049 Bacteria 979
1671 Ga0451576_0000914 3300045051 Bacteria 55935
1672 Ga0451576_0004476 3300045051 Bacteria 18097
1673 Ga0451576_0014049 3300045051 Bacteria 8922
1674 Ga0451576_0052912 3300045051 Bacteria 4254
1675 Ga0451576_0122968 3300045051 Bacteria 2702
1676 Ga0451576_0241548 3300045051 Bacteria 1887
1677 Ga0451576_0467602 3300045051 Bacteria 1324
1678 Ga0451576_0636156 3300045051 Bacteria 1121
1679 Ga0451576_1358864 3300045051 Bacteria 740
1680 Ga0466958_0074271 3300045836 Bacteria 2083
1681 Ga0466958_0473553 3300045836 Bacteria 812
1682 Ga0466967_0056668 3300045976 Bacteria 3456
1683 Ga0466967_0075650 3300045976 Bacteria 3026
1684 Ga0466967_1135311 3300045976 Bacteria 779
1685 Ga0495627_007566 3300046453 Bacteria 4154
1686 Ga0495592_0008709 3300046454 Bacteria 7615
1687 Ga0495592_0015966 3300046454 Bacteria 5697
1688 Ga0495603_0032423 3300046455 Bacteria 3143
1689 Ga0495591_156730 3300046458 Bacteria 546
1690 Ga0495629_0154872 3300046459 Bacteria 1593
1691 Ga0495629_0381748 3300046459 Bacteria 959
1692 Ga0495638_0051454 3300046460 Bacteria 2569
1693 Ga0495638_0085327 3300046460 Bacteria 1910
1694 Ga0495638_0208178 3300046460 Bacteria 1100
1695 Ga0495651_0311118 3300046462 Bacteria 1053
1696 Ga0495651_0691763 3300046462 Bacteria 636
1697 Ga0495653_0115724 3300046463 Bacteria 1919
1698 Ga0495650_0016331 3300046471 Bacteria 3765
1699 Ga0495650_0191780 3300046471 Bacteria 714
1700 Ga0495580_0145541 3300046472 Bacteria 1642
1701 Ga0495582_0117129 3300046473 Bacteria 1499
1702 Ga0495582_0542480 3300046473 Bacteria 673
1703 Ga0495605_0023835 3300046474 Bacteria 3212
1704 Ga0495605_0105856 3300046474 Bacteria 1288
1705 Ga0495639_0017429 3300046475 Bacteria 3119
1706 Ga0495639_0061533 3300046475 Bacteria 1721
1707 Ga0495664_0132586 3300046477 Bacteria 1509
1708 Ga0495584_0261560 3300046491 Bacteria 879
1709 Ga0495585_0055375 3300046492 Bacteria 2192
1710 Ga0495607_0399698 3300046501 Bacteria 625
1711 Ga0495583_0015974 3300046506 Bacteria 4055
1712 Ga0495606_0099657 3300046507 Bacteria 1771
1713 Ga0495606_0112339 3300046507 Bacteria 1642
1714 Ga0495606_0223399 3300046507 Bacteria 1060
1715 Ga0495608_0178630 3300046511 Bacteria 1344
1716 Ga0495610_0008701 3300046512 Bacteria 6532
1717 Ga0495616_0006630 3300046513 Bacteria 6993
1718 Ga0495618_0346612 3300046514 Bacteria 916
1719 Ga0495620_0010437 3300046515 Bacteria 4901
1720 Ga0495628_0140583 3300046516 Bacteria 1843
1721 Ga0495631_0002748 3300046518 Bacteria 9757
1722 Ga0495632_0009715 3300046519 Bacteria 5772
1723 Ga0495632_0016885 3300046519 Bacteria 4045
1724 Ga0495632_0173014 3300046519 Bacteria 991
1725 Ga0495637_0020235 3300046520 Bacteria 3064
1726 Ga0495648_0042223 3300046524 Bacteria 2871
1727 Ga0495648_0148033 3300046524 Bacteria 1228
1728 Ga0495648_0201241 3300046524 Bacteria 997
1729 Ga0495648_0270304 3300046524 Bacteria 811
1730 Ga0495666_0043869 3300046526 Bacteria 2160
1731 Ga0495642_0013334 3300046528 Bacteria 3178
1732 Ga0495642_0167757 3300046528 Bacteria 953
1733 Ga0495642_0554511 3300046528 Bacteria 510
1734 Ga0495654_0000550 3300046530 Bacteria 30238
1735 Ga0495654_0043604 3300046530 Bacteria 2223
1736 Ga0495640_0366968 3300046533 Bacteria 887
1737 Ga0495586_0021373 3300046535 Bacteria 3449
1738 Ga0495621_0002735 3300046539 Bacteria 4785
1739 Ga0495621_0003885 3300046539 Bacteria 4149
1740 Ga0495621_0160934 3300046539 Bacteria 888
1741 Ga0495597_0000153 3300046542 Bacteria 61233
1742 Ga0495597_0020188 3300046542 Bacteria 3107
1743 Ga0495597_0383230 3300046542 Bacteria 536
1744 Ga0495622_0088536 3300046557 Bacteria 1423
1745 Ga0495622_0250621 3300046557 Bacteria 779
1746 Ga0495656_0000929 3300046615 Bacteria 9473
1747 Ga0495656_0062221 3300046615 Bacteria 1632
1748 Ga0495656_0434962 3300046615 Bacteria 690
1749 Ga0495668_0051073 3300046616 Bacteria 2290
1750 Ga0495668_0360329 3300046616 Bacteria 798
1751 Ga0495634_0625845 3300046642 Bacteria 623
1752 Ga0495611_0175389 3300046648 Bacteria 1002
1753 Ga0495625_0000714 3300046660 Bacteria 46916
1754 Ga0495625_0010826 3300046660 Bacteria 7505
1755 Ga0495625_0096602 3300046660 Bacteria 2035
1756 Ga0495625_0108856 3300046660 Bacteria 1896
1757 Ga0495625_0148101 3300046660 Bacteria 1579
1758 Ga0495625_0627755 3300046660 Bacteria 642
1759 Ga0495625_0850208 3300046660 Bacteria 527
1760 Ga0495635_0463626 3300046663 Bacteria 837
1761 Ga0495588_0076870 3300046674 Bacteria 1740
1762 Ga0495623_0050249 3300046679 Bacteria 2641
1763 Ga0495623_0587185 3300046679 Bacteria 580
1764 Ga0495646_0031855 3300046680 Bacteria 3284
1765 Ga0495647_0009386 3300046681 Bacteria 3313
1766 Ga0495647_0010703 3300046681 Bacteria 3128
1767 Ga0495647_0097247 3300046681 Bacteria 1215
1768 Ga0495658_0201880 3300046683 Bacteria 1239
1769 Ga0495658_0213479 3300046683 Bacteria 1206
1770 Ga0495658_0300309 3300046683 Bacteria 1015
1771 Ga0495658_0348305 3300046683 Bacteria 941
1772 Ga0495658_0835723 3300046683 Bacteria 589
1773 Ga0495613_0240571 3300046689 Bacteria 1266
1774 Ga0495624_0514420 3300046690 Bacteria 716
1775 Ga0495624_0517615 3300046690 Bacteria 713
1776 Ga0495624_0905451 3300046690 Bacteria 519
1777 Ga0495670_0151238 3300046691 Bacteria 1217
1778 Ga0495670_0183285 3300046691 Bacteria 1106
1779 Ga0495671_0019317 3300046692 Bacteria 3605
1780 Ga0495671_0327995 3300046692 Bacteria 735
1781 Ga0495649_0004353 3300046694 Bacteria 9282
1782 Ga0495649_0084532 3300046694 Bacteria 1694
1783 Ga0495589_0027163 3300046794 Bacteria 2895
1784 Ga0495589_0137394 3300046794 Bacteria 1172
1785 Ga0495660_0006585 3300046810 Bacteria 6863
1786 Ga0495660_0084665 3300046810 Bacteria 1658
1787 Ga0495660_0433749 3300046810 Bacteria 570
1788 Ga0495581_0525553 3300047315 Bacteria 687
1789 Ga0495604_0900102 3300047317 Bacteria 553
1790 Ga0495636_0517764 3300047318 Bacteria 578
1791 Ga0495674_0003080 3300047319 Bacteria 16205
1792 Ga0495674_0025003 3300047319 Bacteria 5481
1793 Ga0495674_0131454 3300047319 Bacteria 2109
1794 Ga0495672_0000655 3300047320 Bacteria 38461
1795 Ga0495672_0022880 3300047320 Bacteria 4054
1796 Ga0495676_0007147 3300047321 Bacteria 10247
1797 Ga0495687_001512 3300047443 Bacteria 21202
1798 Ga0495687_002480 3300047443 Bacteria 14721
1799 Ga0495687_047916 3300047443 Bacteria 1836
1800 Ga0495677_0045384 3300047445 Bacteria 1612
1801 Ga0495673_0026656 3300047469 Bacteria 2760
1802 Ga0495684_0527155 3300047471 Bacteria 808
1803 Ga0495686_0005600 3300047472 Bacteria 9866
1804 Ga0495686_0008724 3300047472 Bacteria 7397
1805 Ga0495593_0006672 3300047673 Bacteria 6755
1806 Ga0495593_0060213 3300047673 Bacteria 1988
1807 Ga0495593_0100100 3300047673 Bacteria 1487
1808 Ga0495602_0226558 3300048088 Bacteria 1407
1809 Ga0495614_0009932 3300048089 Bacteria 4201
1810 Ga0495626_0051745 3300048091 Bacteria 1894
1811 Ga0496100_0047259 3300048903 Bacteria 2772
1812 Ga0496100_0673556 3300048903 Bacteria 806
1813 Ga0496101_0021483 3300048904 Bacteria 4435
1814 Ga0496101_0043750 3300048904 Bacteria 3201
1815 Ga0496101_0504671 3300048904 Bacteria 956
1816 Ga0496101_1055879 3300048904 Bacteria 638
1817 Ga0496102_0013747 3300048905 Bacteria 7020
1818 Ga0496102_0051832 3300048905 Bacteria 3738
1819 Ga0496102_0109753 3300048905 Bacteria 2571
1820 Ga0496102_0173558 3300048905 Bacteria 2029
1821 Ga0496103_0006569 3300048906 Bacteria 6937
1822 Ga0496103_0399580 3300048906 Bacteria 883
1823 Ga0496104_0015973 3300048907 Bacteria 6813
1824 Ga0496104_0270479 3300048907 Bacteria 1612
1825 Ga0496104_0684598 3300048907 Bacteria 933
1826 Ga0496104_1377640 3300048907 Bacteria 608
1827 Ga0496105_0005071 3300048908 Bacteria 9977
1828 Ga0496105_0030674 3300048908 Bacteria 4405
1829 Ga0496105_0045888 3300048908 Bacteria 3605
1830 Ga0496105_0241040 3300048908 Bacteria 1467
1831 Ga0496105_0828454 3300048908 Bacteria 702
1832 Ga0496105_0834771 3300048908 Bacteria 698
1833 Ga0496105_0938940 3300048908 Bacteria 650
1834 Ga0496105_0968325 3300048908 Bacteria 638
1835 Ga0496106_0184459 3300048909 Bacteria 1657
1836 Ga0496106_0540275 3300048909 Bacteria 935
1837 Ga0496107_0144211 3300048910 Bacteria 1760
1838 Ga0496108_0022590 3300048911 Bacteria 5173
1839 Ga0496108_0061117 3300048911 Bacteria 3170
1840 Ga0496108_0090344 3300048911 Bacteria 2604
1841 Ga0496108_0260502 3300048911 Bacteria 1509
1842 Ga0496108_0411333 3300048911 Bacteria 1181
1843 Ga0496108_0580207 3300048911 Bacteria 977
1844 Ga0496108_0731375 3300048911 Bacteria 857
1845 Ga0496108_1024469 3300048911 Bacteria 704
1846 Ga0496108_1396629 3300048911 Bacteria 586
1847 Ga0496109_0074882 3300048912 Bacteria 3113
1848 Ga0496109_0079105 3300048912 Bacteria 3028
1849 Ga0496109_0253973 3300048912 Bacteria 1655
1850 Ga0496109_0435780 3300048912 Bacteria 1238
1851 Ga0496109_0438180 3300048912 Bacteria 1234
1852 Ga0496109_0448801 3300048912 Bacteria 1218
1853 Ga0496110_0010246 3300048913 Bacteria 7614
1854 Ga0496110_0027229 3300048913 Bacteria 4899
1855 Ga0496110_0031132 3300048913 Bacteria 4602
1856 Ga0496110_0070427 3300048913 Bacteria 3099
1857 Ga0496110_0102247 3300048913 Bacteria 2570
1858 Ga0496110_0283289 3300048913 Bacteria 1509
1859 Ga0496110_1587025 3300048913 Bacteria 564
1860 Ga0496111_0149804 3300048914 Bacteria 1730
1861 Ga0496111_0551367 3300048914 Bacteria 846
1862 Ga0496112_0308348 3300048915 Bacteria 1528
1863 Ga0496112_0316248 3300048915 Bacteria 1506
1864 Ga0496112_0330744 3300048915 Bacteria 1467
1865 Ga0496113_0009758 3300048916 Bacteria 6311
1866 Ga0496113_0049458 3300048916 Bacteria 3130
1867 Ga0496113_0777851 3300048916 Bacteria 761
1868 Ga0496114_0079247 3300048917 Bacteria 2772
1869 Ga0496114_1395569 3300048917 Bacteria 588
1870 Ga0496115_0007123 3300048918 Bacteria 8212
1871 Ga0496116_0004666 3300048919 Bacteria 12969
1872 Ga0496116_0009886 3300048919 Bacteria 8068
1873 Ga0496116_0017716 3300048919 Bacteria 5518
1874 Ga0496116_0145930 3300048919 Bacteria 1322
1875 Ga0496116_0337573 3300048919 Bacteria 696
1876 Ga0496116_0477789 3300048919 Bacteria 525
1877 Ga0496117_0020169 3300048920 Bacteria 5445
1878 Ga0496117_0037073 3300048920 Bacteria 3637
1879 Ga0496117_0075277 3300048920 Bacteria 2243
1880 Ga0496117_0117343 3300048920 Bacteria 1643
1881 Ga0496117_0489530 3300048920 Bacteria 599
1882 Ga0496118_0007919 3300048921 Bacteria 11122
1883 Ga0496118_0011718 3300048921 Bacteria 8523
1884 Ga0496118_0015352 3300048921 Bacteria 7096
1885 Ga0496118_0071859 3300048921 Bacteria 2488
1886 Ga0496118_0186102 3300048921 Bacteria 1248
1887 Ga0496119_0049882 3300048922 Bacteria 2584
1888 Ga0496119_0063307 3300048922 Bacteria 2201
1889 Ga0496119_0075863 3300048922 Bacteria 1952
1890 Ga0496119_0228659 3300048922 Bacteria 948
1891 Ga0496119_0367284 3300048922 Bacteria 693
1892 Ga0496120_0011850 3300048923 Bacteria 5966
1893 Ga0496120_0107456 3300048923 Bacteria 1463
1894 Ga0496121_0000257 3300048924 Bacteria 112257
1895 Ga0496121_0000478 3300048924 Bacteria 77761
1896 Ga0496121_0110968 3300048924 Bacteria 2092
1897 Ga0496121_0180297 3300048924 Bacteria 1525
1898 Ga0496121_0223451 3300048924 Bacteria 1324
1899 Ga0496121_0251144 3300048924 Bacteria 1226
1900 Ga0496121_0251147 3300048924 Bacteria 1226
1901 Ga0496121_0724773 3300048924 Bacteria 595
1902 Ga0496122_0000077 3300048925 Bacteria 218099
1903 Ga0496122_0000177 3300048925 Bacteria 151124
1904 Ga0496122_0021150 3300048925 Bacteria 5837
1905 Ga0496122_0056621 3300048925 Bacteria 2921
1906 Ga0496122_0068323 3300048925 Bacteria 2552
1907 Ga0496122_0078507 3300048925 Bacteria 2312
1908 Ga0496122_0143523 3300048925 Bacteria 1489
1909 Ga0496122_0171797 3300048925 Bacteria 1305
1910 Ga0496123_0000050 3300048926 Bacteria 238021
1911 Ga0496123_0003980 3300048926 Bacteria 16002
1912 Ga0496123_0030980 3300048926 Bacteria 3902
1913 Ga0496123_0055801 3300048926 Bacteria 2588
1914 Ga0496123_0065568 3300048926 Bacteria 2307
1915 Ga0496123_0194941 3300048926 Bacteria 1044
1916 Ga0496124_0000036 3300048927 Bacteria 318032
1917 Ga0496124_0002660 3300048927 Bacteria 22924
1918 Ga0496124_0006878 3300048927 Bacteria 12232
1919 Ga0496124_0059631 3300048927 Bacteria 3205
1920 Ga0496124_0103335 3300048927 Bacteria 2305
1921 Ga0496124_0154437 3300048927 Bacteria 1796
1922 Ga0496124_0166248 3300048927 Bacteria 1714
1923 Ga0496124_0242212 3300048927 Bacteria 1340
1924 Ga0496124_0269123 3300048927 Bacteria 1249
1925 Ga0496124_0320485 3300048927 Bacteria 1110
1926 Ga0496124_0437038 3300048927 Bacteria 896
1927 Ga0496124_0472814 3300048927 Bacteria 848
1928 Ga0496125_0000146 3300048928 Bacteria 154919
1929 Ga0496125_0021126 3300048928 Bacteria 6083
1930 Ga0496125_0031217 3300048928 Bacteria 4751
1931 Ga0496125_0043130 3300048928 Bacteria 3834
1932 Ga0496125_0043843 3300048928 Bacteria 3791
1933 Ga0496125_0080851 3300048928 Bacteria 2485
1934 Ga0496125_0097356 3300048928 Bacteria 2180
1935 Ga0496125_0210477 3300048928 Bacteria 1263
1936 Ga0496125_0737410 3300048928 Bacteria 518
1937 Ga0496126_0137352 3300048929 Bacteria 2107
1938 Ga0496126_0156464 3300048929 Bacteria 1950
1939 Ga0496126_0315190 3300048929 Bacteria 1287
1940 Ga0496126_0497852 3300048929 Bacteria 974
1941 Ga0501306_021570 3300049127 Bacteria 903
1942 Ga0501310_015194 3300049130 Bacteria 911
1943 Ga0495682_0014946 3300049460 Bacteria 2941
1944 Ga0495682_0064665 3300049460 Bacteria 1319
1945 Ga0501290_007970 3300049513 Bacteria 1334
1946 Ga0501292_008734 3300049515 Bacteria 1489
1947 Ga0501298_172416 3300049521 Bacteria 539
1948 Ga0501300_009618 3300049523 Bacteria 1410
1949 Ga0501301_015817 3300049524 Bacteria 677
1950 Ga0501303_012601 3300049526 Bacteria 816
1951 Ga0501312_045622 3300049528 Bacteria 727
1952 Ga0501315_014423 3300049531 Bacteria 1001
1953 Ga0501323_026474 3300049539 Bacteria 794
1954 Ga0501032_0335137 3300049569 Bacteria 975
1955 Ga0501033_0020756 3300049570 Bacteria 4963
1956 Ga0501037_0834719 3300049573 Bacteria 607
1957 Ga0501042_0909589 3300049578 Bacteria 641
1958 Ga0501043_0000023 3300049579 Bacteria 154331
1959 Ga0501043_0095479 3300049579 Bacteria 2337
1960 Ga0501046_0000018 3300049580 Bacteria 220589
1961 Ga0501047_0000020 3300049581 Bacteria 259377
1962 Ga0501047_0019486 3300049581 Bacteria 6508
1963 Ga0501047_0279819 3300049581 Bacteria 1513
1964 Ga0501047_0287863 3300049581 Bacteria 1487
1965 Ga0501048_0001064 3300049582 Bacteria 20552
1966 Ga0501068_0794170 3300049584 Bacteria 621
1967 Ga0501070_0220651 3300049586 Bacteria 1555
1968 Ga0501074_1153505 3300049590 Bacteria 544
1969 Ga0501198_000006 3300049649 Bacteria 129954
1970 Ga0501206_022334 3300049653 Bacteria 907
1971 Ga0501222_000007 3300049662 Bacteria 126703
1972 Ga0501222_009041 3300049662 Bacteria 1319
1973 Ga0501222_027554 3300049662 Bacteria 773
1974 Ga0501249_019142 3300049679 Bacteria 1484
1975 Ga0501257_067637 3300049686 Bacteria 909
1976 Ga0501261_029283 3300049690 Bacteria 826
1977 Ga0501221_074704 3300049704 Bacteria 806
1978 Ga0501225_0022614 3300049705 Bacteria 1735
1979 Ga0501080_0447141 3300049742 Bacteria 1159
1980 Ga0501083_0743463 3300049744 Bacteria 638
1981 Ga0501241_090622 3300049758 Bacteria 647
1982 Ga0501262_000426 3300049759 Bacteria 5053
1983 Ga0501262_004524 3300049759 Bacteria 1615
1984 Ga0501265_006632 3300049762 Bacteria 1349
1985 Ga0501035_0005419 3300049822 Bacteria 12063
1986 Ga0501035_0014590 3300049822 Bacteria 7252
1987 Ga0501035_0042955 3300049822 Bacteria 4075
1988 Ga0501035_0640938 3300049822 Bacteria 862
1989 Ga0501035_1512598 3300049822 Bacteria 511
1990 Ga0501044_0000124 3300049823 Bacteria 92998
1991 Ga0501044_0349267 3300049823 Bacteria 1399
1992 nmdc:mga03683_129022_c1 3300050489 Bacteria 1130
1993 nmdc:mga03683_13658_c1 3300050489 Bacteria 2993
1994 nmdc:mga03683_15946_c1 3300050489 Bacteria 2813
1995 nmdc:mga03683_25031_c1 3300050489 Bacteria 2340
1996 nmdc:mga03683_257465_c1 3300050489 Bacteria 811
1997 nmdc:mga03683_302734_c1 3300050489 Bacteria 750
1998 nmdc:mga03683_35298_c1 3300050489 Bacteria 2028
1999 nmdc:mga03683_36243_c1 3300050489 Bacteria 2006
2000 nmdc:mga03683_403677_c1 3300050489 Bacteria 653
2001 nmdc:mga03683_40783_c1 3300050489 Bacteria 1905
2002 nmdc:mga03683_416764_c1 3300050489 Bacteria 643
2003 nmdc:mga03683_52476_c1 3300050489 Bacteria 1704
2004 nmdc:mga03683_64218_c1 3300050489 Bacteria 1557
2005 nmdc:mga03n38_119129_c1 3300050490 Bacteria 1295
2006 nmdc:mga03n38_150061_c1 3300050490 Bacteria 1172
2007 nmdc:mga03n38_29739_c1 3300050490 Bacteria 2289
2008 nmdc:mga03n38_413424_c1 3300050490 Bacteria 745
2009 nmdc:mga03n38_464600_c1 3300050490 Bacteria 706
2010 nmdc:mga03n38_518338_c1 3300050490 Bacteria 671
2011 nmdc:mga03n38_67321_c1 3300050490 Bacteria 1648
2012 nmdc:mga03n38_82759_c1 3300050490 Bacteria 1512
2013 nmdc:mga00v17_178309_c1 3300050491 Bacteria 1371
2014 nmdc:mga00v17_259459_c1 3300050491 Bacteria 1127
2015 nmdc:mga00v17_29618_c1 3300050491 Bacteria 3214
2016 nmdc:mga00v17_36194_c1 3300050491 Bacteria 2941
2017 nmdc:mga00v17_80575_c1 3300050491 Bacteria 2032
2018 nmdc:mga00v17_854253_c1 3300050491 Bacteria 578
2019 nmdc:mga00v17_948565_c1 3300050491 Bacteria 543
2020 nmdc:mga0yw44_17114_c1 3300050492 Bacteria 3936
2021 nmdc:mga0yw44_2117_c1 3300050492 Bacteria 8316
2022 nmdc:mga0yw44_568078_c1 3300050492 Bacteria 770
2023 nmdc:mga0k408_10403_c1 3300050493 Bacteria 5031
2024 nmdc:mga0k408_1042_c1 3300050493 Bacteria 15212
2025 nmdc:mga0k408_113390_c1 3300050493 Bacteria 1270
2026 nmdc:mga0k408_1409_c2 3300050493 Bacteria 9482
2027 nmdc:mga0k408_184_c1 3300050493 Bacteria 32850
2028 nmdc:mga0k408_21023_c1 3300050493 Bacteria 3663
2029 nmdc:mga0k408_213388_c1 3300050493 Bacteria 1153
2030 nmdc:mga0k408_218610_c1 3300050493 Bacteria 1138
2031 nmdc:mga0k408_234464_c1 3300050493 Bacteria 1096
2032 nmdc:mga0k408_24809_c1 3300050493 Bacteria 3093
2033 nmdc:mga0k408_249873_c1 3300050493 Bacteria 1059
2034 nmdc:mga0k408_258989_c1 3300050493 Bacteria 1039
2035 nmdc:mga0k408_269183_c1 3300050493 Bacteria 1017
2036 nmdc:mga0k408_287274_c1 3300050493 Bacteria 982
2037 nmdc:mga0k408_289518_c1 3300050493 Bacteria 978
2038 nmdc:mga0k408_308331_c1 3300050493 Bacteria 945
2039 nmdc:mga0k408_318128_c1 3300050493 Bacteria 929
2040 nmdc:mga0k408_319019_c1 3300050493 Bacteria 927
2041 nmdc:mga0k408_3275_c1 3300050493 Bacteria 8570
2042 nmdc:mga0k408_33719_c1 3300050493 Bacteria 2929
2043 nmdc:mga0k408_33735_c1 3300050493 Bacteria 2928
2044 nmdc:mga0k408_344847_c1 3300050493 Bacteria 888
2045 nmdc:mga0k408_369265_c1 3300050493 Bacteria 855
2046 nmdc:mga0k408_371103_c1 3300050493 Bacteria 853
2047 nmdc:mga0k408_37772_c1 3300050493 Bacteria 2773
2048 nmdc:mga0k408_38238_c2 3300050493 Bacteria 2386
2049 nmdc:mga0k408_428840_c1 3300050493 Bacteria 786
2050 nmdc:mga0k408_431_c1 3300050493 Bacteria 14862
2051 nmdc:mga0k408_446061_c1 3300050493 Bacteria 769
2052 nmdc:mga0k408_6723_c1 3300050493 Bacteria 6133
2053 nmdc:mga0k408_73412_c1 3300050493 Bacteria 1998
2054 nmdc:mga0k408_85145_c1 3300050493 Bacteria 1855
2055 nmdc:mga0k408_922826_c1 3300050493 Bacteria 506
2056 nmdc:mga0k408_98343_c1 3300050493 Bacteria 1724
2057 nmdc:mga06z11_10830_c1 3300050494 Bacteria 3904
2058 nmdc:mga06z11_150164_c1 3300050494 Bacteria 1324
2059 nmdc:mga06z11_150172_c1 3300050494 Bacteria 1324
2060 nmdc:mga06z11_15291_c1 3300050494 Bacteria 3422
2061 nmdc:mga06z11_161766_c1 3300050494 Bacteria 1280
2062 nmdc:mga06z11_524843_c1 3300050494 Bacteria 718
2063 nmdc:mga06z11_617420_c1 3300050494 Bacteria 660
2064 nmdc:mga06z11_783752_c1 3300050494 Bacteria 581
2065 nmdc:mga04h51_165110_c1 3300050495 Bacteria 854
2066 nmdc:mga04h51_183773_c1 3300050495 Bacteria 815
2067 nmdc:mga04h51_486730_c1 3300050495 Bacteria 526
2068 nmdc:mga04h51_50859_c1 3300050495 Bacteria 1390
2069 nmdc:mga04h51_55031_c1 3300050495 Bacteria 1347
2070 nmdc:mga07m45_134161_c1 3300050496 Bacteria 1433
2071 nmdc:mga07m45_142225_c1 3300050496 Bacteria 1390
2072 nmdc:mga07m45_143054_c1 3300050496 Bacteria 1386
2073 nmdc:mga07m45_1476_c1 3300050496 Bacteria 10809
2074 nmdc:mga07m45_15079_c1 3300050496 Bacteria 4127
2075 nmdc:mga07m45_172943_c1 3300050496 Bacteria 1256
2076 nmdc:mga07m45_185_c2 3300050496 Bacteria 20271
2077 nmdc:mga07m45_188626_c1 3300050496 Bacteria 1199
2078 nmdc:mga07m45_235204_c1 3300050496 Bacteria 1066
2079 nmdc:mga07m45_33735_c1 3300050496 Bacteria 2844
2080 nmdc:mga07m45_4156_c1 3300050496 Bacteria 7068
2081 nmdc:mga07m45_42688_c1 3300050496 Bacteria 2543
2082 nmdc:mga07m45_456517_c1 3300050496 Bacteria 741
2083 nmdc:mga07m45_47374_c1 3300050496 Bacteria 2417
2084 nmdc:mga07m45_51524_c1 3300050496 Bacteria 2321
2085 nmdc:mga07m45_57467_c1 3300050496 Bacteria 2200
2086 nmdc:mga07m45_63097_c1 3300050496 Bacteria 2101
2087 nmdc:mga07m45_63_c1 3300050496 Bacteria 41859
2088 nmdc:mga07m45_765786_c1 3300050496 Bacteria 554
2089 nmdc:mga07m45_8991_c1 3300050496 Bacteria 5159
2090 nmdc:mga07m45_89_c1 3300050496 Bacteria 34943
2091 nmdc:mga05p37_224604_c1 3300050507 Bacteria 2265
2092 nmdc:mga0qj67_513127_c1 3300050509 Bacteria 963
2093 nmdc:mga08y16_1118147_c1 3300050511 Bacteria 762
2094 nmdc:mga08y16_1203545_c1 3300050511 Bacteria 728
2095 nmdc:mga0rr50_1478700_c1 3300050513 Bacteria 574
2096 nmdc:mga0a205_1567267_c1 3300050515 Bacteria 507
2097 nmdc:mga0sz30_255183_c1 3300050516 Bacteria 781
2098 nmdc:mga0sz30_5833_c1 3300050516 Bacteria 4538
2099 nmdc:mga0sz30_71021_c1 3300050516 Bacteria 1499
2100 Ga0495601_0019173 3300053077 Bacteria 4170
2101 Ga0500610_0013258 3300053079 Bacteria 3829
2102 Ga0500635_0000141 3300053080 Bacteria 40938
2103 Ga0500635_0174722 3300053080 Bacteria 828
2104 Ga0495595_0027263 3300053084 Bacteria 2544
2105 Ga0495619_0305846 3300053085 Bacteria 1101
2106 Ga0500578_0012415 3300053086 Bacteria 5497
2107 Ga0500578_0014379 3300053086 Bacteria 5091
2108 Ga0500578_0269994 3300053086 Bacteria 1018
2109 Ga0500578_0332177 3300053086 Bacteria 893
2110 Ga0500643_010889 3300053087 Bacteria 3356
2111 Ga0500643_059800 3300053087 Bacteria 1071
2112 Ga0500644_0068624 3300053088 Bacteria 1271
2113 Ga0500644_0203105 3300053088 Bacteria 820
2114 Ga0500581_347294 3300053089 Bacteria 564
2115 Ga0500646_0023313 3300053090 Bacteria 1659
2116 Ga0500651_0000430 3300053093 Bacteria 22553
2117 Ga0500651_0040824 3300053093 Bacteria 2924
2118 Ga0500651_0062864 3300053093 Bacteria 2317
2119 Ga0500651_0071886 3300053093 Bacteria 2152
2120 Ga0500641_0051443 3300053096 Bacteria 1695
2121 Ga0500641_0121902 3300053096 Bacteria 1124
2122 Ga0500650_0137949 3300053098 Bacteria 1131
2123 Ga0500562_013680 3300053108 Bacteria 2075
2124 Ga0500562_033286 3300053108 Bacteria 1362
2125 Ga0500571_000252 3300053110 Bacteria 20356
2126 Ga0500593_000652 3300053117 Bacteria 13240
2127 Ga0500594_0001047 3300053118 Bacteria 5924
2128 Ga0500594_0007268 3300053118 Bacteria 2504
2129 Ga0500595_084247 3300053119 Bacteria 927
2130 Ga0500607_001874 3300053121 Bacteria 18035
2131 Ga0500608_003111 3300053122 Bacteria 6160
2132 Ga0500608_336011 3300053122 Bacteria 542
2133 Ga0500614_143450 3300053123 Bacteria 716
2134 Ga0500618_006166 3300053125 Bacteria 3547
2135 Ga0500626_170970 3300053128 Bacteria 884
2136 Ga0500628_001978 3300053129 Bacteria 3443
2137 Ga0500642_0003789 3300053130 Bacteria 4632
2138 Ga0500642_0343800 3300053130 Bacteria 664
2139 Ga0500652_000307 3300053131 Bacteria 17714
2140 Ga0500652_051518 3300053131 Bacteria 1682
2141 Ga0500658_0000352 3300053134 Bacteria 20402
2142 Ga0500658_0003377 3300053134 Bacteria 6041
2143 Ga0500559_0000191 3300053136 Bacteria 49243
2144 Ga0500559_0021313 3300053136 Bacteria 2746
2145 Ga0500559_0169647 3300053136 Bacteria 1026
2146 Ga0500559_0400613 3300053136 Bacteria 638
2147 Ga0500568_0008116 3300053139 Bacteria 5090
2148 Ga0500568_0010712 3300053139 Bacteria 4282
2149 Ga0500568_0013994 3300053139 Bacteria 3636
2150 Ga0500568_0023355 3300053139 Bacteria 2630
2151 Ga0500577_0056692 3300053142 Bacteria 1492
2152 Ga0500586_272474 3300053145 Bacteria 521
2153 Ga0500600_0004796 3300053149 Bacteria 7946
2154 Ga0500604_0005077 3300053151 Bacteria 3480
2155 Ga0500616_0079455 3300053153 Bacteria 1651
2156 Ga0500619_001373 3300053154 Bacteria 4281
2157 Ga0500622_0000160 3300053156 Bacteria 70774
2158 Ga0500622_0001454 3300053156 Bacteria 18928
2159 Ga0500622_0002916 3300053156 Bacteria 11895
2160 Ga0500622_0049393 3300053156 Bacteria 2169
2161 Ga0500627_0082231 3300053158 Bacteria 1436
2162 Ga0500627_0228641 3300053158 Bacteria 828
2163 Ga0500627_0393109 3300053158 Bacteria 592
2164 Ga0500634_0002470 3300053161 Bacteria 7808
2165 Ga0500638_003518 3300053162 Bacteria 5815
2166 Ga0500636_0000056 3300053177 Bacteria 53780
2167 Ga0500636_0021960 3300053177 Bacteria 3777
2168 Ga0500636_0176766 3300053177 Bacteria 1150
2169 Ga0500637_0082707 3300053178 Bacteria 1855
2170 Ga0500625_159704 3300053729 Bacteria 830
2171 Ga0500645_006616 3300053730 Bacteria 4111
2172 Ga0500645_130547 3300053730 Bacteria 698
2173 Ga0590071_000819 3300059421 Bacteria 8680
2174 Ga0590074_014194 3300059423 Bacteria 1347
2175 Ga0590077_094099 3300059426 Bacteria 697
2176 Ga0587107_039858 3300059652 Bacteria 754
2177 Ga0466962_0023883 3300061719 Bacteria 2938
2178 Ga0466962_0174104 3300061719 Bacteria 1048
2179 Ga0466962_0613120 3300061719 Bacteria 555
2180 2501072656 2501025501 Bacteria 7768574
2181 2501080514 2501025502 Bacteria 9641094
2182 2501410538 2501025504 Bacteria 8008976
2183 2509129719 2508501125 Bacteria 7208311
2184 2510251509 2510065045 Bacteria 7761063
2185 2511087025 2510917013 Bacteria 9951648
2186 2511096994 2510917014 Bacteria 8296963
2187 2511103804 2510917015 Bacteria 7950052
2188 2512345533 2512047030 Bacteria 9031815
2189 2513226638 2513020051 Bacteria 6053213
2190 2513960104 2513237151 Bacteria 6309801
2191 2514048883 2513237166 Bacteria 10373764
2192 2515680819 2515154122 Bacteria 8609520
2193 2515690698 2515154123 Bacteria 6387382
2194 2516019471 2515154189 Bacteria 9629850
2195 2519459173 2519103095 Bacteria 6629912
2196 2527075488 2526164713 Bacteria 6780608
2197 2547372534 2547132103 Bacteria 5115736
2198 2555260046 2554235234 Bacteria 5762085
2199 2563058828 2562617112 Bacteria 10918404
2200 2585290247 2582581311 Bacteria 6763856
2201 2587730421 2585428057 Bacteria 6737412
2202 2587733182 2585428058 Bacteria 6853932
2203 2587755893 2585428062 Bacteria 6842168
2204 2588294396 2588253510 Bacteria 6901809
2205 2599412563 2599185169 Bacteria 5441380
2206 2599624963 2599185214 Bacteria 8209958
2207 2599672975 2599185226 Bacteria 8233575
2208 2599682575 2599185227 Bacteria 8246414
2209 2599694583 2599185229 Bacteria 8216126
2210 2599736774 2599185239 Bacteria 8686614
2211 2599744846 2599185240 Bacteria 7968121
2212 2599905002 2599185292 Bacteria 6290804
2213 2600205790 2599185355 Bacteria 7968906
2214 2600812107 2600255067 Bacteria 6795583
2215 2601524089 2600255254 Bacteria 5281859
2216 2601529243 2600255255 Bacteria 5282785
2217 2601616077 2600255280 Bacteria 5292309
2218 2601620802 2600255281 Bacteria 5288753
2219 2601644144 2600255287 Bacteria 5210468
2220 2601649199 2600255288 Bacteria 5282738
2221 2601654126 2600255289 Bacteria 5281907
2222 2601659548 2600255290 Bacteria 5282218
2223 2601663969 2600255291 Bacteria 5217298
2224 2601696926 2600255298 Bacteria 5215185
2225 2601701975 2600255299 Bacteria 5218662
2226 2601706870 2600255300 Bacteria 5287774
2227 2601712179 2600255301 Bacteria 5280532
2228 2601717387 2600255302 Bacteria 5288235
2229 2601722345 2600255303 Bacteria 5219315
2230 2601727315 2600255304 Bacteria 5283973
2231 2601732620 2600255305 Bacteria 5282329
2232 2601736865 2600255306 Bacteria 5281613
2233 2601743192 2600255307 Bacteria 5439064
2234 2601753986 2600255309 Bacteria 5431045
2235 2602021080 2600255392 Bacteria 5437392
2236 2603662127 2602042052 Bacteria 5215873
2237 2603667026 2602042053 Bacteria 5214361
2238 2603839739 2602042103 Bacteria 5284714
2239 2603844813 2602042104 Bacteria 5281639
2240 2603850180 2602042105 Bacteria 5282303
2241 2603854956 2602042106 Bacteria 5282744
2242 2603867704 2602042109 Bacteria 5152801
2243 2603872532 2602042110 Bacteria 5283285
2244 2603877838 2602042111 Bacteria 5212080
2245 2606050009 2603880178 Bacteria 5283018
2246 2606071669 2603880184 Bacteria 5217896
2247 2606147400 2603880202 Bacteria 5284684
2248 2606177899 2603880211 Bacteria 5284226
2249 2609909418 2609459761 Bacteria 5513740
2250 2637223893 2636415599 Bacteria 5718434
2251 2643860359 2643221569 Bacteria 6064337
2252 2643968983 2643221592 Bacteria 6608788
2253 2643979418 2643221594 Bacteria 5811388
2254 2644119906 2643221621 Bacteria 6212786
2255 2644144114 2643221625 Bacteria 6512927
2256 2644159347 2643221628 Bacteria 5745828
2257 2644249093 2643221644 Bacteria 6865017
2258 2644273234 2643221648 Bacteria 6521465
2259 2644304328 2643221654 Bacteria 5273570
2260 2644329274 2643221658 Bacteria 6064537
2261 2644337319 2643221660 Bacteria 4208257
2262 2644401147 2643221672 Bacteria 6322190
2263 2676405306 2675903046 Bacteria 5451247
2264 2676742975 2675903129 Bacteria 7964495
2265 2707099697 2706794495 Bacteria 4536932
2266 2713476518 2711768613 Bacteria 11048459
2267 2719640623 2718217991 Bacteria 7829542
2268 2723878533 2721755763 Bacteria 4464185
2269 2735818211 2734482258 Unclassified 2930739
2270 2738717409 2738541277 Bacteria 7458140
2271 2738818678 2738541296 Bacteria 7285013
2272 2738831165 2738541298 Bacteria 7286732
2273 2738872693 2738541306 Bacteria 7284992
2274 2738879013 2738541307 Bacteria 8606193
2275 2739184323 2738543002 Bacteria 7284546
2276 2739219292 2738543008 Bacteria 7282815
2277 2739248803 2738543013 Bacteria 5618633
2278 2739278095 2738543019 Bacteria 7459457
2279 2739612878 2739367655 Bacteria 4051151
2280 2746088695 2744054900 Bacteria 8399525
2281 2746097364 2744054901 Bacteria 8397047
2282 2753571427 2751185846 Bacteria 7242164
2283 2777023209 2775507074 Bacteria 5532402
2284 2791922655 2791354903 Bacteria 4937680
2285 2792836075 2791355137 Bacteria 9654227
2286 2808972722 2808606384 Bacteria 8474373
2287 2809007704 2808606390 Bacteria 8476311
2288 2809014756 2808606391 Bacteria 8308166
2289 2809035689 2808606395 Bacteria 6020352
2290 2817261462 2816332253 Bacteria 6764532
2291 2817279148 2816332256 Bacteria 6891714
2292 2817456252 2816332286 Bacteria 6853759
2293 2819596917 2818991446 Bacteria 7757362
2294 2819619972 2818991450 Bacteria 6962147
2295 2819631298 2818991452 Bacteria 8442785
2296 2831266000 2831265667 Bacteria 7184833
2297 2831870061 2831864461 Bacteria 6502356
2298 2834641800 2834641062 Bacteria 5559922
2299 2838057871 2838054893 Bacteria 7451788
2300 2842328626 2842324504 Bacteria 9364110
2301 2842352942 2842348783 Bacteria 9002918
2302 2842458713 2842454564 Bacteria 8730687
2303 2842681050 2842677519 Bacteria 5615038
2304 2843694552 2843690924 Bacteria 5169057
2305 2846542812 2846540461 Bacteria 5471451
2306 2852107325 2852103415 Bacteria 5193810
2307 2854602836 2854601825 Bacteria 4797592
2308 2857539036 2857537821 Bacteria 5248181
2309 2857546976 2857542790 Bacteria 5326616
2310 2858956146 2858950400 Bacteria 6783797
2311 2863427387 2863421361 Bacteria 7300805
2312 2870070855 2870068957 Bacteria 8925310
2313 2881414910 2881412998 Bacteria 6492157
2314 2881715984 2881714928 Bacteria 2469486
2315 2881928151 2881927736 Bacteria 3993927
2316 2883093065 2883087390 Bacteria 9532701
2317 2884087641 2884086401 Bacteria 5005459
2318 2885197427 2885192300 Bacteria 5882526
2319 2885203659 2885198086 Bacteria 7212419
2320 2885216991 2885211737 Bacteria 7212420
2321 2885272977 2885270888 Bacteria 9831543
2322 2886849521 2886848708 Bacteria 5632523
2323 2895516583 2895511927 Bacteria 6802080
2324 2899930341 2899924645 Bacteria 7487985
2325 2900053258 2900051742 Bacteria 4985156
2326 2900634255 2900634093 Bacteria 10263517
2327 2902683727 2902682994 Bacteria 8951596
2328 2904438014 2904434214 Bacteria 6230908
2329 2904455129 2904449895 Bacteria 6927402
2330 2904457545 2904456579 Bacteria 6819253
2331 2904480507 2904479285 Bacteria 5073931
2332 2904484565 2904483920 Bacteria 7545285
2333 2904517859 2904513164 Bacteria 5476410
2334 2904543703 2904541872 Bacteria 8915136
2335 2904570006 2904564687 Bacteria 7609577
2336 2904576083 2904571731 Bacteria 7608790
2337 2904624210 2904615490 Bacteria 10047340
2338 2919111170 2919108558 Bacteria 5897419
2339 2919466901 2919462493 Bacteria 5817112
2340 2919531471 2919527303 Bacteria 7718827
2341 2919704690 2919704043 Bacteria 5560311
2342 2921652672 2921643360 Bacteria 11448031
2343 2928039454 2928037797 Bacteria 7273642
2344 2928044941 2928044640 Bacteria 7271509
2345 2928052742 2928051484 Bacteria 7773759
2346 2928064584 2928064002 Bacteria 7419480
2347 2928075000 2928070936 Bacteria 8062541
2348 2928088181 2928084124 Bacteria 7159212
2349 2928110535 2928108538 Bacteria 7360024
2350 2928116402 2928115317 Bacteria 6477646
2351 2928140051 2928135762 Bacteria 7259641
2352 2928171570 2928170801 Bacteria 8785406
2353 2928505543 2928503688 Bacteria 7268108
2354 2928542570 2928536128 Bacteria 7657547
2355 2929162745 2929160207 Bacteria 9075316
2356 2929527410 2929520902 Bacteria 6765052
2357 2935625487 2935625433 Bacteria 5042964
2358 2939570200 2939568625 Bacteria 4542555
2359 2939618774 2939617950 Bacteria 4820956
2360 2939631728 2939631187 Bacteria 6118131
2361 2939642757 2939642701 Bacteria 4475280
2362 2941485628
2363 2945876552 2945874760 Bacteria 5527237
2364 2945911258 2945909444 Bacteria 7065066
2365 2945937378 2945934425 Bacteria 7444609
2366 2945947273 2945945610 Bacteria 5951079
2367 2945977706 2945972063 Bacteria 6086495
2368 2945986454 2945984333 Bacteria 7358892
2369 2954772688 2954767861 Bacteria 5535784
2370 2969080905 2969079654 Bacteria 5439582
2371 2971822304 2971820967 Bacteria 5823634
2372 2974439579 2974435778 Bacteria 4876478
2373 2984563367 2984559226 Bacteria 5683096
2374 2984596101 2984595703 Bacteria 5682994
2375 2990705928 2990703756 Bacteria 7715990
2376 2998345739 2998344455 Bacteria 4222996
2377 3000378162 3000376612 Bacteria 4705565
2378 642425583 641736151 Bacteria 7477263
2379 642418902 641736154 Bacteria 7689995
2380 642593236 642555112 Bacteria 8676562
2381 642622133 642555113 Bacteria 8214658
2382 8018846959 8018845410 Bacteria 8933938
2383 8019504888 8019504834 Bacteria 4819156
2384 8020813612 8020807995 Bacteria 6801506
2385 8020944920 8020938398 Bacteria 7472757
2386 8020945497 8020945358 Bacteria 8467355
2387 8020957043 8020953355 Bacteria 7439080
2388 8021122099 8021120328 Bacteria 8782274
2389 8039102598 8039098773 Bacteria 6602928
2390 8040172810 8040167225 Bacteria 6542727
2391 8040173719 8040173305 Bacteria 6827067
2392 8055228235 8055225921 Bacteria 3341787
2393 8055268962 8055266321 Bacteria 7999742
2394 8055302054 8055301274 Bacteria 8587385
2395 8055694809 8055693939 Bacteria 4772047
2396 Ga0070662_100019784
2397 SwRhRL2b_contig_1415115
2398 JGI24740J21852_10005200
2399 JGI24739J22299_10033552
2400 JGI24739J22299_10040520
2401 JGI24737J22298_10022183
2402 JGI24735J21928_10043643
2403 JGI24744J21845_10047460
2404 JGI25156J39149_1000200
2405 JGI25156J39149_1001430
2406 JGI25156J39149_1004572
2407 JGI25156J39149_1007679
2408 JGI25156J39149_1020932
2409 JGI25154J39366_1000288
2410 JGI25154J39366_1000649
2411 JGI25157J39369_1000095
2412 JGI25152J39213_1001922
2413 JGI25152J39213_1004308
2414 JGI25150J39212_1027828
2415 JGI25159J45721_1010035
2416 JGI25159J45721_1010105
2417 JGI25151J46595_10000262
2418 JGI25151J46595_10001813
2419 JGI25151J46595_10023911
2420 JGI25151J46595_10030757
2421 JGI25153J46596_10001361
2422 JGI25153J46596_10020746
2423 rootH1_10061749
2424 rootH2_10002329
2425 rootH2_10166799
2426 rootL2_10000441
2427 rootL2_10237090
2428 rootH1_10049462
2429 rootH1_10068787
2430 JGI26128J50194_1001209
2431 Ga0006562J51391_1061692
2432 Ga0055538_1004535
2433 Ga0055539_1000688
2434 Ga0055539_1001465
2435 Ga0055539_1014267
2436 Ga0055533_1000100
2437 Ga0055533_1006422
2438 Ga0055532_1002241
2439 Ga0055532_1003811
2440 Ga0055525_1000011
2441 Ga0055525_1001558
2442 Ga0055535_1001571
2443 Ga0055535_1001668
2444 Ga0055542_1000027
2445 Ga0055542_1002307
2446 Ga0055529_1001099
2447 Ga0055529_1001608
2448 Ga0055526_1005479
2449 Ga0055526_1013218
2450 Ga0055537_1000193
2451 Ga0055524_1002870
2452 Ga0055524_1015745
2453 Ga0055536_1000726
2454 Ga0055536_1003097
2455 Ga0055536_1007352
2456 Ga0055536_1015208
2457 Ga0055536_1048677
2458 Ga0055534_1000186
2459 Ga0055534_1002158
2460 Ga0055534_1023929
2461 Ga0055528_1073688
2462 Ga0055530_10000754
2463 Ga0055530_10008221
2464 Ga0055530_10030912
2465 Ga0055530_10073206
2466 Ga0055540_1002266
2467 Ga0055540_1002894
2468 Ga0055540_1004211
2469 Ga0055540_1005185
2470 Ga0055540_1010868
2471 Ga0055531_10000985
2472 Ga0055531_10002017
2473 Ga0055531_10013088
2474 Ga0055531_10054307
2475 Ga0055531_10065267
2476 Ga0055541_1000908
2477 Ga0065165_1000613
2478 Ga0065165_1055167
2479 Ga0065714_10078829
2480 Ga0065714_10187930
2481 Ga0065704_10079876
2482 Ga0065704_10094721
2483 Ga0065704_10315903
2484 Ga0065712_10111357
2485 Ga0065715_10214645
2486 Ga0065715_10427078
2487 Ga0065715_10978353
2488 Ga0065707_10081939
2489 Ga0070658_10028554
2490 Ga0070658_10607777
2491 Ga0070658_11588604
2492 Ga0070676_10023135
2493 Ga0070676_10024406
2494 Ga0070676_10062029
2495 Ga0070676_10137992
2496 Ga0070676_10199487
2497 Ga0070676_11612860
2498 Ga0070683_100007089
2499 Ga0070683_100161279
2500 Ga0070690_100558986
2501 Ga0070690_101013982
2502 Ga0070690_101151193
2503 Ga0070670_100001125
2504 Ga0070670_100046529
2505 Ga0070670_100096992
2506 Ga0070670_100454984
2507 Ga0070670_100472434
2508 Ga0070677_10004970
2509 Ga0070677_10053445
2510 Ga0070677_10106704
2511 Ga0070677_10469173
2512 Ga0068869_100001634
2513 Ga0068869_100011402
2514 Ga0068869_100186279
2515 Ga0068869_100186727
2516 Ga0070666_10027432
2517 Ga0070666_10385928
2518 Ga0070680_100096787
2519 Ga0070680_100200062
2520 Ga0070682_100287160
2521 Ga0070682_100362998
2522 Ga0068868_100006467
2523 Ga0068868_100007731
2524 Ga0068868_100025309
2525 Ga0068868_100065185
2526 Ga0068868_100118510
2527 Ga0068868_101187791
2528 Ga0068868_101773706
2529 Ga0070660_100057666
2530 Ga0070660_100060030
2531 Ga0070660_100064464
2532 Ga0070660_100084433
2533 Ga0070660_100100400
2534 Ga0070660_100421144
2535 Ga0070660_100487769
2536 Ga0070689_100051808
2537 Ga0070689_101720046
2538 Ga0070691_10511035
2539 Ga0070691_10702540
2540 Ga0070687_100030647
2541 Ga0070687_100101179
2542 Ga0070661_100006518
2543 Ga0070661_100048491
2544 Ga0070661_100171509
2545 Ga0070668_100181696
2546 Ga0070668_100317949
2547 Ga0070668_100685438
2548 Ga0070668_100787852
2549 Ga0070669_100021660
2550 Ga0070669_100094234
2551 Ga0070669_100160968
2552 Ga0070669_100256084
2553 Ga0070669_100256428
2554 Ga0070669_100521925
2555 Ga0070669_100936393
2556 Ga0070669_101719900
2557 Ga0070675_100000735
2558 Ga0070675_100004598
2559 Ga0070675_100015112
2560 Ga0070675_100207836
2561 Ga0070675_100693446
2562 Ga0070671_100001944
2563 Ga0070671_100005456
2564 Ga0070671_100022352
2565 Ga0070671_100046866
2566 Ga0070671_100081043
2567 Ga0070671_100161322
2568 Ga0070671_100195282
2569 Ga0070671_100511880
2570 Ga0070671_100848462
2571 Ga0070674_100013900
2572 Ga0070674_100236533
2573 Ga0070674_100393943
2574 Ga0070674_100558089
2575 Ga0070674_100572738
2576 Ga0070674_101435039
2577 Ga0070673_100023482
2578 Ga0070673_100066105
2579 Ga0070673_100071444
2580 Ga0070673_100132605
2581 Ga0070673_100167182
2582 Ga0070673_101028246
2583 Ga0070673_101089811
2584 Ga0070673_101167683
2585 Ga0070673_101976188
2586 Ga0070688_101394628
2587 Ga0070659_100003967
2588 Ga0070659_100008273
2589 Ga0070659_100025101
2590 Ga0070659_100063404
2591 Ga0070659_100227135
2592 Ga0070659_100239306
2593 Ga0070659_100776578
2594 Ga0070659_100897242
2595 Ga0070659_101989550
2596 Ga0070667_100006642
2597 Ga0070667_100021358
2598 Ga0070667_100032736
2599 Ga0070667_100065683
2600 Ga0070667_100157606
2601 Ga0070667_100177885
2602 Ga0070667_100358733
2603 Ga0070667_100500355
2604 Ga0070711_101059401
2605 Ga0070705_101672577
2606 Ga0070700_100009387
2607 Ga0070694_101409094
2608 Ga0070708_100234856
2609 Ga0070663_100037434
2610 Ga0070663_100087596
2611 Ga0070678_100024742
2612 Ga0070678_100035395
2613 Ga0070678_100077032
2614 Ga0070678_100309688
2615 Ga0070678_100343197
2616 Ga0070678_100580319
2617 Ga0070678_101064826
2618 Ga0070678_101213316
2619 Ga0070678_101541364
2620 Ga0070662_100009726
2621 Ga0070662_100011762
2622 Ga0070662_100320690
2623 Ga0070662_100597588
2624 Ga0070662_100649418
2625 Ga0070681_10680870
2626 Ga0070681_11479174
2627 Ga0068867_100000085
2628 Ga0068867_100004130
2629 Ga0068867_100008539
2630 Ga0068867_100013868
2631 Ga0068867_100105705
2632 Ga0068867_100115384
2633 Ga0068867_100197479
2634 Ga0068867_100322526
2635 Ga0068867_100575423
2636 Ga0068867_100597927
2637 Ga0070685_10597373
2638 Ga0070706_100000822
2639 Ga0070706_100156252
2640 Ga0070707_100631562
2641 Ga0070707_100926753
2642 Ga0070699_101304060
2643 Ga0070684_100002981
2644 Ga0070684_100170273
2645 Ga0070684_100300695
2646 Ga0068853_100057775
2647 Ga0068853_100149756
2648 Ga0068853_100157572
2649 Ga0068853_100222162
2650 Ga0068853_100375749
2651 Ga0070672_100000244
2652 Ga0070672_100005577
2653 Ga0070672_100008576
2654 Ga0070672_100010686
2655 Ga0070672_100125840
2656 Ga0070672_100350090
2657 Ga0070672_100377133
2658 Ga0070672_100592457
2659 Ga0070686_100295769
2660 Ga0070695_100421502
2661 Ga0070693_100355385
2662 Ga0070693_100570766
2663 Ga0070665_100006131
2664 Ga0070665_100107301
2665 Ga0070665_100225136
2666 Ga0070665_100573091
2667 Ga0070665_102492028
2668 Ga0068855_100030205
2669 Ga0068855_100125071
2670 Ga0068855_100166273
2671 Ga0068855_100176007
2672 Ga0068855_100191710
2673 Ga0068855_100395419
2674 Ga0068855_101423419
2675 Ga0068855_101437348
2676 Ga0070664_100021750
2677 Ga0070664_100037096
2678 Ga0070664_100050836
2679 Ga0070664_100179981
2680 Ga0070664_100319026
2681 Ga0070664_100451978
2682 Ga0070664_100552726
2683 Ga0068857_100018728
2684 Ga0068857_100045340
2685 Ga0068857_100115387
2686 Ga0068857_100426752
2687 Ga0068857_100600050
2688 Ga0068857_100787047
2689 Ga0068857_100845678
2690 Ga0068857_101495090
2691 Ga0068854_100002508
2692 Ga0068854_100006996
2693 Ga0068854_100080379
2694 Ga0068854_100096393
2695 Ga0068854_100130539
2696 Ga0068854_100375269
2697 Ga0068854_100384051
2698 Ga0068854_100527821
2699 Ga0068854_100754653
2700 Ga0068856_100013314
2701 Ga0068856_100022023
2702 Ga0068856_100043233
2703 Ga0068856_100098167
2704 Ga0068856_100521922
2705 Ga0068856_100707698
2706 Ga0070702_100122681
2707 Ga0068852_100008757
2708 Ga0068852_100076296
2709 Ga0068852_100109246
2710 Ga0068852_100126238
2711 Ga0068852_100162554
2712 Ga0068852_100177678
2713 Ga0068852_100206166
2714 Ga0068852_100252479
2715 Ga0068852_100295609
2716 Ga0068852_101055902
2717 Ga0068852_102076170
2718 Ga0068859_100032096
2719 Ga0068859_100222130
2720 Ga0068859_100437590
2721 Ga0068859_100539851
2722 Ga0068859_100586895
2723 Ga0068859_101977742
2724 Ga0068864_100011590
2725 Ga0068864_100015868
2726 Ga0068864_100032380
2727 Ga0068864_100078599
2728 Ga0068866_10035274
2729 Ga0068866_10245943
2730 Ga0068861_100000582
2731 Ga0068861_100000677
2732 Ga0068861_100119213
2733 Ga0068851_10005711
2734 Ga0068851_10079563
2735 Ga0068851_10086935
2736 Ga0068851_10112479
2737 Ga0068851_10405114
2738 Ga0068851_10606699
2739 Ga0068870_10205411
2740 Ga0068870_10257640
2741 Ga0068870_10540408
2742 Ga0068870_10725988
2743 Ga0068870_11226770
2744 Ga0068863_100004173
2745 Ga0068863_100082398
2746 Ga0068863_100093622
2747 Ga0068863_100357715
2748 Ga0068858_100000560
2749 Ga0068858_100037529
2750 Ga0068858_100057084
2751 Ga0068858_100397457
2752 Ga0068858_100780252
2753 Ga0068858_101140323
2754 Ga0068860_100002632
2755 Ga0068860_100061216
2756 Ga0068860_100240537
2757 Ga0068860_100341603
2758 Ga0068860_101736591
2759 Ga0068862_100010198
2760 Ga0068862_100070096
2761 Ga0068862_100823561
2762 Ga0068862_101997397
2763 Ga0081455_10232278
2764 Ga0075365_10004297
2765 Ga0075365_10029244
2766 Ga0075368_10015003
2767 Ga0075368_10025640
2768 Ga0075368_10089158
2769 Ga0075368_10110095
2770 Ga0075368_10120838
2771 Ga0075368_10127894
2772 Ga0075368_10233661
2773 Ga0075368_10483754
2774 Ga0075363_100001372
2775 Ga0075363_100011135
2776 Ga0075363_100036596
2777 Ga0075363_100083784
2778 Ga0075363_100083793
2779 Ga0075363_100135138
2780 Ga0075363_100145033
2781 Ga0075363_100245793
2782 Ga0075363_100532557
2783 Ga0075363_100642870
2784 Ga0075364_10012528
2785 Ga0075364_10016278
2786 Ga0075364_10085088
2787 Ga0075364_10100218
2788 Ga0075364_10393356
2789 Ga0075364_10433501
2790 Ga0075364_10457758
2791 Ga0075364_10624434
2792 Ga0075364_10754383
2793 Ga0075432_10150260
2794 Ga0075362_10005070
2795 Ga0075362_10006907
2796 Ga0075362_10006970
2797 Ga0075362_10018421
2798 Ga0075362_10024484
2799 Ga0075362_10114760
2800 Ga0075362_10125632
2801 Ga0075362_10135822
2802 Ga0075362_10150654
2803 Ga0075362_10288997
2804 Ga0075362_10299394
2805 Ga0075362_10536063
2806 Ga0075362_10589544
2807 Ga0075367_10005547
2808 Ga0075367_10012600
2809 Ga0075367_10026352
2810 Ga0075367_10036496
2811 Ga0075367_10037500
2812 Ga0075367_10062713
2813 Ga0075367_10069417
2814 Ga0075367_10111626
2815 Ga0075367_10574567
2816 Ga0075367_10846119
2817 Ga0075369_10001852
2818 Ga0075369_10095160
2819 Ga0075369_10097573
2820 Ga0075369_10136040
2821 Ga0075366_10001677
2822 Ga0075366_10002935
2823 Ga0075366_10003541
2824 Ga0075366_10004492
2825 Ga0075366_10005743
2826 Ga0075366_10009910
2827 Ga0075366_10010575
2828 Ga0075366_10011468
2829 Ga0075366_10013487
2830 Ga0075366_10033053
2831 Ga0075366_10034984
2832 Ga0075366_10043108
2833 Ga0075366_10048738
2834 Ga0075366_10051847
2835 Ga0075366_10052964
2836 Ga0075366_10091551
2837 Ga0075366_10096603
2838 Ga0075366_10101808
2839 Ga0075366_10106830
2840 Ga0075366_10148761
2841 Ga0075366_10155628
2842 Ga0075366_10196689
2843 Ga0075366_10201532
2844 Ga0075366_10219966
2845 Ga0075366_10257032
2846 Ga0075366_10278101
2847 Ga0075366_10284664
2848 Ga0075366_10307972
2849 Ga0075366_10319902
2850 Ga0075366_10389133
2851 Ga0075366_10441189
2852 Ga0075366_10879797
2853 Ga0075366_11018047
2854 Ga0097621_100011918
2855 Ga0097621_100040679
2856 Ga0097621_100064071
2857 Ga0097621_100107140
2858 Ga0097621_100134827
2859 Ga0097621_100137354
2860 Ga0097621_100498620
2861 Ga0097621_101343929
2862 Ga0075370_10000124
2863 Ga0075370_10000159
2864 Ga0075370_10001473
2865 Ga0075370_10003561
2866 Ga0075370_10004375
2867 Ga0075370_10008986
2868 Ga0075370_10011875
2869 Ga0075370_10012982
2870 Ga0075370_10018684
2871 Ga0075370_10024332
2872 Ga0075370_10031609
2873 Ga0075370_10041223
2874 Ga0075370_10044762
2875 Ga0075370_10049244
2876 Ga0075370_10081886
2877 Ga0075370_10083339
2878 Ga0075370_10103526
2879 Ga0075370_10150489
2880 Ga0075370_10170120
2881 Ga0075370_10539614
2882 Ga0075370_10877565
2883 Ga0068871_100044806
2884 Ga0068871_100108518
2885 Ga0068871_100526870
2886 Ga0075429_101499775
2887 Ga0068865_100040309
2888 Ga0068865_100058476
2889 Ga0068865_100168495
2890 Ga0068865_100459002
2891 Ga0068865_100749447
2892 Ga0097620_100032096
2893 Ga0097620_100222131
2894 Ga0097620_100437573
2895 Ga0097620_100539782
2896 Ga0097620_100586914
2897 Ga0097620_101977887
2898 Ga0099823_1058477
2899 Ga0099826_10029080
2900 Ga0099826_10131993
2901 Ga0075435_100640821
2902 Ga0105251_10002173
2903 Ga0105251_10017441
2904 Ga0105251_10058772
2905 Ga0105244_10000329
2906 Ga0105244_10001834
2907 Ga0105244_10024925
2908 Ga0105244_10037053
2909 Ga0105244_10368012
2910 Ga0105250_10000105
2911 Ga0105250_10129259
2912 Ga0105240_10017700
2913 Ga0105240_10020431
2914 Ga0105240_10022278
2915 Ga0105240_10336480
2916 Ga0105240_11672081
2917 Ga0111539_11096507
2918 Ga0111539_11532128
2919 Ga0111539_12951320
2920 Ga0105245_10150078
2921 Ga0105245_10172687
2922 Ga0105245_10245508
2923 Ga0105245_10485053
2924 Ga0105245_10669374
2925 Ga0105245_11204771
2926 Ga0105245_11594832
2927 Ga0105247_10441827
2928 Ga0105247_11257926
2929 Ga0114129_10051750
2930 Ga0105243_10000486
2931 Ga0105243_10003231
2932 Ga0105243_10003279
2933 Ga0105243_10021379
2934 Ga0105243_10105356
2935 Ga0105243_10120855
2936 Ga0105243_10335147
2937 Ga0105243_10415518
2938 Ga0105243_11059092
2939 Ga0105243_11142834
2940 Ga0105243_12170737
2941 Ga0105241_10003239
2942 Ga0105241_10401883
2943 Ga0105241_10724360
2944 Ga0105241_10935623
2945 Ga0105241_11873201
2946 Ga0105241_12604394
2947 Ga0105242_10961652
2948 Ga0105242_11425078
2949 Ga0105248_10000445
2950 Ga0105248_10017866
2951 Ga0105248_10025421
2952 Ga0105248_10046075
2953 Ga0105248_10409042
2954 Ga0105248_10728412
2955 Ga0105248_11419170
2956 Ga0105248_11874896
2957 Ga0105248_12224160
2958 Ga0105237_10000548
2959 Ga0105237_10015839
2960 Ga0105237_10182787
2961 Ga0105237_10231058
2962 Ga0105237_10341422
2963 Ga0105237_10445838
2964 Ga0105237_10738902
2965 Ga0105237_10923354
2966 Ga0105238_10020973
2967 Ga0105238_10136657
2968 Ga0105238_10161939
2969 Ga0105238_10650503
2970 Ga0105249_10038755
2971 Ga0105249_10052334
2972 Ga0105249_10177219
2973 Ga0105249_10318349
2974 Ga0105249_10336225
2975 Ga0105249_13095095
2976 Ga0105239_10001569
2977 Ga0105239_10052411
2978 Ga0105239_10174209
2979 Ga0105239_10274852
2980 Ga0105239_10280880
2981 Ga0105239_10777111
2982 Ga0105239_13137326
2983 Ga0105246_10007754
2984 Ga0105246_10200957
2985 Ga0105246_10375419
2986 Ga0105246_11159263
2987 Ga0105246_11783863
2988 Ga0157322_1021901
2989 Ga0157319_1000006
2990 Ga0157347_1003675
2991 Ga0157339_1024310
2992 Ga0157342_1018967
2993 Ga0157327_1046646
2994 Ga0157373_10004477
2995 Ga0157373_10005848
2996 Ga0157373_10037609
2997 Ga0157373_10103380
2998 Ga0157373_10115188
2999 Ga0157373_10151556
3000 Ga0157371_10099143
3001 Ga0157371_10255462
3002 Ga0157371_10616305
3003 Ga0157371_10722570
3004 Ga0157371_11100124
3005 Ga0157370_10001046
3006 Ga0157370_10014128
3007 Ga0157370_10217371
3008 Ga0157370_10312903
3009 Ga0157370_10353690
3010 Ga0157370_10923045
3011 Ga0157369_10000981
3012 Ga0157369_10014051
3013 Ga0157369_10017535
3014 Ga0157369_10019561
3015 Ga0157369_10374804
3016 Ga0157369_10397815
3017 Ga0157369_11428250
3018 Ga0157374_10000032
3019 Ga0157374_10005865
3020 Ga0157374_10014186
3021 Ga0157374_10145876
3022 Ga0157374_10277004
3023 Ga0157374_10380304
3024 Ga0157374_10419587
3025 Ga0157378_10000558
3026 Ga0157378_10481027
3027 Ga0157378_10511813
3028 Ga0157378_10831066
3029 Ga0157378_10835110
3030 Ga0157378_11412386
3031 Ga0157378_11729265
3032 Ga0157378_11757097
3033 Ga0157378_12632226
3034 Ga0157378_12638068
3035 Ga0163162_10005747
3036 Ga0163162_10045656
3037 Ga0163162_10109110
3038 Ga0163162_10223961
3039 Ga0163162_10232252
3040 Ga0163162_10609804
3041 Ga0163162_11187961
3042 Ga0157372_10019251
3043 Ga0157372_10188302
3044 Ga0157372_10276126
3045 Ga0157372_10372342
3046 Ga0157372_10388386
3047 Ga0157372_10712918
3048 Ga0157372_11133255
3049 Ga0157372_11258917
3050 Ga0157375_10013127
3051 Ga0157375_10031297
3052 Ga0157375_10059867
3053 Ga0157375_10068447
3054 Ga0157375_10106464
3055 Ga0157375_10119991
3056 Ga0157375_10187002
3057 Ga0157375_10325666
3058 Ga0157375_10548459
3059 Ga0157375_10723557
3060 Ga0157375_11604339
3061 Ga0163163_10129383
3062 Ga0163163_10272395
3063 Ga0163163_10817455
3064 Ga0163163_11322412
3065 Ga0157380_10053803
3066 Ga0157380_10228832
3067 Ga0157380_10320589
3068 Ga0157380_10571025
3069 Ga0157380_11716265
3070 Ga0157380_12956872
3071 Ga0182008_10001960
3072 Ga0182008_10009359
3073 Ga0182008_10116948
3074 Ga0182008_10431370
3075 Ga0182008_10983333
3076 Ga0157377_10000028
3077 Ga0157377_10077811
3078 Ga0157379_10035995
3079 Ga0157379_10043963
3080 Ga0157379_10051052
3081 Ga0157379_10107677
3082 Ga0157379_10142242
3083 Ga0157379_10181011
3084 Ga0157379_10242497
3085 Ga0157379_10290484
3086 Ga0157379_11078161
3087 Ga0157376_10009600
3088 Ga0157376_10048381
3089 Ga0157376_10092691
3090 Ga0157376_10187310
3091 Ga0157376_10576089
3092 Ga0157376_10671608
3093 Ga0157376_11200374
3094 Ga0157376_11914755
3095 Ga0182006_1001354
3096 Ga0182006_1010741
3097 Ga0182006_1011055
3098 Ga0182006_1030375
3099 Ga0182006_1071057
3100 Ga0182007_10001767
3101 Ga0182007_10021863
3102 Ga0182007_10111558
3103 Ga0182007_10270552
3104 Ga0182005_1029694
3105 Ga0182005_1091376
3106 Ga0182005_1297163
3107 Ga0163161_10001250
3108 Ga0163161_10023133
3109 Ga0163161_10048400
3110 Ga0163161_10196275
3111 Ga0163161_10216770
3112 Ga0163161_10669334
3113 Ga0163161_10675892
3114 Ga0206355_1269035
3115 Ga0206352_10797362
3116 Ga0213872_10000011
3117 Ga0213872_10000043
3118 Ga0213872_10000272
3119 Ga0213872_10040543
3120 Ga0213872_10060109
3121 Ga0213872_10074479
3122 Ga0213872_10075054
3123 Ga0213872_10227793
3124 Ga0213876_10287255
3125 Ga0209435_125931
3126 Ga0209436_101446
3127 Ga0209784_100938
3128 Ga0209566_100561
3129 Ga0209674_100003
3130 Ga0209674_100122
3131 Ga0209672_100191
3132 Ga0209672_100222
3133 Ga0209147_100435
3134 Ga0209563_100005
3135 Ga0209563_100017
3136 Ga0209563_103222
3137 Ga0209258_100048
3138 Ga0209258_100559
3139 Ga0209258_102813
3140 Ga0207425_1000786
3141 Ga0207425_1003597
3142 Ga0209646_1000022
3143 Ga0209646_1000271
3144 Ga0209026_1000085
3145 Ga0209026_1004183
3146 Ga0209677_101546
3147 Ga0209677_101615
3148 Ga0209677_103383
3149 Ga0209148_1000021
3150 Ga0209148_1000040
3151 Ga0209148_1012316
3152 Ga0209759_1000068
3153 Ga0209759_1001746
3154 Ga0209759_1001796
3155 Ga0209759_1002047
3156 Ga0209759_1021973
3157 Ga0209759_1031313
3158 Ga0209129_1000007
3159 Ga0209129_1000369
3160 Ga0209129_1001205
3161 Ga0209129_1024238
3162 Ga0209565_1000153
3163 Ga0209565_1001390
3164 Ga0209565_1003425
3165 Ga0209565_1078898
3166 Ga0209455_1000643
3167 Ga0209455_1001880
3168 Ga0209673_1000423
3169 Ga0209673_1000566
3170 Ga0209673_1000801
3171 Ga0209673_1006937
3172 Ga0209673_1013020
3173 Ga0209673_1013271
3174 Ga0209673_1013645
3175 Ga0209673_1046556
3176 Ga0209130_1000953
3177 Ga0209130_1001018
3178 Ga0209130_1001734
3179 Ga0209675_1000150
3180 Ga0209675_1001481
3181 Ga0209675_1001635
3182 Ga0209675_1002237
3183 Ga0209675_1002884
3184 Ga0209676_1000004
3185 Ga0209676_1000735
3186 Ga0209676_1001743
3187 Ga0209676_1002326
3188 Ga0209676_1004231
3189 Ga0209676_1007213
3190 Ga0209676_1030459
3191 Ga0209025_1000057
3192 Ga0209025_1000217
3193 Ga0209025_1000278
3194 Ga0209025_1001179
3195 Ga0209025_1010012
3196 Ga0209025_1018495
3197 Ga0209025_1124121
3198 Ga0209564_1000003
3199 Ga0209564_1000046
3200 Ga0209564_1000915
3201 Ga0209564_1001044
3202 Ga0209564_1015210
3203 Ga0209564_1077190
3204 Ga0209758_1000025
3205 Ga0209758_1000709
3206 Ga0209758_1002316
3207 Ga0209758_1020934
3208 Ga0209050_1000002
3209 Ga0209050_1000861
3210 Ga0209050_1001823
3211 Ga0209050_1002866
3212 Ga0209050_1002874
3213 Ga0209050_1003318
3214 Ga0209050_1035133
3215 Ga0209050_1037278
3216 Ga0209050_1097324
3217 Ga0209256_1000067
3218 Ga0209256_1000366
3219 Ga0209256_1005597
3220 Ga0209256_1008454
3221 Ga0209256_1041041
3222 Ga0209256_1042846
3223 Ga0209256_1094527
3224 Ga0207426_1000001
3225 Ga0207426_1000028
3226 Ga0207426_1020977
3227 Ga0209051_1000002
3228 Ga0209051_1000049
3229 Ga0209051_1000096
3230 Ga0209051_1000532
3231 Ga0209051_1000913
3232 Ga0209051_1004959
3233 Ga0209051_1007617
3234 Ga0209051_1010944
3235 Ga0209051_1013466
3236 Ga0209051_1035263
3237 Ga0209051_1107638
3238 Ga0209257_1000002
3239 Ga0209257_1000072
3240 Ga0209257_1005501
3241 Ga0209257_1005948
3242 Ga0209257_1012640
3243 Ga0209257_1013234
3244 Ga0209257_1021343
3245 Ga0207697_10054088
3246 Ga0207697_10101513
3247 Ga0207697_10455412
3248 Ga0207656_10012183
3249 Ga0207656_10029824
3250 Ga0207656_10071677
3251 Ga0207656_10111356
3252 Ga0207656_10111360
3253 Ga0207696_1000131
3254 Ga0207655_1000004
3255 Ga0207655_1003340
3256 Ga0207655_1029730
3257 Ga0207655_1118431
3258 Ga0207655_1236898
3259 Ga0207713_1000052
3260 Ga0207713_1000084
3261 Ga0207713_1043333
3262 Ga0207682_10006629
3263 Ga0207682_10022477
3264 Ga0207682_10067253
3265 Ga0207682_10071200
3266 Ga0207682_10532095
3267 Ga0207642_10037663
3268 Ga0207642_10743245
3269 Ga0207688_10036837
3270 Ga0207688_10167683
3271 Ga0207688_10248005
3272 Ga0207680_10216266
3273 Ga0207647_10046340
3274 Ga0207647_10052312
3275 Ga0207685_10596594
3276 Ga0207645_10003439
3277 Ga0207645_10015692
3278 Ga0207645_10030847
3279 Ga0207645_10066499
3280 Ga0207645_10205138
3281 Ga0207645_11133322
3282 Ga0207643_10244189
3283 Ga0207705_10026548
3284 Ga0207705_10102916
3285 Ga0207705_10165193
3286 Ga0207705_10236422
3287 Ga0207705_10347626
3288 Ga0207705_10378081
3289 Ga0207705_11014738
3290 Ga0207705_11017966
3291 Ga0207684_10002530
3292 Ga0207684_10136233
3293 Ga0207684_10401714
3294 Ga0207654_10197100
3295 Ga0207654_10639853
3296 Ga0207707_10024701
3297 Ga0207707_11140491
3298 Ga0207707_11289473
3299 Ga0207695_10030367
3300 Ga0207695_10177375
3301 Ga0207695_10204007
3302 Ga0207695_10267148
3303 Ga0207695_10430581
3304 Ga0207671_10010913
3305 Ga0207671_10134750
3306 Ga0207671_10143413
3307 Ga0207671_10356571
3308 Ga0207671_10883563
3309 Ga0207663_10737599
3310 Ga0207660_10491418
3311 Ga0207662_10594733
3312 Ga0207657_10000539
3313 Ga0207657_10016351
3314 Ga0207657_10063967
3315 Ga0207657_10095194
3316 Ga0207657_10154007
3317 Ga0207657_10160330
3318 Ga0207657_10342010
3319 Ga0207657_10951572
3320 Ga0207649_10027765
3321 Ga0207649_10065254
3322 Ga0207649_10859077
3323 Ga0207652_10164160
3324 Ga0207652_10273281
3325 Ga0207652_11186502
3326 Ga0207646_10149795
3327 Ga0207681_10010347
3328 Ga0207681_10015245
3329 Ga0207681_10065307
3330 Ga0207681_10136055
3331 Ga0207681_11262814
3332 Ga0207694_10065085
3333 Ga0207694_10110900
3334 Ga0207694_10147805
3335 Ga0207694_10323332
3336 Ga0207694_10663995
3337 Ga0207694_11171087
3338 Ga0207650_10001071
3339 Ga0207650_10033566
3340 Ga0207650_10208534
3341 Ga0207650_10233262
3342 Ga0207650_10457365
3343 Ga0207650_10596088
3344 Ga0207650_10628582
3345 Ga0207650_10865198
3346 Ga0207659_10002589
3347 Ga0207659_10010915
3348 Ga0207659_10013311
3349 Ga0207659_10127689
3350 Ga0207659_10371230
3351 Ga0207659_10538064
3352 Ga0207659_10721579
3353 Ga0207687_10055314
3354 Ga0207687_10066030
3355 Ga0207687_10225398
3356 Ga0207687_10291600
3357 Ga0207687_11043346
3358 Ga0207664_10020035
3359 Ga0207644_10002293
3360 Ga0207644_10005830
3361 Ga0207644_10008258
3362 Ga0207644_10033013
3363 Ga0207644_10066865
3364 Ga0207644_10181125
3365 Ga0207644_10451985
3366 Ga0207644_10582408
3367 Ga0207644_10919969
3368 Ga0207644_10967293
3369 Ga0207690_10009822
3370 Ga0207690_10047094
3371 Ga0207690_10051966
3372 Ga0207690_10075669
3373 Ga0207690_10161082
3374 Ga0207690_10195198
3375 Ga0207690_10387241
3376 Ga0207690_10397108
3377 Ga0207706_10001856
3378 Ga0207706_10005010
3379 Ga0207706_10023334
3380 Ga0207706_10050415
3381 Ga0207706_10127657
3382 Ga0207706_10278780
3383 Ga0207706_10396119
3384 Ga0207706_10666473
3385 Ga0207706_11275413
3386 Ga0207686_10562429
3387 Ga0207686_10687661
3388 Ga0207709_10000348
3389 Ga0207709_10000556
3390 Ga0207709_10005637
3391 Ga0207709_10006258
3392 Ga0207709_10007492
3393 Ga0207709_10193284
3394 Ga0207709_10803082
3395 Ga0207670_10036922
3396 Ga0207669_10002735
3397 Ga0207669_10163716
3398 Ga0207669_10198881
3399 Ga0207669_10549955
3400 Ga0207704_10061644
3401 Ga0207704_10351102
3402 Ga0207704_10439315
3403 Ga0207691_10004533
3404 Ga0207691_10005312
3405 Ga0207691_10007653
3406 Ga0207691_10057377
3407 Ga0207691_10174786
3408 Ga0207691_10327127
3409 Ga0207691_10618110
3410 Ga0207691_10733465
3411 Ga0207691_11369505
3412 Ga0207711_10007461
3413 Ga0207711_10013057
3414 Ga0207711_10015303
3415 Ga0207711_10078718
3416 Ga0207711_10245986
3417 Ga0207711_10375692
3418 Ga0207711_11205800
3419 Ga0207711_11233896
3420 Ga0207711_11868024
3421 Ga0207689_10004291
3422 Ga0207689_10018167
3423 Ga0207689_10022168
3424 Ga0207689_10051486
3425 Ga0207689_10282689
3426 Ga0207689_10371595
3427 Ga0207689_10460278
3428 Ga0207689_11056852
3429 Ga0207661_10069956
3430 Ga0207661_10152654
3431 Ga0207679_10037286
3432 Ga0207679_10046527
3433 Ga0207679_10151674
3434 Ga0207679_10185328
3435 Ga0207679_10322897
3436 Ga0207679_10483534
3437 Ga0207679_10684044
3438 Ga0207667_10016870
3439 Ga0207667_10053981
3440 Ga0207667_10080136
3441 Ga0207667_10108428
3442 Ga0207667_10116858
3443 Ga0207667_10271910
3444 Ga0207667_10836318
3445 Ga0207667_11999714
3446 Ga0207651_10003468
3447 Ga0207651_10032840
3448 Ga0207651_10041449
3449 Ga0207651_10074451
3450 Ga0207651_10078352
3451 Ga0207651_10278866
3452 Ga0207651_10336242
3453 Ga0207651_10380602
3454 Ga0207651_10989381
3455 Ga0207651_11035467
3456 Ga0207651_11180812
3457 Ga0207712_10016113
3458 Ga0207712_10162453
3459 Ga0207712_10485853
3460 Ga0207712_11132805
3461 Ga0207668_10160980
3462 Ga0207668_10185382
3463 Ga0207668_10284338
3464 Ga0207668_10564733
3465 Ga0207668_11103147
3466 Ga0207668_11177387
3467 Ga0207668_11208167
3468 Ga0207640_10001781
3469 Ga0207640_10114521
3470 Ga0207640_10276907
3471 Ga0207640_10502366
3472 Ga0207640_11005044
3473 Ga0207640_11475505
3474 Ga0207658_10005312
3475 Ga0207658_10035630
3476 Ga0207658_10069435
3477 Ga0207658_10117580
3478 Ga0207658_10134850
3479 Ga0207658_10268119
3480 Ga0207658_10278531
3481 Ga0207658_11076938
3482 Ga0207677_10000972
3483 Ga0207677_10001461
3484 Ga0207677_10006577
3485 Ga0207677_10568710
3486 Ga0207677_10695636
3487 Ga0207677_11868105
3488 Ga0207703_10012389
3489 Ga0207703_10082733
3490 Ga0207703_10621142
3491 Ga0207703_10831053
3492 Ga0207703_11080904
3493 Ga0207639_10004119
3494 Ga0207639_10032894
3495 Ga0207639_10067958
3496 Ga0207639_10215624
3497 Ga0207639_10898220
3498 Ga0207639_10988179
3499 Ga0207678_10018317
3500 Ga0207678_10073350
3501 Ga0207678_10649783
3502 Ga0207678_10864781
3503 Ga0207678_11010811
3504 Ga0207678_11168927
3505 Ga0207678_11196387
3506 Ga0207678_11362173
3507 Ga0207678_11499097
3508 Ga0207708_10222353
3509 Ga0207702_10000698
3510 Ga0207702_10000732
3511 Ga0207702_10001319
3512 Ga0207702_10184699
3513 Ga0207702_10277540
3514 Ga0207702_10553839
3515 Ga0207702_10797152
3516 Ga0207702_11018288
3517 Ga0207641_10003025
3518 Ga0207641_10082621
3519 Ga0207641_10096599
3520 Ga0207641_10354578
3521 Ga0207648_10000146
3522 Ga0207648_10001822
3523 Ga0207648_10003244
3524 Ga0207648_10011303
3525 Ga0207648_10013115
3526 Ga0207648_10193560
3527 Ga0207648_10265695
3528 Ga0207648_10280515
3529 Ga0207648_10309354
3530 Ga0207648_10316866
3531 Ga0207648_10525420
3532 Ga0207648_10627607
3533 Ga0207648_11413271
3534 Ga0207676_10001000
3535 Ga0207676_10007652
3536 Ga0207676_10014293
3537 Ga0207676_10214855
3538 Ga0207676_10307788
3539 Ga0207676_10592142
3540 Ga0207676_11598846
3541 Ga0207676_11608865
3542 Ga0207674_10005362
3543 Ga0207674_10012070
3544 Ga0207674_10020685
3545 Ga0207674_10083208
3546 Ga0207674_10126264
3547 Ga0207674_10203057
3548 Ga0207674_10323642
3549 Ga0207674_10340698
3550 Ga0207674_10637731
3551 Ga0207674_10929873
3552 Ga0207674_10956645
3553 Ga0207674_11239762
3554 Ga0207674_11559830
3555 Ga0207675_100000857
3556 Ga0207675_100007272
3557 Ga0207675_100048118
3558 Ga0207675_101542020
3559 Ga0207675_101706059
3560 Ga0207675_102439470
3561 Ga0207683_10003588
3562 Ga0207683_10025072
3563 Ga0207683_10100629
3564 Ga0207683_10237104
3565 Ga0207683_10296833
3566 Ga0207683_10389095
3567 Ga0207683_11136446
3568 Ga0207683_11149581
3569 Ga0207698_10048848
3570 Ga0207698_10059821
3571 Ga0207698_10109749
3572 Ga0207698_10112411
3573 Ga0207698_10113315
3574 Ga0207698_10130132
3575 Ga0207698_10140855
3576 Ga0207698_10319705
3577 Ga0207698_10388622
3578 Ga0207698_10457285
3579 Ga0207698_10651216
3580 Ga0207698_10777828
3581 Ga0207698_10994646
3582 Ga0207698_11196478
3583 Ga0207698_11490572
3584 Ga0207698_12714087
3585 Ga0209389_1067513
3586 Ga0209371_1000218
3587 Ga0209371_1009244
3588 Ga0209981_1009284
3589 Ga0209981_1046705
3590 Ga0209996_1001204
3591 Ga0209995_1003268
3592 Ga0209968_1000123
3593 Ga0209999_1009109
3594 Ga0209282_1002929
3595 Ga0209966_1000001
3596 Ga0209998_10020024
3597 Ga0209998_10043006
3598 Ga0209813_10018067
3599 Ga0209813_10045904
3600 Ga0209813_10144705
3601 Ga0209813_10227928
3602 Ga0209813_10335095
3603 Ga0209813_10356493
3604 Ga0209974_10001570
3605 Ga0209974_10039516
3606 Ga0209974_10133454
3607 Ga0207428_10775357
3608 Ga0268266_10081508
3609 Ga0268266_10327068
3610 Ga0268266_10466277
3611 Ga0268266_10562082
3612 Ga0268266_11245677
3613 Ga0268265_10008049
3614 Ga0268265_10094734
3615 Ga0268265_10395518
3616 Ga0268264_10009130
3617 Ga0268264_10073483
3618 Ga0268264_10245697
3619 Ga0268264_10264306
3620 Ga0268264_10549097
3621 Ga0268264_10757437
3622 Ga0265334_10122037
3623 Ga0265323_10040942
3624 Ga0307517_10000805
3625 Ga0307517_10077388
3626 Ga0307517_10183915
3627 Ga0307517_10195603
3628 Ga0307517_10346790
3629 Ga0307517_10407601
3630 Ga0307515_10000020
3631 Ga0307515_10000053
3632 Ga0307515_10001032
3633 Ga0307515_10002612
3634 Ga0307515_10005265
3635 Ga0307515_10014672
3636 Ga0307515_10037926
3637 Ga0307515_10045683
3638 Ga0307515_10048358
3639 Ga0307515_10084485
3640 Ga0307515_10112003
3641 Ga0307515_10413000
3642 Ga0307515_10588117
3643 Ga0265324_10227390
3644 Ga0268256_1000174
3645 Ga0268256_1016030
3646 Ga0268256_1021508
3647 Ga0307512_10035617
3648 Ga0307512_10044313
3649 Ga0307512_10233285
3650 Ga0316177_1178071
3651 Ga0316176_1020296
3652 Ga0314311_1266168
3653 Ga0316179_1063983
3654 Ga0316178_1148277
3655 Ga0316183_1017320
3656 Ga0316181_1020992
3657 Ga0316182_1299692
3658 Ga0265327_10000158
3659 Ga0265327_10000640
3660 Ga0265327_10023188
3661 Ga0265327_10227028
3662 Ga0265327_10316668
3663 Ga0265316_10236963
3664 Ga0265316_11282330
3665 Ga0307513_10014068
3666 Ga0307513_10119699
3667 Ga0307513_10135699
3668 Ga0307513_10158438
3669 Ga0307513_10242399
3670 Ga0307513_10323194
3671 Ga0307513_10476072
3672 Ga0307513_10693839
3673 Ga0307509_10001946
3674 Ga0307509_10002654
3675 Ga0307509_10008897
3676 Ga0307509_10140975
3677 Ga0307509_10143796
3678 Ga0307509_10202426
3679 Ga0307509_10291208
3680 Ga0307509_11005609
3681 Ga0307408_100008062
3682 Ga0307408_100008200
3683 Ga0307408_100047567
3684 Ga0307408_100065038
3685 Ga0307408_100076502
3686 Ga0307408_100154143
3687 Ga0307408_100214499
3688 Ga0307408_100317795
3689 Ga0307408_100610836
3690 Ga0307408_100968574
3691 Ga0307408_102219087
3692 Ga0307508_10000004
3693 Ga0307508_10000078
3694 Ga0307508_10002611
3695 Ga0307508_10058330
3696 Ga0307508_10097952
3697 Ga0307508_10387871
3698 Ga0307508_10536118
3699 Ga0307514_10003397
3700 Ga0307514_10122350
3701 Ga0307514_10132041
3702 Ga0316579_10367458
3703 Ga0307516_10000497
3704 Ga0307516_10001023
3705 Ga0307516_10017381
3706 Ga0307516_10022278
3707 Ga0307516_10022921
3708 Ga0307516_10046323
3709 Ga0307516_10156564
3710 Ga0307516_10209567
3711 Ga0307516_10402920
3712 Ga0307516_10859608
3713 Ga0307516_11014043
3714 Ga0307405_10002891
3715 Ga0307405_10033496
3716 Ga0307405_10058525
3717 Ga0307405_10072893
3718 Ga0307405_10091624
3719 Ga0307405_10145859
3720 Ga0307405_12061651
3721 Ga0316577_10076331
3722 Ga0307413_10018011
3723 Ga0307413_10036799
3724 Ga0307413_10221794
3725 Ga0307413_10717891
3726 Ga0307413_11200767
3727 Ga0307413_11585218
3728 Ga0307410_10082470
3729 Ga0307410_10124374
3730 Ga0307410_10499673
3731 Ga0307410_10565987
3732 Ga0307410_12130887
3733 Ga0307406_10007967
3734 Ga0307406_10182693
3735 Ga0307406_10189848
3736 Ga0307406_10597273
3737 Ga0307406_11168192
3738 Ga0307406_11340675
3739 Ga0307407_10071891
3740 Ga0307407_10307089
3741 Ga0307407_10482758
3742 Ga0307407_11322006
3743 Ga0307412_10001384
3744 Ga0307412_10003210
3745 Ga0307412_10021895
3746 Ga0307412_10034400
3747 Ga0307412_10043071
3748 Ga0307412_10043743
3749 Ga0307412_10056266
3750 Ga0307412_10156113
3751 Ga0307412_10236021
3752 Ga0307412_10356212
3753 Ga0307412_10683024
3754 Ga0307412_10721909
3755 Ga0307412_10791088
3756 Ga0307412_11002241
3757 Ga0307412_11449973
3758 Ga0307409_100000086
3759 Ga0307409_100024728
3760 Ga0307409_100732557
3761 Ga0307409_101027605
3762 Ga0307409_101972378
3763 Ga0307409_102028809
3764 Ga0307409_102617248
3765 Ga0307409_102943023
3766 Ga0307416_100024835
3767 Ga0307416_100051514
3768 Ga0307416_100130486
3769 Ga0307416_100323291
3770 Ga0307416_100571575
3771 Ga0307416_100623909
3772 Ga0307416_101059411
3773 Ga0307416_101197589
3774 Ga0307416_101306335
3775 Ga0307416_101383634
3776 Ga0307416_101405940
3777 Ga0307414_10024960
3778 Ga0307414_10067625
3779 Ga0307414_10086711
3780 Ga0307414_10111423
3781 Ga0307414_10115418
3782 Ga0307414_10174830
3783 Ga0307414_11097499
3784 Ga0307414_11161104
3785 Ga0307411_10005193
3786 Ga0307411_10063367
3787 Ga0307411_10074309
3788 Ga0307411_10104486
3789 Ga0307411_10123397
3790 Ga0307411_10180169
3791 Ga0307411_10254323
3792 Ga0307411_10613968
3793 Ga0307411_10995515
3794 Ga0307411_11988153
3795 Ga0307415_100000361
3796 Ga0307415_100133882
3797 Ga0307415_101088308
3798 Ga0316593_10026594
3799 Ga0307507_10100794
3800 Ga0307507_10130139
3801 Ga0307510_10009306
3802 Ga0307510_10017087
3803 Ga0307510_10041763
3804 Ga0307510_10135811
3805 Ga0307510_10279920
3806 Ga0307510_10367980
3807 Ga0373930_0026313
3808 Ga0373959_0033468
3809 Ga0373959_0090448
3810 Ga0373938_0081594
3811 Ga0373938_0110016
3812 Ga0373928_0132188
3813 Ga0373929_0032309
3814 Ga0373940_0011192
3815 Ga0373944_0177474
3816 Ga0373944_0193002
3817 Ga0373944_0194084
3818 Ga0373944_0249845
3819 Ga0373952_0050313
3820 Ga0373923_0304964
3821 Ga0373941_0224634
3822 Ga0373941_0340503
3823 Ga0373945_0142088
3824 Ga0373953_0129594
3825 Ga0373943_0159516
3826 Ga0373946_0039114
3827 Ga0373955_0450700
3828 Ga0373942_0070650
3829 Ga0373962_0312170
3830 Ga0373924_0528130
3831 Ga0373931_0009283
3832 Ga0373931_0014386
3833 Ga0373931_0026583
3834 Ga0373935_0311811
3835 Ga0373935_0523714
3836 Ga0373935_1408693
3837 Ga0373927_0009569
3838 Ga0373927_0211207
3839 Ga0373927_0240876
3840 Ga0373933_1163731
3841 Ga0373947_0473855
3842 Ga0373947_0531919
3843 Ga0373947_0891802
3844 Ga0373937_0069375
3845 Ga0373937_0381456
3846 Ga0316582_0015066
3847 Ga0316584_0092501
3848 Ga0373925_0078641
3849 Ga0373925_0242397
3850 Ga0373925_0307578
3851 Ga0373925_0330534
3852 Ga0395899_0004720
3853 Ga0395900_0000109
3854 Ga0395900_0029684
3855 Ga0395900_0118039
3856 Ga0395900_1485775
3857 Ga0395898_0015056
3858 Ga0395898_0037637
3859 Ga0395898_0046059
3860 Ga0395898_0297054
3861 Ga0395905_0000488
3862 Ga0395905_0011451
3863 Ga0395905_0025592
3864 Ga0395905_0034301
3865 Ga0395905_0036014
3866 Ga0395905_0166348
3867 Ga0395905_0531124
3868 Ga0395905_0585851
3869 Ga0395905_0592545
3870 Ga0316581_0021996
3871 Ga0395901_0012844
3872 Ga0395901_0985377
3873 Ga0436365_1178302
3874 Ga0436360_0258616
3875 Ga0436361_0167979
3876 Ga0436361_0214541
3877 Ga0436361_0217332
3878 Ga0436361_0359670
3879 Ga0436361_0529504
3880 Ga0436361_0683214
3881 Ga0436361_0769709
3882 Ga0436361_1056645
3883 Ga0436361_1092359
3884 Ga0436363_0880003
3885 Ga0436363_1113045
3886 Ga0439436_0005082
3887 Ga0439436_0017528
3888 Ga0439436_0058755
3889 Ga0439438_015929
3890 Ga0439439_0000304
3891 Ga0439439_0167384
3892 Ga0439447_041937
3893 Ga0439453_0072178
3894 Ga0439461_0014042
3895 Ga0439461_0092374
3896 Ga0439466_0002298
3897 Ga0439466_0009551
3898 Ga0439465_0003892
3899 Ga0439465_0087386
3900 Ga0439465_0183658
3901 Ga0439465_0382652
3902 Ga0451789_0160463
3903 Ga0451791_1329588
3904 Ga0451793_0907941
3905 Ga0451793_1009248
3906 Ga0451797_1109477
3907 Ga0451795_0913388
3908 Ga0451798_0882602
3909 Ga0451798_1022954
3910 Ga0451800_0983364
3911 Ga0451800_1592322
3912 Ga0451802_0064922
3913 Ga0451806_649029
3914 Ga0451804_0858374
3915 Ga0451807_1165661
3916 Ga0451807_2033827
3917 Ga0451807_2607001
3918 Ga0451833_1194697
3919 Ga0451839_0399468
3920 Ga0451839_0693068
3921 Ga0451839_0749505
3922 Ga0451841_0449173
3923 Ga0451845_0413049
3924 Ga0451847_0674285
3925 Ga0451851_0829363
3926 Ga0451843_0383449
3927 Ga0451843_0510807
3928 Ga0451843_0908011
3929 Ga0451843_1432462
3930 Ga0451853_0990419
3931 Ga0451853_1045547
3932 Ga0451853_1701460
3933 Ga0451853_1730775
3934 Ga0439431_0002568
3935 Ga0439431_0103546
3936 Ga0439433_0022304
3937 Ga0439433_0080513
3938 Ga0439442_003022
3939 Ga0439442_031470
3940 Ga0439442_133545
3941 Ga0439445_0021223
3942 Ga0439445_0051253
3943 Ga0439445_0258069
3944 Ga0439448_0000154
3945 Ga0439448_0248931
3946 Ga0439432_003328
3947 Ga0439432_150236
3948 Ga0439449_0002911
3949 Ga0439449_0004348
3950 Ga0439449_0142564
3951 Ga0439452_002322
3952 Ga0439452_004417
3953 Ga0439455_0004565
3954 Ga0439455_0046089
3955 Ga0439455_0092612
3956 Ga0439457_168515
3957 Ga0439462_0003593
3958 Ga0450911_056827
3959 Ga0450919_000602
3960 Ga0450919_011901
3961 Ga0450920_005125
3962 Ga0450923_026479
3963 Ga0450888_066290
3964 Ga0450890_016977
3965 Ga0450890_026369
3966 Ga0450890_034900
3967 Ga0450897_009986
3968 Ga0450894_013462
3969 Ga0450898_049450
3970 Ga0450898_056288
3971 Ga0450899_009850
3972 Ga0450899_011977
3973 Ga0450889_015950
3974 Ga0450906_022700
3975 Ga0450907_048795
3976 Ga0439446_0196246
3977 Ga0439446_0203182
3978 Ga0450909_026534
3979 Ga0439434_0002020
3980 Ga0439434_0004225
3981 Ga0439434_0091011
3982 Ga0439459_0016027
3983 Ga0450918_000607
3984 Ga0450918_003867
3985 Ga0450893_0027764
3986 Ga0451577_0006746
3987 Ga0451577_0008963
3988 Ga0451577_0065508
3989 Ga0451577_0238241
3990 Ga0451577_0404128
3991 Ga0451577_0445720
3992 Ga0451577_1015378
3993 Ga0451577_1580173
3994 Ga0451577_1823083
3995 Ga0466969_0000395
3996 Ga0466969_0001952
3997 Ga0466969_0008585
3998 Ga0466969_0010813
3999 Ga0466969_0027212
4000 Ga0466972_0008024
4001 Ga0466972_0013627
4002 Ga0466972_0022412
4003 Ga0466972_0038687
4004 Ga0466972_0351804
4005 Ga0466980_0248074
4006 Ga0453683_0001626
4007 Ga0453683_0119199
4008 Ga0453683_1211943
4009 Ga0466965_0027809
4010 Ga0466965_0036578
4011 Ga0466965_0041138
4012 Ga0466965_0054005
4013 Ga0466965_0254979
4014 Ga0466966_0099105
4015 Ga0466966_0200822
4016 Ga0466961_0005306
4017 Ga0466961_0011241
4018 Ga0466961_0035961
4019 Ga0466961_0156934
4020 Ga0466961_0204242
4021 Ga0466961_0298460
4022 Ga0466963_0057018
4023 Ga0466963_0125037
4024 Ga0466963_0211748
4025 Ga0466964_0031972
4026 Ga0466964_0141395
4027 Ga0466964_0155240
4028 Ga0466964_0408670
4029 Ga0453684_0003638
4030 Ga0453684_0088462
4031 Ga0453684_0139796
4032 Ga0453684_0172543
4033 Ga0453684_0349930
4034 Ga0453684_0483714
4035 Ga0453684_0513278
4036 Ga0453684_0606434
4037 Ga0453684_1089263
4038 Ga0453684_1301134
4039 Ga0466971_0004739
4040 Ga0466971_0189161
4041 Ga0466971_0269457
4042 Ga0466968_0059440
4043 Ga0466968_0185307
4044 Ga0466968_0228024
4045 Ga0466968_0279379
4046 Ga0466970_0007521
4047 Ga0466970_0060241
4048 Ga0466970_0147824
4049 Ga0466970_0450782
4050 Ga0466957_0014902
4051 Ga0466957_0117828
4052 Ga0466957_0166856
4053 Ga0466957_0202241
4054 Ga0466957_0268488
4055 Ga0466957_0443444
4056 Ga0466960_0020318
4057 Ga0466960_0114141
4058 Ga0466960_0873204
4059 Ga0466959_0003919
4060 Ga0466959_0087673
4061 Ga0466959_0105260
4062 Ga0466959_0111821
4063 Ga0466959_0218492
4064 Ga0466959_0368236
4065 Ga0451576_0000914
4066 Ga0451576_0004476
4067 Ga0451576_0014049
4068 Ga0451576_0052912
4069 Ga0451576_0122968
4070 Ga0451576_0241548
4071 Ga0451576_0467602
4072 Ga0451576_0636156
4073 Ga0451576_1358864
4074 Ga0466958_0074271
4075 Ga0466958_0473553
4076 Ga0466967_0056668
4077 Ga0466967_0075650
4078 Ga0466967_1135311
4079 Ga0495627_007566
4080 Ga0495592_0008709
4081 Ga0495592_0015966
4082 Ga0495603_0032423
4083 Ga0495591_156730
4084 Ga0495629_0154872
4085 Ga0495629_0381748
4086 Ga0495638_0051454
4087 Ga0495638_0085327
4088 Ga0495638_0208178
4089 Ga0495651_0311118
4090 Ga0495651_0691763
4091 Ga0495653_0115724
4092 Ga0495650_0016331
4093 Ga0495650_0191780
4094 Ga0495580_0145541
4095 Ga0495582_0117129
4096 Ga0495582_0542480
4097 Ga0495605_0023835
4098 Ga0495605_0105856
4099 Ga0495639_0017429
4100 Ga0495639_0061533
4101 Ga0495664_0132586
4102 Ga0495584_0261560
4103 Ga0495585_0055375
4104 Ga0495607_0399698
4105 Ga0495583_0015974
4106 Ga0495606_0099657
4107 Ga0495606_0112339
4108 Ga0495606_0223399
4109 Ga0495608_0178630
4110 Ga0495610_0008701
4111 Ga0495616_0006630
4112 Ga0495618_0346612
4113 Ga0495620_0010437
4114 Ga0495628_0140583
4115 Ga0495631_0002748
4116 Ga0495632_0009715
4117 Ga0495632_0016885
4118 Ga0495632_0173014
4119 Ga0495637_0020235
4120 Ga0495648_0042223
4121 Ga0495648_0148033
4122 Ga0495648_0201241
4123 Ga0495648_0270304
4124 Ga0495666_0043869
4125 Ga0495642_0013334
4126 Ga0495642_0167757
4127 Ga0495642_0554511
4128 Ga0495654_0000550
4129 Ga0495654_0043604
4130 Ga0495640_0366968
4131 Ga0495586_0021373
4132 Ga0495621_0002735
4133 Ga0495621_0003885
4134 Ga0495621_0160934
4135 Ga0495597_0000153
4136 Ga0495597_0020188
4137 Ga0495597_0383230
4138 Ga0495622_0088536
4139 Ga0495622_0250621
4140 Ga0495656_0000929
4141 Ga0495656_0062221
4142 Ga0495656_0434962
4143 Ga0495668_0051073
4144 Ga0495668_0360329
4145 Ga0495634_0625845
4146 Ga0495611_0175389
4147 Ga0495625_0000714
4148 Ga0495625_0010826
4149 Ga0495625_0096602
4150 Ga0495625_0108856
4151 Ga0495625_0148101
4152 Ga0495625_0627755
4153 Ga0495625_0850208
4154 Ga0495635_0463626
4155 Ga0495588_0076870
4156 Ga0495623_0050249
4157 Ga0495623_0587185
4158 Ga0495646_0031855
4159 Ga0495647_0009386
4160 Ga0495647_0010703
4161 Ga0495647_0097247
4162 Ga0495658_0201880
4163 Ga0495658_0213479
4164 Ga0495658_0300309
4165 Ga0495658_0348305
4166 Ga0495658_0835723
4167 Ga0495613_0240571
4168 Ga0495624_0514420
4169 Ga0495624_0517615
4170 Ga0495624_0905451
4171 Ga0495670_0151238
4172 Ga0495670_0183285
4173 Ga0495671_0019317
4174 Ga0495671_0327995
4175 Ga0495649_0004353
4176 Ga0495649_0084532
4177 Ga0495589_0027163
4178 Ga0495589_0137394
4179 Ga0495660_0006585
4180 Ga0495660_0084665
4181 Ga0495660_0433749
4182 Ga0495581_0525553
4183 Ga0495604_0900102
4184 Ga0495636_0517764
4185 Ga0495674_0003080
4186 Ga0495674_0025003
4187 Ga0495674_0131454
4188 Ga0495672_0000655
4189 Ga0495672_0022880
4190 Ga0495676_0007147
4191 Ga0495687_001512
4192 Ga0495687_002480
4193 Ga0495687_047916
4194 Ga0495677_0045384
4195 Ga0495673_0026656
4196 Ga0495684_0527155
4197 Ga0495686_0005600
4198 Ga0495686_0008724
4199 Ga0495593_0006672
4200 Ga0495593_0060213
4201 Ga0495593_0100100
4202 Ga0495602_0226558
4203 Ga0495614_0009932
4204 Ga0495626_0051745
4205 Ga0496100_0047259
4206 Ga0496100_0673556
4207 Ga0496101_0021483
4208 Ga0496101_0043750
4209 Ga0496101_0504671
4210 Ga0496101_1055879
4211 Ga0496102_0013747
4212 Ga0496102_0051832
4213 Ga0496102_0109753
4214 Ga0496102_0173558
4215 Ga0496103_0006569
4216 Ga0496103_0399580
4217 Ga0496104_0015973
4218 Ga0496104_0270479
4219 Ga0496104_0684598
4220 Ga0496104_1377640
4221 Ga0496105_0005071
4222 Ga0496105_0030674
4223 Ga0496105_0045888
4224 Ga0496105_0241040
4225 Ga0496105_0828454
4226 Ga0496105_0834771
4227 Ga0496105_0938940
4228 Ga0496105_0968325
4229 Ga0496106_0184459
4230 Ga0496106_0540275
4231 Ga0496107_0144211
4232 Ga0496108_0022590
4233 Ga0496108_0061117
4234 Ga0496108_0090344
4235 Ga0496108_0260502
4236 Ga0496108_0411333
4237 Ga0496108_0580207
4238 Ga0496108_0731375
4239 Ga0496108_1024469
4240 Ga0496108_1396629
4241 Ga0496109_0074882
4242 Ga0496109_0079105
4243 Ga0496109_0253973
4244 Ga0496109_0435780
4245 Ga0496109_0438180
4246 Ga0496109_0448801
4247 Ga0496110_0010246
4248 Ga0496110_0027229
4249 Ga0496110_0031132
4250 Ga0496110_0070427
4251 Ga0496110_0102247
4252 Ga0496110_0283289
4253 Ga0496110_1587025
4254 Ga0496111_0149804
4255 Ga0496111_0551367
4256 Ga0496112_0308348
4257 Ga0496112_0316248
4258 Ga0496112_0330744
4259 Ga0496113_0009758
4260 Ga0496113_0049458
4261 Ga0496113_0777851
4262 Ga0496114_0079247
4263 Ga0496114_1395569
4264 Ga0496115_0007123
4265 Ga0496116_0004666
4266 Ga0496116_0009886
4267 Ga0496116_0017716
4268 Ga0496116_0145930
4269 Ga0496116_0337573
4270 Ga0496116_0477789
4271 Ga0496117_0020169
4272 Ga0496117_0037073
4273 Ga0496117_0075277
4274 Ga0496117_0117343
4275 Ga0496117_0489530
4276 Ga0496118_0007919
4277 Ga0496118_0011718
4278 Ga0496118_0015352
4279 Ga0496118_0071859
4280 Ga0496118_0186102
4281 Ga0496119_0049882
4282 Ga0496119_0063307
4283 Ga0496119_0075863
4284 Ga0496119_0228659
4285 Ga0496119_0367284
4286 Ga0496120_0011850
4287 Ga0496120_0107456
4288 Ga0496121_0000257
4289 Ga0496121_0000478
4290 Ga0496121_0110968
4291 Ga0496121_0180297
4292 Ga0496121_0223451
4293 Ga0496121_0251144
4294 Ga0496121_0251147
4295 Ga0496121_0724773
4296 Ga0496122_0000077
4297 Ga0496122_0000177
4298 Ga0496122_0021150
4299 Ga0496122_0056621
4300 Ga0496122_0068323
4301 Ga0496122_0078507
4302 Ga0496122_0143523
4303 Ga0496122_0171797
4304 Ga0496123_0000050
4305 Ga0496123_0003980
4306 Ga0496123_0030980
4307 Ga0496123_0055801
4308 Ga0496123_0065568
4309 Ga0496123_0194941
4310 Ga0496124_0000036
4311 Ga0496124_0002660
4312 Ga0496124_0006878
4313 Ga0496124_0059631
4314 Ga0496124_0103335
4315 Ga0496124_0154437
4316 Ga0496124_0166248
4317 Ga0496124_0242212
4318 Ga0496124_0269123
4319 Ga0496124_0320485
4320 Ga0496124_0437038
4321 Ga0496124_0472814
4322 Ga0496125_0000146
4323 Ga0496125_0021126
4324 Ga0496125_0031217
4325 Ga0496125_0043130
4326 Ga0496125_0043843
4327 Ga0496125_0080851
4328 Ga0496125_0097356
4329 Ga0496125_0210477
4330 Ga0496125_0737410
4331 Ga0496126_0137352
4332 Ga0496126_0156464
4333 Ga0496126_0315190
4334 Ga0496126_0497852
4335 Ga0501306_021570
4336 Ga0501310_015194
4337 Ga0495682_0014946
4338 Ga0495682_0064665
4339 Ga0501290_007970
4340 Ga0501292_008734
4341 Ga0501298_172416
4342 Ga0501300_009618
4343 Ga0501301_015817
4344 Ga0501303_012601
4345 Ga0501312_045622
4346 Ga0501315_014423
4347 Ga0501323_026474
4348 Ga0501032_0335137
4349 Ga0501033_0020756
4350 Ga0501037_0834719
4351 Ga0501042_0909589
4352 Ga0501043_0000023
4353 Ga0501043_0095479
4354 Ga0501046_0000018
4355 Ga0501047_0000020
4356 Ga0501047_0019486
4357 Ga0501047_0279819
4358 Ga0501047_0287863
4359 Ga0501048_0001064
4360 Ga0501068_0794170
4361 Ga0501070_0220651
4362 Ga0501074_1153505
4363 Ga0501198_000006
4364 Ga0501206_022334
4365 Ga0501222_000007
4366 Ga0501222_009041
4367 Ga0501222_027554
4368 Ga0501249_019142
4369 Ga0501257_067637
4370 Ga0501261_029283
4371 Ga0501221_074704
4372 Ga0501225_0022614
4373 Ga0501080_0447141
4374 Ga0501083_0743463
4375 Ga0501241_090622
4376 Ga0501262_000426
4377 Ga0501262_004524
4378 Ga0501265_006632
4379 Ga0501035_0005419
4380 Ga0501035_0014590
4381 Ga0501035_0042955
4382 Ga0501035_0640938
4383 Ga0501035_1512598
4384 Ga0501044_0000124
4385 Ga0501044_0349267
4386 nmdc:mga03683_129022_c1
4387 nmdc:mga03683_13658_c1
4388 nmdc:mga03683_15946_c1
4389 nmdc:mga03683_25031_c1
4390 nmdc:mga03683_257465_c1
4391 nmdc:mga03683_302734_c1
4392 nmdc:mga03683_35298_c1
4393 nmdc:mga03683_36243_c1
4394 nmdc:mga03683_403677_c1
4395 nmdc:mga03683_40783_c1
4396 nmdc:mga03683_416764_c1
4397 nmdc:mga03683_52476_c1
4398 nmdc:mga03683_64218_c1
4399 nmdc:mga03n38_119129_c1
4400 nmdc:mga03n38_150061_c1
4401 nmdc:mga03n38_29739_c1
4402 nmdc:mga03n38_413424_c1
4403 nmdc:mga03n38_464600_c1
4404 nmdc:mga03n38_518338_c1
4405 nmdc:mga03n38_67321_c1
4406 nmdc:mga03n38_82759_c1
4407 nmdc:mga00v17_178309_c1
4408 nmdc:mga00v17_259459_c1
4409 nmdc:mga00v17_29618_c1
4410 nmdc:mga00v17_36194_c1
4411 nmdc:mga00v17_80575_c1
4412 nmdc:mga00v17_854253_c1
4413 nmdc:mga00v17_948565_c1
4414 nmdc:mga0yw44_17114_c1
4415 nmdc:mga0yw44_2117_c1
4416 nmdc:mga0yw44_568078_c1
4417 nmdc:mga0k408_10403_c1
4418 nmdc:mga0k408_1042_c1
4419 nmdc:mga0k408_113390_c1
4420 nmdc:mga0k408_1409_c2
4421 nmdc:mga0k408_184_c1
4422 nmdc:mga0k408_21023_c1
4423 nmdc:mga0k408_213388_c1
4424 nmdc:mga0k408_218610_c1
4425 nmdc:mga0k408_234464_c1
4426 nmdc:mga0k408_24809_c1
4427 nmdc:mga0k408_249873_c1
4428 nmdc:mga0k408_258989_c1
4429 nmdc:mga0k408_269183_c1
4430 nmdc:mga0k408_287274_c1
4431 nmdc:mga0k408_289518_c1
4432 nmdc:mga0k408_308331_c1
4433 nmdc:mga0k408_318128_c1
4434 nmdc:mga0k408_319019_c1
4435 nmdc:mga0k408_3275_c1
4436 nmdc:mga0k408_33719_c1
4437 nmdc:mga0k408_33735_c1
4438 nmdc:mga0k408_344847_c1
4439 nmdc:mga0k408_369265_c1
4440 nmdc:mga0k408_371103_c1
4441 nmdc:mga0k408_37772_c1
4442 nmdc:mga0k408_38238_c2
4443 nmdc:mga0k408_428840_c1
4444 nmdc:mga0k408_431_c1
4445 nmdc:mga0k408_446061_c1
4446 nmdc:mga0k408_6723_c1
4447 nmdc:mga0k408_73412_c1
4448 nmdc:mga0k408_85145_c1
4449 nmdc:mga0k408_922826_c1
4450 nmdc:mga0k408_98343_c1
4451 nmdc:mga06z11_10830_c1
4452 nmdc:mga06z11_150164_c1
4453 nmdc:mga06z11_150172_c1
4454 nmdc:mga06z11_15291_c1
4455 nmdc:mga06z11_161766_c1
4456 nmdc:mga06z11_524843_c1
4457 nmdc:mga06z11_617420_c1
4458 nmdc:mga06z11_783752_c1
4459 nmdc:mga04h51_165110_c1
4460 nmdc:mga04h51_183773_c1
4461 nmdc:mga04h51_486730_c1
4462 nmdc:mga04h51_50859_c1
4463 nmdc:mga04h51_55031_c1
4464 nmdc:mga07m45_134161_c1
4465 nmdc:mga07m45_142225_c1
4466 nmdc:mga07m45_143054_c1
4467 nmdc:mga07m45_1476_c1
4468 nmdc:mga07m45_15079_c1
4469 nmdc:mga07m45_172943_c1
4470 nmdc:mga07m45_185_c2
4471 nmdc:mga07m45_188626_c1
4472 nmdc:mga07m45_235204_c1
4473 nmdc:mga07m45_33735_c1
4474 nmdc:mga07m45_4156_c1
4475 nmdc:mga07m45_42688_c1
4476 nmdc:mga07m45_456517_c1
4477 nmdc:mga07m45_47374_c1
4478 nmdc:mga07m45_51524_c1
4479 nmdc:mga07m45_57467_c1
4480 nmdc:mga07m45_63097_c1
4481 nmdc:mga07m45_63_c1
4482 nmdc:mga07m45_765786_c1
4483 nmdc:mga07m45_8991_c1
4484 nmdc:mga07m45_89_c1
4485 nmdc:mga05p37_224604_c1
4486 nmdc:mga0qj67_513127_c1
4487 nmdc:mga08y16_1118147_c1
4488 nmdc:mga08y16_1203545_c1
4489 nmdc:mga0rr50_1478700_c1
4490 nmdc:mga0a205_1567267_c1
4491 nmdc:mga0sz30_255183_c1
4492 nmdc:mga0sz30_5833_c1
4493 nmdc:mga0sz30_71021_c1
4494 Ga0495601_0019173
4495 Ga0500610_0013258
4496 Ga0500635_0000141
4497 Ga0500635_0174722
4498 Ga0495595_0027263
4499 Ga0495619_0305846
4500 Ga0500578_0012415
4501 Ga0500578_0014379
4502 Ga0500578_0269994
4503 Ga0500578_0332177
4504 Ga0500643_010889
4505 Ga0500643_059800
4506 Ga0500644_0068624
4507 Ga0500644_0203105
4508 Ga0500581_347294
4509 Ga0500646_0023313
4510 Ga0500651_0000430
4511 Ga0500651_0040824
4512 Ga0500651_0062864
4513 Ga0500651_0071886
4514 Ga0500641_0051443
4515 Ga0500641_0121902
4516 Ga0500650_0137949
4517 Ga0500562_013680
4518 Ga0500562_033286
4519 Ga0500571_000252
4520 Ga0500593_000652
4521 Ga0500594_0001047
4522 Ga0500594_0007268
4523 Ga0500595_084247
4524 Ga0500607_001874
4525 Ga0500608_003111
4526 Ga0500608_336011
4527 Ga0500614_143450
4528 Ga0500618_006166
4529 Ga0500626_170970
4530 Ga0500628_001978
4531 Ga0500642_0003789
4532 Ga0500642_0343800
4533 Ga0500652_000307
4534 Ga0500652_051518
4535 Ga0500658_0000352
4536 Ga0500658_0003377
4537 Ga0500559_0000191
4538 Ga0500559_0021313
4539 Ga0500559_0169647
4540 Ga0500559_0400613
4541 Ga0500568_0008116
4542 Ga0500568_0010712
4543 Ga0500568_0013994
4544 Ga0500568_0023355
4545 Ga0500577_0056692
4546 Ga0500586_272474
4547 Ga0500600_0004796
4548 Ga0500604_0005077
4549 Ga0500616_0079455
4550 Ga0500619_001373
4551 Ga0500622_0000160
4552 Ga0500622_0001454
4553 Ga0500622_0002916
4554 Ga0500622_0049393
4555 Ga0500627_0082231
4556 Ga0500627_0228641
4557 Ga0500627_0393109
4558 Ga0500634_0002470
4559 Ga0500638_003518
4560 Ga0500636_0000056
4561 Ga0500636_0021960
4562 Ga0500636_0176766
4563 Ga0500637_0082707
4564 Ga0500625_159704
4565 Ga0500645_006616
4566 Ga0500645_130547
4567 Ga0590071_000819
4568 Ga0590074_014194
4569 Ga0590077_094099
4570 Ga0587107_039858
4571 Ga0466962_0023883
4572 Ga0466962_0174104
4573 Ga0466962_0613120
4574 2501072656
4575 2501080514
4576 2501410538
4577 2509129719
4578 2510251509
4579 2511087025
4580 2511096994
4581 2511103804
4582 2512345533
4583 2513226638
4584 2513960104
4585 2514048883
4586 2515680819
4587 2515690698
4588 2516019471
4589 2519459173
4590 2527075488
4591 2547372534
4592 2555260046
4593 2563058828
4594 2585290247
4595 2587730421
4596 2587733182
4597 2587755893
4598 2588294396
4599 2599412563
4600 2599624963
4601 2599672975
4602 2599682575
4603 2599694583
4604 2599736774
4605 2599744846
4606 2599905002
4607 2600205790
4608 2600812107
4609 2601524089
4610 2601529243
4611 2601616077
4612 2601620802
4613 2601644144
4614 2601649199
4615 2601654126
4616 2601659548
4617 2601663969
4618 2601696926
4619 2601701975
4620 2601706870
4621 2601712179
4622 2601717387
4623 2601722345
4624 2601727315
4625 2601732620
4626 2601736865
4627 2601743192
4628 2601753986
4629 2602021080
4630 2603662127
4631 2603667026
4632 2603839739
4633 2603844813
4634 2603850180
4635 2603854956
4636 2603867704
4637 2603872532
4638 2603877838
4639 2606050009
4640 2606071669
4641 2606147400
4642 2606177899
4643 2609909418
4644 2637223893
4645 2643860359
4646 2643968983
4647 2643979418
4648 2644119906
4649 2644144114
4650 2644159347
4651 2644249093
4652 2644273234
4653 2644304328
4654 2644329274
4655 2644337319
4656 2644401147
4657 2676405306
4658 2676742975
4659 2707099697
4660 2713476518
4661 2719640623
4662 2723878533
4663 2735818211
4664 2738717409
4665 2738818678
4666 2738831165
4667 2738872693
4668 2738879013
4669 2739184323
4670 2739219292
4671 2739248803
4672 2739278095
4673 2739612878
4674 2746088695
4675 2746097364
4676 2753571427
4677 2777023209
4678 2791922655
4679 2792836075
4680 2808972722
4681 2809007704
4682 2809014756
4683 2809035689
4684 2817261462
4685 2817279148
4686 2817456252
4687 2819596917
4688 2819619972
4689 2819631298
4690 2831266000
4691 2831870061
4692 2834641800
4693 2838057871
4694 2842328626
4695 2842352942
4696 2842458713
4697 2842681050
4698 2843694552
4699 2846542812
4700 2852107325
4701 2854602836
4702 2857539036
4703 2857546976
4704 2858956146
4705 2863427387
4706 2870070855
4707 2881414910
4708 2881715984
4709 2881928151
4710 2883093065
4711 2884087641
4712 2885197427
4713 2885203659
4714 2885216991
4715 2885272977
4716 2886849521
4717 2895516583
4718 2899930341
4719 2900053258
4720 2900634255
4721 2902683727
4722 2904438014
4723 2904455129
4724 2904457545
4725 2904480507
4726 2904484565
4727 2904517859
4728 2904543703
4729 2904570006
4730 2904576083
4731 2904624210
4732 2919111170
4733 2919466901
4734 2919531471
4735 2919704690
4736 2921652672
4737 2928039454
4738 2928044941
4739 2928052742
4740 2928064584
4741 2928075000
4742 2928088181
4743 2928110535
4744 2928116402
4745 2928140051
4746 2928171570
4747 2928505543
4748 2928542570
4749 2929162745
4750 2929527410
4751 2935625487
4752 2939570200
4753 2939618774
4754 2939631728
4755 2939642757
4756 2941485628
4757 2945876552
4758 2945911258
4759 2945937378
4760 2945947273
4761 2945977706
4762 2945986454
4763 2954772688
4764 2969080905
4765 2971822304
4766 2974439579
4767 2984563367
4768 2984596101
4769 2990705928
4770 2998345739
4771 3000378162
4772 642425583
4773 642418902
4774 642593236
4775 642622133
4776 8018846959
4777 8019504888
4778 8020813612
4779 8020944920
4780 8020945497
4781 8020957043
4782 8021122099
4783 8039102598
4784 8040172810
4785 8040173719
4786 8055228235
4787 8055268962
4788 8055302054
4789 8055694809

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

27

108

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1i7h-assembly3.cif.gz_C crystal sturcuture of fdx 0.9753 2 108
1i7h-assembly3.cif.gz_C crystal sturcuture of fdx 0.9577 2 108
3ah7-assembly1.cif.gz_A-2 crystal structure of the isc-like [2fe-2s] ferredoxin (fdxb) from pseudomonas putida jcm 20004 0.9543 1 107
3ah7-assembly1.cif.gz_A-2 crystal structure of the isc-like [2fe-2s] ferredoxin (fdxb) from pseudomonas putida jcm 20004 0.9292 1 107
3n9y-assembly1.cif.gz_C crystal structure of human cyp11a1 in complex with cholesterol 0.8668 26 89
ID Description Score Start End Superfamily
1i7hA00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9679 2 110 3.10.20.30
1i7hA00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9593 2 110 3.10.20.30
af_Q9CPW2_55_168_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.867 2 107 3.10.20.30
af_A4I756_34_144_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8637 2 104 3.10.20.30
4ltuB00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8604 2 104 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A6L9CCH0-F1-model_v4 deleted 0.9842 1 91
AF-Q89A15-F1-model_v4 2Fe-2S ferredoxin 0.9767 1 107 GO:0005829
GO:0009055
GO:0046872
GO:0051537
GO:0140647
AF-A0A6L5CA48-F1-model_v4 deleted 0.9763 45 101
AF-A0A6L9CCH0-F1-model_v4 deleted 0.9736 1 91
AF-A0A455TAU1-F1-model_v4 2Fe-2S ferredoxin 0.9729 1 107 GO:0005829
GO:0009055
GO:0051537
GO:0140647

Map