metagRoot

F496779

General Info

Members	Datasets	Scaffolds	Average Seq Length
2402	843	4804	278

Family's Representative Sequence

Representative Sequence	3300005354\|Ga0070675_100326135\|Ga0070675_1003261352
Length	314
Sequence	MCAGDHPAGTGVDGYWTSNRCRVACKVKPWPLPVISTRRPAFIQMSETGYFHLHLVSDATGETLITVARAAAAQYANVSPVEHLYPMVRSKKQLDQALAEITESPGLVLYTLLEEDLIQLLEKKCRELGLPCMSVLGPVLRLFQSYLGAETIHRAGAQHVLNAEYFQRIDALNFTMLHDDGQHVEGLEEADVVLVGVSRTSKTPTSIYLANRGVKTGNVPLVPVEKLTRPLVVGLYASPERIVQIRENRLLGLKAHRDDDQYIDKTAVAEEVSFSRRLCARHNWPTIDVTRRSIEETAAAVMRLLSERRRHPVA

Samples

	Sample ID	Description	Type	Environment
1	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
2	2010549000	Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes	Metagenome	Endosphere
3	2162886007	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1	Metagenome	Rhizosphere
4	2209111006	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1	Metagenome	Rhizosphere
5	3300000041	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere	Metagenome	Rhizosphere
6	3300000042	Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young	Metagenome	Rhizosphere
7	3300000043	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere	Metagenome	Rhizosphere
8	3300000044	Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old	Metagenome	Rhizosphere
9	3300000045	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere	Metagenome	Rhizosphere
10	3300000652	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA	Metagenome	Rhizosphere
11	3300001430	Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5	Metagenome	Rhizosphere
12	3300001976	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7	Metagenome	Rhizosphere
13	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
14	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
15	3300001990	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3	Metagenome	Rhizosphere
16	3300001991	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2	Metagenome	Rhizosphere
17	3300002067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1	Metagenome	Rhizosphere
18	3300002070	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4	Metagenome	Rhizosphere
19	3300002075	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4	Metagenome	Rhizosphere
20	3300002076	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3	Metagenome	Rhizosphere
21	3300002077	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3	Metagenome	Rhizosphere
22	3300002126	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5	Metagenome	Rhizosphere
23	3300002987	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB	Metagenome	Endosphere
24	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
25	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
26	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
27	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
28	3300003659	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
29	3300003752	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2	Metagenome	Endosphere
30	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
31	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
32	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
33	3300005276	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1	Metagenome	Rhizosphere
34	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
35	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
36	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
37	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
38	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
39	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
40	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
41	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
42	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
43	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
44	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
45	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
46	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
47	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
48	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
49	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
50	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
51	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
52	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
53	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
54	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
55	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
56	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
57	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
58	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
59	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
60	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
61	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
62	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
63	3300005406	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG	Metagenome	Rhizosphere
64	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
65	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
66	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
67	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
68	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
69	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
70	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
71	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
72	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
73	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
74	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
75	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
76	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
77	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
78	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
79	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
80	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
81	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
82	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
83	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
84	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
85	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
86	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
87	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
88	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
89	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
90	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
91	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
92	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
93	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
94	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
95	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
96	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
97	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
98	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
99	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
100	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
101	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
102	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
103	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
104	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
105	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
106	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
107	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
108	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
109	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
110	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
111	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
112	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
113	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
114	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
115	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
116	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
117	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
118	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
119	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
120	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
121	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
122	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
123	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
124	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
125	3300006194	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1	Metagenome	Rhizosphere
126	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
127	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
128	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
129	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
130	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
131	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
132	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
133	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
134	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
135	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
136	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
137	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
138	3300006942	Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW	Metagenome	Nodule
139	3300006943	Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW	Metagenome	Nodule
140	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
141	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
142	3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Metagenome	Rhizosphere
143	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
144	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
145	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
146	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
147	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
148	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
149	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
150	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
151	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
152	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
153	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
154	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
155	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
156	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
157	3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Metagenome	Rhizosphere
158	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
159	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
160	3300012492	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610	Metagenome	Rhizosphere
161	3300012494	Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610	Metagenome	Rhizosphere
162	3300012505	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610	Metagenome	Rhizosphere
163	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
164	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
165	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
166	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
167	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
168	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
169	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
170	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
171	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
172	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
173	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
174	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
175	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
176	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
177	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
178	3300021320	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3	Metagenome	Nodule
179	3300021321	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1	Metagenome	Nodule
180	3300021324	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4	Metagenome	Nodule
181	3300021327	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2	Metagenome	Nodule
182	3300021358	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3	Metagenome	Rhizosphere
183	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
184	3300021377	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7	Metagenome	Unclassified
185	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
186	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
187	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
188	3300025250	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2)	Metagenome	Unclassified
189	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
190	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
191	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
192	3300025271	Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
193	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
194	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
195	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
196	3300025290	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2)	Metagenome	Rhizosphere
197	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
198	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
199	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
200	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
201	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
202	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
203	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
204	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
205	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
206	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
207	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
208	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
209	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
210	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
211	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
212	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
213	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
214	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
215	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
216	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
217	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
218	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
219	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
220	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
221	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
222	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
223	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
224	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
225	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
226	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
227	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
228	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
229	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
230	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
231	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
232	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
233	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
234	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
235	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
236	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
237	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
238	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
239	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
240	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
241	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
242	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
243	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
244	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
245	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
246	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
247	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
248	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
249	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
250	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
251	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
252	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
253	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
254	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
255	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
256	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
257	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
258	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
259	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
260	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
261	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
262	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
263	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
264	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
265	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
266	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
267	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
268	3300027296	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2)	Metagenome	Nodule
269	3300027357	Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2)	Metagenome	Nodule
270	3300027361	Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2)	Metagenome	Nodule
271	3300027363	Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2)	Metagenome	Nodule
272	3300027471	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
273	3300027526	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
274	3300027671	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2)	Metagenome	Rhizosphere
275	3300027682	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
276	3300027717	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
277	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
278	3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
279	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
280	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
281	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
282	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
283	3300028556	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG	Metagenome	Rhizosphere
284	3300028558	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG	Metagenome	Rhizosphere
285	3300028573	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG	Metagenome	Rhizosphere
286	3300028653	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG	Metagenome	Rhizosphere
287	3300028666	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG	Metagenome	Rhizosphere
288	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
289	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
290	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
291	3300029957	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG	Metagenome	Rhizosphere
292	3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Metagenome	Unclassified
293	3300031235	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG	Metagenome	Rhizosphere
294	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
295	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
296	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
297	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
298	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
299	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
300	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
301	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
302	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
303	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
304	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
305	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
306	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
307	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
308	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
309	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
310	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
311	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
312	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
313	3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Metagenome	Unclassified
314	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
315	3300033442	Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1	Metagenome	Nodule
316	3300034816	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3	Metagenome	Rhizosphere
317	3300034817	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1	Metagenome	Rhizosphere
318	3300034818	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3	Metagenome	Rhizosphere
319	3300034819	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1	Metagenome	Rhizosphere
320	3300034820	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2	Metagenome	Rhizosphere
321	3300034957	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2	Metagenome	Rhizosphere
322	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
323	3300035084	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1	Metagenome	Rhizosphere
324	3300035085	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2	Metagenome	Rhizosphere
325	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
326	3300035088	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4	Metagenome	Rhizosphere
327	3300035091	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4	Metagenome	Rhizosphere
328	3300035092	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11	Metagenome	Rhizosphere
329	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
330	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
331	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
332	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
333	3300035115	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11	Metagenome	Rhizosphere
334	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
335	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
336	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
337	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
338	3300035120	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5	Metagenome	Rhizosphere
339	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
340	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
341	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
342	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
343	3300035207	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16	Metagenome	Rhizosphere
344	3300035241	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4	Metagenome	Rhizosphere
345	3300035242	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11	Metagenome	Rhizosphere
346	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
347	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
348	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
349	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
350	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
351	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
352	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
353	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
354	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
355	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
356	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
357	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
358	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
359	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
360	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
361	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
362	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
363	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
364	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
365	3300041408	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195	Metagenome	Rhizosphere
366	3300041453	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG	Metagenome	Rhizoplane
367	3300041460	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG	Metagenome	Rhizoplane
368	3300042003	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551	Metagenome	Rhizosphere
369	3300042438	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533	Metagenome	Rhizosphere
370	3300042461	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366	Metagenome	Rhizosphere
371	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
372	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
373	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
374	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
375	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
376	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
377	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
378	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
379	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
380	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
381	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
382	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
383	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
384	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
385	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
386	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
387	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
388	3300046452	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere	Metagenome	Rhizosphere
389	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
390	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
391	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
392	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
393	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
394	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
395	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
396	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
397	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
398	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
399	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
400	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
401	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
402	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
403	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
404	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
405	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
406	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
407	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
408	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
409	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
410	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
411	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
412	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
413	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
414	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
415	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
416	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
417	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
418	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
419	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
420	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
421	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
422	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
423	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
424	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
425	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
426	3300046537	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere	Metagenome	Rhizosphere
427	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
428	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
429	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
430	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
431	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
432	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
433	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
434	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
435	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
436	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
437	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
438	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
439	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
440	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
441	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
442	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
443	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
444	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
445	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
446	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
447	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
448	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
449	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
450	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
451	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
452	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
453	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
454	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
455	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
456	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
457	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
458	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
459	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
460	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
461	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
462	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
463	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
464	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
465	3300047446	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere	Metagenome	Rhizosphere
466	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
467	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
468	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
469	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
470	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
471	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
472	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
473	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
474	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
475	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
476	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
477	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
478	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
479	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
480	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
481	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
482	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
483	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
484	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
485	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
486	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
487	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
488	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
489	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
490	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
491	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
492	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
493	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
494	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
495	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
496	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
497	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
498	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
499	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
500	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
501	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
502	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
503	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
504	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
505	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
506	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
507	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
508	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
509	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
510	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
511	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
512	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
513	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
514	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
515	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
516	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
517	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
518	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
519	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
520	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
521	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
522	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
523	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
524	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
525	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
526	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
527	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
528	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
529	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
530	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
531	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
532	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
533	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
534	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
535	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
536	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
537	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
538	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
539	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
540	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
541	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
542	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
543	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
544	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
545	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
546	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
547	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
548	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
549	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
550	3300053079	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere	Metagenome	Endosphere
551	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
552	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
553	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
554	3300053088	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere	Metagenome	Endosphere
555	3300053089	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere	Metagenome	Endosphere
556	3300053090	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere	Metagenome	Endosphere
557	3300053091	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere	Metagenome	Endosphere
558	3300053092	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere	Metagenome	Endosphere
559	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
560	3300053094	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere	Metagenome	Endosphere
561	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
562	3300053098	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere	Metagenome	Endosphere
563	3300053102	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere	Metagenome	Endosphere
564	3300053104	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere	Metagenome	Endosphere
565	3300053105	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere	Metagenome	Endosphere
566	3300053109	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere	Metagenome	Endosphere
567	3300053111	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere	Metagenome	Endosphere
568	3300053116	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere	Metagenome	Endosphere
569	3300053117	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere	Metagenome	Endosphere
570	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
571	3300053121	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere	Metagenome	Endosphere
572	3300053122	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere	Metagenome	Endosphere
573	3300053130	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere	Metagenome	Endosphere
574	3300053131	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere	Metagenome	Endosphere
575	3300053133	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere	Metagenome	Endosphere
576	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
577	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
578	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
579	3300053140	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere	Metagenome	Endosphere
580	3300053142	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere	Metagenome	Endosphere
581	3300053145	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere	Metagenome	Endosphere
582	3300053146	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere	Metagenome	Endosphere
583	3300053148	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere	Metagenome	Endosphere
584	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
585	3300053155	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere	Metagenome	Endosphere
586	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
587	3300053158	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere	Metagenome	Endosphere
588	3300053161	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere	Metagenome	Endosphere
589	3300053162	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere	Metagenome	Endosphere
590	3300053163	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere	Metagenome	Endosphere
591	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
592	3300053178	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere	Metagenome	Endosphere
593	3300053729	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere	Metagenome	Endosphere
594	3300053731	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere	Metagenome	Endosphere
595	3300053735	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere	Metagenome	Endosphere
596	3300053737	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere	Metagenome	Endosphere
597	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
598	3300055283	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere	Metagenome	Endosphere
599	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
600	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
601	2507262055	Bradyrhizobium sp. WSM1417	Isolate	Nodule
602	2508501009	Bradyrhizobium sp. WSM471	Isolate	Nodule
603	2508501042	Bradyrhizobium sp. WSM1253	Isolate	Nodule
604	2508501128	Bradyrhizobium sp. ARR65	Isolate	Nodule
605	2511231028	Bradyrhizobium sp. YR681	Isolate	Rhizosphere
606	2513237092	Bradyrhizobium sp. WSM1743	Isolate	Nodule
607	2513237094	Bradyrhizobium sp. WSM3983	Isolate	Nodule
608	2513237095	Bradyrhizobium diazoefficiens USDA 122	Isolate	Nodule
609	2513237096	Bradyrhizobium pachyrhizi USDA 3259	Isolate	Nodule
610	2513237098	Bradyrhizobium elkanii WSM2783	Isolate	Nodule
611	2513237101	Bradyrhizobium murdochi WSM1741	Isolate	Nodule
612	2513237102	Bradyrhizobium japonicum USDA 135	Isolate	Nodule
613	2513237104	Bradyrhizobium sp. EC3.3	Isolate	Nodule
614	2513237137	Bradyrhizobium elkanii USDA 94	Isolate	Nodule
615	2513237139	Bradyrhizobium ottawaense USDA 4	Isolate	Nodule
616	2513237141	Bradyrhizobium sp. TV2a.2	Isolate	Nodule
617	2513237145	Bradyrhizobium elkanii USDA 3254	Isolate	Nodule
618	2513237161	Bradyrhizobium sp. WSM2793	Isolate	Nodule
619	2515154112	Bradyrhizobium sp. WSM4349	Isolate	Nodule
620	2517093001	Bradyrhizobium japonicum USDA 124	Isolate	Nodule
621	2517572143	Bradyrhizobium elkanii USDA 76	Isolate	Nodule
622	2524023205	Bradyrhizobium sp. Cp5.3	Isolate	Nodule
623	2524023210	Bradyrhizobium sp. Ai1a-2	Isolate	Nodule
624	2524023228	Bradyrhizobium sp. Th.b2	Isolate	Nodule
625	2528768022	Bradyrhizobium japonicum USDA 123	Isolate	Nodule
626	2602042107	Bradyrhizobium sp. NFR13	Isolate	Rhizoplane
627	2617270735	Bradyrhizobium shewense ERR11	Isolate	Nodule
628	2617270741	Bradyrhizobium yuanmingense CCBAU 10071	Isolate	Nodule
629	2643221547	Pseudolabrys sp. Root1462	Isolate	Unclassified
630	2643221733	Bosea sp. Root381	Isolate	Unclassified
631	2643221734	Bosea sp. Root670	Isolate	Unclassified
632	2643221736	Bosea sp. Root483D1	Isolate	Unclassified
633	2667528175	Rhizobium tropici NFR14	Isolate	Rhizoplane
634	2721755755	Bradyrhizobium icense LMTR 13	Isolate	Nodule
635	2728368998	Bradyrhizobium macuxiense BR 10303	Isolate	Nodule
636	2744054633	Bradyrhizobium neotropicale BR 10247	Isolate	Unclassified
637	2791355196	Bradyrhizobium sp. Y36	Isolate	Nodule
638	2791355197	Bradyrhizobium sp. C9	Isolate	Nodule
639	2791355199
640	2802429603	Bradyrhizobium ottawaense L2	Isolate	Nodule
641	2816332527	Bradyrhizobium diazoefficiens Y21	Isolate	Nodule
642	2818991467	Bosea vestrisii 3192	Isolate	Unclassified
643	2824600985	Bradyrhizobium sp.HAMBI 2135	Isolate	Unclassified
644	2824609381	Bradyrhizobium sp. HAMBI 2134	Isolate	Unclassified
645	2824617872	Bradyrhizobium sp. HAMBI 2133	Isolate	Unclassified
646	2824626560	Bradyrhizobium sp. HAMBI 2149	Isolate	Unclassified
647	2824635225	Bradyrhizobium sp. HAMBI 2136	Isolate	Unclassified
648	2824644064	Bradyrhizobium sp. HAMBI 2137	Isolate	Unclassified
649	2824653114	Bradyrhizobium sp. HAMBI 2142	Isolate	Unclassified
650	2824661429	Bradyrhizobium sp. HAMBI 2115	Isolate	Unclassified
651	2824671348	Bradyrhizobium sp. HAMBI 2125	Isolate	Unclassified
652	2824679649	Bradyrhizobium sp.HAMBI 2116	Isolate	Unclassified
653	2824687955	Bradyrhizobium sp. HAMBI 2126	Isolate	Unclassified
654	2824696289	Bradyrhizobium sp. HAMBI 2127	Isolate	Unclassified
655	2824704595	Bradyrhizobium sp. HAMBI 2150	Isolate	Unclassified
656	2824714736	Bradyrhizobium sp. HAMBI 2151	Isolate	Unclassified
657	2824723954	Bradyrhizobium sp. HAMBI 2152	Isolate	Unclassified
658	2824732956	Bradyrhizobium sp. HAMBI 2153	Isolate	Unclassified
659	2824746037	Bradyrhizobium sp. HAMBI 2299	Isolate	Unclassified
660	2824753945	Bradyrhizobium sp. HAMBI 2128	Isolate	Unclassified
661	2824763712	Bradyrhizobium sp. HAMBI 2129	Isolate	Unclassified
662	2824773399	Bradyrhizobium sp. HAMBI 2130	Isolate	Unclassified
663	2838122688	Bradyrhizobium sp. CIR3A	Isolate	Nodule
664	2841760612	Bosea sp. Tri-49	Isolate	Nodule
665	2841941048	Bradyrhizobium sp. SBR1B	Isolate	Nodule
666	2841949485	Bradyrhizobium sp. ERR14	Isolate	Nodule
667	2841957949	Bradyrhizobium sp. CIR1	Isolate	Nodule
668	2841966195	Bradyrhizobium sp. CIR18	Isolate	Nodule
669	2841974524	Bradyrhizobium sp. CIR48	Isolate	Nodule
670	2841983080	Bradyrhizobium sp. IAR9	Isolate	Nodule
671	2842038055	Bradyrhizobium centrosematis SEMIA 424	Isolate	Nodule
672	2842045827	Bradyrhizobium centrosematis SEMIA 431	Isolate	Nodule
673	2844104063	Bosea sp. Tri-39	Isolate	Nodule
674	2844315083	Bradyrhizobium guangzhouense CCBAU 51670	Isolate	Unclassified
675	2847930680	Bradyrhizobium zhanjiangense CCBAU 51778	Isolate	Unclassified
676	2847939898	Bradyrhizobium ottawaense OO99	Isolate	Unclassified
677	2849076700	Bradyrhizobium symbiodeficiens 85S1MB	Isolate	Nodule
678	2851182111	Bosea sp. Tri-44	Isolate	Nodule
679	2851246043	Bosea sp. Tri-54	Isolate	Nodule
680	2857509624	Bradyrhizobium sp. R-73088	Isolate	Unclassified
681	2857524615	Tardiphaga sp. R-73074	Isolate	Unclassified
682	2874590934	Bradyrhizobium canariense UBMA181	Isolate	Nodule
683	2874604998	Bradyrhizobium sp. LMTR 3	Isolate	Nodule
684	2874612657	Bradyrhizobium forestalis INPA54B	Isolate	Nodule
685	2874620515	Bradyrhizobium nanningense CCBAU 53390	Isolate	Unclassified
686	2874628541	Bradyrhizobium betae Opo-243	Isolate	Unclassified
687	2874645413	Bradyrhizobium canariense UBMA122	Isolate	Nodule
688	2876761206	Bradyrhizobium centrolobii BR 10245	Isolate	Nodule
689	2876771140	Bradyrhizobium canariense UBMA192	Isolate	Nodule
690	2876808645	Bradyrhizobium algeriense RST89	Isolate	Unclassified
691	2876818435	Bradyrhizobium canariense UBMA195	Isolate	Nodule
692	2879074833	Bradyrhizobium canariense UBMA171	Isolate	Nodule
693	2879083081	Bradyrhizobium zhanjiangense CCBAU 51787	Isolate	Unclassified
694	2879099564	Bradyrhizobium japonicum UBMA197	Isolate	Nodule
695	2879110137	Bradyrhizobium algeriense RST91	Isolate	Nodule
696	2879127579	Bradyrhizobium canariense UBMA052	Isolate	Nodule
697	2879142872	Bradyrhizobium canariense UBMA061	Isolate	Nodule
698	2881364244	Bradyrhizobium sp. RP6	Isolate	Unclassified
699	2881665667	Bradyrhizobium vignae LMG 28791	Isolate	Unclassified
700	2885366525	Bradyrhizobium sp. LVM 105	Isolate	Unclassified
701	2885374607	Bradyrhizobium sp. NAS96.2	Isolate	Unclassified
702	2885383462	Bradyrhizobium sp. Leo170	Isolate	Unclassified
703	2885409591	Bradyrhizobium sp. NAS80.1	Isolate	Unclassified
704	2888378607	Bradyrhizobium sp. LCT2	Isolate	Unclassified
705	2888388044	Bradyrhizobium cosmicum 58S1	Isolate	Unclassified
706	2888419890	Bradyrhizobium sp. 1(2017) 63S1MB	Isolate	Unclassified
707	2889033259	Bradyrhizobium sp. CCBAU 051011	Isolate	Unclassified
708	2893066018	Tardiphaga sp. P9-11	Isolate	Unclassified
709	2903727486	Bradyrhizobium guangzhouense CCBAU 53424	Isolate	Unclassified
710	2903748898	Bradyrhizobium uaiense UFLA 03-164	Isolate	Nodule
711	2903768456	Bradyrhizobium sp. Leo121	Isolate	Unclassified
712	2904666416	Bradyrhizobium nanningense CCBAU 51757	Isolate	Unclassified
713	2904690495	Bradyrhizobium ivorense CI-1B	Isolate	Nodule
714	2904699407
715	2904711408	Bradyrhizobium sp. USDA 3456	Isolate	Unclassified
716	2906602504	Bradyrhizobium guangzhouense CCBAU 53426	Isolate	Unclassified
717	2906610324
718	2906626472	Bradyrhizobium hipponense aSej3	Isolate	Unclassified
719	2906635258	Bradyrhizobium sp. USDA 3458	Isolate	Unclassified
720	2906643746	Bradyrhizobium genosp. SA-3 Rp7b	Isolate	Unclassified
721	2906660503	Bradyrhizobium brasilense UFLA 03-321	Isolate	Unclassified
722	2908739725	Bradyrhizobium sp. UFLA03-84	Isolate	Nodule
723	2908756301	Bradyrhizobium ivorense CI-41S	Isolate	Nodule
724	2908775508	Bradyrhizobium sp. SUTN9-2	Isolate	Unclassified
725	2917699015	Bosea sp. F3-2	Isolate	Rhizosphere
726	2919073203	Tardiphaga robiniae 1155	Isolate	Unclassified
727	2922361189	Bradyrhizobium australiense WSM 1791	Isolate	Nodule
728	2922368715
729	2922386360	Bradyrhizobium archetypum WSM 1744	Isolate	Nodule
730	2922393267	Bradyrhizobium sp. WBAH10	Isolate	Nodule
731	2922425934
732	2929615660	Bradyrhizobium japonicum TXVA	Isolate	Nodule
733	2929624759	Bradyrhizobium japonicum TXEA	Isolate	Nodule
734	2932784394	Bradyrhizobium sp. S3.2.12	Isolate	Nodule
735	2932794094	Bradyrhizobium sp. S3.2.6	Isolate	Nodule
736	2932801729	Bradyrhizobium sp. S3.3.6	Isolate	Nodule
737	2932809354	Bradyrhizobium sp. S3.5.5	Isolate	Nodule
738	2932818245	Bradyrhizobium sp. S3.9.1	Isolate	Nodule
739	2932828146	Bradyrhizobium sp. S3.9.2	Isolate	Nodule
740	2933577622	Bradyrhizobium japonicum SEMIA 417	Isolate	Nodule
741	2935608549	Bradyrhizobium sp. RT6a	Isolate	Nodule
742	2935616580	Bradyrhizobium sp. RT7a	Isolate	Nodule
743	2935630451	Bradyrhizobium sp. I1.14.4	Isolate	Nodule
744	2935638405	Bradyrhizobium sp. JR19.8	Isolate	Nodule
745	2935648319	Bradyrhizobium sp. JR4.3	Isolate	Nodule
746	2935656913	Bradyrhizobium sp. JR5.3	Isolate	Nodule
747	2935665750	Bradyrhizobium sp. JR7.2	Isolate	Nodule
748	2935675223	Bradyrhizobium sp. LA2.1	Isolate	Nodule
749	2935684952	Bradyrhizobium sp. LA3.X	Isolate	Nodule
750	2935694250	Bradyrhizobium sp. LA6.1	Isolate	Nodule
751	2935703347	Bradyrhizobium sp. LA6.10	Isolate	Nodule
752	2935713505	Bradyrhizobium sp. LA6.12	Isolate	Nodule
753	2935722832	Bradyrhizobium sp. LA6.3	Isolate	Nodule
754	2935732158	Bradyrhizobium sp. LA6.4	Isolate	Nodule
755	2935741537	Bradyrhizobium sp. LA6.7	Isolate	Nodule
756	2935750917	Bradyrhizobium sp. LA6.8	Isolate	Nodule
757	2935760218	Bradyrhizobium sp. LA7.1	Isolate	Nodule
758	2935769743	Bradyrhizobium sp. LB12.1	Isolate	Nodule
759	2935777560	Bradyrhizobium sp. LB14.3	Isolate	Nodule
760	2935785616	Bradyrhizobium sp. LB5.2	Isolate	Nodule
761	2935793552	Bradyrhizobium sp. LB8.2	Isolate	Nodule
762	2935801545	Bradyrhizobium sp. RT10b	Isolate	Nodule
763	2935810662	Bradyrhizobium sp. RT3a	Isolate	Nodule
764	2935819856	Bradyrhizobium sp. RT3b	Isolate	Nodule
765	2935827899	Bradyrhizobium sp. RT4a	Isolate	Nodule
766	2935837841	Bradyrhizobium sp. RT4b	Isolate	Nodule
767	2935847175	Bradyrhizobium sp. RT5a	Isolate	Nodule
768	2935855204	Bradyrhizobium sp. RT7b	Isolate	Nodule
769	2935864058	Bradyrhizobium sp. RT9a	Isolate	Nodule
770	2935873716	Bradyrhizobium sp. RT9b	Isolate	Nodule
771	2935883170	Bradyrhizobium sp. S3.12.5	Isolate	Nodule
772	2935908558	Bradyrhizobium sp. F1.1.1	Isolate	Nodule
773	2935916978	Bradyrhizobium sp. F1.13.3	Isolate	Nodule
774	2935926038	Bradyrhizobium sp. F1.2.1	Isolate	Nodule
775	2935934488	Bradyrhizobium sp. F1.2.2	Isolate	Nodule
776	2935942939	Bradyrhizobium sp. F1.2.6	Isolate	Nodule
777	2935951376	Bradyrhizobium sp. F1.2.8	Isolate	Nodule
778	2935959822	Bradyrhizobium sp. F1.4.3	Isolate	Nodule
779	2935967501	Bradyrhizobium sp. F1.6.2	Isolate	Nodule
780	2935975950	Bradyrhizobium sp. GM2.2	Isolate	Nodule
781	2935984226	Bradyrhizobium sp. i1.15.2	Isolate	Nodule
782	2935992306	Bradyrhizobium sp. I1.7.5	Isolate	Nodule
783	2936002035	Bradyrhizobium sp. I1.8.5	Isolate	Nodule
784	2936011229	Bradyrhizobium sp. JR1.1	Isolate	Nodule
785	2936019824	Bradyrhizobium sp. JR1.5	Isolate	Nodule
786	2936028420	Bradyrhizobium sp. JR1.7	Isolate	Nodule
787	2936037263	Bradyrhizobium sp. JR18.2	Isolate	Nodule
788	2936046547	Bradyrhizobium sp. JR3.12	Isolate	Nodule
789	2936055302	Bradyrhizobium sp. JR4.1	Isolate	Nodule
790	2940556831	Bradyrhizobium sp. LA8.1	Isolate	Nodule
791	2941507105	Bradyrhizobium sp. i1.12.3	Isolate	Nodule
792	2941515067	Bradyrhizobium sp. i1.14.1	Isolate	Nodule
793	2941523033	Bradyrhizobium sp. i1.8.4	Isolate	Nodule
794	2941531003	Bradyrhizobium sp. LB11.1	Isolate	Nodule
795	2941538514	Bradyrhizobium sp. RT11b	Isolate	Nodule
796	3005474847	Bradyrhizobium sp. CCBAU 53421	Isolate	Nodule
797	3005483717	Bradyrhizobium agreste CNPSo 4010	Isolate	Unclassified
798	3005506211	Bradyrhizobium diazoefficiens SZCCT0449	Isolate	Unclassified
799	3005587118	Bradyrhizobium glycinis CNPSo 4016	Isolate	Unclassified
800	3005594810	Bradyrhizobium sp. CCBAU 53340	Isolate	Nodule
801	3005710791	Bradyrhizobium genosp. B BDV5040	Isolate	Unclassified
802	3005718088	Bradyrhizobium sp. CCBAU 53338	Isolate	Nodule
803	8006926726	Bradyrhizobium guangdongense SM32	Isolate	Unclassified
804	8006933436	Bradyrhizobium septentrionale 7(2017)	Isolate	Unclassified
805	8006964411	Bradyrhizobium sp. sBnM-33	Isolate	Nodule
806	8006973647	Bradyrhizobium septentrionale 162S2	Isolate	Nodule
807	8006984368	Bradyrhizobium sp. SRL28	Isolate	Unclassified
808	8006994254	Bradyrhizobium sp. sGM-13	Isolate	Nodule
809	8016511872	Bradyrhizobium sp. S3.14.4	Isolate	Nodule
810	8016522445	Bradyrhizobium sp. LM6.9	Isolate	Nodule
811	8016530956	Bradyrhizobium sp. LM6.11	Isolate	Nodule
812	8016539877	Bradyrhizobium sp. LM6.10	Isolate	Nodule
813	8016548790	Bradyrhizobium sp. LM3.6	Isolate	Nodule
814	8016557553	Bradyrhizobium sp. LM3.4	Isolate	Nodule
815	8016566248	Bradyrhizobium sp. LM3.2	Isolate	Nodule
816	8016575299	Bradyrhizobium sp. LM2.9	Isolate	Nodule
817	8016595262	Bradyrhizobium sp. LM2.3	Isolate	Nodule
818	8016603502	Bradyrhizobium sp. LB7.2	Isolate	Nodule
819	8016613128	Bradyrhizobium sp. LB7.1	Isolate	Nodule
820	8016622563	Bradyrhizobium sp. LB13.1	Isolate	Nodule
821	8016630954	Bradyrhizobium sp. F1.13.1	Isolate	Nodule
822	8017057580	Bradyrhizobium sp. S3.7.6	Isolate	Nodule
823	8019530166	Bradyrhizobium sp. LM4.3	Isolate	Nodule
824	8019538911	Bradyrhizobium sp. LB9.1b	Isolate	Nodule
825	8019547302	Bradyrhizobium sp. LB1.3	Isolate	Nodule
826	8019555841	Bradyrhizobium sp. JR6.1	Isolate	Nodule
827	8019565922	Bradyrhizobium sp. JR3.5	Isolate	Nodule
828	8019576017	Bradyrhizobium sp. i1.7.7	Isolate	Nodule
829	8019586578	Bradyrhizobium sp. i1.4.4	Isolate	Nodule
830	8019597564	Bradyrhizobium sp. i1.3.6	Isolate	Nodule
831	8019608314	Bradyrhizobium sp. i1.3.1	Isolate	Nodule
832	8019619141	Bradyrhizobium sp. GM7.3	Isolate	Nodule
833	8019638758	Bradyrhizobium sp. GM5.1	Isolate	Nodule
834	8019659431	Bradyrhizobium sp. GM22.5	Isolate	Nodule
835	8019668869	Bradyrhizobium sp. GM2.4	Isolate	Nodule
836	8019678201	Bradyrhizobium sp. GM0.4	Isolate	Nodule
837	8019687851	Bradyrhizobium sp. F1.13.4	Isolate	Nodule
838	8055742211	Bradyrhizobium japonicum 5038	Isolate	Nodule
839	8056673599	Bradyrhizobium hereditatis WSM 1738	Isolate	Nodule
840	8056681323	Bradyrhizobium cenepequi CNPSo 4026	Isolate	Nodule
841	8056689827	Bradyrhizobium semiaridum WSM 1704	Isolate	Nodule
842	8056967851	Bradyrhizobium zhengyangense WYCCWR 12678	Isolate	Nodule
843	8057529695	Bosea vestrisii A18/4-2	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	90.07
Metatranscriptomes	0
Isolates	9.93

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	8.53
Nodule	7.79
Rhizoplane	6.24
Rhizosphere	70.11
Stem	0
Stem Tuber	0
Unclassified	0.46

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	Ga0070675_100326135	3300005354	Bacteria	1357
2	RicEn_C4416	2010549000	Bacteria	1482
3	SwRhRL2b_contig_2417348	2162886007	Bacteria	1403
4	2214572730	2209111006	Bacteria	5756
5	ARcpr5oldR_c000196	3300000041	Bacteria	10309
6	ARSoilYngRDRAFT_c00195	3300000042	Bacteria	10197
7	ARcpr5yngRDRAFT_c000005	3300000043	Bacteria	45740
8	ARSoilOldRDRAFT_c000003	3300000044	Bacteria	63923
9	ARCol0oldRDRAFT_c00039	3300000045	Bacteria	10149
10	ARCol0yngRDRAFT_1000194	3300000652	Bacteria	10240
11	JGI24032J14994_100504	3300001430	Bacteria	2048
12	JGI24752J21851_1000622	3300001976	Bacteria	4729
13	JGI24740J21852_10000946	3300001979	Bacteria	12915
14	JGI24739J22299_10001072	3300001989	Bacteria	10181
15	JGI24739J22299_10003399	3300001989	Bacteria	6073
16	JGI24737J22298_10000349	3300001990	Bacteria	15515
17	JGI24737J22298_10000493	3300001990	Bacteria	13715
18	JGI24737J22298_10006737	3300001990	Bacteria	3907
19	JGI24743J22301_10004104	3300001991	Bacteria	2350
20	JGI24735J21928_10018703	3300002067	Bacteria	2135
21	JGI24735J21928_10069449	3300002067	Bacteria	1010
22	JGI24750J21931_1000659	3300002070	Bacteria	5131
23	JGI24738J21930_10000803	3300002075	Bacteria	9022
24	JGI24749J21850_1000742	3300002076	Bacteria	4710
25	JGI24744J21845_10003153	3300002077	Bacteria	3385
26	JGI24744J21845_10008881	3300002077	Bacteria	2065
27	JGI24035J26624_1000051	3300002126	Bacteria	8878
28	JGI25159J45721_1001633	3300002987	Bacteria	9117
29	JGI25406J46586_10000066	3300003203	Bacteria	48110
30	JGI25165J46597_1014054	3300003214	Bacteria	1093
31	JGI25153J46596_10001618	3300003215	Bacteria	13364
32	JGI25153J46596_10001829	3300003215	Bacteria	12618
33	JGI25153J46596_10002496	3300003215	Bacteria	10568
34	JGI25153J46596_10014159	3300003215	Bacteria	3332
35	JGI25160J50197_1003905	3300003354	Bacteria	6529
36	JGI25160J50197_1009567	3300003354	Bacteria	3581
37	JGI25404J52841_10005627	3300003659	Bacteria	2590
38	JGI25404J52841_10005730	3300003659	Bacteria	2571
39	JGI25404J52841_10026842	3300003659	Bacteria	1239
40	Ga0055539_1007755	3300003752	Bacteria	1351
41	Ga0055526_1014208	3300003771	Bacteria	3294
42	Ga0055531_10003199	3300003794	Bacteria	10519
43	Ga0065165_1000365	3300005262	Bacteria	74017
44	Ga0065165_1001133	3300005262	Bacteria	31291
45	Ga0065165_1001495	3300005262	Bacteria	24729
46	Ga0065717_1001964	3300005276	Bacteria	4771
47	Ga0065704_10073913	3300005289	Bacteria	6674
48	Ga0065712_10002282	3300005290	Bacteria	4699
49	Ga0065712_10162912	3300005290	Bacteria	1290
50	Ga0065715_10002794	3300005293	Bacteria	6802
51	Ga0065715_10089788	3300005293	Bacteria	8503
52	Ga0065707_10006094	3300005295	Bacteria	3922
53	Ga0065707_10086522	3300005295	Bacteria	5414
54	Ga0070658_10071586	3300005327	Bacteria	2840
55	Ga0070658_10072420	3300005327	Bacteria	2824
56	Ga0070658_10141574	3300005327	Bacteria	2009
57	Ga0070658_10188148	3300005327	Bacteria	1739
58	Ga0070676_10000360	3300005328	Bacteria	20914
59	Ga0070676_10064947	3300005328	Bacteria	2178
60	Ga0070676_10222755	3300005328	Bacteria	1247
61	Ga0070683_100003076	3300005329	Bacteria	13434
62	Ga0070683_100083038	3300005329	Bacteria	3001
63	Ga0070690_100002249	3300005330	Bacteria	10354
64	Ga0070690_100009502	3300005330	Bacteria	5636
65	Ga0070690_100012428	3300005330	Bacteria	5010
66	Ga0070690_100155829	3300005330	Bacteria	1561
67	Ga0070690_100300522	3300005330	Bacteria	1151
68	Ga0070670_100000827	3300005331	Bacteria	24178
69	Ga0070670_100229170	3300005331	Bacteria	1617
70	Ga0070670_100382741	3300005331	Bacteria	1240
71	Ga0070677_10003275	3300005333	Bacteria	5217
72	Ga0070677_10149087	3300005333	Bacteria	1087
73	Ga0068869_100000013	3300005334	Bacteria	73970
74	Ga0068869_100020918	3300005334	Bacteria	4495
75	Ga0070666_10001254	3300005335	Bacteria	15354
76	Ga0070666_10050409	3300005335	Bacteria	2799
77	Ga0070666_10242070	3300005335	Bacteria	1276
78	Ga0070680_100002249	3300005336	Bacteria	14255
79	Ga0070680_100002907	3300005336	Bacteria	12726
80	Ga0070680_100006151	3300005336	Bacteria	9105
81	Ga0070680_100011100	3300005336	Bacteria	6964
82	Ga0070680_100056958	3300005336	Bacteria	3194
83	Ga0070680_100090420	3300005336	Bacteria	2534
84	Ga0070680_100101410	3300005336	Bacteria	2389
85	Ga0070680_100231723	3300005336	Bacteria	1560
86	Ga0070680_100377583	3300005336	Bacteria	1207
87	Ga0070682_100015075	3300005337	Bacteria	4474
88	Ga0070682_100018296	3300005337	Bacteria	4093
89	Ga0068868_100006458	3300005338	Bacteria	8298
90	Ga0068868_100023763	3300005338	Bacteria	4642
91	Ga0068868_100086938	3300005338	Bacteria	2514
92	Ga0068868_100454103	3300005338	Bacteria	1115
93	Ga0070660_100001856	3300005339	Bacteria	14539
94	Ga0070660_100083861	3300005339	Bacteria	2504
95	Ga0070660_100282819	3300005339	Bacteria	1358
96	Ga0070689_100000474	3300005340	Bacteria	23677
97	Ga0070689_100002685	3300005340	Bacteria	11665
98	Ga0070689_100017774	3300005340	Bacteria	5229
99	Ga0070689_100385462	3300005340	Bacteria	1182
100	Ga0070691_10000101	3300005341	Bacteria	25190
101	Ga0070691_10147224	3300005341	Bacteria	1205
102	Ga0070687_100003699	3300005343	Bacteria	5984
103	Ga0070687_100003845	3300005343	Bacteria	5901
104	Ga0070661_100001285	3300005344	Bacteria	17639
105	Ga0070661_100067991	3300005344	Bacteria	2619
106	Ga0070692_10000014	3300005345	Bacteria	35936
107	Ga0070692_10014365	3300005345	Bacteria	3718
108	Ga0070668_100000629	3300005347	Bacteria	23731
109	Ga0070668_100015369	3300005347	Bacteria	5720
110	Ga0070668_100032431	3300005347	Bacteria	3975
111	Ga0070668_100283220	3300005347	Bacteria	1385
112	Ga0070668_100577958	3300005347	Bacteria	981
113	Ga0070669_100000289	3300005353	Bacteria	39576
114	Ga0070669_100008012	3300005353	Bacteria	7544
115	Ga0070669_100068834	3300005353	Bacteria	2613
116	Ga0070669_100137553	3300005353	Bacteria	1880
117	Ga0070669_100434353	3300005353	Bacteria	1080
118	Ga0070675_100000501	3300005354	Bacteria	26898
119	Ga0070675_100016974	3300005354	Bacteria	5784
120	Ga0070671_100000142	3300005355	Bacteria	46386
121	Ga0070671_100012637	3300005355	Bacteria	6804
122	Ga0070671_100049595	3300005355	Bacteria	3492
123	Ga0070671_100090457	3300005355	Bacteria	2562
124	Ga0070671_100097781	3300005355	Bacteria	2462
125	Ga0070671_100123533	3300005355	Bacteria	2179
126	Ga0070674_100000392	3300005356	Bacteria	21972
127	Ga0070674_100007332	3300005356	Bacteria	6501
128	Ga0070674_100043742	3300005356	Bacteria	3048
129	Ga0070674_100228812	3300005356	Bacteria	1450
130	Ga0070674_100236966	3300005356	Bacteria	1427
131	Ga0070673_100001752	3300005364	Bacteria	12936
132	Ga0070673_100089955	3300005364	Bacteria	2507
133	Ga0070688_100000484	3300005365	Bacteria	20178
134	Ga0070688_100010100	3300005365	Bacteria	5191
135	Ga0070659_100001872	3300005366	Bacteria	15083
136	Ga0070659_100134448	3300005366	Bacteria	2011
137	Ga0070659_100250848	3300005366	Bacteria	1467
138	Ga0070659_100373467	3300005366	Bacteria	1200
139	Ga0070667_100002125	3300005367	Bacteria	17476
140	Ga0070667_100011934	3300005367	Bacteria	7189
141	Ga0070667_100016279	3300005367	Bacteria	6150
142	Ga0070667_100096889	3300005367	Bacteria	2544
143	Ga0070667_100101972	3300005367	Bacteria	2479
144	Ga0070667_100326109	3300005367	Bacteria	1386
145	Ga0070703_10001490	3300005406	Bacteria	7027
146	Ga0070709_10000584	3300005434	Bacteria	21359
147	Ga0070709_10015171	3300005434	Bacteria	4377
148	Ga0070709_10025948	3300005434	Bacteria	3467
149	Ga0070709_10044458	3300005434	Bacteria	2751
150	Ga0070709_10046391	3300005434	Bacteria	2701
151	Ga0070709_10150083	3300005434	Bacteria	1610
152	Ga0070714_100007186	3300005435	Bacteria	8642
153	Ga0070714_100014018	3300005435	Bacteria	6431
154	Ga0070714_100044926	3300005435	Bacteria	3741
155	Ga0070714_100051084	3300005435	Bacteria	3524
156	Ga0070714_100068153	3300005435	Bacteria	3070
157	Ga0070714_100068887	3300005435	Bacteria	3054
158	Ga0070714_100140603	3300005435	Bacteria	2167
159	Ga0070714_100161404	3300005435	Bacteria	2028
160	Ga0070714_100180023	3300005435	Bacteria	1923
161	Ga0070714_100322431	3300005435	Bacteria	1445
162	Ga0070713_100000749	3300005436	Bacteria	20796
163	Ga0070713_100001823	3300005436	Bacteria	13757
164	Ga0070713_100002764	3300005436	Bacteria	11471
165	Ga0070713_100012129	3300005436	Bacteria	6310
166	Ga0070713_100026964	3300005436	Bacteria	4518
167	Ga0070713_100040684	3300005436	Bacteria	3780
168	Ga0070713_100059036	3300005436	Bacteria	3202
169	Ga0070713_100100054	3300005436	Bacteria	2509
170	Ga0070713_100166548	3300005436	Bacteria	1971
171	Ga0070713_100294733	3300005436	Bacteria	1492
172	Ga0070710_10002956	3300005437	Bacteria	8071
173	Ga0070710_10007104	3300005437	Bacteria	5410
174	Ga0070710_10055167	3300005437	Bacteria	2244
175	Ga0070701_10000008	3300005438	Bacteria	53317
176	Ga0070701_10052668	3300005438	Bacteria	2115
177	Ga0070711_100003385	3300005439	Bacteria	9292
178	Ga0070711_100003792	3300005439	Bacteria	8870
179	Ga0070711_100014489	3300005439	Bacteria	4968
180	Ga0070711_100057105	3300005439	Bacteria	2701
181	Ga0070711_100064004	3300005439	Bacteria	2568
182	Ga0070711_100124881	3300005439	Bacteria	1909
183	Ga0070711_100370606	3300005439	Bacteria	1155
184	Ga0070711_100393791	3300005439	Bacteria	1123
185	Ga0070705_100004263	3300005440	Bacteria	6978
186	Ga0070705_100011791	3300005440	Bacteria	4423
187	Ga0070705_100152983	3300005440	Bacteria	1533
188	Ga0070700_100000486	3300005441	Bacteria	19940
189	Ga0070700_100011018	3300005441	Bacteria	4999
190	Ga0070694_100000463	3300005444	Bacteria	22164
191	Ga0070694_100043032	3300005444	Bacteria	3018
192	Ga0070708_100081054	3300005445	Bacteria	2938
193	Ga0070708_100104863	3300005445	Bacteria	2593
194	Ga0070663_100001666	3300005455	Bacteria	12295
195	Ga0070663_100015711	3300005455	Bacteria	4896
196	Ga0070663_100016155	3300005455	Bacteria	4838
197	Ga0070663_100017648	3300005455	Bacteria	4662
198	Ga0070663_100019740	3300005455	Bacteria	4450
199	Ga0070663_100060975	3300005455	Bacteria	2715
200	Ga0070663_100154659	3300005455	Bacteria	1761
201	Ga0070663_100160062	3300005455	Bacteria	1732
202	Ga0070678_100004520	3300005456	Bacteria	7898
203	Ga0070678_100020799	3300005456	Bacteria	4312
204	Ga0070678_100060733	3300005456	Bacteria	2783
205	Ga0070678_100070102	3300005456	Bacteria	2619
206	Ga0070678_100075882	3300005456	Bacteria	2530
207	Ga0070678_100271041	3300005456	Bacteria	1431
208	Ga0070662_100004371	3300005457	Bacteria	8928
209	Ga0070662_100023743	3300005457	Bacteria	4216
210	Ga0070681_10002062	3300005458	Bacteria	18223
211	Ga0070681_10024430	3300005458	Bacteria	6084
212	Ga0070681_10071633	3300005458	Bacteria	3430
213	Ga0070681_10083693	3300005458	Bacteria	3143
214	Ga0070681_10095970	3300005458	Bacteria	2913
215	Ga0070681_10112319	3300005458	Bacteria	2664
216	Ga0070681_10273193	3300005458	Bacteria	1601
217	Ga0070681_10389132	3300005458	Bacteria	1305
218	Ga0068867_100000303	3300005459	Bacteria	32425
219	Ga0068867_100122572	3300005459	Bacteria	2010
220	Ga0070685_10001725	3300005466	Bacteria	11480
221	Ga0070685_10002009	3300005466	Bacteria	10543
222	Ga0070685_10024058	3300005466	Bacteria	3342
223	Ga0070707_100093433	3300005468	Bacteria	2912
224	Ga0070707_100205808	3300005468	Bacteria	1918
225	Ga0070699_100245023	3300005518	Bacteria	1601
226	Ga0070699_100452046	3300005518	Bacteria	1165
227	Ga0070679_100005343	3300005530	Bacteria	11885
228	Ga0070679_100018483	3300005530	Bacteria	6765
229	Ga0070679_100018688	3300005530	Bacteria	6728
230	Ga0070679_100070784	3300005530	Bacteria	3479
231	Ga0070679_100082355	3300005530	Bacteria	3207
232	Ga0070679_100131887	3300005530	Bacteria	2479
233	Ga0070679_100162199	3300005530	Bacteria	2209
234	Ga0070679_100244491	3300005530	Bacteria	1751
235	Ga0070679_100282919	3300005530	Bacteria	1611
236	Ga0070684_100001519	3300005535	Bacteria	16786
237	Ga0070684_100013695	3300005535	Bacteria	6545
238	Ga0070684_100086326	3300005535	Bacteria	2785
239	Ga0070684_100144268	3300005535	Bacteria	2155
240	Ga0070697_100049187	3300005536	Bacteria	3421
241	Ga0070697_100186163	3300005536	Bacteria	1761
242	Ga0070697_100263673	3300005536	Bacteria	1475
243	Ga0068853_100000726	3300005539	Bacteria	22782
244	Ga0068853_100006442	3300005539	Bacteria	9329
245	Ga0068853_100052672	3300005539	Bacteria	3505
246	Ga0068853_100154249	3300005539	Bacteria	2069
247	Ga0068853_100168699	3300005539	Bacteria	1979
248	Ga0068853_100207810	3300005539	Bacteria	1784
249	Ga0068853_100208738	3300005539	Bacteria	1780
250	Ga0068853_100296470	3300005539	Bacteria	1493
251	Ga0068853_100300794	3300005539	Bacteria	1483
252	Ga0068853_100325291	3300005539	Bacteria	1426
253	Ga0068853_100426290	3300005539	Bacteria	1245
254	Ga0070672_100000469	3300005543	Bacteria	23426
255	Ga0070686_100004236	3300005544	Bacteria	7898
256	Ga0070686_100004861	3300005544	Bacteria	7417
257	Ga0070686_100011541	3300005544	Bacteria	5013
258	Ga0070686_100231901	3300005544	Bacteria	1340
259	Ga0070695_100001715	3300005545	Bacteria	12340
260	Ga0070696_100005271	3300005546	Bacteria	8631
261	Ga0070696_100093641	3300005546	Bacteria	2143
262	Ga0070693_100000411	3300005547	Bacteria	19398
263	Ga0070693_100044496	3300005547	Bacteria	2512
264	Ga0070693_100127094	3300005547	Bacteria	1588
265	Ga0070693_100224103	3300005547	Bacteria	1234
266	Ga0070693_100291477	3300005547	Bacteria	1096
267	Ga0070665_100032806	3300005548	Bacteria	5225
268	Ga0070665_100046518	3300005548	Bacteria	4358
269	Ga0070665_100126173	3300005548	Bacteria	2561
270	Ga0070665_100195837	3300005548	Bacteria	2021
271	Ga0070665_100467261	3300005548	Bacteria	1272
272	Ga0070704_100001671	3300005549	Bacteria	12037
273	Ga0070704_100006946	3300005549	Bacteria	6712
274	Ga0068855_100036647	3300005563	Bacteria	5835
275	Ga0068855_100056640	3300005563	Bacteria	4598
276	Ga0068855_100186449	3300005563	Bacteria	2343
277	Ga0068855_100193509	3300005563	Bacteria	2292
278	Ga0068855_100235288	3300005563	Bacteria	2049
279	Ga0068855_100294758	3300005563	Bacteria	1797
280	Ga0068855_100454147	3300005563	Bacteria	1398
281	Ga0068855_100620915	3300005563	Bacteria	1164
282	Ga0068855_100708758	3300005563	Bacteria	1076
283	Ga0070664_100001745	3300005564	Bacteria	17407
284	Ga0070664_100036564	3300005564	Bacteria	4126
285	Ga0070664_100049496	3300005564	Bacteria	3554
286	Ga0070664_100072515	3300005564	Bacteria	2953
287	Ga0070664_100179042	3300005564	Bacteria	1884
288	Ga0068857_100000307	3300005577	Bacteria	33926
289	Ga0068857_100005001	3300005577	Bacteria	11266
290	Ga0068857_100022934	3300005577	Bacteria	5491
291	Ga0068857_100050370	3300005577	Bacteria	3695
292	Ga0068857_100122189	3300005577	Bacteria	2345
293	Ga0068857_100248563	3300005577	Bacteria	1630
294	Ga0068854_100000761	3300005578	Bacteria	19144
295	Ga0068854_100050668	3300005578	Bacteria	2972
296	Ga0068854_100178224	3300005578	Bacteria	1658
297	Ga0068854_100205471	3300005578	Bacteria	1551
298	Ga0068856_100003904	3300005614	Bacteria	14952
299	Ga0068856_100005232	3300005614	Bacteria	12806
300	Ga0068856_100029052	3300005614	Bacteria	5402
301	Ga0068856_100057074	3300005614	Bacteria	3854
302	Ga0068856_100066450	3300005614	Bacteria	3563
303	Ga0068856_100084807	3300005614	Bacteria	3147
304	Ga0068856_100107475	3300005614	Bacteria	2785
305	Ga0068856_100281254	3300005614	Bacteria	1681
306	Ga0070702_100001142	3300005615	Bacteria	10662
307	Ga0068852_100000151	3300005616	Bacteria	46414
308	Ga0068852_100003053	3300005616	Bacteria	11648
309	Ga0068852_100032124	3300005616	Bacteria	4342
310	Ga0068852_100087068	3300005616	Bacteria	2786
311	Ga0068852_100098557	3300005616	Bacteria	2632
312	Ga0068852_100110172	3300005616	Bacteria	2501
313	Ga0068852_100194562	3300005616	Bacteria	1915
314	Ga0068852_100230986	3300005616	Bacteria	1763
315	Ga0068859_100001785	3300005617	Bacteria	21901
316	Ga0068859_100099537	3300005617	Bacteria	2963
317	Ga0068859_100105197	3300005617	Bacteria	2881
318	Ga0068859_100226866	3300005617	Bacteria	1956
319	Ga0068859_100361921	3300005617	Bacteria	1546
320	Ga0068859_100570405	3300005617	Bacteria	1225
321	Ga0068859_100571070	3300005617	Bacteria	1225
322	Ga0068859_100606988	3300005617	Bacteria	1187
323	Ga0068859_100638570	3300005617	Bacteria	1157
324	Ga0068864_100019467	3300005618	Bacteria	5675
325	Ga0068864_100195466	3300005618	Bacteria	1856
326	Ga0068864_100287428	3300005618	Bacteria	1536
327	Ga0068866_10000049	3300005718	Bacteria	45908
328	Ga0068866_10089680	3300005718	Bacteria	1672
329	Ga0068866_10117765	3300005718	Bacteria	1492
330	Ga0068861_100000471	3300005719	Bacteria	23427
331	Ga0068861_100034571	3300005719	Bacteria	3738
332	Ga0068851_10009214	3300005834	Bacteria	4582
333	Ga0068851_10011049	3300005834	Bacteria	4227
334	Ga0068870_10001002	3300005840	Bacteria	11150
335	Ga0068863_100000418	3300005841	Bacteria	43162
336	Ga0068863_100021397	3300005841	Bacteria	6173
337	Ga0068863_100478125	3300005841	Bacteria	1225
338	Ga0068858_100002238	3300005842	Bacteria	19549
339	Ga0068858_100070830	3300005842	Bacteria	3232
340	Ga0068858_100077479	3300005842	Bacteria	3088
341	Ga0068858_100401761	3300005842	Bacteria	1317
342	Ga0068858_100412031	3300005842	Bacteria	1299
343	Ga0068860_100002578	3300005843	Bacteria	18969
344	Ga0068860_100004221	3300005843	Bacteria	14730
345	Ga0068860_100116754	3300005843	Bacteria	2553
346	Ga0068862_100001613	3300005844	Bacteria	20538
347	Ga0068862_100122807	3300005844	Bacteria	2290
348	Ga0068862_100330497	3300005844	Bacteria	1409
349	Ga0081455_10000002	3300005937	Bacteria	460472
350	Ga0081455_10004129	3300005937	Bacteria	16422
351	Ga0081455_10014333	3300005937	Bacteria	7777
352	Ga0081455_10019448	3300005937	Bacteria	6424
353	Ga0081455_10041411	3300005937	Bacteria	4051
354	Ga0081455_10046329	3300005937	Bacteria	3774
355	Ga0081455_10054015	3300005937	Bacteria	3428
356	Ga0081455_10114225	3300005937	Bacteria	2140
357	Ga0081455_10128852	3300005937	Bacteria	1981
358	Ga0081455_10266931	3300005937	Bacteria	1244
359	Ga0081540_1000166	3300005983	Bacteria	68242
360	Ga0081540_1003867	3300005983	Bacteria	11686
361	Ga0081540_1005753	3300005983	Bacteria	9184
362	Ga0081540_1006025	3300005983	Bacteria	8920
363	Ga0081540_1011590	3300005983	Bacteria	5885
364	Ga0081540_1012484	3300005983	Bacteria	5587
365	Ga0081540_1012727	3300005983	Bacteria	5515
366	Ga0081540_1048028	3300005983	Bacteria	2141
367	Ga0081540_1048404	3300005983	Bacteria	2129
368	Ga0081539_10000064	3300005985	Bacteria	247020
369	Ga0081539_10005111	3300005985	Bacteria	13729
370	Ga0081539_10014339	3300005985	Bacteria	5871
371	Ga0081539_10059891	3300005985	Bacteria	2093
372	Ga0081539_10107882	3300005985	Bacteria	1407
373	Ga0070717_10000598	3300006028	Bacteria	23163
374	Ga0070717_10039944	3300006028	Bacteria	3819
375	Ga0070717_10061554	3300006028	Bacteria	3111
376	Ga0070717_10113288	3300006028	Bacteria	2316
377	Ga0070717_10137166	3300006028	Bacteria	2108
378	Ga0070717_10263088	3300006028	Bacteria	1526
379	Ga0075365_10024282	3300006038	Bacteria	3821
380	Ga0075365_10069733	3300006038	Bacteria	2363
381	Ga0075365_10086378	3300006038	Bacteria	2132
382	Ga0075365_10159173	3300006038	Bacteria	1573
383	Ga0075365_10173023	3300006038	Bacteria	1508
384	Ga0075368_10007115	3300006042	Bacteria	3939
385	Ga0075368_10073785	3300006042	Bacteria	1381
386	Ga0075363_100025684	3300006048	Bacteria	3007
387	Ga0075363_100027004	3300006048	Bacteria	2941
388	Ga0075363_100029115	3300006048	Bacteria	2848
389	Ga0075363_100068851	3300006048	Bacteria	1920
390	Ga0075363_100166683	3300006048	Bacteria	1249
391	Ga0075363_100209128	3300006048	Bacteria	1116
392	Ga0075364_10050606	3300006051	Bacteria	2712
393	Ga0075364_10112291	3300006051	Bacteria	1819
394	Ga0075364_10171548	3300006051	Bacteria	1466
395	Ga0075432_10014522	3300006058	Bacteria	2683
396	Ga0070715_10001417	3300006163	Bacteria	6938
397	Ga0070715_10001906	3300006163	Bacteria	6267
398	Ga0070715_10030043	3300006163	Bacteria	2193
399	Ga0070715_10077074	3300006163	Bacteria	1504
400	Ga0070715_10104125	3300006163	Bacteria	1329
401	Ga0070716_100000922	3300006173	Bacteria	12727
402	Ga0070716_100001657	3300006173	Bacteria	10041
403	Ga0070716_100029244	3300006173	Bacteria	2977
404	Ga0070716_100040719	3300006173	Bacteria	2586
405	Ga0070716_100182258	3300006173	Bacteria	1380
406	Ga0070712_100005171	3300006175	Bacteria	8072
407	Ga0070712_100005584	3300006175	Bacteria	7779
408	Ga0070712_100024546	3300006175	Bacteria	3997
409	Ga0070712_100034950	3300006175	Bacteria	3409
410	Ga0070712_100035030	3300006175	Bacteria	3405
411	Ga0070712_100097287	3300006175	Bacteria	2169
412	Ga0070712_100102172	3300006175	Bacteria	2123
413	Ga0070712_100177019	3300006175	Bacteria	1659
414	Ga0075362_10022233	3300006177	Bacteria	2670
415	Ga0075362_10190409	3300006177	Bacteria	996
416	Ga0075367_10007084	3300006178	Bacteria	5717
417	Ga0075367_10027915	3300006178	Bacteria	3215
418	Ga0075367_10036073	3300006178	Bacteria	2865
419	Ga0075369_10049718	3300006186	Bacteria	1812
420	Ga0075369_10091566	3300006186	Bacteria	1357
421	Ga0075427_10000365	3300006194	Bacteria	5002
422	Ga0075366_10011732	3300006195	Bacteria	4953
423	Ga0075366_10077040	3300006195	Bacteria	1990
424	Ga0075366_10122166	3300006195	Bacteria	1569
425	Ga0075366_10146185	3300006195	Bacteria	1430
426	Ga0097621_100000012	3300006237	Bacteria	105108
427	Ga0097621_100014206	3300006237	Bacteria	5954
428	Ga0097621_100234116	3300006237	Bacteria	1604
429	Ga0097621_100594897	3300006237	Bacteria	1010
430	Ga0075370_10020566	3300006353	Bacteria	3610
431	Ga0075370_10056481	3300006353	Bacteria	2231
432	Ga0075370_10094314	3300006353	Bacteria	1728
433	Ga0068871_100000611	3300006358	Bacteria	24571
434	Ga0075428_100166474	3300006844	Bacteria	2391
435	Ga0075428_100311376	3300006844	Bacteria	1692
436	Ga0075430_100015106	3300006846	Bacteria	6572
437	Ga0075433_10060417	3300006852	Bacteria	3318
438	Ga0075433_10117947	3300006852	Unclassified	2355
439	Ga0075434_100000193	3300006871	Bacteria	40605
440	Ga0075434_100000647	3300006871	Bacteria	26943
441	Ga0075434_100008129	3300006871	Bacteria	9728
442	Ga0075434_100053188	3300006871	Bacteria	4024
443	Ga0075434_100081344	3300006871	Bacteria	3236
444	Ga0075434_100082007	3300006871	Bacteria	3222
445	Ga0075434_100800901	3300006871	Bacteria	958
446	Ga0075429_100000451	3300006880	Bacteria	30628
447	Ga0075429_100386651	3300006880	Bacteria	1225
448	Ga0068865_100001539	3300006881	Bacteria	13451
449	Ga0068865_100010595	3300006881	Bacteria	5745
450	Ga0068865_100025848	3300006881	Bacteria	3866
451	Ga0068865_100031167	3300006881	Bacteria	3554
452	Ga0075436_100344269	3300006914	Bacteria	1074
453	Ga0097620_100001785	3300006931	Bacteria	21901
454	Ga0097620_100099536	3300006931	Bacteria	2963
455	Ga0097620_100105196	3300006931	Bacteria	2881
456	Ga0097620_100226863	3300006931	Bacteria	1956
457	Ga0097620_100361953	3300006931	Bacteria	1546
458	Ga0097620_100570424	3300006931	Bacteria	1225
459	Ga0097620_100571033	3300006931	Bacteria	1225
460	Ga0097620_100606988	3300006931	Bacteria	1187
461	Ga0097620_100638572	3300006931	Bacteria	1157
462	Ga0099824_1014228	3300006942	Bacteria	7980
463	Ga0099824_1026035	3300006942	Bacteria	3088
464	Ga0099822_1000827	3300006943	Bacteria	32648
465	Ga0075435_100003880	3300007076	Bacteria	10208
466	Ga0075435_100014928	3300007076	Bacteria	5826
467	Ga0099794_10006977	3300007265	Bacteria	4607
468	Ga0099795_10008993	3300007788	Bacteria	2879
469	Ga0105251_10048371	3300009011	Bacteria	2038
470	Ga0105250_10007496	3300009092	Bacteria	4683
471	Ga0105240_10003692	3300009093	Bacteria	23676
472	Ga0105240_10008228	3300009093	Bacteria	14944
473	Ga0105240_10025163	3300009093	Bacteria	7828
474	Ga0105240_10034925	3300009093	Bacteria	6482
475	Ga0105240_10043110	3300009093	Bacteria	5744
476	Ga0105240_10119042	3300009093	Bacteria	3182
477	Ga0105240_10334999	3300009093	Bacteria	1720
478	Ga0105240_10363048	3300009093	Bacteria	1640
479	Ga0105240_10377529	3300009093	Bacteria	1601
480	Ga0111539_10000679	3300009094	Bacteria	44034
481	Ga0111539_10000925	3300009094	Bacteria	38387
482	Ga0111539_10002056	3300009094	Bacteria	26910
483	Ga0111539_10192542	3300009094	Bacteria	2379
484	Ga0111539_10324879	3300009094	Bacteria	1791
485	Ga0111539_10515586	3300009094	Bacteria	1393
486	Ga0105245_10000090	3300009098	Bacteria	90378
487	Ga0105245_10089730	3300009098	Bacteria	2826
488	Ga0105245_10217136	3300009098	Bacteria	1843
489	Ga0105247_10001092	3300009101	Bacteria	20219
490	Ga0105247_10020697	3300009101	Bacteria	3954
491	Ga0105247_10024972	3300009101	Bacteria	3604
492	Ga0105247_10034333	3300009101	Bacteria	3089
493	Ga0105247_10152469	3300009101	Bacteria	1524
494	Ga0105247_10155419	3300009101	Bacteria	1510
495	Ga0114129_10006700	3300009147	Bacteria	16356
496	Ga0114129_10443248	3300009147	Bacteria	1704
497	Ga0105243_10002557	3300009148	Bacteria	15205
498	Ga0105243_10006084	3300009148	Bacteria	9330
499	Ga0105243_10006975	3300009148	Bacteria	8699
500	Ga0105243_10029257	3300009148	Bacteria	4236
501	Ga0105243_10077202	3300009148	Bacteria	2708
502	Ga0105241_10000053	3300009174	Bacteria	94578
503	Ga0105241_10090424	3300009174	Bacteria	2414
504	Ga0105241_10124355	3300009174	Bacteria	2081
505	Ga0105241_10132389	3300009174	Bacteria	2021
506	Ga0105241_10342329	3300009174	Bacteria	1296
507	Ga0105241_10677332	3300009174	Bacteria	939
508	Ga0105242_10000491	3300009176	Bacteria	31233
509	Ga0105242_10049041	3300009176	Bacteria	3434
510	Ga0105242_10245208	3300009176	Bacteria	1612
511	Ga0105248_10000964	3300009177	Bacteria	32048
512	Ga0105248_10003797	3300009177	Bacteria	16742
513	Ga0105248_10038276	3300009177	Bacteria	5368
514	Ga0105248_10153982	3300009177	Bacteria	2594
515	Ga0105248_10236684	3300009177	Bacteria	2055
516	Ga0105248_10281257	3300009177	Bacteria	1873
517	Ga0105248_10312566	3300009177	Bacteria	1770
518	Ga0105237_10008862	3300009545	Bacteria	10847
519	Ga0105237_10015141	3300009545	Bacteria	8036
520	Ga0105237_10027862	3300009545	Bacteria	5757
521	Ga0105237_10080675	3300009545	Bacteria	3244
522	Ga0105237_10080987	3300009545	Bacteria	3237
523	Ga0105237_10218579	3300009545	Bacteria	1906
524	Ga0105237_10223905	3300009545	Bacteria	1881
525	Ga0105238_10005518	3300009551	Bacteria	12492
526	Ga0105238_10008791	3300009551	Bacteria	10106
527	Ga0105238_10013990	3300009551	Bacteria	8115
528	Ga0105238_10034755	3300009551	Bacteria	5127
529	Ga0105238_10052809	3300009551	Bacteria	4085
530	Ga0105238_10097925	3300009551	Bacteria	2918
531	Ga0105238_10270541	3300009551	Bacteria	1680
532	Ga0105238_10287553	3300009551	Bacteria	1626
533	Ga0105238_10299735	3300009551	Bacteria	1591
534	Ga0105238_10321084	3300009551	Bacteria	1534
535	Ga0105238_10364014	3300009551	Bacteria	1436
536	Ga0105238_10461643	3300009551	Bacteria	1268
537	Ga0105238_10874522	3300009551	Bacteria	916
538	Ga0105249_10001085	3300009553	Bacteria	24172
539	Ga0105249_10106323	3300009553	Bacteria	2647
540	Ga0105249_10115854	3300009553	Bacteria	2540
541	Ga0105249_10247337	3300009553	Bacteria	1766
542	Ga0105249_10407766	3300009553	Bacteria	1391
543	Ga0099796_10016347	3300010159	Bacteria	2189
544	Ga0099796_10030093	3300010159	Bacteria	1758
545	Ga0105239_10002519	3300010375	Bacteria	23275
546	Ga0105239_10009940	3300010375	Bacteria	10682
547	Ga0105239_10012065	3300010375	Bacteria	9637
548	Ga0105239_10014833	3300010375	Bacteria	8642
549	Ga0105239_10053131	3300010375	Bacteria	4445
550	Ga0105239_10071090	3300010375	Bacteria	3823
551	Ga0105239_10093727	3300010375	Bacteria	3316
552	Ga0105239_10095287	3300010375	Bacteria	3288
553	Ga0105239_10124206	3300010375	Bacteria	2868
554	Ga0105239_10128073	3300010375	Bacteria	2822
555	Ga0105239_10232870	3300010375	Bacteria	2067
556	Ga0105239_10271752	3300010375	Bacteria	1907
557	Ga0105239_10313409	3300010375	Bacteria	1768
558	Ga0105239_10641834	3300010375	Bacteria	1212
559	Ga0105246_10000052	3300011119	Bacteria	46290
560	Ga0105246_10005044	3300011119	Bacteria	8027
561	Ga0105246_10043290	3300011119	Bacteria	3054
562	Ga0105246_10070799	3300011119	Bacteria	2454
563	Ga0105246_10148363	3300011119	Bacteria	1772
564	Ga0105246_10243181	3300011119	Bacteria	1424
565	Ga0157335_1001428	3300012492	Bacteria	1312
566	Ga0157341_1001939	3300012494	Bacteria	1310
567	Ga0157339_1000852	3300012505	Bacteria	1696
568	Ga0157373_10021395	3300013100	Bacteria	4699
569	Ga0157373_10138414	3300013100	Bacteria	1712
570	Ga0157373_10196245	3300013100	Bacteria	1423
571	Ga0157371_10003401	3300013102	Bacteria	14457
572	Ga0157371_10037614	3300013102	Bacteria	3463
573	Ga0157371_10241669	3300013102	Bacteria	1299
574	Ga0157371_10318295	3300013102	Bacteria	1129
575	Ga0157370_10023260	3300013104	Bacteria	6153
576	Ga0157370_10087018	3300013104	Bacteria	2935
577	Ga0157370_10089444	3300013104	Bacteria	2892
578	Ga0157370_10142585	3300013104	Bacteria	2232
579	Ga0157370_10327402	3300013104	Bacteria	1413
580	Ga0157370_10629700	3300013104	Bacteria	981
581	Ga0157369_10001511	3300013105	Bacteria	28540
582	Ga0157369_10159158	3300013105	Bacteria	2384
583	Ga0157369_10255370	3300013105	Bacteria	1829
584	Ga0157369_10417724	3300013105	Bacteria	1391
585	Ga0157369_10453675	3300013105	Bacteria	1328
586	Ga0157374_10001210	3300013296	Bacteria	22071
587	Ga0157374_10055607	3300013296	Bacteria	3694
588	Ga0157374_10064601	3300013296	Bacteria	3435
589	Ga0157374_10177581	3300013296	Bacteria	2079
590	Ga0157378_10002713	3300013297	Bacteria	15762
591	Ga0157378_10078751	3300013297	Bacteria	2974
592	Ga0157378_10201436	3300013297	Bacteria	1883
593	Ga0163162_10000308	3300013306	Bacteria	45253
594	Ga0163162_10041674	3300013306	Bacteria	4594
595	Ga0163162_10073674	3300013306	Bacteria	3471
596	Ga0163162_10079821	3300013306	Bacteria	3338
597	Ga0163162_10116570	3300013306	Bacteria	2772
598	Ga0163162_10321040	3300013306	Bacteria	1681
599	Ga0163162_10522399	3300013306	Bacteria	1317
600	Ga0163162_10558197	3300013306	Bacteria	1273
601	Ga0157372_10002370	3300013307	Bacteria	20397
602	Ga0157372_10040215	3300013307	Bacteria	5163
603	Ga0157372_10283795	3300013307	Bacteria	1925
604	Ga0157372_10609627	3300013307	Bacteria	1272
605	Ga0157375_10000414	3300013308	Bacteria	38778
606	Ga0157375_10039319	3300013308	Bacteria	4552
607	Ga0157375_10176028	3300013308	Bacteria	2289
608	Ga0157375_10225179	3300013308	Bacteria	2034
609	Ga0157375_10249642	3300013308	Bacteria	1935
610	Ga0157375_10487912	3300013308	Bacteria	1397
611	Ga0157375_10641958	3300013308	Bacteria	1218
612	Ga0163163_10002008	3300014325	Bacteria	17189
613	Ga0163163_10016496	3300014325	Bacteria	6868
614	Ga0163163_10022724	3300014325	Bacteria	5943
615	Ga0163163_10077402	3300014325	Bacteria	3321
616	Ga0163163_10120586	3300014325	Bacteria	2656
617	Ga0163163_10151049	3300014325	Bacteria	2366
618	Ga0163163_10158656	3300014325	Bacteria	2307
619	Ga0163163_10369133	3300014325	Bacteria	1492
620	Ga0163163_10448537	3300014325	Bacteria	1350
621	Ga0157380_10000122	3300014326	Bacteria	43303
622	Ga0157380_10495451	3300014326	Bacteria	1185
623	Ga0157377_10000688	3300014745	Bacteria	13982
624	Ga0157379_10000261	3300014968	Bacteria	41455
625	Ga0157379_10098068	3300014968	Bacteria	2631
626	Ga0157379_10309900	3300014968	Bacteria	1440
627	Ga0157376_10002538	3300014969	Bacteria	12376
628	Ga0157376_10053954	3300014969	Bacteria	3349
629	Ga0157376_10202573	3300014969	Bacteria	1827
630	Ga0163161_10000199	3300017792	Bacteria	55004
631	Ga0214544_1000016	3300021320	Bacteria	204278
632	Ga0214542_1000016	3300021321	Bacteria	210332
633	Ga0214545_1000008	3300021324	Bacteria	215190
634	Ga0214543_1001466	3300021327	Bacteria	45567
635	Ga0213873_10009795	3300021358	Bacteria	2001
636	Ga0213872_10028176	3300021361	Bacteria	2577
637	Ga0213872_10047754	3300021361	Bacteria	1946
638	Ga0213874_10006393	3300021377	Bacteria	2789
639	Ga0213876_10003239	3300021384	Bacteria	9341
640	Ga0213876_10112222	3300021384	Bacteria	1447
641	Ga0209563_105374	3300025230	Bacteria	2333
642	Ga0207425_1005837	3300025245	Bacteria	3448
643	Ga0209026_1009167	3300025250	Bacteria	1973
644	Ga0209677_100672	3300025253	Bacteria	17650
645	Ga0209677_104189	3300025253	Bacteria	4281
646	Ga0209148_1000282	3300025254	Bacteria	78016
647	Ga0209148_1007881	3300025254	Bacteria	2176
648	Ga0209233_1004421	3300025261	Bacteria	4784
649	Ga0209233_1010542	3300025261	Bacteria	2764
650	Ga0209233_1012168	3300025261	Bacteria	2504
651	Ga0207666_1000049	3300025271	Bacteria	23286
652	Ga0207666_1000597	3300025271	Bacteria	4335
653	Ga0209455_1001040	3300025272	Bacteria	13815
654	Ga0209455_1002709	3300025272	Bacteria	6657
655	Ga0209455_1008795	3300025272	Bacteria	2708
656	Ga0209673_1012007	3300025273	Bacteria	3524
657	Ga0209130_1000045	3300025284	Bacteria	240278
658	Ga0207673_1000439	3300025290	Bacteria	4308
659	Ga0209564_1000321	3300025295	Bacteria	93331
660	Ga0209564_1005785	3300025295	Bacteria	6902
661	Ga0209564_1006440	3300025295	Bacteria	6329
662	Ga0209564_1009846	3300025295	Bacteria	4485
663	Ga0209758_1000069	3300025297	Bacteria	286161
664	Ga0209758_1000635	3300025297	Bacteria	53736
665	Ga0209758_1000686	3300025297	Bacteria	50478
666	Ga0209758_1002443	3300025297	Bacteria	18966
667	Ga0209758_1005237	3300025297	Bacteria	10159
668	Ga0209758_1005561	3300025297	Bacteria	9602
669	Ga0209758_1008699	3300025297	Bacteria	6495
670	Ga0209758_1010679	3300025297	Bacteria	5453
671	Ga0209758_1030622	3300025297	Bacteria	2225
672	Ga0209256_1033836	3300025299	Bacteria	1369
673	Ga0207426_1000826	3300025302	Bacteria	33158
674	Ga0207426_1002082	3300025302	Bacteria	13833
675	Ga0207426_1018863	3300025302	Bacteria	2422
676	Ga0207426_1019837	3300025302	Bacteria	2345
677	Ga0207426_1047523	3300025302	Bacteria	1294
678	Ga0209257_1000473	3300025304	Bacteria	73323
679	Ga0209257_1018878	3300025304	Bacteria	2627
680	Ga0207697_10000335	3300025315	Bacteria	26204
681	Ga0207697_10025453	3300025315	Bacteria	2418
682	Ga0207656_10016962	3300025321	Bacteria	2845
683	Ga0207656_10038990	3300025321	Bacteria	2007
684	Ga0207656_10106192	3300025321	Bacteria	1293
685	Ga0207682_10000042	3300025893	Bacteria	52333
686	Ga0207682_10092512	3300025893	Bacteria	1313
687	Ga0207692_10016486	3300025898	Bacteria	3274
688	Ga0207692_10019032	3300025898	Bacteria	3095
689	Ga0207692_10020310	3300025898	Bacteria	3018
690	Ga0207692_10041703	3300025898	Bacteria	2274
691	Ga0207692_10235900	3300025898	Bacteria	1090
692	Ga0207642_10000065	3300025899	Bacteria	29318
693	Ga0207642_10087754	3300025899	Bacteria	1528
694	Ga0207642_10160839	3300025899	Bacteria	1205
695	Ga0207710_10000734	3300025900	Bacteria	18097
696	Ga0207710_10019877	3300025900	Bacteria	2867
697	Ga0207710_10022757	3300025900	Bacteria	2690
698	Ga0207710_10053801	3300025900	Bacteria	1812
699	Ga0207688_10000053	3300025901	Bacteria	41441
700	Ga0207688_10006140	3300025901	Bacteria	6539
701	Ga0207680_10044067	3300025903	Bacteria	2621
702	Ga0207680_10152265	3300025903	Bacteria	1543
703	Ga0207680_10242520	3300025903	Unclassified	1242
704	Ga0207647_10001150	3300025904	Bacteria	20374
705	Ga0207647_10002277	3300025904	Bacteria	14628
706	Ga0207647_10002930	3300025904	Bacteria	12849
707	Ga0207647_10057180	3300025904	Bacteria	2392
708	Ga0207647_10072916	3300025904	Bacteria	2070
709	Ga0207685_10012934	3300025905	Bacteria	2565
710	Ga0207685_10013733	3300025905	Bacteria	2514
711	Ga0207685_10042206	3300025905	Bacteria	1711
712	Ga0207685_10180580	3300025905	Bacteria	978
713	Ga0207699_10002977	3300025906	Bacteria	8054
714	Ga0207699_10003057	3300025906	Bacteria	7943
715	Ga0207699_10003164	3300025906	Bacteria	7824
716	Ga0207699_10044378	3300025906	Bacteria	2587
717	Ga0207699_10079993	3300025906	Bacteria	2024
718	Ga0207699_10146192	3300025906	Bacteria	1559
719	Ga0207645_10000090	3300025907	Bacteria	65569
720	Ga0207645_10011508	3300025907	Bacteria	6037
721	Ga0207645_10096477	3300025907	Bacteria	1905
722	Ga0207645_10166633	3300025907	Bacteria	1443
723	Ga0207645_10214065	3300025907	Bacteria	1270
724	Ga0207645_10216934	3300025907	Bacteria	1261
725	Ga0207643_10000082	3300025908	Bacteria	62322
726	Ga0207705_10018481	3300025909	Bacteria	4986
727	Ga0207705_10025377	3300025909	Bacteria	4231
728	Ga0207705_10131695	3300025909	Bacteria	1861
729	Ga0207654_10000058	3300025911	Bacteria	75628
730	Ga0207654_10004743	3300025911	Bacteria	6884
731	Ga0207654_10024310	3300025911	Bacteria	3255
732	Ga0207654_10247453	3300025911	Bacteria	1194
733	Ga0207654_10361339	3300025911	Bacteria	1002
734	Ga0207707_10000100	3300025912	Bacteria	85682
735	Ga0207707_10007842	3300025912	Bacteria	9283
736	Ga0207707_10020346	3300025912	Bacteria	5794
737	Ga0207707_10056938	3300025912	Bacteria	3402
738	Ga0207707_10170877	3300025912	Bacteria	1900
739	Ga0207707_10389487	3300025912	Bacteria	1197
740	Ga0207695_10000107	3300025913	Bacteria	252606
741	Ga0207695_10000453	3300025913	Bacteria	89314
742	Ga0207695_10070809	3300025913	Bacteria	3563
743	Ga0207695_10137509	3300025913	Bacteria	2395
744	Ga0207695_10196781	3300025913	Bacteria	1931
745	Ga0207695_10567094	3300025913	Bacteria	1017
746	Ga0207671_10006934	3300025914	Bacteria	9976
747	Ga0207671_10022867	3300025914	Bacteria	4720
748	Ga0207671_10039004	3300025914	Bacteria	3519
749	Ga0207671_10070331	3300025914	Bacteria	2609
750	Ga0207671_10075442	3300025914	Bacteria	2522
751	Ga0207671_10106543	3300025914	Bacteria	2128
752	Ga0207693_10000310	3300025915	Bacteria	45408
753	Ga0207693_10002221	3300025915	Bacteria	16903
754	Ga0207693_10002937	3300025915	Bacteria	14752
755	Ga0207693_10013676	3300025915	Bacteria	6537
756	Ga0207693_10016511	3300025915	Bacteria	5899
757	Ga0207693_10028589	3300025915	Bacteria	4406
758	Ga0207693_10045294	3300025915	Bacteria	3456
759	Ga0207693_10092818	3300025915	Bacteria	2366
760	Ga0207693_10309987	3300025915	Bacteria	1236
761	Ga0207663_10032061	3300025916	Bacteria	3116
762	Ga0207663_10033325	3300025916	Bacteria	3068
763	Ga0207663_10038220	3300025916	Bacteria	2900
764	Ga0207663_10063141	3300025916	Bacteria	2357
765	Ga0207663_10127397	3300025916	Bacteria	1753
766	Ga0207663_10166201	3300025916	Bacteria	1563
767	Ga0207663_10333825	3300025916	Bacteria	1143
768	Ga0207660_10000083	3300025917	Bacteria	50279
769	Ga0207660_10018837	3300025917	Bacteria	4608
770	Ga0207660_10023642	3300025917	Bacteria	4153
771	Ga0207660_10048720	3300025917	Bacteria	3000
772	Ga0207660_10052872	3300025917	Bacteria	2893
773	Ga0207660_10077983	3300025917	Bacteria	2427
774	Ga0207660_10080400	3300025917	Bacteria	2393
775	Ga0207660_10552665	3300025917	Bacteria	936
776	Ga0207662_10007146	3300025918	Bacteria	6072
777	Ga0207662_10017526	3300025918	Bacteria	4053
778	Ga0207662_10210360	3300025918	Bacteria	1262
779	Ga0207657_10001336	3300025919	Bacteria	26204
780	Ga0207657_10001686	3300025919	Bacteria	23826
781	Ga0207657_10014898	3300025919	Bacteria	7564
782	Ga0207657_10022984	3300025919	Bacteria	5817
783	Ga0207657_10057036	3300025919	Bacteria	3368
784	Ga0207657_10060102	3300025919	Bacteria	3262
785	Ga0207657_10175078	3300025919	Bacteria	1737
786	Ga0207649_10000643	3300025920	Bacteria	23321
787	Ga0207649_10036240	3300025920	Bacteria	2970
788	Ga0207649_10119077	3300025920	Bacteria	1777
789	Ga0207649_10194096	3300025920	Bacteria	1430
790	Ga0207652_10000557	3300025921	Bacteria	37611
791	Ga0207652_10026633	3300025921	Bacteria	4818
792	Ga0207652_10030893	3300025921	Bacteria	4492
793	Ga0207652_10040001	3300025921	Bacteria	3981
794	Ga0207652_10134241	3300025921	Bacteria	2209
795	Ga0207652_10189872	3300025921	Bacteria	1848
796	Ga0207652_10201882	3300025921	Bacteria	1789
797	Ga0207652_10493677	3300025921	Bacteria	1102
798	Ga0207646_10095001	3300025922	Bacteria	2670
799	Ga0207681_10000271	3300025923	Bacteria	38955
800	Ga0207681_10227791	3300025923	Bacteria	1445
801	Ga0207694_10001009	3300025924	Bacteria	24556
802	Ga0207694_10007667	3300025924	Bacteria	8175
803	Ga0207694_10038148	3300025924	Bacteria	3693
804	Ga0207694_10053306	3300025924	Bacteria	3136
805	Ga0207694_10094099	3300025924	Bacteria	2367
806	Ga0207694_10118044	3300025924	Bacteria	2116
807	Ga0207650_10032088	3300025925	Bacteria	3799
808	Ga0207650_10136231	3300025925	Bacteria	1926
809	Ga0207659_10000161	3300025926	Bacteria	39821
810	Ga0207659_10000460	3300025926	Bacteria	24451
811	Ga0207659_10144234	3300025926	Bacteria	1852
812	Ga0207687_10000063	3300025927	Bacteria	83105
813	Ga0207687_10012464	3300025927	Bacteria	5554
814	Ga0207687_10076079	3300025927	Bacteria	2410
815	Ga0207700_10001418	3300025928	Bacteria	13613
816	Ga0207700_10004421	3300025928	Bacteria	8285
817	Ga0207700_10010167	3300025928	Bacteria	5920
818	Ga0207700_10026056	3300025928	Bacteria	4072
819	Ga0207700_10030214	3300025928	Bacteria	3834
820	Ga0207700_10067717	3300025928	Bacteria	2734
821	Ga0207700_10076096	3300025928	Bacteria	2603
822	Ga0207700_10114116	3300025928	Bacteria	2179
823	Ga0207700_10119721	3300025928	Bacteria	2133
824	Ga0207700_10125666	3300025928	Bacteria	2086
825	Ga0207700_10327804	3300025928	Bacteria	1328
826	Ga0207664_10004485	3300025929	Bacteria	9460
827	Ga0207664_10019693	3300025929	Bacteria	4993
828	Ga0207664_10036266	3300025929	Bacteria	3811
829	Ga0207664_10048578	3300025929	Bacteria	3338
830	Ga0207664_10081559	3300025929	Bacteria	2632
831	Ga0207664_10180253	3300025929	Bacteria	1813
832	Ga0207664_10189317	3300025929	Bacteria	1770
833	Ga0207664_10500655	3300025929	Bacteria	1088
834	Ga0207644_10000591	3300025931	Bacteria	23144
835	Ga0207644_10011436	3300025931	Bacteria	5872
836	Ga0207644_10059212	3300025931	Bacteria	2770
837	Ga0207644_10060210	3300025931	Bacteria	2747
838	Ga0207644_10332617	3300025931	Bacteria	1230
839	Ga0207644_10554725	3300025931	Bacteria	951
840	Ga0207690_10000897	3300025932	Bacteria	19010
841	Ga0207690_10106097	3300025932	Bacteria	2015
842	Ga0207690_10132246	3300025932	Bacteria	1828
843	Ga0207690_10226025	3300025932	Bacteria	1434
844	Ga0207690_10264463	3300025932	Bacteria	1334
845	Ga0207690_10475570	3300025932	Bacteria	1008
846	Ga0207706_10001197	3300025933	Bacteria	26204
847	Ga0207706_10030254	3300025933	Bacteria	4831
848	Ga0207706_10039210	3300025933	Bacteria	4199
849	Ga0207706_10087334	3300025933	Bacteria	2742
850	Ga0207686_10000614	3300025934	Bacteria	22208
851	Ga0207686_10024638	3300025934	Bacteria	3489
852	Ga0207709_10000429	3300025935	Bacteria	40094
853	Ga0207709_10076079	3300025935	Bacteria	2148
854	Ga0207709_10238566	3300025935	Bacteria	1321
855	Ga0207670_10000485	3300025936	Bacteria	21952
856	Ga0207670_10006650	3300025936	Bacteria	6428
857	Ga0207670_10051762	3300025936	Bacteria	2759
858	Ga0207670_10091818	3300025936	Bacteria	2148
859	Ga0207670_10251871	3300025936	Bacteria	1365
860	Ga0207669_10000019	3300025937	Bacteria	111630
861	Ga0207669_10170314	3300025937	Bacteria	1549
862	Ga0207669_10317964	3300025937	Bacteria	1190
863	Ga0207704_10000552	3300025938	Bacteria	16651
864	Ga0207704_10123590	3300025938	Bacteria	1777
865	Ga0207665_10001734	3300025939	Bacteria	14668
866	Ga0207665_10006611	3300025939	Bacteria	7690
867	Ga0207665_10009684	3300025939	Bacteria	6325
868	Ga0207665_10118027	3300025939	Bacteria	1871
869	Ga0207665_10125262	3300025939	Bacteria	1819
870	Ga0207665_10127756	3300025939	Bacteria	1801
871	Ga0207691_10000987	3300025940	Bacteria	28275
872	Ga0207691_10040766	3300025940	Bacteria	4289
873	Ga0207691_10086631	3300025940	Bacteria	2810
874	Ga0207711_10011159	3300025941	Bacteria	7467
875	Ga0207711_10012997	3300025941	Bacteria	6916
876	Ga0207711_10071484	3300025941	Bacteria	3010
877	Ga0207711_10106207	3300025941	Bacteria	2491
878	Ga0207711_10192391	3300025941	Bacteria	1860
879	Ga0207711_10327793	3300025941	Bacteria	1416
880	Ga0207689_10000916	3300025942	Bacteria	28296
881	Ga0207689_10134681	3300025942	Unclassified	2034
882	Ga0207689_10159295	3300025942	Bacteria	1860
883	Ga0207689_10178399	3300025942	Bacteria	1752
884	Ga0207689_10283303	3300025942	Bacteria	1372
885	Ga0207661_10000281	3300025944	Bacteria	32639
886	Ga0207661_10063954	3300025944	Bacteria	2981
887	Ga0207661_10193687	3300025944	Bacteria	1783
888	Ga0207661_10383665	3300025944	Bacteria	1272
889	Ga0207679_10000026	3300025945	Bacteria	200073
890	Ga0207679_10090266	3300025945	Bacteria	2368
891	Ga0207679_10097234	3300025945	Bacteria	2293
892	Ga0207679_10269529	3300025945	Bacteria	1455
893	Ga0207667_10002324	3300025949	Bacteria	23814
894	Ga0207667_10004064	3300025949	Bacteria	17974
895	Ga0207667_10015224	3300025949	Bacteria	8745
896	Ga0207667_10022622	3300025949	Bacteria	6937
897	Ga0207667_10141261	3300025949	Bacteria	2479
898	Ga0207667_10240035	3300025949	Bacteria	1855
899	Ga0207667_10270516	3300025949	Bacteria	1737
900	Ga0207667_10607740	3300025949	Bacteria	1102
901	Ga0207651_10000101	3300025960	Bacteria	37898
902	Ga0207712_10000908	3300025961	Bacteria	21454
903	Ga0207712_10218803	3300025961	Bacteria	1521
904	Ga0207712_10239725	3300025961	Bacteria	1460
905	Ga0207668_10000726	3300025972	Bacteria	20155
906	Ga0207668_10054744	3300025972	Bacteria	2770
907	Ga0207668_10159236	3300025972	Bacteria	1757
908	Ga0207668_10224893	3300025972	Bacteria	1509
909	Ga0207668_10349247	3300025972	Bacteria	1236
910	Ga0207640_10000596	3300025981	Bacteria	21479
911	Ga0207640_10064044	3300025981	Bacteria	2446
912	Ga0207640_10129721	3300025981	Bacteria	1821
913	Ga0207640_10247627	3300025981	Bacteria	1381
914	Ga0207640_10314960	3300025981	Bacteria	1243
915	Ga0207658_10003725	3300025986	Bacteria	10734
916	Ga0207658_10118433	3300025986	Bacteria	2107
917	Ga0207677_10000651	3300026023	Bacteria	20869
918	Ga0207677_10079428	3300026023	Bacteria	2346
919	Ga0207677_10113338	3300026023	Bacteria	2024
920	Ga0207677_10250420	3300026023	Bacteria	1438
921	Ga0207677_10317108	3300026023	Bacteria	1294
922	Ga0207677_10450597	3300026023	Bacteria	1103
923	Ga0207703_10001717	3300026035	Bacteria	19677
924	Ga0207703_10028705	3300026035	Bacteria	4389
925	Ga0207703_10099895	3300026035	Bacteria	2457
926	Ga0207703_10108324	3300026035	Bacteria	2366
927	Ga0207703_10212977	3300026035	Bacteria	1724
928	Ga0207703_10268259	3300026035	Bacteria	1545
929	Ga0207639_10002317	3300026041	Bacteria	12780
930	Ga0207639_10008158	3300026041	Bacteria	7162
931	Ga0207639_10031138	3300026041	Bacteria	3918
932	Ga0207639_10147371	3300026041	Bacteria	1968
933	Ga0207639_10200353	3300026041	Bacteria	1712
934	Ga0207639_10418887	3300026041	Bacteria	1210
935	Ga0207678_10000831	3300026067	Bacteria	28276
936	Ga0207678_10004832	3300026067	Bacteria	12098
937	Ga0207678_10005663	3300026067	Bacteria	11166
938	Ga0207678_10031777	3300026067	Bacteria	4603
939	Ga0207678_10039914	3300026067	Bacteria	4072
940	Ga0207678_10045970	3300026067	Bacteria	3775
941	Ga0207678_10053719	3300026067	Bacteria	3471
942	Ga0207708_10002086	3300026075	Bacteria	14711
943	Ga0207708_10007188	3300026075	Bacteria	8232
944	Ga0207708_10021696	3300026075	Bacteria	4845
945	Ga0207708_10188098	3300026075	Bacteria	1642
946	Ga0207708_10198676	3300026075	Bacteria	1599
947	Ga0207702_10000004	3300026078	Bacteria	422182
948	Ga0207702_10001701	3300026078	Bacteria	21732
949	Ga0207702_10005168	3300026078	Bacteria	11483
950	Ga0207702_10082698	3300026078	Bacteria	2792
951	Ga0207702_10149669	3300026078	Bacteria	2122
952	Ga0207702_10152046	3300026078	Bacteria	2106
953	Ga0207702_10154503	3300026078	Bacteria	2090
954	Ga0207702_10217083	3300026078	Bacteria	1781
955	Ga0207702_10222725	3300026078	Bacteria	1758
956	Ga0207702_10279826	3300026078	Bacteria	1577
957	Ga0207702_10485388	3300026078	Bacteria	1203
958	Ga0207641_10002162	3300026088	Bacteria	18511
959	Ga0207641_10853150	3300026088	Bacteria	903
960	Ga0207648_10001440	3300026089	Bacteria	26204
961	Ga0207648_10027306	3300026089	Bacteria	5069
962	Ga0207648_10047658	3300026089	Bacteria	3755
963	Ga0207648_10122872	3300026089	Bacteria	2283
964	Ga0207676_10000563	3300026095	Bacteria	30791
965	Ga0207676_10026824	3300026095	Bacteria	4285
966	Ga0207676_10179576	3300026095	Bacteria	1852
967	Ga0207674_10000890	3300026116	Bacteria	39065
968	Ga0207674_10001207	3300026116	Bacteria	33673
969	Ga0207674_10002298	3300026116	Bacteria	24210
970	Ga0207674_10046110	3300026116	Bacteria	4478
971	Ga0207674_10050784	3300026116	Bacteria	4235
972	Ga0207674_10060579	3300026116	Bacteria	3827
973	Ga0207674_10074016	3300026116	Bacteria	3419
974	Ga0207675_100000983	3300026118	Bacteria	28277
975	Ga0207675_100034844	3300026118	Bacteria	4695
976	Ga0207675_100101390	3300026118	Bacteria	2712
977	Ga0207683_10000324	3300026121	Bacteria	43461
978	Ga0207683_10001459	3300026121	Bacteria	21325
979	Ga0207683_10037437	3300026121	Bacteria	4224
980	Ga0207683_10037847	3300026121	Bacteria	4203
981	Ga0207683_10063219	3300026121	Bacteria	3261
982	Ga0207683_10089829	3300026121	Bacteria	2735
983	Ga0207683_10358358	3300026121	Bacteria	1339
984	Ga0207683_10368755	3300026121	Bacteria	1319
985	Ga0207698_10000634	3300026142	Bacteria	20408
986	Ga0207698_10037553	3300026142	Bacteria	3569
987	Ga0207698_10066209	3300026142	Bacteria	2843
988	Ga0207698_10081718	3300026142	Bacteria	2609
989	Ga0207698_10129747	3300026142	Bacteria	2152
990	Ga0207698_10222866	3300026142	Bacteria	1706
991	Ga0207698_10261757	3300026142	Bacteria	1589
992	Ga0207698_10303068	3300026142	Bacteria	1488
993	Ga0209389_1000033	3300027296	Bacteria	131516
994	Ga0209389_1000182	3300027296	Bacteria	48705
995	Ga0209589_1000021	3300027357	Bacteria	186431
996	Ga0209589_1000040	3300027357	Bacteria	126550
997	Ga0209489_100028	3300027361	Bacteria	186431
998	Ga0209489_100045	3300027361	Bacteria	158225
999	Ga0209489_100209	3300027361	Bacteria	96349
1000	Ga0209700_100011	3300027363	Bacteria	362159
1001	Ga0209700_100037	3300027363	Bacteria	186431
1002	Ga0209995_1022537	3300027471	Bacteria	1045
1003	Ga0209968_1016151	3300027526	Bacteria	1184
1004	Ga0209588_1003941	3300027671	Bacteria	4150
1005	Ga0209971_1009877	3300027682	Bacteria	2258
1006	Ga0209998_10001212	3300027717	Bacteria	6329
1007	Ga0209813_10004390	3300027866	Bacteria	3366
1008	Ga0209974_10001144	3300027876	Bacteria	9440
1009	Ga0209974_10011378	3300027876	Bacteria	2988
1010	Ga0209974_10044083	3300027876	Bacteria	1487
1011	Ga0207428_10000130	3300027907	Bacteria	104457
1012	Ga0207428_10000180	3300027907	Bacteria	88557
1013	Ga0207428_10000286	3300027907	Bacteria	68250
1014	Ga0207428_10121991	3300027907	Bacteria	1998
1015	Ga0268266_10001190	3300028379	Bacteria	32120
1016	Ga0268266_10003966	3300028379	Bacteria	14358
1017	Ga0268266_10006553	3300028379	Bacteria	10645
1018	Ga0268266_10010790	3300028379	Bacteria	7959
1019	Ga0268266_10018702	3300028379	Bacteria	5903
1020	Ga0268266_10026048	3300028379	Bacteria	4974
1021	Ga0268266_10060942	3300028379	Bacteria	3253
1022	Ga0268266_10161936	3300028379	Bacteria	2025
1023	Ga0268266_10202084	3300028379	Bacteria	1819
1024	Ga0268265_10004798	3300028380	Bacteria	9319
1025	Ga0268264_10000062	3300028381	Bacteria	302110
1026	Ga0268264_10027250	3300028381	Bacteria	4666
1027	Ga0265337_1004948	3300028556	Bacteria	5419
1028	Ga0265326_10019560	3300028558	Bacteria	1944
1029	Ga0265334_10041598	3300028573	Bacteria	1796
1030	Ga0265334_10056600	3300028573	Bacteria	1488
1031	Ga0265323_10010254	3300028653	Bacteria	3802
1032	Ga0265336_10000561	3300028666	Bacteria	21059
1033	Ga0307517_10001338	3300028786	Bacteria	41372
1034	Ga0307515_10062859	3300028794	Bacteria	5232
1035	Ga0307515_10181770	3300028794	Bacteria	2050
1036	Ga0307515_10289619	3300028794	Bacteria	1335
1037	Ga0307515_10356527	3300028794	Bacteria	1106
1038	Ga0265338_10000598	3300028800	Bacteria	63497
1039	Ga0265338_10020386	3300028800	Bacteria	6975
1040	Ga0265338_10088359	3300028800	Bacteria	2572
1041	Ga0265324_10007924	3300029957	Bacteria	4261
1042	Ga0307511_10032499	3300030521	Bacteria	4634
1043	Ga0307511_10161439	3300030521	Bacteria	1257
1044	Ga0265330_10011313	3300031235	Bacteria	4189
1045	Ga0265330_10015500	3300031235	Bacteria	3525
1046	Ga0265330_10078748	3300031235	Bacteria	1421
1047	Ga0265332_10011743	3300031238	Bacteria	3890
1048	Ga0265332_10044345	3300031238	Bacteria	1918
1049	Ga0265325_10000011	3300031241	Bacteria	150631
1050	Ga0265325_10003966	3300031241	Bacteria	9472
1051	Ga0265325_10010784	3300031241	Bacteria	5272
1052	Ga0265325_10038989	3300031241	Bacteria	2504
1053	Ga0265325_10122320	3300031241	Bacteria	1253
1054	Ga0265340_10015122	3300031247	Bacteria	4015
1055	Ga0265340_10027823	3300031247	Bacteria	2848
1056	Ga0265340_10059770	3300031247	Bacteria	1827
1057	Ga0265339_10001062	3300031249	Bacteria	20880
1058	Ga0265339_10021072	3300031249	Bacteria	3800
1059	Ga0265339_10047184	3300031249	Bacteria	2366
1060	Ga0265331_10024816	3300031250	Bacteria	3029
1061	Ga0265316_10135766	3300031344	Bacteria	1851
1062	Ga0307513_10135414	3300031456	Bacteria	2400
1063	Ga0307513_10380870	3300031456	Bacteria	1150
1064	Ga0307513_10402072	3300031456	Bacteria	1104
1065	Ga0307509_10080587	3300031507	Bacteria	3366
1066	Ga0265313_10000008	3300031595	Bacteria	173405
1067	Ga0265313_10020196	3300031595	Bacteria	3681
1068	Ga0307508_10118780	3300031616	Bacteria	2246
1069	Ga0307508_10201682	3300031616	Bacteria	1589
1070	Ga0307508_10207705	3300031616	Bacteria	1559
1071	Ga0265314_10002746	3300031711	Bacteria	17598
1072	Ga0265314_10042090	3300031711	Bacteria	3262
1073	Ga0265342_10000625	3300031712	Bacteria	37152
1074	Ga0265342_10035856	3300031712	Bacteria	3032
1075	Ga0265342_10054134	3300031712	Bacteria	2386
1076	Ga0265342_10057548	3300031712	Bacteria	2300
1077	Ga0265342_10197901	3300031712	Bacteria	1093
1078	Ga0307516_10008308	3300031730	Bacteria	11766
1079	Ga0307516_10022504	3300031730	Bacteria	6470
1080	Ga0307516_10093671	3300031730	Bacteria	2829
1081	Ga0307516_10102284	3300031730	Bacteria	2680
1082	Ga0307516_10318436	3300031730	Bacteria	1227
1083	Ga0307516_10409265	3300031730	Bacteria	1015
1084	Ga0307405_10031045	3300031731	Bacteria	3141
1085	Ga0307410_10094066	3300031852	Bacteria	2134
1086	Ga0307406_10038341	3300031901	Bacteria	2966
1087	Ga0307412_10197313	3300031911	Bacteria	1526
1088	Ga0307416_100092107	3300032002	Bacteria	2606
1089	Ga0307416_100149616	3300032002	Bacteria	2139
1090	Ga0307416_100493536	3300032002	Bacteria	1287
1091	Ga0307411_10317908	3300032005	Bacteria	1256
1092	Ga0307507_10019178	3300033179	Bacteria	7716
1093	Ga0307510_10021983	3300033180	Bacteria	7418
1094	Ga0307510_10037056	3300033180	Bacteria	5418
1095	Ga0307510_10072508	3300033180	Bacteria	3421
1096	Ga0315911_1000008	3300033442	Bacteria	381285
1097	Ga0373930_0000103	3300034816	Bacteria	8807
1098	Ga0373930_0003413	3300034816	Bacteria	2518
1099	Ga0373930_0007086	3300034816	Bacteria	1917
1100	Ga0373930_0012448	3300034816	Bacteria	1552
1101	Ga0373948_0000862	3300034817	Bacteria	4039
1102	Ga0373950_0000731	3300034818	Bacteria	4077
1103	Ga0373950_0014963	3300034818	Unclassified	1311
1104	Ga0373958_0000037	3300034819	Bacteria	13403
1105	Ga0373959_0000941	3300034820	Bacteria	4889
1106	Ga0373959_0009861	3300034820	Bacteria	1657
1107	Ga0373938_0000190	3300034957	Bacteria	9113
1108	Ga0373938_0009528	3300034957	Bacteria	1762
1109	Ga0373926_0007441	3300035083	Bacteria	3646
1110	Ga0373926_0017993	3300035083	Bacteria	2428
1111	Ga0373928_0029080	3300035084	Bacteria	1213
1112	Ga0373929_0000503	3300035085	Bacteria	7457
1113	Ga0373929_0006273	3300035085	Bacteria	2147
1114	Ga0373929_0010781	3300035085	Bacteria	1714
1115	Ga0373929_0020115	3300035085	Bacteria	1343
1116	Ga0373934_0002347	3300035086	Bacteria	6965
1117	Ga0373940_0000178	3300035088	Bacteria	8521
1118	Ga0373951_0000165	3300035091	Bacteria	24248
1119	Ga0373951_0004364	3300035091	Bacteria	3363
1120	Ga0373951_0010273	3300035091	Bacteria	2102
1121	Ga0373952_0000829	3300035092	Bacteria	5590
1122	Ga0373923_0004419	3300035111	Bacteria	4662
1123	Ga0373923_0023286	3300035111	Bacteria	2435
1124	Ga0373923_0029991	3300035111	Bacteria	2185
1125	Ga0373923_0051538	3300035111	Bacteria	1727
1126	Ga0373923_0081219	3300035111	Bacteria	1406
1127	Ga0373923_0112538	3300035111	Bacteria	1210
1128	Ga0373932_0000221	3300035112	Bacteria	16961
1129	Ga0373932_0001308	3300035112	Bacteria	7020
1130	Ga0373932_0007946	3300035112	Bacteria	2533
1131	Ga0373936_0011829	3300035113	Bacteria	3311
1132	Ga0373936_0028137	3300035113	Bacteria	2208
1133	Ga0373939_0000178	3300035114	Bacteria	17639
1134	Ga0373939_0000211	3300035114	Bacteria	16115
1135	Ga0373941_0000085	3300035115	Bacteria	15179
1136	Ga0373941_0018807	3300035115	Bacteria	1914
1137	Ga0373945_0034128	3300035116	Bacteria	1811
1138	Ga0373945_0044384	3300035116	Bacteria	1616
1139	Ga0373953_0009436	3300035117	Bacteria	3358
1140	Ga0373954_0000883	3300035118	Bacteria	11661
1141	Ga0373954_0016379	3300035118	Bacteria	3317
1142	Ga0373956_0018845	3300035119	Bacteria	2924
1143	Ga0373956_0085815	3300035119	Bacteria	1448
1144	Ga0373957_0001330	3300035120	Bacteria	6639
1145	Ga0373957_0007368	3300035120	Bacteria	3519
1146	Ga0373957_0049500	3300035120	Bacteria	1604
1147	Ga0373957_0070742	3300035120	Bacteria	1364
1148	Ga0373960_0001587	3300035121	Bacteria	5072
1149	Ga0373960_0009749	3300035121	Bacteria	2333
1150	Ga0373943_0009325	3300035170	Bacteria	4400
1151	Ga0373943_0058528	3300035170	Bacteria	1918
1152	Ga0373943_0060330	3300035170	Bacteria	1893
1153	Ga0373946_0002144	3300035171	Bacteria	6923
1154	Ga0373946_0006651	3300035171	Bacteria	4199
1155	Ga0373946_0013913	3300035171	Bacteria	3030
1156	Ga0373955_0001067	3300035172	Bacteria	11681
1157	Ga0373955_0002823	3300035172	Bacteria	7630
1158	Ga0373955_0006562	3300035172	Bacteria	5307
1159	Ga0373955_0012669	3300035172	Bacteria	4057
1160	Ga0373955_0021359	3300035172	Bacteria	3267
1161	Ga0373955_0022947	3300035172	Bacteria	3173
1162	Ga0373942_0001835	3300035207	Bacteria	5368
1163	Ga0373942_0004182	3300035207	Bacteria	3362
1164	Ga0373942_0031734	3300035207	Bacteria	1399
1165	Ga0373961_0001088	3300035241	Bacteria	8657
1166	Ga0373961_0020525	3300035241	Bacteria	1749
1167	Ga0373962_0000271	3300035242	Bacteria	11153
1168	Ga0373924_0005686	3300035410	Bacteria	4425
1169	Ga0373924_0026792	3300035410	Bacteria	2289
1170	Ga0373924_0030107	3300035410	Bacteria	2174
1171	Ga0373924_0082472	3300035410	Bacteria	1369
1172	Ga0373924_0107917	3300035410	Bacteria	1201
1173	Ga0373931_0000854	3300035691	Bacteria	12844
1174	Ga0373931_0004670	3300035691	Bacteria	6269
1175	Ga0373931_0007821	3300035691	Bacteria	5052
1176	Ga0373931_0020376	3300035691	Bacteria	3318
1177	Ga0373935_0000953	3300035692	Bacteria	15634
1178	Ga0373935_0009363	3300035692	Bacteria	5861
1179	Ga0373935_0375082	3300035692	Bacteria	1018
1180	Ga0373935_0405554	3300035692	Bacteria	980
1181	Ga0373927_0001486	3300035695	Bacteria	17658
1182	Ga0373927_0016979	3300035695	Bacteria	4797
1183	Ga0373927_0020336	3300035695	Bacteria	4354
1184	Ga0373927_0020725	3300035695	Bacteria	4311
1185	Ga0373927_0047148	3300035695	Bacteria	2787
1186	Ga0373927_0085319	3300035695	Bacteria	2049
1187	Ga0373927_0210585	3300035695	Bacteria	1277
1188	Ga0373927_0210852	3300035695	Bacteria	1276
1189	Ga0373927_0231919	3300035695	Bacteria	1213
1190	Ga0373927_0370168	3300035695	Bacteria	945
1191	Ga0373933_0000031	3300035724	Bacteria	85038
1192	Ga0373933_0001638	3300035724	Bacteria	13046
1193	Ga0373933_0004073	3300035724	Bacteria	8051
1194	Ga0373933_0009095	3300035724	Bacteria	5421
1195	Ga0373933_0046875	3300035724	Bacteria	2568
1196	Ga0373933_0275632	3300035724	Unclassified	1086
1197	Ga0373933_0283029	3300035724	Bacteria	1071
1198	Ga0373947_0016744	3300035725	Bacteria	4212
1199	Ga0373947_0034928	3300035725	Bacteria	2975
1200	Ga0373947_0108866	3300035725	Bacteria	1748
1201	Ga0373947_0125159	3300035725	Bacteria	1636
1202	Ga0373947_0136574	3300035725	Bacteria	1569
1203	Ga0373937_0022664	3300036401	Bacteria	5648
1204	Ga0373937_0024864	3300036401	Bacteria	5406
1205	Ga0373937_0035182	3300036401	Bacteria	4558
1206	Ga0373937_0063798	3300036401	Bacteria	3388
1207	Ga0373937_0185374	3300036401	Bacteria	1954
1208	Ga0373937_0245399	3300036401	Bacteria	1688
1209	Ga0373937_0342089	3300036401	Bacteria	1417
1210	Ga0373925_0001713	3300037068	Bacteria	18492
1211	Ga0373925_0011017	3300037068	Bacteria	6566
1212	Ga0373925_0012057	3300037068	Bacteria	6259
1213	Ga0373925_0021659	3300037068	Bacteria	4685
1214	Ga0373925_0061385	3300037068	Bacteria	2823
1215	Ga0373925_0061914	3300037068	Bacteria	2812
1216	Ga0373925_0065920	3300037068	Bacteria	2729
1217	Ga0395899_0032437	3300037312	Bacteria	3923
1218	Ga0395899_0095919	3300037312	Bacteria	2145
1219	Ga0395900_0003383	3300037418	Bacteria	17226
1220	Ga0395900_0034932	3300037418	Bacteria	5178
1221	Ga0395900_0040360	3300037418	Bacteria	4810
1222	Ga0395900_0128808	3300037418	Bacteria	2594
1223	Ga0395898_0042666	3300037466	Bacteria	4474
1224	Ga0395898_0071806	3300037466	Bacteria	3344
1225	Ga0395898_0149786	3300037466	Bacteria	2233
1226	Ga0395898_0214916	3300037466	Bacteria	1834
1227	Ga0395898_0238773	3300037466	Bacteria	1733
1228	Ga0395898_0253695	3300037466	Bacteria	1677
1229	Ga0395905_0206657	3300037471	Bacteria	1840
1230	Ga0436364_0096232	3300037853	Bacteria	2164
1231	Ga0395901_0161555	3300038443	Bacteria	2353
1232	Ga0395901_0230847	3300038443	Bacteria	1932
1233	Ga0395901_0250229	3300038443	Bacteria	1846
1234	Ga0395901_0272541	3300038443	Bacteria	1760
1235	Ga0395901_0434709	3300038443	Bacteria	1344
1236	Ga0395901_0486977	3300038443	Bacteria	1257
1237	Ga0436365_0221825	3300039437	Bacteria	1693
1238	Ga0436365_0946034	3300039437	Bacteria	9968
1239	Ga0436365_0949897	3300039437	Bacteria	15199
1240	Ga0436365_1714553	3300039437	Bacteria	1591
1241	Ga0436360_0780899	3300039438	Bacteria	2054
1242	Ga0436361_0333730	3300039447	Bacteria	2348
1243	Ga0436363_0863782	3300039450	Bacteria	5485
1244	Ga0436363_0926778	3300039450	Bacteria	971
1245	Ga0436363_1148766	3300039450	Bacteria	3575
1246	Ga0436362_0112883	3300039453	Bacteria	1833
1247	Ga0436362_0546439	3300039453	Bacteria	2270
1248	Ga0436362_0693408	3300039453	Bacteria	1453
1249	Ga0439453_0006962	3300041408	Bacteria	1777
1250	Ga0451797_1160655	3300041453	Bacteria	1433
1251	Ga0451802_0544973	3300041460	Bacteria	1559
1252	Ga0439443_004964	3300042003	Bacteria	1760
1253	Ga0439459_0024175	3300042438	Bacteria	1190
1254	Ga0439460_0007890	3300042461	Bacteria	2675
1255	Ga0451577_0274370	3300042876	Bacteria	1527
1256	Ga0466969_0030685	3300044656	Bacteria	2739
1257	Ga0466969_0118977	3300044656	Bacteria	1231
1258	Ga0466972_0000119	3300044658	Bacteria	66620
1259	Ga0466972_0023237	3300044658	Bacteria	3083
1260	Ga0466972_0120032	3300044658	Bacteria	1240
1261	Ga0453683_0027898	3300044673	Bacteria	3578
1262	Ga0466965_0029278	3300044683	Bacteria	2679
1263	Ga0466965_0036005	3300044683	Bacteria	2427
1264	Ga0466966_0001462	3300044684	Bacteria	15200
1265	Ga0466966_0064168	3300044684	Bacteria	2313
1266	Ga0466966_0142339	3300044684	Bacteria	1465
1267	Ga0466961_0000139	3300044693	Bacteria	48781
1268	Ga0466961_0119230	3300044693	Bacteria	1657
1269	Ga0466963_0021631	3300044694	Bacteria	4061
1270	Ga0466964_0106147	3300044706	Bacteria	1246
1271	Ga0466964_0145203	3300044706	Bacteria	1095
1272	Ga0453684_0033092	3300044712	Bacteria	7214
1273	Ga0466968_0033860	3300044735	Bacteria	2130
1274	Ga0466968_0064073	3300044735	Bacteria	1589
1275	Ga0466957_0109451	3300044842	Bacteria	1751
1276	Ga0466960_0056971	3300044901	Bacteria	1904
1277	Ga0466959_0084047	3300045049	Bacteria	2291
1278	Ga0466959_0161266	3300045049	Bacteria	1576
1279	Ga0466959_0209189	3300045049	Bacteria	1356
1280	Ga0451576_0044873	3300045051	Bacteria	4657
1281	Ga0466958_0031880	3300045836	Bacteria	3133
1282	Ga0466967_0083690	3300045976	Bacteria	2886
1283	Ga0466967_0105726	3300045976	Bacteria	2579
1284	Ga0466967_0225224	3300045976	Bacteria	1783
1285	Ga0466967_0361534	3300045976	Bacteria	1406
1286	Ga0495617_033033	3300046452	Bacteria	1737
1287	Ga0495592_0003085	3300046454	Bacteria	11889
1288	Ga0495592_0024684	3300046454	Bacteria	4570
1289	Ga0495592_0036398	3300046454	Bacteria	3708
1290	Ga0495592_0115227	3300046454	Bacteria	1897
1291	Ga0495603_0000047	3300046455	Bacteria	53081
1292	Ga0495603_0020465	3300046455	Bacteria	4010
1293	Ga0495603_0022882	3300046455	Bacteria	3782
1294	Ga0495603_0029746	3300046455	Bacteria	3293
1295	Ga0495603_0041392	3300046455	Bacteria	2755
1296	Ga0495603_0062555	3300046455	Bacteria	2197
1297	Ga0495603_0162744	3300046455	Bacteria	1294
1298	Ga0495603_0212020	3300046455	Bacteria	1118
1299	Ga0495590_0061027	3300046457	Bacteria	1320
1300	Ga0495629_0000320	3300046459	Bacteria	41151
1301	Ga0495629_0000588	3300046459	Bacteria	29503
1302	Ga0495629_0001972	3300046459	Bacteria	15994
1303	Ga0495629_0112059	3300046459	Bacteria	1902
1304	Ga0495629_0138131	3300046459	Bacteria	1696
1305	Ga0495629_0169058	3300046459	Bacteria	1518
1306	Ga0495638_0001094	3300046460	Bacteria	26401
1307	Ga0495638_0040689	3300046460	Bacteria	2944
1308	Ga0495638_0054969	3300046460	Bacteria	2473
1309	Ga0495641_0008426	3300046461	Bacteria	6288
1310	Ga0495641_0015004	3300046461	Bacteria	4166
1311	Ga0495641_0064684	3300046461	Bacteria	1647
1312	Ga0495651_0011341	3300046462	Bacteria	6848
1313	Ga0495651_0016592	3300046462	Bacteria	5703
1314	Ga0495651_0027555	3300046462	Bacteria	4426
1315	Ga0495651_0066310	3300046462	Bacteria	2756
1316	Ga0495651_0116423	3300046462	Bacteria	1969
1317	Ga0495651_0196007	3300046462	Bacteria	1417
1318	Ga0495653_0002188	3300046463	Bacteria	15461
1319	Ga0495653_0016106	3300046463	Bacteria	6091
1320	Ga0495653_0022979	3300046463	Bacteria	5042
1321	Ga0495653_0144596	3300046463	Bacteria	1668
1322	Ga0495650_0062027	3300046471	Bacteria	1495
1323	Ga0495650_0095507	3300046471	Bacteria	1124
1324	Ga0495580_0005073	3300046472	Bacteria	10969
1325	Ga0495580_0046436	3300046472	Bacteria	3081
1326	Ga0495580_0290614	3300046472	Bacteria	1114
1327	Ga0495582_0000043	3300046473	Bacteria	63647
1328	Ga0495582_0006066	3300046473	Bacteria	6732
1329	Ga0495639_0000091	3300046475	Bacteria	44027
1330	Ga0495639_0007375	3300046475	Bacteria	4720
1331	Ga0495639_0030682	3300046475	Bacteria	2390
1332	Ga0495639_0083615	3300046475	Bacteria	1489
1333	Ga0495662_0000128	3300046476	Bacteria	28645
1334	Ga0495664_0027103	3300046477	Bacteria	3340
1335	Ga0495664_0039757	3300046477	Bacteria	2780
1336	Ga0495664_0053277	3300046477	Bacteria	2406
1337	Ga0495584_0002387	3300046491	Bacteria	10658
1338	Ga0495584_0048578	3300046491	Bacteria	2139
1339	Ga0495584_0074191	3300046491	Bacteria	1710
1340	Ga0495584_0161793	3300046491	Bacteria	1138
1341	Ga0495585_0008207	3300046492	Bacteria	6341
1342	Ga0495594_0000453	3300046499	Bacteria	20836
1343	Ga0495594_0003274	3300046499	Bacteria	8388
1344	Ga0495594_0155911	3300046499	Bacteria	1297
1345	Ga0495607_0010697	3300046501	Bacteria	6149
1346	Ga0495583_0024679	3300046506	Bacteria	3016
1347	Ga0495606_0000252	3300046507	Bacteria	94511
1348	Ga0495606_0020289	3300046507	Bacteria	4905
1349	Ga0495606_0257391	3300046507	Bacteria	965
1350	Ga0495608_0030843	3300046511	Bacteria	3626
1351	Ga0495608_0048520	3300046511	Bacteria	2821
1352	Ga0495608_0062600	3300046511	Bacteria	2444
1353	Ga0495608_0229182	3300046511	Bacteria	1163
1354	Ga0495618_0013046	3300046514	Bacteria	5050
1355	Ga0495618_0024256	3300046514	Bacteria	3755
1356	Ga0495618_0063716	3300046514	Bacteria	2341
1357	Ga0495618_0182599	3300046514	Bacteria	1333
1358	Ga0495618_0218758	3300046514	Bacteria	1202
1359	Ga0495620_0038307	3300046515	Bacteria	2129
1360	Ga0495620_0059303	3300046515	Bacteria	1600
1361	Ga0495620_0064024	3300046515	Bacteria	1522
1362	Ga0495628_0000249	3300046516	Bacteria	47492
1363	Ga0495628_0020336	3300046516	Bacteria	5478
1364	Ga0495628_0052492	3300046516	Bacteria	3220
1365	Ga0495628_0059445	3300046516	Bacteria	3000
1366	Ga0495628_0113838	3300046516	Bacteria	2079
1367	Ga0495628_0127194	3300046516	Bacteria	1951
1368	Ga0495630_0044580	3300046517	Bacteria	3314
1369	Ga0495630_0079935	3300046517	Bacteria	2466
1370	Ga0495630_0123621	3300046517	Bacteria	1963
1371	Ga0495632_0079408	3300046519	Bacteria	1566
1372	Ga0495637_0069636	3300046520	Bacteria	1423
1373	Ga0495637_0110247	3300046520	Bacteria	1067
1374	Ga0495643_0004740	3300046522	Bacteria	9408
1375	Ga0495643_0057943	3300046522	Bacteria	2063
1376	Ga0495644_0001475	3300046523	Bacteria	9593
1377	Ga0495648_0000286	3300046524	Bacteria	57430
1378	Ga0495648_0010274	3300046524	Bacteria	7148
1379	Ga0495648_0086311	3300046524	Bacteria	1770
1380	Ga0495666_0035220	3300046526	Bacteria	2441
1381	Ga0495666_0043942	3300046526	Bacteria	2158
1382	Ga0495666_0085973	3300046526	Bacteria	1485
1383	Ga0495652_0013367	3300046529	Bacteria	7389
1384	Ga0495652_0018347	3300046529	Bacteria	6239
1385	Ga0495652_0043484	3300046529	Bacteria	3868
1386	Ga0495652_0064883	3300046529	Bacteria	3070
1387	Ga0495652_0162932	3300046529	Bacteria	1729
1388	Ga0495652_0272445	3300046529	Bacteria	1243
1389	Ga0495652_0327226	3300046529	Bacteria	1105
1390	Ga0495654_0006037	3300046530	Bacteria	6951
1391	Ga0495665_0001635	3300046531	Bacteria	11999
1392	Ga0495665_0074226	3300046531	Bacteria	1791
1393	Ga0495640_0007459	3300046533	Bacteria	8592
1394	Ga0495640_0039130	3300046533	Bacteria	3330
1395	Ga0495640_0059727	3300046533	Bacteria	2595
1396	Ga0495640_0090769	3300046533	Bacteria	2016
1397	Ga0495640_0112306	3300046533	Bacteria	1779
1398	Ga0495586_0070330	3300046535	Bacteria	1911
1399	Ga0495587_0023867	3300046536	Bacteria	3754
1400	Ga0495587_0049923	3300046536	Bacteria	2476
1401	Ga0495587_0113807	3300046536	Bacteria	1552
1402	Ga0495587_0133906	3300046536	Bacteria	1416
1403	Ga0495587_0194911	3300046536	Bacteria	1146
1404	Ga0495587_0199522	3300046536	Bacteria	1132
1405	Ga0495598_0032901	3300046537	Bacteria	1468
1406	Ga0495609_0060397	3300046538	Bacteria	1676
1407	Ga0495645_0001006	3300046543	Bacteria	19191
1408	Ga0495645_0035369	3300046543	Bacteria	3642
1409	Ga0495645_0042219	3300046543	Bacteria	3325
1410	Ga0495645_0146956	3300046543	Bacteria	1641
1411	Ga0495645_0212630	3300046543	Bacteria	1305
1412	Ga0495622_0010031	3300046557	Bacteria	4381
1413	Ga0495622_0013370	3300046557	Bacteria	3807
1414	Ga0495622_0018113	3300046557	Bacteria	3280
1415	Ga0495622_0021427	3300046557	Bacteria	3008
1416	Ga0495622_0055495	3300046557	Bacteria	1837
1417	Ga0495622_0093736	3300046557	Bacteria	1378
1418	Ga0495622_0125151	3300046557	Bacteria	1173
1419	Ga0495633_0006799	3300046558	Bacteria	6706
1420	Ga0495667_0002652	3300046559	Bacteria	11945
1421	Ga0495667_0011278	3300046559	Bacteria	6047
1422	Ga0495667_0045323	3300046559	Bacteria	2912
1423	Ga0495667_0123867	3300046559	Bacteria	1668
1424	Ga0495667_0246146	3300046559	Bacteria	1138
1425	Ga0495656_0000123	3300046615	Bacteria	29630
1426	Ga0495668_0036116	3300046616	Bacteria	2770
1427	Ga0495668_0048118	3300046616	Bacteria	2366
1428	Ga0495634_0021849	3300046642	Bacteria	4516
1429	Ga0495634_0044652	3300046642	Bacteria	2998
1430	Ga0495634_0065147	3300046642	Bacteria	2415
1431	Ga0495634_0142117	3300046642	Bacteria	1523
1432	Ga0495611_0170607	3300046648	Bacteria	1017
1433	Ga0495625_0056335	3300046660	Bacteria	2799
1434	Ga0495625_0094790	3300046660	Bacteria	2058
1435	Ga0495625_0284297	3300046660	Bacteria	1063
1436	Ga0495635_0001078	3300046663	Bacteria	18109
1437	Ga0495635_0001788	3300046663	Bacteria	14525
1438	Ga0495635_0003088	3300046663	Bacteria	11458
1439	Ga0495635_0005472	3300046663	Bacteria	8833
1440	Ga0495635_0006182	3300046663	Bacteria	8344
1441	Ga0495635_0147977	3300046663	Bacteria	1599
1442	Ga0495659_0000648	3300046664	Bacteria	12635
1443	Ga0495661_0155342	3300046665	Bacteria	1232
1444	Ga0495661_0191664	3300046665	Bacteria	1076
1445	Ga0495588_0008121	3300046674	Bacteria	4800
1446	Ga0495588_0024864	3300046674	Bacteria	2979
1447	Ga0495588_0156479	3300046674	Bacteria	1205
1448	Ga0495657_0010052	3300046675	Bacteria	7134
1449	Ga0495657_0012323	3300046675	Bacteria	6354
1450	Ga0495657_0016857	3300046675	Bacteria	5313
1451	Ga0495657_0058547	3300046675	Bacteria	2558
1452	Ga0495657_0089349	3300046675	Bacteria	1980
1453	Ga0495657_0125671	3300046675	Bacteria	1611
1454	Ga0495599_0001153	3300046678	Bacteria	14977
1455	Ga0495599_0012093	3300046678	Bacteria	5312
1456	Ga0495599_0016129	3300046678	Bacteria	4637
1457	Ga0495599_0050500	3300046678	Bacteria	2606
1458	Ga0495623_0004489	3300046679	Bacteria	9167
1459	Ga0495623_0016469	3300046679	Bacteria	4775
1460	Ga0495623_0046940	3300046679	Bacteria	2741
1461	Ga0495623_0093678	3300046679	Bacteria	1838
1462	Ga0495646_0004178	3300046680	Bacteria	9076
1463	Ga0495646_0006980	3300046680	Bacteria	7170
1464	Ga0495646_0230262	3300046680	Bacteria	999
1465	Ga0495647_0002969	3300046681	Bacteria	5388
1466	Ga0495647_0011225	3300046681	Bacteria	3066
1467	Ga0495647_0021856	3300046681	Bacteria	2308
1468	Ga0495647_0072507	3300046681	Bacteria	1381
1469	Ga0495658_0000601	3300046683	Bacteria	19735
1470	Ga0495658_0002995	3300046683	Bacteria	8449
1471	Ga0495658_0207842	3300046683	Bacteria	1222
1472	Ga0495669_0190309	3300046684	Unclassified	979
1473	Ga0495613_0001794	3300046689	Bacteria	16314
1474	Ga0495613_0138626	3300046689	Bacteria	1739
1475	Ga0495613_0147899	3300046689	Bacteria	1676
1476	Ga0495624_0000694	3300046690	Bacteria	26424
1477	Ga0495624_0074674	3300046690	Bacteria	2106
1478	Ga0495671_0083319	3300046692	Bacteria	1567
1479	Ga0495671_0171568	3300046692	Bacteria	1054
1480	Ga0495649_0022117	3300046694	Bacteria	3559
1481	Ga0495589_0038643	3300046794	Bacteria	2388
1482	Ga0495589_0042748	3300046794	Bacteria	2258
1483	Ga0495600_0002039	3300046809	Bacteria	11375
1484	Ga0495600_0016286	3300046809	Bacteria	4715
1485	Ga0495600_0019222	3300046809	Bacteria	4360
1486	Ga0495600_0072547	3300046809	Bacteria	2249
1487	Ga0495600_0088862	3300046809	Bacteria	2015
1488	Ga0495660_0052752	3300046810	Bacteria	2209
1489	Ga0495581_0000486	3300047315	Bacteria	20240
1490	Ga0495581_0003184	3300047315	Bacteria	9395
1491	Ga0495581_0052214	3300047315	Bacteria	2361
1492	Ga0495581_0094007	3300047315	Bacteria	1740
1493	Ga0495581_0095658	3300047315	Bacteria	1725
1494	Ga0495581_0134214	3300047315	Bacteria	1442
1495	Ga0495604_0005947	3300047317	Bacteria	9680
1496	Ga0495604_0009217	3300047317	Bacteria	7814
1497	Ga0495604_0010825	3300047317	Bacteria	7244
1498	Ga0495604_0029213	3300047317	Bacteria	4385
1499	Ga0495604_0055664	3300047317	Bacteria	3048
1500	Ga0495604_0221682	3300047317	Bacteria	1302
1501	Ga0495674_0003925	3300047319	Bacteria	14430
1502	Ga0495674_0010066	3300047319	Bacteria	8964
1503	Ga0495674_0037870	3300047319	Bacteria	4332
1504	Ga0495674_0058274	3300047319	Bacteria	3377
1505	Ga0495674_0089440	3300047319	Bacteria	2632
1506	Ga0495674_0094357	3300047319	Bacteria	2552
1507	Ga0495674_0104383	3300047319	Bacteria	2409
1508	Ga0495674_0159539	3300047319	Bacteria	1887
1509	Ga0495672_0025202	3300047320	Bacteria	3813
1510	Ga0495676_0075429	3300047321	Bacteria	2579
1511	Ga0495676_0079376	3300047321	Bacteria	2495
1512	Ga0495676_0084508	3300047321	Bacteria	2394
1513	Ga0495676_0091661	3300047321	Bacteria	2271
1514	Ga0495676_0151317	3300047321	Bacteria	1651
1515	Ga0495680_0000689	3300047322	Bacteria	37846
1516	Ga0495680_0009034	3300047322	Bacteria	9004
1517	Ga0495680_0013096	3300047322	Bacteria	7249
1518	Ga0495680_0015853	3300047322	Bacteria	6486
1519	Ga0495680_0019326	3300047322	Bacteria	5753
1520	Ga0495680_0168515	3300047322	Bacteria	1586
1521	Ga0495683_0020152	3300047323	Bacteria	3441
1522	Ga0495683_0074095	3300047323	Bacteria	1669
1523	Ga0495687_007102	3300047443	Bacteria	6681
1524	Ga0495675_0001437	3300047444	Bacteria	14419
1525	Ga0495675_0009835	3300047444	Bacteria	5963
1526	Ga0495675_0015422	3300047444	Bacteria	4832
1527	Ga0495675_0031708	3300047444	Bacteria	3374
1528	Ga0495677_0098608	3300047445	Bacteria	1105
1529	Ga0495677_0099909	3300047445	Bacteria	1098
1530	Ga0495679_044824	3300047446	Bacteria	1353
1531	Ga0495673_0045161	3300047469	Bacteria	1960
1532	Ga0495673_0084624	3300047469	Bacteria	1307
1533	Ga0495681_0019926	3300047470	Bacteria	3649
1534	Ga0495681_0122274	3300047470	Bacteria	1116
1535	Ga0495684_0000313	3300047471	Bacteria	39705
1536	Ga0495684_0002684	3300047471	Bacteria	14089
1537	Ga0495684_0020400	3300047471	Bacteria	5107
1538	Ga0495686_0075227	3300047472	Bacteria	2071
1539	Ga0495593_0000005	3300047673	Bacteria	93984
1540	Ga0495593_0000693	3300047673	Bacteria	19452
1541	Ga0495593_0013264	3300047673	Bacteria	4704
1542	Ga0495593_0064383	3300047673	Bacteria	1914
1543	Ga0495602_0002384	3300048088	Bacteria	19072
1544	Ga0495602_0007244	3300048088	Bacteria	11614
1545	Ga0495602_0011207	3300048088	Bacteria	9270
1546	Ga0495602_0037524	3300048088	Bacteria	4495
1547	Ga0495602_0053983	3300048088	Bacteria	3552
1548	Ga0495602_0124770	3300048088	Bacteria	2065
1549	Ga0495602_0270260	3300048088	Bacteria	1257
1550	Ga0495614_0007962	3300048089	Bacteria	4710
1551	Ga0496100_0001453	3300048903	Bacteria	11609
1552	Ga0496100_0004117	3300048903	Bacteria	7668
1553	Ga0496100_0008582	3300048903	Bacteria	5704
1554	Ga0496100_0011507	3300048903	Bacteria	5039
1555	Ga0496100_0048602	3300048903	Bacteria	2739
1556	Ga0496100_0212649	3300048903	Bacteria	1415
1557	Ga0496100_0354832	3300048903	Bacteria	1108
1558	Ga0496101_0000468	3300048904	Bacteria	25464
1559	Ga0496101_0006584	3300048904	Bacteria	7485
1560	Ga0496101_0043343	3300048904	Bacteria	3216
1561	Ga0496101_0105796	3300048904	Bacteria	2112
1562	Ga0496101_0145379	3300048904	Bacteria	1810
1563	Ga0496102_0001314	3300048905	Bacteria	22298
1564	Ga0496102_0021069	3300048905	Bacteria	5765
1565	Ga0496102_0028200	3300048905	Bacteria	5014
1566	Ga0496102_0038433	3300048905	Bacteria	4319
1567	Ga0496102_0093823	3300048905	Bacteria	2780
1568	Ga0496102_0095293	3300048905	Bacteria	2758
1569	Ga0496102_0169651	3300048905	Bacteria	2054
1570	Ga0496102_0328692	3300048905	Bacteria	1440
1571	Ga0496102_0366786	3300048905	Unclassified	1355
1572	Ga0496102_0455458	3300048905	Bacteria	1200
1573	Ga0496102_0483605	3300048905	Bacteria	1160
1574	Ga0496103_0008659	3300048906	Bacteria	6041
1575	Ga0496103_0013281	3300048906	Bacteria	4881
1576	Ga0496103_0014273	3300048906	Bacteria	4716
1577	Ga0496103_0159200	3300048906	Bacteria	1448
1578	Ga0496103_0307451	3300048906	Bacteria	1020
1579	Ga0496104_0000239	3300048907	Bacteria	48386
1580	Ga0496104_0012293	3300048907	Bacteria	7695
1581	Ga0496104_0012475	3300048907	Bacteria	7643
1582	Ga0496104_0072639	3300048907	Bacteria	3272
1583	Ga0496104_0081494	3300048907	Bacteria	3086
1584	Ga0496104_0199393	3300048907	Bacteria	1913
1585	Ga0496104_0214949	3300048907	Bacteria	1834
1586	Ga0496104_0240495	3300048907	Bacteria	1722
1587	Ga0496104_0297575	3300048907	Bacteria	1526
1588	Ga0496104_0491072	3300048907	Bacteria	1139
1589	Ga0496104_0573957	3300048907	Bacteria	1038
1590	Ga0496105_0000398	3300048908	Bacteria	28619
1591	Ga0496105_0000935	3300048908	Bacteria	19915
1592	Ga0496105_0012329	3300048908	Bacteria	6768
1593	Ga0496105_0012763	3300048908	Bacteria	6654
1594	Ga0496105_0025256	3300048908	Bacteria	4835
1595	Ga0496105_0083297	3300048908	Bacteria	2641
1596	Ga0496105_0163562	3300048908	Bacteria	1826
1597	Ga0496105_0206808	3300048908	Bacteria	1601
1598	Ga0496105_0519852	3300048908	Bacteria	932
1599	Ga0496106_0000236	3300048909	Bacteria	38678
1600	Ga0496106_0001014	3300048909	Bacteria	20581
1601	Ga0496106_0067463	3300048909	Bacteria	2727
1602	Ga0496106_0074650	3300048909	Bacteria	2596
1603	Ga0496106_0088327	3300048909	Bacteria	2389
1604	Ga0496106_0159746	3300048909	Bacteria	1782
1605	Ga0496106_0172713	3300048909	Bacteria	1714
1606	Ga0496106_0181364	3300048909	Bacteria	1671
1607	Ga0496106_0326600	3300048909	Unclassified	1231
1608	Ga0496106_0560483	3300048909	Bacteria	916
1609	Ga0496107_0000965	3300048910	Bacteria	17064
1610	Ga0496107_0006262	3300048910	Bacteria	8180
1611	Ga0496107_0010146	3300048910	Bacteria	6533
1612	Ga0496107_0011653	3300048910	Bacteria	6127
1613	Ga0496107_0014083	3300048910	Bacteria	5598
1614	Ga0496107_0020391	3300048910	Bacteria	4681
1615	Ga0496107_0023024	3300048910	Bacteria	4404
1616	Ga0496107_0035286	3300048910	Bacteria	3585
1617	Ga0496107_0074003	3300048910	Bacteria	2478
1618	Ga0496107_0144002	3300048910	Bacteria	1761
1619	Ga0496107_0163028	3300048910	Bacteria	1653
1620	Ga0496107_0223620	3300048910	Bacteria	1400
1621	Ga0496107_0427517	3300048910	Bacteria	985
1622	Ga0496108_0000849	3300048911	Bacteria	23796
1623	Ga0496108_0001543	3300048911	Bacteria	18244
1624	Ga0496108_0005663	3300048911	Bacteria	10116
1625	Ga0496108_0012923	3300048911	Bacteria	6803
1626	Ga0496108_0055454	3300048911	Bacteria	3328
1627	Ga0496108_0062393	3300048911	Bacteria	3138
1628	Ga0496108_0104083	3300048911	Bacteria	2422
1629	Ga0496108_0125766	3300048911	Bacteria	2201
1630	Ga0496108_0351988	3300048911	Bacteria	1285
1631	Ga0496108_0544743	3300048911	Bacteria	1012
1632	Ga0496109_0000224	3300048912	Bacteria	55854
1633	Ga0496109_0000414	3300048912	Bacteria	37873
1634	Ga0496109_0004282	3300048912	Bacteria	11922
1635	Ga0496109_0026221	3300048912	Bacteria	5196
1636	Ga0496109_0075500	3300048912	Bacteria	3099
1637	Ga0496109_0077160	3300048912	Bacteria	3066
1638	Ga0496109_0103281	3300048912	Bacteria	2645
1639	Ga0496109_0112207	3300048912	Bacteria	2535
1640	Ga0496109_0142097	3300048912	Bacteria	2245
1641	Ga0496109_0146234	3300048912	Bacteria	2211
1642	Ga0496109_0410607	3300048912	Bacteria	1279
1643	Ga0496109_0618655	3300048912	Bacteria	1019
1644	Ga0496110_0012677	3300048913	Bacteria	6937
1645	Ga0496110_0025638	3300048913	Bacteria	5041
1646	Ga0496110_0044581	3300048913	Bacteria	3873
1647	Ga0496110_0055104	3300048913	Bacteria	3498
1648	Ga0496110_0093478	3300048913	Bacteria	2692
1649	Ga0496110_0177587	3300048913	Bacteria	1933
1650	Ga0496110_0230176	3300048913	Bacteria	1685
1651	Ga0496110_0330972	3300048913	Unclassified	1387
1652	Ga0496110_0348751	3300048913	Bacteria	1348
1653	Ga0496111_0001884	3300048914	Bacteria	12408
1654	Ga0496111_0031987	3300048914	Bacteria	3749
1655	Ga0496111_0032982	3300048914	Bacteria	3693
1656	Ga0496111_0035701	3300048914	Bacteria	3554
1657	Ga0496111_0193174	3300048914	Bacteria	1513
1658	Ga0496111_0207838	3300048914	Bacteria	1454
1659	Ga0496111_0223339	3300048914	Bacteria	1399
1660	Ga0496111_0245379	3300048914	Bacteria	1330
1661	Ga0496111_0428158	3300048914	Bacteria	977
1662	Ga0496112_0000020	3300048915	Bacteria	169373
1663	Ga0496112_0001044	3300048915	Bacteria	20400
1664	Ga0496112_0055429	3300048915	Bacteria	3898
1665	Ga0496112_0060236	3300048915	Bacteria	3740
1666	Ga0496112_0085759	3300048915	Bacteria	3115
1667	Ga0496112_0135786	3300048915	Bacteria	2430
1668	Ga0496112_0212285	3300048915	Bacteria	1892
1669	Ga0496112_0342485	3300048915	Bacteria	1438
1670	Ga0496113_0008868	3300048916	Bacteria	6576
1671	Ga0496113_0009598	3300048916	Bacteria	6352
1672	Ga0496113_0025475	3300048916	Bacteria	4216
1673	Ga0496113_0026173	3300048916	Bacteria	4168
1674	Ga0496113_0026913	3300048916	Bacteria	4116
1675	Ga0496113_0036756	3300048916	Bacteria	3590
1676	Ga0496113_0060373	3300048916	Bacteria	2858
1677	Ga0496113_0092954	3300048916	Bacteria	2327
1678	Ga0496113_0110860	3300048916	Bacteria	2136
1679	Ga0496113_0129462	3300048916	Bacteria	1979
1680	Ga0496113_0186433	3300048916	Bacteria	1646
1681	Ga0496114_0005384	3300048917	Bacteria	10007
1682	Ga0496114_0021424	3300048917	Bacteria	5260
1683	Ga0496114_0022004	3300048917	Bacteria	5191
1684	Ga0496114_0023821	3300048917	Bacteria	4995
1685	Ga0496114_0050674	3300048917	Bacteria	3456
1686	Ga0496114_0059281	3300048917	Bacteria	3197
1687	Ga0496114_0659677	3300048917	Bacteria	920
1688	Ga0496115_0003980	3300048918	Bacteria	10658
1689	Ga0496115_0006071	3300048918	Bacteria	8821
1690	Ga0496115_0008492	3300048918	Bacteria	7598
1691	Ga0496115_0047342	3300048918	Bacteria	3438
1692	Ga0496115_0105976	3300048918	Bacteria	2307
1693	Ga0496115_0108631	3300048918	Bacteria	2277
1694	Ga0496115_0144741	3300048918	Bacteria	1961
1695	Ga0496115_0198209	3300048918	Bacteria	1659
1696	Ga0496115_0231335	3300048918	Bacteria	1524
1697	Ga0496116_0050598	3300048919	Bacteria	2767
1698	Ga0496116_0126522	3300048919	Bacteria	1467
1699	Ga0496117_0017224	3300048920	Bacteria	6045
1700	Ga0496117_0027455	3300048920	Bacteria	4436
1701	Ga0496117_0033893	3300048920	Bacteria	3856
1702	Ga0496117_0219061	3300048920	Bacteria	1061
1703	Ga0496118_0003026	3300048921	Bacteria	21707
1704	Ga0496118_0014494	3300048921	Bacteria	7378
1705	Ga0496118_0025699	3300048921	Bacteria	5040
1706	Ga0496118_0035791	3300048921	Bacteria	4024
1707	Ga0496118_0154748	3300048921	Bacteria	1428
1708	Ga0496119_0025923	3300048922	Bacteria	4080
1709	Ga0496119_0035726	3300048922	Bacteria	3251
1710	Ga0496120_0083845	3300048923	Bacteria	1720
1711	Ga0496120_0086205	3300048923	Bacteria	1689
1712	Ga0496120_0093327	3300048923	Bacteria	1604
1713	Ga0496121_0000270	3300048924	Bacteria	108787
1714	Ga0496121_0000370	3300048924	Bacteria	92397
1715	Ga0496121_0001039	3300048924	Bacteria	49470
1716	Ga0496121_0011522	3300048924	Bacteria	9798
1717	Ga0496121_0019165	3300048924	Bacteria	6856
1718	Ga0496121_0030770	3300048924	Bacteria	4923
1719	Ga0496121_0046170	3300048924	Bacteria	3731
1720	Ga0496121_0070234	3300048924	Bacteria	2822
1721	Ga0496121_0129567	3300048924	Bacteria	1891
1722	Ga0496121_0154562	3300048924	Bacteria	1684
1723	Ga0496121_0314580	3300048924	Bacteria	1057
1724	Ga0496121_0380837	3300048924	Bacteria	930
1725	Ga0496122_0028108	3300048925	Bacteria	4785
1726	Ga0496122_0049845	3300048925	Bacteria	3199
1727	Ga0496122_0071551	3300048925	Bacteria	2471
1728	Ga0496122_0077351	3300048925	Bacteria	2337
1729	Ga0496122_0093455	3300048925	Bacteria	2040
1730	Ga0496122_0116276	3300048925	Bacteria	1740
1731	Ga0496123_0010549	3300048926	Bacteria	8145
1732	Ga0496123_0041585	3300048926	Bacteria	3183
1733	Ga0496123_0041888	3300048926	Bacteria	3168
1734	Ga0496123_0194316	3300048926	Bacteria	1046
1735	Ga0496124_0036402	3300048927	Bacteria	4294
1736	Ga0496124_0057421	3300048927	Bacteria	3279
1737	Ga0496124_0092914	3300048927	Bacteria	2457
1738	Ga0496124_0104184	3300048927	Bacteria	2294
1739	Ga0496124_0191797	3300048927	Bacteria	1563
1740	Ga0496124_0274037	3300048927	Bacteria	1234
1741	Ga0496124_0304603	3300048927	Bacteria	1149
1742	Ga0496125_0000328	3300048928	Bacteria	91806
1743	Ga0496125_0000407	3300048928	Bacteria	80570
1744	Ga0496125_0023759	3300048928	Bacteria	5651
1745	Ga0496125_0026887	3300048928	Bacteria	5226
1746	Ga0496125_0052055	3300048928	Bacteria	3370
1747	Ga0496125_0057775	3300048928	Bacteria	3139
1748	Ga0496125_0093298	3300048928	Bacteria	2247
1749	Ga0496125_0183626	3300048928	Bacteria	1390
1750	Ga0496126_0002944	3300048929	Bacteria	22128
1751	Ga0496126_0015944	3300048929	Bacteria	7536
1752	Ga0496126_0022058	3300048929	Bacteria	6204
1753	Ga0496126_0026314	3300048929	Bacteria	5580
1754	Ga0496126_0033530	3300048929	Bacteria	4829
1755	Ga0496126_0069770	3300048929	Bacteria	3133
1756	Ga0496126_0073081	3300048929	Bacteria	3049
1757	Ga0496126_0084695	3300048929	Bacteria	2796
1758	Ga0496126_0086187	3300048929	Bacteria	2768
1759	Ga0496126_0119982	3300048929	Bacteria	2282
1760	Ga0496126_0181126	3300048929	Bacteria	1790
1761	Ga0496126_0200307	3300048929	Bacteria	1686
1762	Ga0496126_0216838	3300048929	Bacteria	1609
1763	Ga0496126_0279367	3300048929	Bacteria	1384
1764	Ga0496126_0320487	3300048929	Bacteria	1274
1765	Ga0496126_0391559	3300048929	Bacteria	1129
1766	Ga0496126_0395003	3300048929	Bacteria	1123
1767	Ga0496126_0422013	3300048929	Bacteria	1078
1768	Ga0495682_0027899	3300049460	Bacteria	2093
1769	Ga0501031_0019691	3300049568	Bacteria	4396
1770	Ga0501031_0036126	3300049568	Bacteria	3223
1771	Ga0501032_0000475	3300049569	Bacteria	32423
1772	Ga0501032_0008230	3300049569	Bacteria	7602
1773	Ga0501032_0047597	3300049569	Bacteria	2895
1774	Ga0501032_0077047	3300049569	Bacteria	2220
1775	Ga0501032_0083346	3300049569	Bacteria	2126
1776	Ga0501032_0204455	3300049569	Bacteria	1288
1777	Ga0501032_0225404	3300049569	Bacteria	1219
1778	Ga0501032_0233681	3300049569	Bacteria	1195
1779	Ga0501033_0000440	3300049570	Bacteria	39822
1780	Ga0501033_0001499	3300049570	Bacteria	20673
1781	Ga0501033_0015169	3300049570	Bacteria	5847
1782	Ga0501033_0055525	3300049570	Bacteria	2928
1783	Ga0501033_0089360	3300049570	Bacteria	2253
1784	Ga0501033_0100724	3300049570	Bacteria	2108
1785	Ga0501033_0108247	3300049570	Bacteria	2024
1786	Ga0501033_0110542	3300049570	Bacteria	2000
1787	Ga0501033_0181846	3300049570	Bacteria	1507
1788	Ga0501033_0183877	3300049570	Bacteria	1497
1789	Ga0501033_0232590	3300049570	Bacteria	1309
1790	Ga0501034_0000250	3300049571	Bacteria	99407
1791	Ga0501034_0000286	3300049571	Bacteria	90126
1792	Ga0501034_0016008	3300049571	Bacteria	7698
1793	Ga0501034_0017998	3300049571	Bacteria	7248
1794	Ga0501034_0086116	3300049571	Bacteria	3143
1795	Ga0501034_0282544	3300049571	Bacteria	1599
1796	Ga0501034_0317717	3300049571	Bacteria	1491
1797	Ga0501036_0000098	3300049572	Bacteria	54252
1798	Ga0501036_0000118	3300049572	Bacteria	49383
1799	Ga0501036_0039965	3300049572	Bacteria	3968
1800	Ga0501036_0041038	3300049572	Bacteria	3916
1801	Ga0501036_0056697	3300049572	Bacteria	3319
1802	Ga0501036_0061100	3300049572	Bacteria	3191
1803	Ga0501036_0118974	3300049572	Bacteria	2231
1804	Ga0501036_0138010	3300049572	Bacteria	2058
1805	Ga0501037_0000092	3300049573	Bacteria	83924
1806	Ga0501037_0006812	3300049573	Bacteria	8353
1807	Ga0501037_0010464	3300049573	Bacteria	6812
1808	Ga0501037_0038799	3300049573	Bacteria	3508
1809	Ga0501037_0045631	3300049573	Bacteria	3216
1810	Ga0501037_0105157	3300049573	Bacteria	2034
1811	Ga0501037_0173603	3300049573	Bacteria	1531
1812	Ga0501037_0191107	3300049573	Bacteria	1449
1813	Ga0501038_0000059	3300049574	Bacteria	92319
1814	Ga0501038_0003448	3300049574	Bacteria	14742
1815	Ga0501038_0006869	3300049574	Bacteria	10512
1816	Ga0501038_0045822	3300049574	Bacteria	3794
1817	Ga0501038_0053622	3300049574	Bacteria	3470
1818	Ga0501038_0073971	3300049574	Bacteria	2883
1819	Ga0501038_0245348	3300049574	Bacteria	1420
1820	Ga0501038_0389701	3300049574	Bacteria	1079
1821	Ga0501038_0446136	3300049574	Bacteria	995
1822	Ga0501039_0000085	3300049575	Bacteria	70306
1823	Ga0501039_0031807	3300049575	Bacteria	4068
1824	Ga0501039_0039138	3300049575	Bacteria	3662
1825	Ga0501039_0041308	3300049575	Bacteria	3561
1826	Ga0501039_0056725	3300049575	Bacteria	3034
1827	Ga0501039_0087620	3300049575	Bacteria	2425
1828	Ga0501042_0023911	3300049578	Bacteria	4280
1829	Ga0501042_0063966	3300049578	Bacteria	2629
1830	Ga0501042_0493882	3300049578	Bacteria	889
1831	Ga0501043_0001889	3300049579	Bacteria	17947
1832	Ga0501043_0004952	3300049579	Bacteria	10775
1833	Ga0501043_0012702	3300049579	Bacteria	6584
1834	Ga0501043_0022014	3300049579	Bacteria	5000
1835	Ga0501043_0035424	3300049579	Bacteria	3926
1836	Ga0501043_0057515	3300049579	Bacteria	3053
1837	Ga0501043_0093310	3300049579	Bacteria	2366
1838	Ga0501043_0103540	3300049579	Bacteria	2236
1839	Ga0501043_0127740	3300049579	Bacteria	1993
1840	Ga0501043_0140231	3300049579	Bacteria	1893
1841	Ga0501043_0160047	3300049579	Bacteria	1759
1842	Ga0501043_0195367	3300049579	Bacteria	1572
1843	Ga0501043_0352222	3300049579	Bacteria	1118
1844	Ga0501043_0473485	3300049579	Bacteria	939
1845	Ga0501046_0000483	3300049580	Bacteria	39806
1846	Ga0501046_0050847	3300049580	Bacteria	3272
1847	Ga0501046_0075433	3300049580	Bacteria	2614
1848	Ga0501046_0101818	3300049580	Bacteria	2202
1849	Ga0501046_0173337	3300049580	Bacteria	1617
1850	Ga0501046_0233967	3300049580	Bacteria	1356
1851	Ga0501046_0450610	3300049580	Bacteria	925
1852	Ga0501047_0000022	3300049581	Bacteria	249062
1853	Ga0501047_0000097	3300049581	Bacteria	107310
1854	Ga0501047_0035421	3300049581	Bacteria	4822
1855	Ga0501047_0082864	3300049581	Bacteria	3083
1856	Ga0501047_0094732	3300049581	Bacteria	2864
1857	Ga0501047_0105578	3300049581	Bacteria	2697
1858	Ga0501047_0126511	3300049581	Bacteria	2436
1859	Ga0501047_0197121	3300049581	Bacteria	1875
1860	Ga0501047_0197426	3300049581	Bacteria	1874
1861	Ga0501047_0199409	3300049581	Bacteria	1862
1862	Ga0501047_0301859	3300049581	Bacteria	1443
1863	Ga0501047_0338192	3300049581	Bacteria	1343
1864	Ga0501047_0472768	3300049581	Bacteria	1081
1865	Ga0501048_0000522	3300049582	Bacteria	26987
1866	Ga0501048_0000821	3300049582	Bacteria	22904
1867	Ga0501048_0004230	3300049582	Bacteria	10938
1868	Ga0501048_0333172	3300049582	Bacteria	1081
1869	Ga0501067_0000510	3300049583	Bacteria	21249
1870	Ga0501067_0014598	3300049583	Bacteria	4348
1871	Ga0501067_0047604	3300049583	Bacteria	2378
1872	Ga0501067_0093305	3300049583	Unclassified	1671
1873	Ga0501067_0094982	3300049583	Bacteria	1655
1874	Ga0501067_0095935	3300049583	Bacteria	1647
1875	Ga0501067_0255904	3300049583	Bacteria	975
1876	Ga0501068_0001239	3300049584	Bacteria	13551
1877	Ga0501068_0006616	3300049584	Bacteria	6397
1878	Ga0501068_0025351	3300049584	Bacteria	3488
1879	Ga0501068_0045541	3300049584	Bacteria	2643
1880	Ga0501068_0097120	3300049584	Bacteria	1823
1881	Ga0501069_0000707	3300049585	Bacteria	15581
1882	Ga0501069_0040743	3300049585	Bacteria	2567
1883	Ga0501070_0005840	3300049586	Bacteria	10495
1884	Ga0501070_0037509	3300049586	Bacteria	4045
1885	Ga0501070_0039631	3300049586	Bacteria	3929
1886	Ga0501070_0055323	3300049586	Bacteria	3288
1887	Ga0501070_0065590	3300049586	Bacteria	3006
1888	Ga0501070_0067214	3300049586	Bacteria	2968
1889	Ga0501070_0104832	3300049586	Bacteria	2338
1890	Ga0501070_0210199	3300049586	Bacteria	1597
1891	Ga0501070_0212749	3300049586	Bacteria	1586
1892	Ga0501070_0221258	3300049586	Bacteria	1552
1893	Ga0501070_0252643	3300049586	Bacteria	1442
1894	Ga0501070_0345001	3300049586	Bacteria	1209
1895	Ga0501070_0469856	3300049586	Bacteria	1012
1896	Ga0501070_0484606	3300049586	Bacteria	994
1897	Ga0501071_0015263	3300049587	Bacteria	5271
1898	Ga0501071_0102548	3300049587	Bacteria	2110
1899	Ga0501071_0108813	3300049587	Bacteria	2047
1900	Ga0501071_0179113	3300049587	Bacteria	1588
1901	Ga0501071_0293036	3300049587	Bacteria	1233
1902	Ga0501072_0001923	3300049588	Bacteria	15457
1903	Ga0501072_0043896	3300049588	Bacteria	3515
1904	Ga0501072_0314070	3300049588	Bacteria	1245
1905	Ga0501073_0000955	3300049589	Bacteria	20800
1906	Ga0501073_0031647	3300049589	Bacteria	3774
1907	Ga0501073_0072009	3300049589	Bacteria	2407
1908	Ga0501073_0202072	3300049589	Bacteria	1374
1909	Ga0501073_0343440	3300049589	Bacteria	1030
1910	Ga0501074_0002275	3300049590	Bacteria	13361
1911	Ga0501074_0006843	3300049590	Bacteria	8236
1912	Ga0501074_0028474	3300049590	Bacteria	4049
1913	Ga0501074_0031430	3300049590	Bacteria	3846
1914	Ga0501074_0042683	3300049590	Bacteria	3281
1915	Ga0501074_0059730	3300049590	Bacteria	2747
1916	Ga0501074_0061940	3300049590	Bacteria	2695
1917	Ga0501076_0224081	3300049592	Bacteria	1537
1918	Ga0501076_0574203	3300049592	Bacteria	930
1919	Ga0501077_0103504	3300049593	Bacteria	1804
1920	Ga0501079_0003103	3300049741	Bacteria	12169
1921	Ga0501079_0055474	3300049741	Bacteria	3058
1922	Ga0501079_0199560	3300049741	Bacteria	1562
1923	Ga0501079_0242586	3300049741	Bacteria	1408
1924	Ga0501080_0000047	3300049742	Bacteria	76956
1925	Ga0501080_0009878	3300049742	Bacteria	8717
1926	Ga0501080_0022030	3300049742	Bacteria	5902
1927	Ga0501080_0031264	3300049742	Bacteria	4960
1928	Ga0501080_0037799	3300049742	Bacteria	4507
1929	Ga0501080_0049324	3300049742	Bacteria	3919
1930	Ga0501080_0065376	3300049742	Bacteria	3383
1931	Ga0501080_0075608	3300049742	Bacteria	3133
1932	Ga0501080_0079680	3300049742	Bacteria	3045
1933	Ga0501080_0123108	3300049742	Bacteria	2402
1934	Ga0501080_0203918	3300049742	Bacteria	1815
1935	Ga0501081_0055518	3300049743	Bacteria	2737
1936	Ga0501081_0241692	3300049743	Bacteria	1317
1937	Ga0501081_0330208	3300049743	Bacteria	1122
1938	Ga0501083_0000808	3300049744	Bacteria	20535
1939	Ga0501083_0007229	3300049744	Bacteria	7884
1940	Ga0501083_0013360	3300049744	Bacteria	5741
1941	Ga0501083_0045709	3300049744	Bacteria	2961
1942	Ga0501083_0059138	3300049744	Bacteria	2564
1943	Ga0501083_0063302	3300049744	Bacteria	2467
1944	Ga0501083_0135591	3300049744	Bacteria	1613
1945	Ga0501083_0157872	3300049744	Bacteria	1484
1946	Ga0501083_0208181	3300049744	Bacteria	1275
1947	Ga0501035_0000240	3300049822	Bacteria	65635
1948	Ga0501035_0001276	3300049822	Bacteria	26011
1949	Ga0501035_0005844	3300049822	Bacteria	11604
1950	Ga0501035_0008993	3300049822	Bacteria	9289
1951	Ga0501035_0080808	3300049822	Bacteria	2870
1952	Ga0501035_0167522	3300049822	Bacteria	1899
1953	Ga0501035_0211585	3300049822	Bacteria	1658
1954	Ga0501035_0258695	3300049822	Bacteria	1476
1955	Ga0501035_0333829	3300049822	Bacteria	1271
1956	Ga0501044_0000072	3300049823	Bacteria	124143
1957	Ga0501044_0000122	3300049823	Bacteria	93246
1958	Ga0501044_0025318	3300049823	Bacteria	6288
1959	Ga0501044_0047773	3300049823	Bacteria	4426
1960	Ga0501044_0056754	3300049823	Bacteria	4020
1961	Ga0501044_0058319	3300049823	Bacteria	3959
1962	Ga0501044_0065427	3300049823	Bacteria	3707
1963	Ga0501044_0097979	3300049823	Bacteria	2952
1964	Ga0501044_0187642	3300049823	Bacteria	2031
1965	Ga0501044_0193433	3300049823	Bacteria	1995
1966	Ga0501044_0278162	3300049823	Bacteria	1608
1967	Ga0501044_0282993	3300049823	Bacteria	1591
1968	Ga0501044_0392472	3300049823	Bacteria	1301
1969	Ga0501045_0027715	3300049824	Bacteria	4084
1970	Ga0501045_0165744	3300049824	Bacteria	1646
1971	Ga0501045_0276571	3300049824	Bacteria	1250
1972	nmdc:mga03683_163888_c1	3300050489	Bacteria	1008
1973	nmdc:mga03683_42133_c1	3300050489	Bacteria	1877
1974	nmdc:mga03683_57061_c1	3300050489	Bacteria	1643
1975	nmdc:mga03683_79303_c1	3300050489	Bacteria	1415
1976	nmdc:mga03n38_19891_c1	3300050490	Bacteria	2676
1977	nmdc:mga03n38_42929_c1	3300050490	Bacteria	1979
1978	nmdc:mga03n38_5778_c1	3300050490	Bacteria	4246
1979	nmdc:mga00v17_15563_c1	3300050491	Bacteria	4270
1980	nmdc:mga00v17_36286_c1	3300050491	Bacteria	2937
1981	nmdc:mga0yw44_147214_c1	3300050492	Bacteria	1534
1982	nmdc:mga0yw44_2639_c1	3300050492	Bacteria	7723
1983	nmdc:mga0yw44_46826_c1	3300050492	Bacteria	2599
1984	nmdc:mga0yw44_95715_c1	3300050492	Bacteria	1884
1985	nmdc:mga0k408_21946_c1	3300050493	Bacteria	3591
1986	nmdc:mga0k408_252332_c1	3300050493	Bacteria	1053
1987	nmdc:mga0k408_261781_c1	3300050493	Bacteria	1033
1988	nmdc:mga0k408_30659_c1	3300050493	Bacteria	3067
1989	nmdc:mga0k408_39149_c1	3300050493	Bacteria	2723
1990	nmdc:mga0k408_59277_c1	3300050493	Bacteria	2224
1991	nmdc:mga06z11_160880_c1	3300050494	Bacteria	1283
1992	nmdc:mga06z11_2466_c1	3300050494	Bacteria	7069
1993	nmdc:mga04h51_14665_c1	3300050495	Bacteria	2244
1994	nmdc:mga07m45_15602_c1	3300050496	Bacteria	4057
1995	nmdc:mga07m45_31423_c1	3300050496	Bacteria	2943
1996	nmdc:mga07m45_32616_c1	3300050496	Bacteria	2888
1997	nmdc:mga07m45_35038_c1	3300050496	Bacteria	2791
1998	nmdc:mga07m45_43662_c1	3300050496	Bacteria	2514
1999	nmdc:mga07m45_68239_c1	3300050496	Bacteria	2021
2000	nmdc:mga05p37_10573_c1	3300050507	Bacteria	10943
2001	nmdc:mga05p37_151024_c1	3300050507	Bacteria	2841
2002	nmdc:mga05p37_36662_c1	3300050507	Bacteria	6014
2003	nmdc:mga05p37_863_c1	3300050507	Bacteria	34108
2004	nmdc:mga09592_1701_c1	3300050508	Bacteria	17738
2005	nmdc:mga0qj67_1189_c1	3300050509	Bacteria	18042
2006	nmdc:mga0qj67_445_c1	3300050509	Bacteria	28226
2007	nmdc:mga06r32_6584_c1	3300050510	Bacteria	10438
2008	nmdc:mga08y16_128308_c1	3300050511	Unclassified	2638
2009	nmdc:mga08y16_13856_c1	3300050511	Bacteria	8486
2010	nmdc:mga08y16_179101_c1	3300050511	Bacteria	2201
2011	nmdc:mga08y16_2133_c1	3300050511	Bacteria	20270
2012	nmdc:mga08y16_21765_c1	3300050511	Bacteria	6766
2013	nmdc:mga08y16_644738_c1	3300050511	Bacteria	1064
2014	nmdc:mga08y16_78483_c1	3300050511	Bacteria	3442
2015	nmdc:mga0n895_26341_c1	3300050512	Bacteria	5505
2016	nmdc:mga0n895_2738_c1	3300050512	Bacteria	8288
2017	nmdc:mga0n895_332932_c1	3300050512	Bacteria	1538
2018	nmdc:mga0n895_427_c1	3300050512	Bacteria	28261
2019	nmdc:mga0n895_55_c1	3300050512	Bacteria	66529
2020	nmdc:mga0rr50_15797_c1	3300050513	Bacteria	4994
2021	nmdc:mga0rr50_272144_c1	3300050513	Bacteria	1412
2022	nmdc:mga0rr50_81453_c1	3300050513	Bacteria	2498
2023	nmdc:mga0a205_2491_c1	3300050515	Bacteria	16230
2024	nmdc:mga0a205_62861_c1	3300050515	Bacteria	3587
2025	nmdc:mga0sz30_58435_c1	3300050516	Bacteria	1323
2026	Ga0495601_0001987	3300053077	Bacteria	11450
2027	Ga0495601_0002133	3300053077	Bacteria	11131
2028	Ga0495601_0017401	3300053077	Bacteria	4362
2029	Ga0495601_0018323	3300053077	Bacteria	4259
2030	Ga0495601_0023764	3300053077	Bacteria	3768
2031	Ga0495601_0035959	3300053077	Bacteria	3093
2032	Ga0495601_0079528	3300053077	Bacteria	2102
2033	Ga0495601_0315763	3300053077	Bacteria	1017
2034	Ga0495612_0000243	3300053078	Bacteria	22586
2035	Ga0495612_0004160	3300053078	Bacteria	5997
2036	Ga0495612_0108765	3300053078	Bacteria	1185
2037	Ga0500610_0149213	3300053079	Bacteria	1173
2038	Ga0495595_0003024	3300053084	Bacteria	6650
2039	Ga0495595_0008950	3300053084	Bacteria	4128
2040	Ga0495595_0009151	3300053084	Bacteria	4092
2041	Ga0495595_0010093	3300053084	Bacteria	3920
2042	Ga0495595_0023372	3300053084	Bacteria	2720
2043	Ga0495595_0034011	3300053084	Bacteria	2303
2044	Ga0495595_0145200	3300053084	Bacteria	1165
2045	Ga0495619_0000139	3300053085	Bacteria	54165
2046	Ga0495619_0000330	3300053085	Bacteria	33168
2047	Ga0495619_0001222	3300053085	Bacteria	16829
2048	Ga0495619_0001830	3300053085	Bacteria	14136
2049	Ga0495619_0012438	3300053085	Bacteria	5360
2050	Ga0495619_0028591	3300053085	Bacteria	3597
2051	Ga0495619_0038733	3300053085	Bacteria	3110
2052	Ga0495619_0056307	3300053085	Bacteria	2606
2053	Ga0495619_0143799	3300053085	Bacteria	1643
2054	Ga0495619_0201845	3300053085	Bacteria	1377
2055	Ga0500643_000063	3300053087	Bacteria	122135
2056	Ga0500644_0108270	3300053088	Bacteria	1066
2057	Ga0500581_090861	3300053089	Bacteria	1513
2058	Ga0500646_0007427	3300053090	Bacteria	2802
2059	Ga0500647_0028092	3300053091	Bacteria	2661
2060	Ga0500583_0030333	3300053092	Bacteria	2367
2061	Ga0500651_0005704	3300053093	Bacteria	7129
2062	Ga0500651_0007402	3300053093	Bacteria	6409
2063	Ga0500651_0094553	3300053093	Bacteria	1837
2064	Ga0500566_0000151	3300053094	Bacteria	35674
2065	Ga0500566_0000236	3300053094	Bacteria	29461
2066	Ga0500566_0000247	3300053094	Bacteria	28953
2067	Ga0500566_0015485	3300053094	Bacteria	4476
2068	Ga0500641_0006119	3300053096	Bacteria	4264
2069	Ga0500641_0011386	3300053096	Bacteria	3226
2070	Ga0500641_0018450	3300053096	Bacteria	2624
2071	Ga0500641_0021622	3300053096	Bacteria	2455
2072	Ga0500641_0218273	3300053096	Bacteria	809
2073	Ga0500650_0004779	3300053098	Bacteria	4953
2074	Ga0500650_0097644	3300053098	Bacteria	1376
2075	Ga0500650_0101342	3300053098	Bacteria	1347
2076	Ga0500650_0106935	3300053098	Bacteria	1307
2077	Ga0500554_002974	3300053102	Bacteria	3403
2078	Ga0500554_110457	3300053102	Bacteria	924
2079	Ga0500556_0000006	3300053104	Bacteria	453982
2080	Ga0500557_000037	3300053105	Bacteria	71114
2081	Ga0500569_004907	3300053109	Bacteria	2843
2082	Ga0500569_030594	3300053109	Bacteria	1508
2083	Ga0500569_090435	3300053109	Bacteria	991
2084	Ga0500572_001270	3300053111	Bacteria	7065
2085	Ga0500592_000189	3300053116	Bacteria	11829
2086	Ga0500592_008283	3300053116	Bacteria	1650
2087	Ga0500593_022901	3300053117	Bacteria	2761
2088	Ga0500595_005148	3300053119	Bacteria	5739
2089	Ga0500595_006181	3300053119	Bacteria	5123
2090	Ga0500595_007015	3300053119	Bacteria	4718
2091	Ga0500595_012681	3300053119	Bacteria	3250
2092	Ga0500595_013452	3300053119	Bacteria	3133
2093	Ga0500595_013641	3300053119	Bacteria	3109
2094	Ga0500595_023699	3300053119	Bacteria	2153
2095	Ga0500607_023497	3300053121	Bacteria	3453
2096	Ga0500607_026533	3300053121	Bacteria	3220
2097	Ga0500608_004120	3300053122	Bacteria	5573
2098	Ga0500608_017789	3300053122	Bacteria	3234
2099	Ga0500608_021338	3300053122	Bacteria	2992
2100	Ga0500642_0000004	3300053130	Bacteria	433122
2101	Ga0500642_0000062	3300053130	Bacteria	58970
2102	Ga0500642_0003645	3300053130	Bacteria	4687
2103	Ga0500652_000555	3300053131	Bacteria	13010
2104	Ga0500652_007548	3300053131	Bacteria	3567
2105	Ga0500655_037189	3300053133	Bacteria	949
2106	Ga0500658_0063629	3300053134	Bacteria	1541
2107	Ga0500559_0000179	3300053136	Bacteria	50232
2108	Ga0500559_0006133	3300053136	Bacteria	5442
2109	Ga0500559_0015873	3300053136	Bacteria	3179
2110	Ga0500568_0003071	3300053139	Bacteria	9536
2111	Ga0500568_0014034	3300053139	Bacteria	3631
2112	Ga0500568_0016646	3300053139	Bacteria	3262
2113	Ga0500568_0024462	3300053139	Bacteria	2557
2114	Ga0500568_0030451	3300053139	Bacteria	2234
2115	Ga0500568_0039632	3300053139	Bacteria	1900
2116	Ga0500573_0112425	3300053140	Bacteria	1522
2117	Ga0500577_0000470	3300053142	Bacteria	10444
2118	Ga0500577_0080270	3300053142	Bacteria	1299
2119	Ga0500586_002011	3300053145	Bacteria	4468
2120	Ga0500588_0018770	3300053146	Bacteria	1828
2121	Ga0500588_0023611	3300053146	Bacteria	1688
2122	Ga0500588_0094409	3300053146	Bacteria	1022
2123	Ga0500590_032675	3300053148	Bacteria	2698
2124	Ga0500616_0000022	3300053153	Bacteria	460463
2125	Ga0500616_0003813	3300053153	Bacteria	11186
2126	Ga0500616_0073671	3300053153	Bacteria	1733
2127	Ga0500620_010224	3300053155	Bacteria	2459
2128	Ga0500622_0025609	3300053156	Bacteria	3116
2129	Ga0500622_0033524	3300053156	Bacteria	2692
2130	Ga0500622_0063226	3300053156	Bacteria	1884
2131	Ga0500627_0007472	3300053158	Bacteria	3808
2132	Ga0500627_0037129	3300053158	Bacteria	2078
2133	Ga0500627_0130371	3300053158	Bacteria	1135
2134	Ga0500634_0018999	3300053161	Bacteria	3697
2135	Ga0500634_0175359	3300053161	Bacteria	971
2136	Ga0500638_000539	3300053162	Bacteria	9511
2137	Ga0500638_058426	3300053162	Bacteria	1857
2138	Ga0500639_182872	3300053163	Bacteria	923
2139	Ga0500636_0000349	3300053177	Bacteria	25486
2140	Ga0500636_0002876	3300053177	Bacteria	9627
2141	Ga0500637_0023445	3300053178	Bacteria	3375
2142	Ga0500637_0083261	3300053178	Bacteria	1849
2143	Ga0500625_001277	3300053729	Bacteria	8427
2144	Ga0500609_005039	3300053731	Bacteria	1808
2145	Ga0500596_000909	3300053735	Bacteria	5920
2146	Ga0500596_004995	3300053735	Bacteria	2377
2147	Ga0500601_000601	3300053737	Bacteria	5134
2148	Ga0501084_0026071	3300054114	Bacteria	4876
2149	Ga0501084_0064354	3300054114	Bacteria	3069
2150	Ga0501084_0854191	3300054114	Bacteria	766
2151	Ga0500661_000348	3300055283	Bacteria	8437
2152	Ga0501082_0001185	3300060353	Bacteria	22911
2153	Ga0501082_0018750	3300060353	Bacteria	5962
2154	Ga0501082_0074667	3300060353	Bacteria	2920
2155	Ga0501082_0098506	3300060353	Bacteria	2528
2156	Ga0501082_0198013	3300060353	Bacteria	1748
2157	Ga0501082_0494549	3300060353	Bacteria	1069
2158	Ga0466962_0081670	3300061719	Bacteria	1546
2159	Ga0466962_0083641	3300061719	Bacteria	1527
2160	2507505238	2507262055	Bacteria	8048963
2161	2508539159	2508501009	Bacteria	7784016
2162	2508695477	2508501042	Bacteria	8719808
2163	2509152626	2508501128	Bacteria	8613869
2164	2511395425	2511231028	Bacteria	8046582
2165	2513625338	2513237092	Bacteria	8341956
2166	2513644157	2513237094	Bacteria	8789602
2167	2513651523	2513237095	Bacteria	8976980
2168	2513658806	2513237096	Bacteria	8722461
2169	2513674595	2513237098	Bacteria	9902361
2170	2513695103	2513237101	Bacteria	7952346
2171	2513706029	2513237102	Bacteria	7703324
2172	2513720311	2513237104	Bacteria	10034502
2173	2513860813	2513237137	Bacteria	9558895
2174	2513873535	2513237139	Bacteria	8737671
2175	2513888759	2513237141	Bacteria	8496279
2176	2513921070	2513237145	Bacteria	8979722
2177	2514012478	2513237161	Bacteria	8871253
2178	2515627435	2515154112	Bacteria	8294334
2179	2517107718	2517093001	Bacteria	9002274
2180	2517888835	2517572143	Bacteria	9484767
2181	2524440897	2524023205	Bacteria	8918781
2182	2524467841	2524023210	Bacteria	9029266
2183	2524537061	2524023228	Bacteria	10118060
2184	2528852930	2528768022	Bacteria	10457665
2185	2603858518	2602042107	Bacteria	6226103
2186	2617352391	2617270735	Bacteria	9163226
2187	2617373753	2617270741	Bacteria	8201522
2188	2643757991	2643221547	Bacteria	4740017
2189	2644730968	2643221733	Bacteria	5690728
2190	2644734838	2643221734	Bacteria	5365412
2191	2644746486	2643221736	Bacteria	6608466
2192	2671119951	2667528175	Bacteria	7532676
2193	2723841635	2721755755	Bacteria	8322773
2194	2728754982	2728368998	Bacteria	8720350
2195	2745081681	2744054633	Bacteria	8678936
2196	2793062035	2791355196	Bacteria	7323613
2197	2793072923	2791355197	Bacteria	8420563
2198	2793082757
2199	2805915619	2802429603	Bacteria	8777136
2200	2818237642	2816332527	Bacteria	8933356
2201	2819722257	2818991467	Bacteria	5893227
2202	2824604592	2824600985	Bacteria	8488197
2203	2824612317	2824609381	Bacteria	8672835
2204	2824624492	2824617872	Bacteria	8814715
2205	2824633407	2824626560	Bacteria	8813858
2206	2824640296	2824635225	Bacteria	8785348
2207	2824647270	2824644064	Bacteria	8743947
2208	2824655182	2824653114	Bacteria	8493680
2209	2824669694	2824661429	Bacteria	9877870
2210	2824676632	2824671348	Bacteria	8369588
2211	2824684067	2824679649	Bacteria	8248951
2212	2824694694	2824687955	Bacteria	8360029
2213	2824703826	2824696289	Bacteria	8335049
2214	2824708936	2824704595	Bacteria	9667483
2215	2824717414	2824714736	Bacteria	8717648
2216	2824727623	2824723954	Bacteria	8758240
2217	2824739858	2824732956	Bacteria	7810675
2218	2824752551	2824746037	Bacteria	7911610
2219	2824759963	2824753945	Bacteria	9787441
2220	2824770397	2824763712	Bacteria	9792355
2221	2824775529	2824773399	Bacteria	8360218
2222	2838124506	2838122688	Bacteria	8803140
2223	2841765000	2841760612	Bacteria	6454112
2224	2841945192	2841941048	Bacteria	8688029
2225	2841951974	2841949485	Bacteria	8680857
2226	2841965427	2841957949	Bacteria	8652217
2227	2841970631	2841966195	Bacteria	8673214
2228	2841979980	2841974524	Bacteria	8931498
2229	2841985159	2841983080	Bacteria	8395090
2230	2842043517	2842038055	Bacteria	8002051
2231	2842052493	2842045827	Bacteria	8006841
2232	2844107552	2844104063	Bacteria	6440972
2233	2844315329	2844315083	Bacteria	8138177
2234	2847931065	2847930680	Bacteria	9342022
2235	2847942148	2847939898	Bacteria	8606328
2236	2849083028	2849076700	Bacteria	7039503
2237	2851183701	2851182111	Bacteria	6047226
2238	2851249658	2851246043	Bacteria	6439203
2239	2857511917	2857509624	Bacteria	7472071
2240	2857526360	2857524615	Bacteria	6615449
2241	2874594438	2874590934	Bacteria	8299676
2242	2874608071	2874604998	Bacteria	7834745
2243	2874613443	2874612657	Bacteria	8252029
2244	2874624774	2874620515	Bacteria	8290088
2245	2874628802	2874628541	Bacteria	8630250
2246	2874649811	2874645413	Bacteria	8214782
2247	2876768920	2876761206	Bacteria	10111113
2248	2876773930	2876771140	Bacteria	8287509
2249	2876815512	2876808645	Bacteria	8824342
2250	2876821810	2876818435	Bacteria	8274608
2251	2879078346	2879074833	Bacteria	8279565
2252	2879085899	2879083081	Bacteria	8587928
2253	2879108556	2879099564	Bacteria	10442239
2254	2879112164	2879110137	Bacteria	8907982
2255	2879130607	2879127579	Bacteria	8294491
2256	2879147116	2879142872	Bacteria	8267021
2257	2881365325	2881364244	Bacteria	7710352
2258	2881668192	2881665667	Bacteria	8175609
2259	2885371035	2885366525	Bacteria	8326213
2260	2885376147	2885374607	Bacteria	8927485
2261	2885388836	2885383462	Bacteria	9473874
2262	2885411669	2885409591	Bacteria	9235467
2263	2888379601	2888378607	Bacteria	9652610
2264	2888390689	2888388044	Bacteria	7304136
2265	2888420314	2888419890	Bacteria	7857137
2266	2889035498	2889033259	Bacteria	9099371
2267	2893067370	2893066018	Bacteria	6158120
2268	2903732190	2903727486	Bacteria	8281579
2269	2903748962	2903748898	Bacteria	9972761
2270	2903770769	2903768456	Bacteria	9749579
2271	2904670271	2904666416	Bacteria	8226587
2272	2904691198	2904690495	Bacteria	9412302
2273	2904708817
2274	2904713171	2904711408	Bacteria	9771557
2275	2906604267	2906602504	Bacteria	8295279
2276	2906613866
2277	2906628964	2906626472	Bacteria	8826946
2278	2906642340	2906635258	Bacteria	8601019
2279	2906649386	2906643746	Bacteria	8722424
2280	2906667368	2906660503	Bacteria	8595048
2281	2908747436	2908739725	Bacteria	8628932
2282	2908756594	2908756301	Bacteria	8864324
2283	2908776270	2908775508	Bacteria	8092255
2284	2917703041	2917699015	Bacteria	7043791
2285	2919073792	2919073203	Bacteria	6531949
2286	2922364007	2922361189	Bacteria	7436256
2287	2922368944
2288	2922392559	2922386360	Bacteria	7017218
2289	2922394232	2922393267	Bacteria	8285685
2290	2922434232
2291	2929618593	2929615660	Bacteria	9193770
2292	2929628722	2929624759	Bacteria	9339455
2293	2932792915	2932784394	Bacteria	9704911
2294	2932794324	2932794094	Bacteria	7915132
2295	2932808082	2932801729	Bacteria	7987968
2296	2932812174	2932809354	Bacteria	9135765
2297	2932823164	2932818245	Bacteria	9955613
2298	2932836080	2932828146	Bacteria	9745859
2299	2933580695	2933577622	Bacteria	9116884
2300	2935615733	2935608549	Bacteria	8203142
2301	2935618513	2935616580	Bacteria	9032984
2302	2935635519	2935630451	Bacteria	8169952
2303	2935641086	2935638405	Bacteria	10015038
2304	2935653649	2935648319	Bacteria	8801166
2305	2935662398	2935656913	Bacteria	8965014
2306	2935670002	2935665750	Bacteria	9571747
2307	2935679149	2935675223	Bacteria	9928132
2308	2935690016	2935684952	Bacteria	9590419
2309	2935698536	2935694250	Bacteria	9291695
2310	2935711472	2935703347	Bacteria	10242284
2311	2935717535	2935713505	Bacteria	9608509
2312	2935723795	2935722832	Bacteria	9608746
2313	2935740004	2935732158	Bacteria	9706831
2314	2935749267	2935741537	Bacteria	9707219
2315	2935757370	2935750917	Bacteria	9590372
2316	2935763544	2935760218	Bacteria	9817913
2317	2935773051	2935769743	Bacteria	7878163
2318	2935782994	2935777560	Bacteria	8077691
2319	2935787960	2935785616	Bacteria	7962367
2320	2935796464	2935793552	Bacteria	8012592
2321	2935809966	2935801545	Bacteria	9301974
2322	2935816272	2935810662	Bacteria	9401221
2323	2935825469	2935819856	Bacteria	8261050
2324	2935835665	2935827899	Bacteria	10038562
2325	2935844616	2935837841	Bacteria	9454360
2326	2935853258	2935847175	Bacteria	8228321
2327	2935862938	2935855204	Bacteria	9035059
2328	2935866680	2935864058	Bacteria	9784707
2329	2935874987	2935873716	Bacteria	9632195
2330	2935890142	2935883170	Bacteria	7964738
2331	2935914731	2935908558	Bacteria	8568796
2332	2935918707	2935916978	Bacteria	9113783
2333	2935931576	2935926038	Bacteria	8601059
2334	2935940173	2935934488	Bacteria	8602579
2335	2935947480	2935942939	Bacteria	8599779
2336	2935956252	2935951376	Bacteria	8602333
2337	2935962629	2935959822	Bacteria	7869783
2338	2935973045	2935967501	Bacteria	8603075
2339	2935980711	2935975950	Bacteria	8347125
2340	2935985135	2935984226	Bacteria	8302647
2341	2935999737	2935992306	Bacteria	9802711
2342	2936010565	2936002035	Bacteria	9362176
2343	2936016700	2936011229	Bacteria	8801034
2344	2936025333	2936019824	Bacteria	8804134
2345	2936034175	2936028420	Bacteria	8965941
2346	2936041277	2936037263	Bacteria	9446081
2347	2936052232	2936046547	Bacteria	8903709
2348	2936056307	2936055302	Bacteria	8785755
2349	2940563283	2940556831	Bacteria	9590747
2350	2941512184	2941507105	Bacteria	8166816
2351	2941519886	2941515067	Bacteria	8166720
2352	2941528173	2941523033	Bacteria	8169134
2353	2941535522	2941531003	Bacteria	7653939
2354	2941543199	2941538514	Bacteria	9402094
2355	3005475054	3005474847	Bacteria	9259049
2356	3005489077	3005483717	Bacteria	7877331
2357	3005509167	3005506211	Bacteria	6943378
2358	3005592218	3005587118	Bacteria	7794411
2359	3005595043	3005594810	Bacteria	8716512
2360	3005710991	3005710791	Bacteria	7622528
2361	3005718296	3005718088	Bacteria	8283608
2362	8006927883	8006926726	Bacteria	6749210
2363	8006936242	8006933436	Bacteria	10410654
2364	8006969353	8006964411	Bacteria	8966052
2365	8006976187	8006973647	Bacteria	10679141
2366	8006990915	8006984368	Bacteria	9651211
2367	8006996518	8006994254	Bacteria	8309700
2368	8016518191	8016511872	Bacteria	9921665
2369	8016526130	8016522445	Bacteria	8156687
2370	8016539742	8016530956	Bacteria	8155261
2371	8016544046	8016539877	Bacteria	8155419
2372	8016549261	8016548790	Bacteria	8155074
2373	8016557686	8016557553	Bacteria	8154380
2374	8016569450	8016566248	Bacteria	8158151
2375	8016582064	8016575299	Bacteria	8154085
2376	8016595719	8016595262	Bacteria	8149947
2377	8016606575	8016603502	Bacteria	8731218
2378	8016618476	8016613128	Bacteria	8794220
2379	8016623168	8016622563	Bacteria	7999408
2380	8016635637	8016630954	Bacteria	9217207
2381	8017058457	8017057580	Bacteria	10023680
2382	8019531018	8019530166	Bacteria	8155624
2383	8019540563	8019538911	Bacteria	7872763
2384	8019550184	8019547302	Bacteria	7996444
2385	8019562402	8019555841	Bacteria	9642137
2386	8019572472	8019565922	Bacteria	9639779
2387	8019577239	8019576017	Bacteria	10049540
2388	8019595319	8019586578	Bacteria	10212056
2389	8019606439	8019597564	Bacteria	10041141
2390	8019612088	8019608314	Bacteria	10042931
2391	8019622962	8019619141	Bacteria	9218857
2392	8019640467	8019638758	Bacteria	9062356
2393	8019666978	8019659431	Bacteria	8577854
2394	8019676735	8019668869	Bacteria	8791617
2395	8019679256	8019678201	Bacteria	8863603
2396	8019696249	8019687851	Bacteria	8712826
2397	8055742443	8055742211	Bacteria	9226248
2398	8056675736	8056673599	Bacteria	7871253
2399	8056687401	8056681323	Bacteria	8472857
2400	8056690951	8056689827	Bacteria	6712655
2401	8056971281	8056967851	Bacteria	9038162
2402	8057532968	8057529695	Bacteria	6306553
2403	Ga0070675_100326135
2404	RicEn_C4416
2405	SwRhRL2b_contig_2417348
2406	2214572730
2407	ARcpr5oldR_c000196
2408	ARSoilYngRDRAFT_c00195
2409	ARcpr5yngRDRAFT_c000005
2410	ARSoilOldRDRAFT_c000003
2411	ARCol0oldRDRAFT_c00039
2412	ARCol0yngRDRAFT_1000194
2413	JGI24032J14994_100504
2414	JGI24752J21851_1000622
2415	JGI24740J21852_10000946
2416	JGI24739J22299_10001072
2417	JGI24739J22299_10003399
2418	JGI24737J22298_10000349
2419	JGI24737J22298_10000493
2420	JGI24737J22298_10006737
2421	JGI24743J22301_10004104
2422	JGI24735J21928_10018703
2423	JGI24735J21928_10069449
2424	JGI24750J21931_1000659
2425	JGI24738J21930_10000803
2426	JGI24749J21850_1000742
2427	JGI24744J21845_10003153
2428	JGI24744J21845_10008881
2429	JGI24035J26624_1000051
2430	JGI25159J45721_1001633
2431	JGI25406J46586_10000066
2432	JGI25165J46597_1014054
2433	JGI25153J46596_10001618
2434	JGI25153J46596_10001829
2435	JGI25153J46596_10002496
2436	JGI25153J46596_10014159
2437	JGI25160J50197_1003905
2438	JGI25160J50197_1009567
2439	JGI25404J52841_10005627
2440	JGI25404J52841_10005730
2441	JGI25404J52841_10026842
2442	Ga0055539_1007755
2443	Ga0055526_1014208
2444	Ga0055531_10003199
2445	Ga0065165_1000365
2446	Ga0065165_1001133
2447	Ga0065165_1001495
2448	Ga0065717_1001964
2449	Ga0065704_10073913
2450	Ga0065712_10002282
2451	Ga0065712_10162912
2452	Ga0065715_10002794
2453	Ga0065715_10089788
2454	Ga0065707_10006094
2455	Ga0065707_10086522
2456	Ga0070658_10071586
2457	Ga0070658_10072420
2458	Ga0070658_10141574
2459	Ga0070658_10188148
2460	Ga0070676_10000360
2461	Ga0070676_10064947
2462	Ga0070676_10222755
2463	Ga0070683_100003076
2464	Ga0070683_100083038
2465	Ga0070690_100002249
2466	Ga0070690_100009502
2467	Ga0070690_100012428
2468	Ga0070690_100155829
2469	Ga0070690_100300522
2470	Ga0070670_100000827
2471	Ga0070670_100229170
2472	Ga0070670_100382741
2473	Ga0070677_10003275
2474	Ga0070677_10149087
2475	Ga0068869_100000013
2476	Ga0068869_100020918
2477	Ga0070666_10001254
2478	Ga0070666_10050409
2479	Ga0070666_10242070
2480	Ga0070680_100002249
2481	Ga0070680_100002907
2482	Ga0070680_100006151
2483	Ga0070680_100011100
2484	Ga0070680_100056958
2485	Ga0070680_100090420
2486	Ga0070680_100101410
2487	Ga0070680_100231723
2488	Ga0070680_100377583
2489	Ga0070682_100015075
2490	Ga0070682_100018296
2491	Ga0068868_100006458
2492	Ga0068868_100023763
2493	Ga0068868_100086938
2494	Ga0068868_100454103
2495	Ga0070660_100001856
2496	Ga0070660_100083861
2497	Ga0070660_100282819
2498	Ga0070689_100000474
2499	Ga0070689_100002685
2500	Ga0070689_100017774
2501	Ga0070689_100385462
2502	Ga0070691_10000101
2503	Ga0070691_10147224
2504	Ga0070687_100003699
2505	Ga0070687_100003845
2506	Ga0070661_100001285
2507	Ga0070661_100067991
2508	Ga0070692_10000014
2509	Ga0070692_10014365
2510	Ga0070668_100000629
2511	Ga0070668_100015369
2512	Ga0070668_100032431
2513	Ga0070668_100283220
2514	Ga0070668_100577958
2515	Ga0070669_100000289
2516	Ga0070669_100008012
2517	Ga0070669_100068834
2518	Ga0070669_100137553
2519	Ga0070669_100434353
2520	Ga0070675_100000501
2521	Ga0070675_100016974
2522	Ga0070671_100000142
2523	Ga0070671_100012637
2524	Ga0070671_100049595
2525	Ga0070671_100090457
2526	Ga0070671_100097781
2527	Ga0070671_100123533
2528	Ga0070674_100000392
2529	Ga0070674_100007332
2530	Ga0070674_100043742
2531	Ga0070674_100228812
2532	Ga0070674_100236966
2533	Ga0070673_100001752
2534	Ga0070673_100089955
2535	Ga0070688_100000484
2536	Ga0070688_100010100
2537	Ga0070659_100001872
2538	Ga0070659_100134448
2539	Ga0070659_100250848
2540	Ga0070659_100373467
2541	Ga0070667_100002125
2542	Ga0070667_100011934
2543	Ga0070667_100016279
2544	Ga0070667_100096889
2545	Ga0070667_100101972
2546	Ga0070667_100326109
2547	Ga0070703_10001490
2548	Ga0070709_10000584
2549	Ga0070709_10015171
2550	Ga0070709_10025948
2551	Ga0070709_10044458
2552	Ga0070709_10046391
2553	Ga0070709_10150083
2554	Ga0070714_100007186
2555	Ga0070714_100014018
2556	Ga0070714_100044926
2557	Ga0070714_100051084
2558	Ga0070714_100068153
2559	Ga0070714_100068887
2560	Ga0070714_100140603
2561	Ga0070714_100161404
2562	Ga0070714_100180023
2563	Ga0070714_100322431
2564	Ga0070713_100000749
2565	Ga0070713_100001823
2566	Ga0070713_100002764
2567	Ga0070713_100012129
2568	Ga0070713_100026964
2569	Ga0070713_100040684
2570	Ga0070713_100059036
2571	Ga0070713_100100054
2572	Ga0070713_100166548
2573	Ga0070713_100294733
2574	Ga0070710_10002956
2575	Ga0070710_10007104
2576	Ga0070710_10055167
2577	Ga0070701_10000008
2578	Ga0070701_10052668
2579	Ga0070711_100003385
2580	Ga0070711_100003792
2581	Ga0070711_100014489
2582	Ga0070711_100057105
2583	Ga0070711_100064004
2584	Ga0070711_100124881
2585	Ga0070711_100370606
2586	Ga0070711_100393791
2587	Ga0070705_100004263
2588	Ga0070705_100011791
2589	Ga0070705_100152983
2590	Ga0070700_100000486
2591	Ga0070700_100011018
2592	Ga0070694_100000463
2593	Ga0070694_100043032
2594	Ga0070708_100081054
2595	Ga0070708_100104863
2596	Ga0070663_100001666
2597	Ga0070663_100015711
2598	Ga0070663_100016155
2599	Ga0070663_100017648
2600	Ga0070663_100019740
2601	Ga0070663_100060975
2602	Ga0070663_100154659
2603	Ga0070663_100160062
2604	Ga0070678_100004520
2605	Ga0070678_100020799
2606	Ga0070678_100060733
2607	Ga0070678_100070102
2608	Ga0070678_100075882
2609	Ga0070678_100271041
2610	Ga0070662_100004371
2611	Ga0070662_100023743
2612	Ga0070681_10002062
2613	Ga0070681_10024430
2614	Ga0070681_10071633
2615	Ga0070681_10083693
2616	Ga0070681_10095970
2617	Ga0070681_10112319
2618	Ga0070681_10273193
2619	Ga0070681_10389132
2620	Ga0068867_100000303
2621	Ga0068867_100122572
2622	Ga0070685_10001725
2623	Ga0070685_10002009
2624	Ga0070685_10024058
2625	Ga0070707_100093433
2626	Ga0070707_100205808
2627	Ga0070699_100245023
2628	Ga0070699_100452046
2629	Ga0070679_100005343
2630	Ga0070679_100018483
2631	Ga0070679_100018688
2632	Ga0070679_100070784
2633	Ga0070679_100082355
2634	Ga0070679_100131887
2635	Ga0070679_100162199
2636	Ga0070679_100244491
2637	Ga0070679_100282919
2638	Ga0070684_100001519
2639	Ga0070684_100013695
2640	Ga0070684_100086326
2641	Ga0070684_100144268
2642	Ga0070697_100049187
2643	Ga0070697_100186163
2644	Ga0070697_100263673
2645	Ga0068853_100000726
2646	Ga0068853_100006442
2647	Ga0068853_100052672
2648	Ga0068853_100154249
2649	Ga0068853_100168699
2650	Ga0068853_100207810
2651	Ga0068853_100208738
2652	Ga0068853_100296470
2653	Ga0068853_100300794
2654	Ga0068853_100325291
2655	Ga0068853_100426290
2656	Ga0070672_100000469
2657	Ga0070686_100004236
2658	Ga0070686_100004861
2659	Ga0070686_100011541
2660	Ga0070686_100231901
2661	Ga0070695_100001715
2662	Ga0070696_100005271
2663	Ga0070696_100093641
2664	Ga0070693_100000411
2665	Ga0070693_100044496
2666	Ga0070693_100127094
2667	Ga0070693_100224103
2668	Ga0070693_100291477
2669	Ga0070665_100032806
2670	Ga0070665_100046518
2671	Ga0070665_100126173
2672	Ga0070665_100195837
2673	Ga0070665_100467261
2674	Ga0070704_100001671
2675	Ga0070704_100006946
2676	Ga0068855_100036647
2677	Ga0068855_100056640
2678	Ga0068855_100186449
2679	Ga0068855_100193509
2680	Ga0068855_100235288
2681	Ga0068855_100294758
2682	Ga0068855_100454147
2683	Ga0068855_100620915
2684	Ga0068855_100708758
2685	Ga0070664_100001745
2686	Ga0070664_100036564
2687	Ga0070664_100049496
2688	Ga0070664_100072515
2689	Ga0070664_100179042
2690	Ga0068857_100000307
2691	Ga0068857_100005001
2692	Ga0068857_100022934
2693	Ga0068857_100050370
2694	Ga0068857_100122189
2695	Ga0068857_100248563
2696	Ga0068854_100000761
2697	Ga0068854_100050668
2698	Ga0068854_100178224
2699	Ga0068854_100205471
2700	Ga0068856_100003904
2701	Ga0068856_100005232
2702	Ga0068856_100029052
2703	Ga0068856_100057074
2704	Ga0068856_100066450
2705	Ga0068856_100084807
2706	Ga0068856_100107475
2707	Ga0068856_100281254
2708	Ga0070702_100001142
2709	Ga0068852_100000151
2710	Ga0068852_100003053
2711	Ga0068852_100032124
2712	Ga0068852_100087068
2713	Ga0068852_100098557
2714	Ga0068852_100110172
2715	Ga0068852_100194562
2716	Ga0068852_100230986
2717	Ga0068859_100001785
2718	Ga0068859_100099537
2719	Ga0068859_100105197
2720	Ga0068859_100226866
2721	Ga0068859_100361921
2722	Ga0068859_100570405
2723	Ga0068859_100571070
2724	Ga0068859_100606988
2725	Ga0068859_100638570
2726	Ga0068864_100019467
2727	Ga0068864_100195466
2728	Ga0068864_100287428
2729	Ga0068866_10000049
2730	Ga0068866_10089680
2731	Ga0068866_10117765
2732	Ga0068861_100000471
2733	Ga0068861_100034571
2734	Ga0068851_10009214
2735	Ga0068851_10011049
2736	Ga0068870_10001002
2737	Ga0068863_100000418
2738	Ga0068863_100021397
2739	Ga0068863_100478125
2740	Ga0068858_100002238
2741	Ga0068858_100070830
2742	Ga0068858_100077479
2743	Ga0068858_100401761
2744	Ga0068858_100412031
2745	Ga0068860_100002578
2746	Ga0068860_100004221
2747	Ga0068860_100116754
2748	Ga0068862_100001613
2749	Ga0068862_100122807
2750	Ga0068862_100330497
2751	Ga0081455_10000002
2752	Ga0081455_10004129
2753	Ga0081455_10014333
2754	Ga0081455_10019448
2755	Ga0081455_10041411
2756	Ga0081455_10046329
2757	Ga0081455_10054015
2758	Ga0081455_10114225
2759	Ga0081455_10128852
2760	Ga0081455_10266931
2761	Ga0081540_1000166
2762	Ga0081540_1003867
2763	Ga0081540_1005753
2764	Ga0081540_1006025
2765	Ga0081540_1011590
2766	Ga0081540_1012484
2767	Ga0081540_1012727
2768	Ga0081540_1048028
2769	Ga0081540_1048404
2770	Ga0081539_10000064
2771	Ga0081539_10005111
2772	Ga0081539_10014339
2773	Ga0081539_10059891
2774	Ga0081539_10107882
2775	Ga0070717_10000598
2776	Ga0070717_10039944
2777	Ga0070717_10061554
2778	Ga0070717_10113288
2779	Ga0070717_10137166
2780	Ga0070717_10263088
2781	Ga0075365_10024282
2782	Ga0075365_10069733
2783	Ga0075365_10086378
2784	Ga0075365_10159173
2785	Ga0075365_10173023
2786	Ga0075368_10007115
2787	Ga0075368_10073785
2788	Ga0075363_100025684
2789	Ga0075363_100027004
2790	Ga0075363_100029115
2791	Ga0075363_100068851
2792	Ga0075363_100166683
2793	Ga0075363_100209128
2794	Ga0075364_10050606
2795	Ga0075364_10112291
2796	Ga0075364_10171548
2797	Ga0075432_10014522
2798	Ga0070715_10001417
2799	Ga0070715_10001906
2800	Ga0070715_10030043
2801	Ga0070715_10077074
2802	Ga0070715_10104125
2803	Ga0070716_100000922
2804	Ga0070716_100001657
2805	Ga0070716_100029244
2806	Ga0070716_100040719
2807	Ga0070716_100182258
2808	Ga0070712_100005171
2809	Ga0070712_100005584
2810	Ga0070712_100024546
2811	Ga0070712_100034950
2812	Ga0070712_100035030
2813	Ga0070712_100097287
2814	Ga0070712_100102172
2815	Ga0070712_100177019
2816	Ga0075362_10022233
2817	Ga0075362_10190409
2818	Ga0075367_10007084
2819	Ga0075367_10027915
2820	Ga0075367_10036073
2821	Ga0075369_10049718
2822	Ga0075369_10091566
2823	Ga0075427_10000365
2824	Ga0075366_10011732
2825	Ga0075366_10077040
2826	Ga0075366_10122166
2827	Ga0075366_10146185
2828	Ga0097621_100000012
2829	Ga0097621_100014206
2830	Ga0097621_100234116
2831	Ga0097621_100594897
2832	Ga0075370_10020566
2833	Ga0075370_10056481
2834	Ga0075370_10094314
2835	Ga0068871_100000611
2836	Ga0075428_100166474
2837	Ga0075428_100311376
2838	Ga0075430_100015106
2839	Ga0075433_10060417
2840	Ga0075433_10117947
2841	Ga0075434_100000193
2842	Ga0075434_100000647
2843	Ga0075434_100008129
2844	Ga0075434_100053188
2845	Ga0075434_100081344
2846	Ga0075434_100082007
2847	Ga0075434_100800901
2848	Ga0075429_100000451
2849	Ga0075429_100386651
2850	Ga0068865_100001539
2851	Ga0068865_100010595
2852	Ga0068865_100025848
2853	Ga0068865_100031167
2854	Ga0075436_100344269
2855	Ga0097620_100001785
2856	Ga0097620_100099536
2857	Ga0097620_100105196
2858	Ga0097620_100226863
2859	Ga0097620_100361953
2860	Ga0097620_100570424
2861	Ga0097620_100571033
2862	Ga0097620_100606988
2863	Ga0097620_100638572
2864	Ga0099824_1014228
2865	Ga0099824_1026035
2866	Ga0099822_1000827
2867	Ga0075435_100003880
2868	Ga0075435_100014928
2869	Ga0099794_10006977
2870	Ga0099795_10008993
2871	Ga0105251_10048371
2872	Ga0105250_10007496
2873	Ga0105240_10003692
2874	Ga0105240_10008228
2875	Ga0105240_10025163
2876	Ga0105240_10034925
2877	Ga0105240_10043110
2878	Ga0105240_10119042
2879	Ga0105240_10334999
2880	Ga0105240_10363048
2881	Ga0105240_10377529
2882	Ga0111539_10000679
2883	Ga0111539_10000925
2884	Ga0111539_10002056
2885	Ga0111539_10192542
2886	Ga0111539_10324879
2887	Ga0111539_10515586
2888	Ga0105245_10000090
2889	Ga0105245_10089730
2890	Ga0105245_10217136
2891	Ga0105247_10001092
2892	Ga0105247_10020697
2893	Ga0105247_10024972
2894	Ga0105247_10034333
2895	Ga0105247_10152469
2896	Ga0105247_10155419
2897	Ga0114129_10006700
2898	Ga0114129_10443248
2899	Ga0105243_10002557
2900	Ga0105243_10006084
2901	Ga0105243_10006975
2902	Ga0105243_10029257
2903	Ga0105243_10077202
2904	Ga0105241_10000053
2905	Ga0105241_10090424
2906	Ga0105241_10124355
2907	Ga0105241_10132389
2908	Ga0105241_10342329
2909	Ga0105241_10677332
2910	Ga0105242_10000491
2911	Ga0105242_10049041
2912	Ga0105242_10245208
2913	Ga0105248_10000964
2914	Ga0105248_10003797
2915	Ga0105248_10038276
2916	Ga0105248_10153982
2917	Ga0105248_10236684
2918	Ga0105248_10281257
2919	Ga0105248_10312566
2920	Ga0105237_10008862
2921	Ga0105237_10015141
2922	Ga0105237_10027862
2923	Ga0105237_10080675
2924	Ga0105237_10080987
2925	Ga0105237_10218579
2926	Ga0105237_10223905
2927	Ga0105238_10005518
2928	Ga0105238_10008791
2929	Ga0105238_10013990
2930	Ga0105238_10034755
2931	Ga0105238_10052809
2932	Ga0105238_10097925
2933	Ga0105238_10270541
2934	Ga0105238_10287553
2935	Ga0105238_10299735
2936	Ga0105238_10321084
2937	Ga0105238_10364014
2938	Ga0105238_10461643
2939	Ga0105238_10874522
2940	Ga0105249_10001085
2941	Ga0105249_10106323
2942	Ga0105249_10115854
2943	Ga0105249_10247337
2944	Ga0105249_10407766
2945	Ga0099796_10016347
2946	Ga0099796_10030093
2947	Ga0105239_10002519
2948	Ga0105239_10009940
2949	Ga0105239_10012065
2950	Ga0105239_10014833
2951	Ga0105239_10053131
2952	Ga0105239_10071090
2953	Ga0105239_10093727
2954	Ga0105239_10095287
2955	Ga0105239_10124206
2956	Ga0105239_10128073
2957	Ga0105239_10232870
2958	Ga0105239_10271752
2959	Ga0105239_10313409
2960	Ga0105239_10641834
2961	Ga0105246_10000052
2962	Ga0105246_10005044
2963	Ga0105246_10043290
2964	Ga0105246_10070799
2965	Ga0105246_10148363
2966	Ga0105246_10243181
2967	Ga0157335_1001428
2968	Ga0157341_1001939
2969	Ga0157339_1000852
2970	Ga0157373_10021395
2971	Ga0157373_10138414
2972	Ga0157373_10196245
2973	Ga0157371_10003401
2974	Ga0157371_10037614
2975	Ga0157371_10241669
2976	Ga0157371_10318295
2977	Ga0157370_10023260
2978	Ga0157370_10087018
2979	Ga0157370_10089444
2980	Ga0157370_10142585
2981	Ga0157370_10327402
2982	Ga0157370_10629700
2983	Ga0157369_10001511
2984	Ga0157369_10159158
2985	Ga0157369_10255370
2986	Ga0157369_10417724
2987	Ga0157369_10453675
2988	Ga0157374_10001210
2989	Ga0157374_10055607
2990	Ga0157374_10064601
2991	Ga0157374_10177581
2992	Ga0157378_10002713
2993	Ga0157378_10078751
2994	Ga0157378_10201436
2995	Ga0163162_10000308
2996	Ga0163162_10041674
2997	Ga0163162_10073674
2998	Ga0163162_10079821
2999	Ga0163162_10116570
3000	Ga0163162_10321040
3001	Ga0163162_10522399
3002	Ga0163162_10558197
3003	Ga0157372_10002370
3004	Ga0157372_10040215
3005	Ga0157372_10283795
3006	Ga0157372_10609627
3007	Ga0157375_10000414
3008	Ga0157375_10039319
3009	Ga0157375_10176028
3010	Ga0157375_10225179
3011	Ga0157375_10249642
3012	Ga0157375_10487912
3013	Ga0157375_10641958
3014	Ga0163163_10002008
3015	Ga0163163_10016496
3016	Ga0163163_10022724
3017	Ga0163163_10077402
3018	Ga0163163_10120586
3019	Ga0163163_10151049
3020	Ga0163163_10158656
3021	Ga0163163_10369133
3022	Ga0163163_10448537
3023	Ga0157380_10000122
3024	Ga0157380_10495451
3025	Ga0157377_10000688
3026	Ga0157379_10000261
3027	Ga0157379_10098068
3028	Ga0157379_10309900
3029	Ga0157376_10002538
3030	Ga0157376_10053954
3031	Ga0157376_10202573
3032	Ga0163161_10000199
3033	Ga0214544_1000016
3034	Ga0214542_1000016
3035	Ga0214545_1000008
3036	Ga0214543_1001466
3037	Ga0213873_10009795
3038	Ga0213872_10028176
3039	Ga0213872_10047754
3040	Ga0213874_10006393
3041	Ga0213876_10003239
3042	Ga0213876_10112222
3043	Ga0209563_105374
3044	Ga0207425_1005837
3045	Ga0209026_1009167
3046	Ga0209677_100672
3047	Ga0209677_104189
3048	Ga0209148_1000282
3049	Ga0209148_1007881
3050	Ga0209233_1004421
3051	Ga0209233_1010542
3052	Ga0209233_1012168
3053	Ga0207666_1000049
3054	Ga0207666_1000597
3055	Ga0209455_1001040
3056	Ga0209455_1002709
3057	Ga0209455_1008795
3058	Ga0209673_1012007
3059	Ga0209130_1000045
3060	Ga0207673_1000439
3061	Ga0209564_1000321
3062	Ga0209564_1005785
3063	Ga0209564_1006440
3064	Ga0209564_1009846
3065	Ga0209758_1000069
3066	Ga0209758_1000635
3067	Ga0209758_1000686
3068	Ga0209758_1002443
3069	Ga0209758_1005237
3070	Ga0209758_1005561
3071	Ga0209758_1008699
3072	Ga0209758_1010679
3073	Ga0209758_1030622
3074	Ga0209256_1033836
3075	Ga0207426_1000826
3076	Ga0207426_1002082
3077	Ga0207426_1018863
3078	Ga0207426_1019837
3079	Ga0207426_1047523
3080	Ga0209257_1000473
3081	Ga0209257_1018878
3082	Ga0207697_10000335
3083	Ga0207697_10025453
3084	Ga0207656_10016962
3085	Ga0207656_10038990
3086	Ga0207656_10106192
3087	Ga0207682_10000042
3088	Ga0207682_10092512
3089	Ga0207692_10016486
3090	Ga0207692_10019032
3091	Ga0207692_10020310
3092	Ga0207692_10041703
3093	Ga0207692_10235900
3094	Ga0207642_10000065
3095	Ga0207642_10087754
3096	Ga0207642_10160839
3097	Ga0207710_10000734
3098	Ga0207710_10019877
3099	Ga0207710_10022757
3100	Ga0207710_10053801
3101	Ga0207688_10000053
3102	Ga0207688_10006140
3103	Ga0207680_10044067
3104	Ga0207680_10152265
3105	Ga0207680_10242520
3106	Ga0207647_10001150
3107	Ga0207647_10002277
3108	Ga0207647_10002930
3109	Ga0207647_10057180
3110	Ga0207647_10072916
3111	Ga0207685_10012934
3112	Ga0207685_10013733
3113	Ga0207685_10042206
3114	Ga0207685_10180580
3115	Ga0207699_10002977
3116	Ga0207699_10003057
3117	Ga0207699_10003164
3118	Ga0207699_10044378
3119	Ga0207699_10079993
3120	Ga0207699_10146192
3121	Ga0207645_10000090
3122	Ga0207645_10011508
3123	Ga0207645_10096477
3124	Ga0207645_10166633
3125	Ga0207645_10214065
3126	Ga0207645_10216934
3127	Ga0207643_10000082
3128	Ga0207705_10018481
3129	Ga0207705_10025377
3130	Ga0207705_10131695
3131	Ga0207654_10000058
3132	Ga0207654_10004743
3133	Ga0207654_10024310
3134	Ga0207654_10247453
3135	Ga0207654_10361339
3136	Ga0207707_10000100
3137	Ga0207707_10007842
3138	Ga0207707_10020346
3139	Ga0207707_10056938
3140	Ga0207707_10170877
3141	Ga0207707_10389487
3142	Ga0207695_10000107
3143	Ga0207695_10000453
3144	Ga0207695_10070809
3145	Ga0207695_10137509
3146	Ga0207695_10196781
3147	Ga0207695_10567094
3148	Ga0207671_10006934
3149	Ga0207671_10022867
3150	Ga0207671_10039004
3151	Ga0207671_10070331
3152	Ga0207671_10075442
3153	Ga0207671_10106543
3154	Ga0207693_10000310
3155	Ga0207693_10002221
3156	Ga0207693_10002937
3157	Ga0207693_10013676
3158	Ga0207693_10016511
3159	Ga0207693_10028589
3160	Ga0207693_10045294
3161	Ga0207693_10092818
3162	Ga0207693_10309987
3163	Ga0207663_10032061
3164	Ga0207663_10033325
3165	Ga0207663_10038220
3166	Ga0207663_10063141
3167	Ga0207663_10127397
3168	Ga0207663_10166201
3169	Ga0207663_10333825
3170	Ga0207660_10000083
3171	Ga0207660_10018837
3172	Ga0207660_10023642
3173	Ga0207660_10048720
3174	Ga0207660_10052872
3175	Ga0207660_10077983
3176	Ga0207660_10080400
3177	Ga0207660_10552665
3178	Ga0207662_10007146
3179	Ga0207662_10017526
3180	Ga0207662_10210360
3181	Ga0207657_10001336
3182	Ga0207657_10001686
3183	Ga0207657_10014898
3184	Ga0207657_10022984
3185	Ga0207657_10057036
3186	Ga0207657_10060102
3187	Ga0207657_10175078
3188	Ga0207649_10000643
3189	Ga0207649_10036240
3190	Ga0207649_10119077
3191	Ga0207649_10194096
3192	Ga0207652_10000557
3193	Ga0207652_10026633
3194	Ga0207652_10030893
3195	Ga0207652_10040001
3196	Ga0207652_10134241
3197	Ga0207652_10189872
3198	Ga0207652_10201882
3199	Ga0207652_10493677
3200	Ga0207646_10095001
3201	Ga0207681_10000271
3202	Ga0207681_10227791
3203	Ga0207694_10001009
3204	Ga0207694_10007667
3205	Ga0207694_10038148
3206	Ga0207694_10053306
3207	Ga0207694_10094099
3208	Ga0207694_10118044
3209	Ga0207650_10032088
3210	Ga0207650_10136231
3211	Ga0207659_10000161
3212	Ga0207659_10000460
3213	Ga0207659_10144234
3214	Ga0207687_10000063
3215	Ga0207687_10012464
3216	Ga0207687_10076079
3217	Ga0207700_10001418
3218	Ga0207700_10004421
3219	Ga0207700_10010167
3220	Ga0207700_10026056
3221	Ga0207700_10030214
3222	Ga0207700_10067717
3223	Ga0207700_10076096
3224	Ga0207700_10114116
3225	Ga0207700_10119721
3226	Ga0207700_10125666
3227	Ga0207700_10327804
3228	Ga0207664_10004485
3229	Ga0207664_10019693
3230	Ga0207664_10036266
3231	Ga0207664_10048578
3232	Ga0207664_10081559
3233	Ga0207664_10180253
3234	Ga0207664_10189317
3235	Ga0207664_10500655
3236	Ga0207644_10000591
3237	Ga0207644_10011436
3238	Ga0207644_10059212
3239	Ga0207644_10060210
3240	Ga0207644_10332617
3241	Ga0207644_10554725
3242	Ga0207690_10000897
3243	Ga0207690_10106097
3244	Ga0207690_10132246
3245	Ga0207690_10226025
3246	Ga0207690_10264463
3247	Ga0207690_10475570
3248	Ga0207706_10001197
3249	Ga0207706_10030254
3250	Ga0207706_10039210
3251	Ga0207706_10087334
3252	Ga0207686_10000614
3253	Ga0207686_10024638
3254	Ga0207709_10000429
3255	Ga0207709_10076079
3256	Ga0207709_10238566
3257	Ga0207670_10000485
3258	Ga0207670_10006650
3259	Ga0207670_10051762
3260	Ga0207670_10091818
3261	Ga0207670_10251871
3262	Ga0207669_10000019
3263	Ga0207669_10170314
3264	Ga0207669_10317964
3265	Ga0207704_10000552
3266	Ga0207704_10123590
3267	Ga0207665_10001734
3268	Ga0207665_10006611
3269	Ga0207665_10009684
3270	Ga0207665_10118027
3271	Ga0207665_10125262
3272	Ga0207665_10127756
3273	Ga0207691_10000987
3274	Ga0207691_10040766
3275	Ga0207691_10086631
3276	Ga0207711_10011159
3277	Ga0207711_10012997
3278	Ga0207711_10071484
3279	Ga0207711_10106207
3280	Ga0207711_10192391
3281	Ga0207711_10327793
3282	Ga0207689_10000916
3283	Ga0207689_10134681
3284	Ga0207689_10159295
3285	Ga0207689_10178399
3286	Ga0207689_10283303
3287	Ga0207661_10000281
3288	Ga0207661_10063954
3289	Ga0207661_10193687
3290	Ga0207661_10383665
3291	Ga0207679_10000026
3292	Ga0207679_10090266
3293	Ga0207679_10097234
3294	Ga0207679_10269529
3295	Ga0207667_10002324
3296	Ga0207667_10004064
3297	Ga0207667_10015224
3298	Ga0207667_10022622
3299	Ga0207667_10141261
3300	Ga0207667_10240035
3301	Ga0207667_10270516
3302	Ga0207667_10607740
3303	Ga0207651_10000101
3304	Ga0207712_10000908
3305	Ga0207712_10218803
3306	Ga0207712_10239725
3307	Ga0207668_10000726
3308	Ga0207668_10054744
3309	Ga0207668_10159236
3310	Ga0207668_10224893
3311	Ga0207668_10349247
3312	Ga0207640_10000596
3313	Ga0207640_10064044
3314	Ga0207640_10129721
3315	Ga0207640_10247627
3316	Ga0207640_10314960
3317	Ga0207658_10003725
3318	Ga0207658_10118433
3319	Ga0207677_10000651
3320	Ga0207677_10079428
3321	Ga0207677_10113338
3322	Ga0207677_10250420
3323	Ga0207677_10317108
3324	Ga0207677_10450597
3325	Ga0207703_10001717
3326	Ga0207703_10028705
3327	Ga0207703_10099895
3328	Ga0207703_10108324
3329	Ga0207703_10212977
3330	Ga0207703_10268259
3331	Ga0207639_10002317
3332	Ga0207639_10008158
3333	Ga0207639_10031138
3334	Ga0207639_10147371
3335	Ga0207639_10200353
3336	Ga0207639_10418887
3337	Ga0207678_10000831
3338	Ga0207678_10004832
3339	Ga0207678_10005663
3340	Ga0207678_10031777
3341	Ga0207678_10039914
3342	Ga0207678_10045970
3343	Ga0207678_10053719
3344	Ga0207708_10002086
3345	Ga0207708_10007188
3346	Ga0207708_10021696
3347	Ga0207708_10188098
3348	Ga0207708_10198676
3349	Ga0207702_10000004
3350	Ga0207702_10001701
3351	Ga0207702_10005168
3352	Ga0207702_10082698
3353	Ga0207702_10149669
3354	Ga0207702_10152046
3355	Ga0207702_10154503
3356	Ga0207702_10217083
3357	Ga0207702_10222725
3358	Ga0207702_10279826
3359	Ga0207702_10485388
3360	Ga0207641_10002162
3361	Ga0207641_10853150
3362	Ga0207648_10001440
3363	Ga0207648_10027306
3364	Ga0207648_10047658
3365	Ga0207648_10122872
3366	Ga0207676_10000563
3367	Ga0207676_10026824
3368	Ga0207676_10179576
3369	Ga0207674_10000890
3370	Ga0207674_10001207
3371	Ga0207674_10002298
3372	Ga0207674_10046110
3373	Ga0207674_10050784
3374	Ga0207674_10060579
3375	Ga0207674_10074016
3376	Ga0207675_100000983
3377	Ga0207675_100034844
3378	Ga0207675_100101390
3379	Ga0207683_10000324
3380	Ga0207683_10001459
3381	Ga0207683_10037437
3382	Ga0207683_10037847
3383	Ga0207683_10063219
3384	Ga0207683_10089829
3385	Ga0207683_10358358
3386	Ga0207683_10368755
3387	Ga0207698_10000634
3388	Ga0207698_10037553
3389	Ga0207698_10066209
3390	Ga0207698_10081718
3391	Ga0207698_10129747
3392	Ga0207698_10222866
3393	Ga0207698_10261757
3394	Ga0207698_10303068
3395	Ga0209389_1000033
3396	Ga0209389_1000182
3397	Ga0209589_1000021
3398	Ga0209589_1000040
3399	Ga0209489_100028
3400	Ga0209489_100045
3401	Ga0209489_100209
3402	Ga0209700_100011
3403	Ga0209700_100037
3404	Ga0209995_1022537
3405	Ga0209968_1016151
3406	Ga0209588_1003941
3407	Ga0209971_1009877
3408	Ga0209998_10001212
3409	Ga0209813_10004390
3410	Ga0209974_10001144
3411	Ga0209974_10011378
3412	Ga0209974_10044083
3413	Ga0207428_10000130
3414	Ga0207428_10000180
3415	Ga0207428_10000286
3416	Ga0207428_10121991
3417	Ga0268266_10001190
3418	Ga0268266_10003966
3419	Ga0268266_10006553
3420	Ga0268266_10010790
3421	Ga0268266_10018702
3422	Ga0268266_10026048
3423	Ga0268266_10060942
3424	Ga0268266_10161936
3425	Ga0268266_10202084
3426	Ga0268265_10004798
3427	Ga0268264_10000062
3428	Ga0268264_10027250
3429	Ga0265337_1004948
3430	Ga0265326_10019560
3431	Ga0265334_10041598
3432	Ga0265334_10056600
3433	Ga0265323_10010254
3434	Ga0265336_10000561
3435	Ga0307517_10001338
3436	Ga0307515_10062859
3437	Ga0307515_10181770
3438	Ga0307515_10289619
3439	Ga0307515_10356527
3440	Ga0265338_10000598
3441	Ga0265338_10020386
3442	Ga0265338_10088359
3443	Ga0265324_10007924
3444	Ga0307511_10032499
3445	Ga0307511_10161439
3446	Ga0265330_10011313
3447	Ga0265330_10015500
3448	Ga0265330_10078748
3449	Ga0265332_10011743
3450	Ga0265332_10044345
3451	Ga0265325_10000011
3452	Ga0265325_10003966
3453	Ga0265325_10010784
3454	Ga0265325_10038989
3455	Ga0265325_10122320
3456	Ga0265340_10015122
3457	Ga0265340_10027823
3458	Ga0265340_10059770
3459	Ga0265339_10001062
3460	Ga0265339_10021072
3461	Ga0265339_10047184
3462	Ga0265331_10024816
3463	Ga0265316_10135766
3464	Ga0307513_10135414
3465	Ga0307513_10380870
3466	Ga0307513_10402072
3467	Ga0307509_10080587
3468	Ga0265313_10000008
3469	Ga0265313_10020196
3470	Ga0307508_10118780
3471	Ga0307508_10201682
3472	Ga0307508_10207705
3473	Ga0265314_10002746
3474	Ga0265314_10042090
3475	Ga0265342_10000625
3476	Ga0265342_10035856
3477	Ga0265342_10054134
3478	Ga0265342_10057548
3479	Ga0265342_10197901
3480	Ga0307516_10008308
3481	Ga0307516_10022504
3482	Ga0307516_10093671
3483	Ga0307516_10102284
3484	Ga0307516_10318436
3485	Ga0307516_10409265
3486	Ga0307405_10031045
3487	Ga0307410_10094066
3488	Ga0307406_10038341
3489	Ga0307412_10197313
3490	Ga0307416_100092107
3491	Ga0307416_100149616
3492	Ga0307416_100493536
3493	Ga0307411_10317908
3494	Ga0307507_10019178
3495	Ga0307510_10021983
3496	Ga0307510_10037056
3497	Ga0307510_10072508
3498	Ga0315911_1000008
3499	Ga0373930_0000103
3500	Ga0373930_0003413
3501	Ga0373930_0007086
3502	Ga0373930_0012448
3503	Ga0373948_0000862
3504	Ga0373950_0000731
3505	Ga0373950_0014963
3506	Ga0373958_0000037
3507	Ga0373959_0000941
3508	Ga0373959_0009861
3509	Ga0373938_0000190
3510	Ga0373938_0009528
3511	Ga0373926_0007441
3512	Ga0373926_0017993
3513	Ga0373928_0029080
3514	Ga0373929_0000503
3515	Ga0373929_0006273
3516	Ga0373929_0010781
3517	Ga0373929_0020115
3518	Ga0373934_0002347
3519	Ga0373940_0000178
3520	Ga0373951_0000165
3521	Ga0373951_0004364
3522	Ga0373951_0010273
3523	Ga0373952_0000829
3524	Ga0373923_0004419
3525	Ga0373923_0023286
3526	Ga0373923_0029991
3527	Ga0373923_0051538
3528	Ga0373923_0081219
3529	Ga0373923_0112538
3530	Ga0373932_0000221
3531	Ga0373932_0001308
3532	Ga0373932_0007946
3533	Ga0373936_0011829
3534	Ga0373936_0028137
3535	Ga0373939_0000178
3536	Ga0373939_0000211
3537	Ga0373941_0000085
3538	Ga0373941_0018807
3539	Ga0373945_0034128
3540	Ga0373945_0044384
3541	Ga0373953_0009436
3542	Ga0373954_0000883
3543	Ga0373954_0016379
3544	Ga0373956_0018845
3545	Ga0373956_0085815
3546	Ga0373957_0001330
3547	Ga0373957_0007368
3548	Ga0373957_0049500
3549	Ga0373957_0070742
3550	Ga0373960_0001587
3551	Ga0373960_0009749
3552	Ga0373943_0009325
3553	Ga0373943_0058528
3554	Ga0373943_0060330
3555	Ga0373946_0002144
3556	Ga0373946_0006651
3557	Ga0373946_0013913
3558	Ga0373955_0001067
3559	Ga0373955_0002823
3560	Ga0373955_0006562
3561	Ga0373955_0012669
3562	Ga0373955_0021359
3563	Ga0373955_0022947
3564	Ga0373942_0001835
3565	Ga0373942_0004182
3566	Ga0373942_0031734
3567	Ga0373961_0001088
3568	Ga0373961_0020525
3569	Ga0373962_0000271
3570	Ga0373924_0005686
3571	Ga0373924_0026792
3572	Ga0373924_0030107
3573	Ga0373924_0082472
3574	Ga0373924_0107917
3575	Ga0373931_0000854
3576	Ga0373931_0004670
3577	Ga0373931_0007821
3578	Ga0373931_0020376
3579	Ga0373935_0000953
3580	Ga0373935_0009363
3581	Ga0373935_0375082
3582	Ga0373935_0405554
3583	Ga0373927_0001486
3584	Ga0373927_0016979
3585	Ga0373927_0020336
3586	Ga0373927_0020725
3587	Ga0373927_0047148
3588	Ga0373927_0085319
3589	Ga0373927_0210585
3590	Ga0373927_0210852
3591	Ga0373927_0231919
3592	Ga0373927_0370168
3593	Ga0373933_0000031
3594	Ga0373933_0001638
3595	Ga0373933_0004073
3596	Ga0373933_0009095
3597	Ga0373933_0046875
3598	Ga0373933_0275632
3599	Ga0373933_0283029
3600	Ga0373947_0016744
3601	Ga0373947_0034928
3602	Ga0373947_0108866
3603	Ga0373947_0125159
3604	Ga0373947_0136574
3605	Ga0373937_0022664
3606	Ga0373937_0024864
3607	Ga0373937_0035182
3608	Ga0373937_0063798
3609	Ga0373937_0185374
3610	Ga0373937_0245399
3611	Ga0373937_0342089
3612	Ga0373925_0001713
3613	Ga0373925_0011017
3614	Ga0373925_0012057
3615	Ga0373925_0021659
3616	Ga0373925_0061385
3617	Ga0373925_0061914
3618	Ga0373925_0065920
3619	Ga0395899_0032437
3620	Ga0395899_0095919
3621	Ga0395900_0003383
3622	Ga0395900_0034932
3623	Ga0395900_0040360
3624	Ga0395900_0128808
3625	Ga0395898_0042666
3626	Ga0395898_0071806
3627	Ga0395898_0149786
3628	Ga0395898_0214916
3629	Ga0395898_0238773
3630	Ga0395898_0253695
3631	Ga0395905_0206657
3632	Ga0436364_0096232
3633	Ga0395901_0161555
3634	Ga0395901_0230847
3635	Ga0395901_0250229
3636	Ga0395901_0272541
3637	Ga0395901_0434709
3638	Ga0395901_0486977
3639	Ga0436365_0221825
3640	Ga0436365_0946034
3641	Ga0436365_0949897
3642	Ga0436365_1714553
3643	Ga0436360_0780899
3644	Ga0436361_0333730
3645	Ga0436363_0863782
3646	Ga0436363_0926778
3647	Ga0436363_1148766
3648	Ga0436362_0112883
3649	Ga0436362_0546439
3650	Ga0436362_0693408
3651	Ga0439453_0006962
3652	Ga0451797_1160655
3653	Ga0451802_0544973
3654	Ga0439443_004964
3655	Ga0439459_0024175
3656	Ga0439460_0007890
3657	Ga0451577_0274370
3658	Ga0466969_0030685
3659	Ga0466969_0118977
3660	Ga0466972_0000119
3661	Ga0466972_0023237
3662	Ga0466972_0120032
3663	Ga0453683_0027898
3664	Ga0466965_0029278
3665	Ga0466965_0036005
3666	Ga0466966_0001462
3667	Ga0466966_0064168
3668	Ga0466966_0142339
3669	Ga0466961_0000139
3670	Ga0466961_0119230
3671	Ga0466963_0021631
3672	Ga0466964_0106147
3673	Ga0466964_0145203
3674	Ga0453684_0033092
3675	Ga0466968_0033860
3676	Ga0466968_0064073
3677	Ga0466957_0109451
3678	Ga0466960_0056971
3679	Ga0466959_0084047
3680	Ga0466959_0161266
3681	Ga0466959_0209189
3682	Ga0451576_0044873
3683	Ga0466958_0031880
3684	Ga0466967_0083690
3685	Ga0466967_0105726
3686	Ga0466967_0225224
3687	Ga0466967_0361534
3688	Ga0495617_033033
3689	Ga0495592_0003085
3690	Ga0495592_0024684
3691	Ga0495592_0036398
3692	Ga0495592_0115227
3693	Ga0495603_0000047
3694	Ga0495603_0020465
3695	Ga0495603_0022882
3696	Ga0495603_0029746
3697	Ga0495603_0041392
3698	Ga0495603_0062555
3699	Ga0495603_0162744
3700	Ga0495603_0212020
3701	Ga0495590_0061027
3702	Ga0495629_0000320
3703	Ga0495629_0000588
3704	Ga0495629_0001972
3705	Ga0495629_0112059
3706	Ga0495629_0138131
3707	Ga0495629_0169058
3708	Ga0495638_0001094
3709	Ga0495638_0040689
3710	Ga0495638_0054969
3711	Ga0495641_0008426
3712	Ga0495641_0015004
3713	Ga0495641_0064684
3714	Ga0495651_0011341
3715	Ga0495651_0016592
3716	Ga0495651_0027555
3717	Ga0495651_0066310
3718	Ga0495651_0116423
3719	Ga0495651_0196007
3720	Ga0495653_0002188
3721	Ga0495653_0016106
3722	Ga0495653_0022979
3723	Ga0495653_0144596
3724	Ga0495650_0062027
3725	Ga0495650_0095507
3726	Ga0495580_0005073
3727	Ga0495580_0046436
3728	Ga0495580_0290614
3729	Ga0495582_0000043
3730	Ga0495582_0006066
3731	Ga0495639_0000091
3732	Ga0495639_0007375
3733	Ga0495639_0030682
3734	Ga0495639_0083615
3735	Ga0495662_0000128
3736	Ga0495664_0027103
3737	Ga0495664_0039757
3738	Ga0495664_0053277
3739	Ga0495584_0002387
3740	Ga0495584_0048578
3741	Ga0495584_0074191
3742	Ga0495584_0161793
3743	Ga0495585_0008207
3744	Ga0495594_0000453
3745	Ga0495594_0003274
3746	Ga0495594_0155911
3747	Ga0495607_0010697
3748	Ga0495583_0024679
3749	Ga0495606_0000252
3750	Ga0495606_0020289
3751	Ga0495606_0257391
3752	Ga0495608_0030843
3753	Ga0495608_0048520
3754	Ga0495608_0062600
3755	Ga0495608_0229182
3756	Ga0495618_0013046
3757	Ga0495618_0024256
3758	Ga0495618_0063716
3759	Ga0495618_0182599
3760	Ga0495618_0218758
3761	Ga0495620_0038307
3762	Ga0495620_0059303
3763	Ga0495620_0064024
3764	Ga0495628_0000249
3765	Ga0495628_0020336
3766	Ga0495628_0052492
3767	Ga0495628_0059445
3768	Ga0495628_0113838
3769	Ga0495628_0127194
3770	Ga0495630_0044580
3771	Ga0495630_0079935
3772	Ga0495630_0123621
3773	Ga0495632_0079408
3774	Ga0495637_0069636
3775	Ga0495637_0110247
3776	Ga0495643_0004740
3777	Ga0495643_0057943
3778	Ga0495644_0001475
3779	Ga0495648_0000286
3780	Ga0495648_0010274
3781	Ga0495648_0086311
3782	Ga0495666_0035220
3783	Ga0495666_0043942
3784	Ga0495666_0085973
3785	Ga0495652_0013367
3786	Ga0495652_0018347
3787	Ga0495652_0043484
3788	Ga0495652_0064883
3789	Ga0495652_0162932
3790	Ga0495652_0272445
3791	Ga0495652_0327226
3792	Ga0495654_0006037
3793	Ga0495665_0001635
3794	Ga0495665_0074226
3795	Ga0495640_0007459
3796	Ga0495640_0039130
3797	Ga0495640_0059727
3798	Ga0495640_0090769
3799	Ga0495640_0112306
3800	Ga0495586_0070330
3801	Ga0495587_0023867
3802	Ga0495587_0049923
3803	Ga0495587_0113807
3804	Ga0495587_0133906
3805	Ga0495587_0194911
3806	Ga0495587_0199522
3807	Ga0495598_0032901
3808	Ga0495609_0060397
3809	Ga0495645_0001006
3810	Ga0495645_0035369
3811	Ga0495645_0042219
3812	Ga0495645_0146956
3813	Ga0495645_0212630
3814	Ga0495622_0010031
3815	Ga0495622_0013370
3816	Ga0495622_0018113
3817	Ga0495622_0021427
3818	Ga0495622_0055495
3819	Ga0495622_0093736
3820	Ga0495622_0125151
3821	Ga0495633_0006799
3822	Ga0495667_0002652
3823	Ga0495667_0011278
3824	Ga0495667_0045323
3825	Ga0495667_0123867
3826	Ga0495667_0246146
3827	Ga0495656_0000123
3828	Ga0495668_0036116
3829	Ga0495668_0048118
3830	Ga0495634_0021849
3831	Ga0495634_0044652
3832	Ga0495634_0065147
3833	Ga0495634_0142117
3834	Ga0495611_0170607
3835	Ga0495625_0056335
3836	Ga0495625_0094790
3837	Ga0495625_0284297
3838	Ga0495635_0001078
3839	Ga0495635_0001788
3840	Ga0495635_0003088
3841	Ga0495635_0005472
3842	Ga0495635_0006182
3843	Ga0495635_0147977
3844	Ga0495659_0000648
3845	Ga0495661_0155342
3846	Ga0495661_0191664
3847	Ga0495588_0008121
3848	Ga0495588_0024864
3849	Ga0495588_0156479
3850	Ga0495657_0010052
3851	Ga0495657_0012323
3852	Ga0495657_0016857
3853	Ga0495657_0058547
3854	Ga0495657_0089349
3855	Ga0495657_0125671
3856	Ga0495599_0001153
3857	Ga0495599_0012093
3858	Ga0495599_0016129
3859	Ga0495599_0050500
3860	Ga0495623_0004489
3861	Ga0495623_0016469
3862	Ga0495623_0046940
3863	Ga0495623_0093678
3864	Ga0495646_0004178
3865	Ga0495646_0006980
3866	Ga0495646_0230262
3867	Ga0495647_0002969
3868	Ga0495647_0011225
3869	Ga0495647_0021856
3870	Ga0495647_0072507
3871	Ga0495658_0000601
3872	Ga0495658_0002995
3873	Ga0495658_0207842
3874	Ga0495669_0190309
3875	Ga0495613_0001794
3876	Ga0495613_0138626
3877	Ga0495613_0147899
3878	Ga0495624_0000694
3879	Ga0495624_0074674
3880	Ga0495671_0083319
3881	Ga0495671_0171568
3882	Ga0495649_0022117
3883	Ga0495589_0038643
3884	Ga0495589_0042748
3885	Ga0495600_0002039
3886	Ga0495600_0016286
3887	Ga0495600_0019222
3888	Ga0495600_0072547
3889	Ga0495600_0088862
3890	Ga0495660_0052752
3891	Ga0495581_0000486
3892	Ga0495581_0003184
3893	Ga0495581_0052214
3894	Ga0495581_0094007
3895	Ga0495581_0095658
3896	Ga0495581_0134214
3897	Ga0495604_0005947
3898	Ga0495604_0009217
3899	Ga0495604_0010825
3900	Ga0495604_0029213
3901	Ga0495604_0055664
3902	Ga0495604_0221682
3903	Ga0495674_0003925
3904	Ga0495674_0010066
3905	Ga0495674_0037870
3906	Ga0495674_0058274
3907	Ga0495674_0089440
3908	Ga0495674_0094357
3909	Ga0495674_0104383
3910	Ga0495674_0159539
3911	Ga0495672_0025202
3912	Ga0495676_0075429
3913	Ga0495676_0079376
3914	Ga0495676_0084508
3915	Ga0495676_0091661
3916	Ga0495676_0151317
3917	Ga0495680_0000689
3918	Ga0495680_0009034
3919	Ga0495680_0013096
3920	Ga0495680_0015853
3921	Ga0495680_0019326
3922	Ga0495680_0168515
3923	Ga0495683_0020152
3924	Ga0495683_0074095
3925	Ga0495687_007102
3926	Ga0495675_0001437
3927	Ga0495675_0009835
3928	Ga0495675_0015422
3929	Ga0495675_0031708
3930	Ga0495677_0098608
3931	Ga0495677_0099909
3932	Ga0495679_044824
3933	Ga0495673_0045161
3934	Ga0495673_0084624
3935	Ga0495681_0019926
3936	Ga0495681_0122274
3937	Ga0495684_0000313
3938	Ga0495684_0002684
3939	Ga0495684_0020400
3940	Ga0495686_0075227
3941	Ga0495593_0000005
3942	Ga0495593_0000693
3943	Ga0495593_0013264
3944	Ga0495593_0064383
3945	Ga0495602_0002384
3946	Ga0495602_0007244
3947	Ga0495602_0011207
3948	Ga0495602_0037524
3949	Ga0495602_0053983
3950	Ga0495602_0124770
3951	Ga0495602_0270260
3952	Ga0495614_0007962
3953	Ga0496100_0001453
3954	Ga0496100_0004117
3955	Ga0496100_0008582
3956	Ga0496100_0011507
3957	Ga0496100_0048602
3958	Ga0496100_0212649
3959	Ga0496100_0354832
3960	Ga0496101_0000468
3961	Ga0496101_0006584
3962	Ga0496101_0043343
3963	Ga0496101_0105796
3964	Ga0496101_0145379
3965	Ga0496102_0001314
3966	Ga0496102_0021069
3967	Ga0496102_0028200
3968	Ga0496102_0038433
3969	Ga0496102_0093823
3970	Ga0496102_0095293
3971	Ga0496102_0169651
3972	Ga0496102_0328692
3973	Ga0496102_0366786
3974	Ga0496102_0455458
3975	Ga0496102_0483605
3976	Ga0496103_0008659
3977	Ga0496103_0013281
3978	Ga0496103_0014273
3979	Ga0496103_0159200
3980	Ga0496103_0307451
3981	Ga0496104_0000239
3982	Ga0496104_0012293
3983	Ga0496104_0012475
3984	Ga0496104_0072639
3985	Ga0496104_0081494
3986	Ga0496104_0199393
3987	Ga0496104_0214949
3988	Ga0496104_0240495
3989	Ga0496104_0297575
3990	Ga0496104_0491072
3991	Ga0496104_0573957
3992	Ga0496105_0000398
3993	Ga0496105_0000935
3994	Ga0496105_0012329
3995	Ga0496105_0012763
3996	Ga0496105_0025256
3997	Ga0496105_0083297
3998	Ga0496105_0163562
3999	Ga0496105_0206808
4000	Ga0496105_0519852
4001	Ga0496106_0000236
4002	Ga0496106_0001014
4003	Ga0496106_0067463
4004	Ga0496106_0074650
4005	Ga0496106_0088327
4006	Ga0496106_0159746
4007	Ga0496106_0172713
4008	Ga0496106_0181364
4009	Ga0496106_0326600
4010	Ga0496106_0560483
4011	Ga0496107_0000965
4012	Ga0496107_0006262
4013	Ga0496107_0010146
4014	Ga0496107_0011653
4015	Ga0496107_0014083
4016	Ga0496107_0020391
4017	Ga0496107_0023024
4018	Ga0496107_0035286
4019	Ga0496107_0074003
4020	Ga0496107_0144002
4021	Ga0496107_0163028
4022	Ga0496107_0223620
4023	Ga0496107_0427517
4024	Ga0496108_0000849
4025	Ga0496108_0001543
4026	Ga0496108_0005663
4027	Ga0496108_0012923
4028	Ga0496108_0055454
4029	Ga0496108_0062393
4030	Ga0496108_0104083
4031	Ga0496108_0125766
4032	Ga0496108_0351988
4033	Ga0496108_0544743
4034	Ga0496109_0000224
4035	Ga0496109_0000414
4036	Ga0496109_0004282
4037	Ga0496109_0026221
4038	Ga0496109_0075500
4039	Ga0496109_0077160
4040	Ga0496109_0103281
4041	Ga0496109_0112207
4042	Ga0496109_0142097
4043	Ga0496109_0146234
4044	Ga0496109_0410607
4045	Ga0496109_0618655
4046	Ga0496110_0012677
4047	Ga0496110_0025638
4048	Ga0496110_0044581
4049	Ga0496110_0055104
4050	Ga0496110_0093478
4051	Ga0496110_0177587
4052	Ga0496110_0230176
4053	Ga0496110_0330972
4054	Ga0496110_0348751
4055	Ga0496111_0001884
4056	Ga0496111_0031987
4057	Ga0496111_0032982
4058	Ga0496111_0035701
4059	Ga0496111_0193174
4060	Ga0496111_0207838
4061	Ga0496111_0223339
4062	Ga0496111_0245379
4063	Ga0496111_0428158
4064	Ga0496112_0000020
4065	Ga0496112_0001044
4066	Ga0496112_0055429
4067	Ga0496112_0060236
4068	Ga0496112_0085759
4069	Ga0496112_0135786
4070	Ga0496112_0212285
4071	Ga0496112_0342485
4072	Ga0496113_0008868
4073	Ga0496113_0009598
4074	Ga0496113_0025475
4075	Ga0496113_0026173
4076	Ga0496113_0026913
4077	Ga0496113_0036756
4078	Ga0496113_0060373
4079	Ga0496113_0092954
4080	Ga0496113_0110860
4081	Ga0496113_0129462
4082	Ga0496113_0186433
4083	Ga0496114_0005384
4084	Ga0496114_0021424
4085	Ga0496114_0022004
4086	Ga0496114_0023821
4087	Ga0496114_0050674
4088	Ga0496114_0059281
4089	Ga0496114_0659677
4090	Ga0496115_0003980
4091	Ga0496115_0006071
4092	Ga0496115_0008492
4093	Ga0496115_0047342
4094	Ga0496115_0105976
4095	Ga0496115_0108631
4096	Ga0496115_0144741
4097	Ga0496115_0198209
4098	Ga0496115_0231335
4099	Ga0496116_0050598
4100	Ga0496116_0126522
4101	Ga0496117_0017224
4102	Ga0496117_0027455
4103	Ga0496117_0033893
4104	Ga0496117_0219061
4105	Ga0496118_0003026
4106	Ga0496118_0014494
4107	Ga0496118_0025699
4108	Ga0496118_0035791
4109	Ga0496118_0154748
4110	Ga0496119_0025923
4111	Ga0496119_0035726
4112	Ga0496120_0083845
4113	Ga0496120_0086205
4114	Ga0496120_0093327
4115	Ga0496121_0000270
4116	Ga0496121_0000370
4117	Ga0496121_0001039
4118	Ga0496121_0011522
4119	Ga0496121_0019165
4120	Ga0496121_0030770
4121	Ga0496121_0046170
4122	Ga0496121_0070234
4123	Ga0496121_0129567
4124	Ga0496121_0154562
4125	Ga0496121_0314580
4126	Ga0496121_0380837
4127	Ga0496122_0028108
4128	Ga0496122_0049845
4129	Ga0496122_0071551
4130	Ga0496122_0077351
4131	Ga0496122_0093455
4132	Ga0496122_0116276
4133	Ga0496123_0010549
4134	Ga0496123_0041585
4135	Ga0496123_0041888
4136	Ga0496123_0194316
4137	Ga0496124_0036402
4138	Ga0496124_0057421
4139	Ga0496124_0092914
4140	Ga0496124_0104184
4141	Ga0496124_0191797
4142	Ga0496124_0274037
4143	Ga0496124_0304603
4144	Ga0496125_0000328
4145	Ga0496125_0000407
4146	Ga0496125_0023759
4147	Ga0496125_0026887
4148	Ga0496125_0052055
4149	Ga0496125_0057775
4150	Ga0496125_0093298
4151	Ga0496125_0183626
4152	Ga0496126_0002944
4153	Ga0496126_0015944
4154	Ga0496126_0022058
4155	Ga0496126_0026314
4156	Ga0496126_0033530
4157	Ga0496126_0069770
4158	Ga0496126_0073081
4159	Ga0496126_0084695
4160	Ga0496126_0086187
4161	Ga0496126_0119982
4162	Ga0496126_0181126
4163	Ga0496126_0200307
4164	Ga0496126_0216838
4165	Ga0496126_0279367
4166	Ga0496126_0320487
4167	Ga0496126_0391559
4168	Ga0496126_0395003
4169	Ga0496126_0422013
4170	Ga0495682_0027899
4171	Ga0501031_0019691
4172	Ga0501031_0036126
4173	Ga0501032_0000475
4174	Ga0501032_0008230
4175	Ga0501032_0047597
4176	Ga0501032_0077047
4177	Ga0501032_0083346
4178	Ga0501032_0204455
4179	Ga0501032_0225404
4180	Ga0501032_0233681
4181	Ga0501033_0000440
4182	Ga0501033_0001499
4183	Ga0501033_0015169
4184	Ga0501033_0055525
4185	Ga0501033_0089360
4186	Ga0501033_0100724
4187	Ga0501033_0108247
4188	Ga0501033_0110542
4189	Ga0501033_0181846
4190	Ga0501033_0183877
4191	Ga0501033_0232590
4192	Ga0501034_0000250
4193	Ga0501034_0000286
4194	Ga0501034_0016008
4195	Ga0501034_0017998
4196	Ga0501034_0086116
4197	Ga0501034_0282544
4198	Ga0501034_0317717
4199	Ga0501036_0000098
4200	Ga0501036_0000118
4201	Ga0501036_0039965
4202	Ga0501036_0041038
4203	Ga0501036_0056697
4204	Ga0501036_0061100
4205	Ga0501036_0118974
4206	Ga0501036_0138010
4207	Ga0501037_0000092
4208	Ga0501037_0006812
4209	Ga0501037_0010464
4210	Ga0501037_0038799
4211	Ga0501037_0045631
4212	Ga0501037_0105157
4213	Ga0501037_0173603
4214	Ga0501037_0191107
4215	Ga0501038_0000059
4216	Ga0501038_0003448
4217	Ga0501038_0006869
4218	Ga0501038_0045822
4219	Ga0501038_0053622
4220	Ga0501038_0073971
4221	Ga0501038_0245348
4222	Ga0501038_0389701
4223	Ga0501038_0446136
4224	Ga0501039_0000085
4225	Ga0501039_0031807
4226	Ga0501039_0039138
4227	Ga0501039_0041308
4228	Ga0501039_0056725
4229	Ga0501039_0087620
4230	Ga0501042_0023911
4231	Ga0501042_0063966
4232	Ga0501042_0493882
4233	Ga0501043_0001889
4234	Ga0501043_0004952
4235	Ga0501043_0012702
4236	Ga0501043_0022014
4237	Ga0501043_0035424
4238	Ga0501043_0057515
4239	Ga0501043_0093310
4240	Ga0501043_0103540
4241	Ga0501043_0127740
4242	Ga0501043_0140231
4243	Ga0501043_0160047
4244	Ga0501043_0195367
4245	Ga0501043_0352222
4246	Ga0501043_0473485
4247	Ga0501046_0000483
4248	Ga0501046_0050847
4249	Ga0501046_0075433
4250	Ga0501046_0101818
4251	Ga0501046_0173337
4252	Ga0501046_0233967
4253	Ga0501046_0450610
4254	Ga0501047_0000022
4255	Ga0501047_0000097
4256	Ga0501047_0035421
4257	Ga0501047_0082864
4258	Ga0501047_0094732
4259	Ga0501047_0105578
4260	Ga0501047_0126511
4261	Ga0501047_0197121
4262	Ga0501047_0197426
4263	Ga0501047_0199409
4264	Ga0501047_0301859
4265	Ga0501047_0338192
4266	Ga0501047_0472768
4267	Ga0501048_0000522
4268	Ga0501048_0000821
4269	Ga0501048_0004230
4270	Ga0501048_0333172
4271	Ga0501067_0000510
4272	Ga0501067_0014598
4273	Ga0501067_0047604
4274	Ga0501067_0093305
4275	Ga0501067_0094982
4276	Ga0501067_0095935
4277	Ga0501067_0255904
4278	Ga0501068_0001239
4279	Ga0501068_0006616
4280	Ga0501068_0025351
4281	Ga0501068_0045541
4282	Ga0501068_0097120
4283	Ga0501069_0000707
4284	Ga0501069_0040743
4285	Ga0501070_0005840
4286	Ga0501070_0037509
4287	Ga0501070_0039631
4288	Ga0501070_0055323
4289	Ga0501070_0065590
4290	Ga0501070_0067214
4291	Ga0501070_0104832
4292	Ga0501070_0210199
4293	Ga0501070_0212749
4294	Ga0501070_0221258
4295	Ga0501070_0252643
4296	Ga0501070_0345001
4297	Ga0501070_0469856
4298	Ga0501070_0484606
4299	Ga0501071_0015263
4300	Ga0501071_0102548
4301	Ga0501071_0108813
4302	Ga0501071_0179113
4303	Ga0501071_0293036
4304	Ga0501072_0001923
4305	Ga0501072_0043896
4306	Ga0501072_0314070
4307	Ga0501073_0000955
4308	Ga0501073_0031647
4309	Ga0501073_0072009
4310	Ga0501073_0202072
4311	Ga0501073_0343440
4312	Ga0501074_0002275
4313	Ga0501074_0006843
4314	Ga0501074_0028474
4315	Ga0501074_0031430
4316	Ga0501074_0042683
4317	Ga0501074_0059730
4318	Ga0501074_0061940
4319	Ga0501076_0224081
4320	Ga0501076_0574203
4321	Ga0501077_0103504
4322	Ga0501079_0003103
4323	Ga0501079_0055474
4324	Ga0501079_0199560
4325	Ga0501079_0242586
4326	Ga0501080_0000047
4327	Ga0501080_0009878
4328	Ga0501080_0022030
4329	Ga0501080_0031264
4330	Ga0501080_0037799
4331	Ga0501080_0049324
4332	Ga0501080_0065376
4333	Ga0501080_0075608
4334	Ga0501080_0079680
4335	Ga0501080_0123108
4336	Ga0501080_0203918
4337	Ga0501081_0055518
4338	Ga0501081_0241692
4339	Ga0501081_0330208
4340	Ga0501083_0000808
4341	Ga0501083_0007229
4342	Ga0501083_0013360
4343	Ga0501083_0045709
4344	Ga0501083_0059138
4345	Ga0501083_0063302
4346	Ga0501083_0135591
4347	Ga0501083_0157872
4348	Ga0501083_0208181
4349	Ga0501035_0000240
4350	Ga0501035_0001276
4351	Ga0501035_0005844
4352	Ga0501035_0008993
4353	Ga0501035_0080808
4354	Ga0501035_0167522
4355	Ga0501035_0211585
4356	Ga0501035_0258695
4357	Ga0501035_0333829
4358	Ga0501044_0000072
4359	Ga0501044_0000122
4360	Ga0501044_0025318
4361	Ga0501044_0047773
4362	Ga0501044_0056754
4363	Ga0501044_0058319
4364	Ga0501044_0065427
4365	Ga0501044_0097979
4366	Ga0501044_0187642
4367	Ga0501044_0193433
4368	Ga0501044_0278162
4369	Ga0501044_0282993
4370	Ga0501044_0392472
4371	Ga0501045_0027715
4372	Ga0501045_0165744
4373	Ga0501045_0276571
4374	nmdc:mga03683_163888_c1
4375	nmdc:mga03683_42133_c1
4376	nmdc:mga03683_57061_c1
4377	nmdc:mga03683_79303_c1
4378	nmdc:mga03n38_19891_c1
4379	nmdc:mga03n38_42929_c1
4380	nmdc:mga03n38_5778_c1
4381	nmdc:mga00v17_15563_c1
4382	nmdc:mga00v17_36286_c1
4383	nmdc:mga0yw44_147214_c1
4384	nmdc:mga0yw44_2639_c1
4385	nmdc:mga0yw44_46826_c1
4386	nmdc:mga0yw44_95715_c1
4387	nmdc:mga0k408_21946_c1
4388	nmdc:mga0k408_252332_c1
4389	nmdc:mga0k408_261781_c1
4390	nmdc:mga0k408_30659_c1
4391	nmdc:mga0k408_39149_c1
4392	nmdc:mga0k408_59277_c1
4393	nmdc:mga06z11_160880_c1
4394	nmdc:mga06z11_2466_c1
4395	nmdc:mga04h51_14665_c1
4396	nmdc:mga07m45_15602_c1
4397	nmdc:mga07m45_31423_c1
4398	nmdc:mga07m45_32616_c1
4399	nmdc:mga07m45_35038_c1
4400	nmdc:mga07m45_43662_c1
4401	nmdc:mga07m45_68239_c1
4402	nmdc:mga05p37_10573_c1
4403	nmdc:mga05p37_151024_c1
4404	nmdc:mga05p37_36662_c1
4405	nmdc:mga05p37_863_c1
4406	nmdc:mga09592_1701_c1
4407	nmdc:mga0qj67_1189_c1
4408	nmdc:mga0qj67_445_c1
4409	nmdc:mga06r32_6584_c1
4410	nmdc:mga08y16_128308_c1
4411	nmdc:mga08y16_13856_c1
4412	nmdc:mga08y16_179101_c1
4413	nmdc:mga08y16_2133_c1
4414	nmdc:mga08y16_21765_c1
4415	nmdc:mga08y16_644738_c1
4416	nmdc:mga08y16_78483_c1
4417	nmdc:mga0n895_26341_c1
4418	nmdc:mga0n895_2738_c1
4419	nmdc:mga0n895_332932_c1
4420	nmdc:mga0n895_427_c1
4421	nmdc:mga0n895_55_c1
4422	nmdc:mga0rr50_15797_c1
4423	nmdc:mga0rr50_272144_c1
4424	nmdc:mga0rr50_81453_c1
4425	nmdc:mga0a205_2491_c1
4426	nmdc:mga0a205_62861_c1
4427	nmdc:mga0sz30_58435_c1
4428	Ga0495601_0001987
4429	Ga0495601_0002133
4430	Ga0495601_0017401
4431	Ga0495601_0018323
4432	Ga0495601_0023764
4433	Ga0495601_0035959
4434	Ga0495601_0079528
4435	Ga0495601_0315763
4436	Ga0495612_0000243
4437	Ga0495612_0004160
4438	Ga0495612_0108765
4439	Ga0500610_0149213
4440	Ga0495595_0003024
4441	Ga0495595_0008950
4442	Ga0495595_0009151
4443	Ga0495595_0010093
4444	Ga0495595_0023372
4445	Ga0495595_0034011
4446	Ga0495595_0145200
4447	Ga0495619_0000139
4448	Ga0495619_0000330
4449	Ga0495619_0001222
4450	Ga0495619_0001830
4451	Ga0495619_0012438
4452	Ga0495619_0028591
4453	Ga0495619_0038733
4454	Ga0495619_0056307
4455	Ga0495619_0143799
4456	Ga0495619_0201845
4457	Ga0500643_000063
4458	Ga0500644_0108270
4459	Ga0500581_090861
4460	Ga0500646_0007427
4461	Ga0500647_0028092
4462	Ga0500583_0030333
4463	Ga0500651_0005704
4464	Ga0500651_0007402
4465	Ga0500651_0094553
4466	Ga0500566_0000151
4467	Ga0500566_0000236
4468	Ga0500566_0000247
4469	Ga0500566_0015485
4470	Ga0500641_0006119
4471	Ga0500641_0011386
4472	Ga0500641_0018450
4473	Ga0500641_0021622
4474	Ga0500641_0218273
4475	Ga0500650_0004779
4476	Ga0500650_0097644
4477	Ga0500650_0101342
4478	Ga0500650_0106935
4479	Ga0500554_002974
4480	Ga0500554_110457
4481	Ga0500556_0000006
4482	Ga0500557_000037
4483	Ga0500569_004907
4484	Ga0500569_030594
4485	Ga0500569_090435
4486	Ga0500572_001270
4487	Ga0500592_000189
4488	Ga0500592_008283
4489	Ga0500593_022901
4490	Ga0500595_005148
4491	Ga0500595_006181
4492	Ga0500595_007015
4493	Ga0500595_012681
4494	Ga0500595_013452
4495	Ga0500595_013641
4496	Ga0500595_023699
4497	Ga0500607_023497
4498	Ga0500607_026533
4499	Ga0500608_004120
4500	Ga0500608_017789
4501	Ga0500608_021338
4502	Ga0500642_0000004
4503	Ga0500642_0000062
4504	Ga0500642_0003645
4505	Ga0500652_000555
4506	Ga0500652_007548
4507	Ga0500655_037189
4508	Ga0500658_0063629
4509	Ga0500559_0000179
4510	Ga0500559_0006133
4511	Ga0500559_0015873
4512	Ga0500568_0003071
4513	Ga0500568_0014034
4514	Ga0500568_0016646
4515	Ga0500568_0024462
4516	Ga0500568_0030451
4517	Ga0500568_0039632
4518	Ga0500573_0112425
4519	Ga0500577_0000470
4520	Ga0500577_0080270
4521	Ga0500586_002011
4522	Ga0500588_0018770
4523	Ga0500588_0023611
4524	Ga0500588_0094409
4525	Ga0500590_032675
4526	Ga0500616_0000022
4527	Ga0500616_0003813
4528	Ga0500616_0073671
4529	Ga0500620_010224
4530	Ga0500622_0025609
4531	Ga0500622_0033524
4532	Ga0500622_0063226
4533	Ga0500627_0007472
4534	Ga0500627_0037129
4535	Ga0500627_0130371
4536	Ga0500634_0018999
4537	Ga0500634_0175359
4538	Ga0500638_000539
4539	Ga0500638_058426
4540	Ga0500639_182872
4541	Ga0500636_0000349
4542	Ga0500636_0002876
4543	Ga0500637_0023445
4544	Ga0500637_0083261
4545	Ga0500625_001277
4546	Ga0500609_005039
4547	Ga0500596_000909
4548	Ga0500596_004995
4549	Ga0500601_000601
4550	Ga0501084_0026071
4551	Ga0501084_0064354
4552	Ga0501084_0854191
4553	Ga0500661_000348
4554	Ga0501082_0001185
4555	Ga0501082_0018750
4556	Ga0501082_0074667
4557	Ga0501082_0098506
4558	Ga0501082_0198013
4559	Ga0501082_0494549
4560	Ga0466962_0081670
4561	Ga0466962_0083641
4562	2507505238
4563	2508539159
4564	2508695477
4565	2509152626
4566	2511395425
4567	2513625338
4568	2513644157
4569	2513651523
4570	2513658806
4571	2513674595
4572	2513695103
4573	2513706029
4574	2513720311
4575	2513860813
4576	2513873535
4577	2513888759
4578	2513921070
4579	2514012478
4580	2515627435
4581	2517107718
4582	2517888835
4583	2524440897
4584	2524467841
4585	2524537061
4586	2528852930
4587	2603858518
4588	2617352391
4589	2617373753
4590	2643757991
4591	2644730968
4592	2644734838
4593	2644746486
4594	2671119951
4595	2723841635
4596	2728754982
4597	2745081681
4598	2793062035
4599	2793072923
4600	2793082757
4601	2805915619
4602	2818237642
4603	2819722257
4604	2824604592
4605	2824612317
4606	2824624492
4607	2824633407
4608	2824640296
4609	2824647270
4610	2824655182
4611	2824669694
4612	2824676632
4613	2824684067
4614	2824694694
4615	2824703826
4616	2824708936
4617	2824717414
4618	2824727623
4619	2824739858
4620	2824752551
4621	2824759963
4622	2824770397
4623	2824775529
4624	2838124506
4625	2841765000
4626	2841945192
4627	2841951974
4628	2841965427
4629	2841970631
4630	2841979980
4631	2841985159
4632	2842043517
4633	2842052493
4634	2844107552
4635	2844315329
4636	2847931065
4637	2847942148
4638	2849083028
4639	2851183701
4640	2851249658
4641	2857511917
4642	2857526360
4643	2874594438
4644	2874608071
4645	2874613443
4646	2874624774
4647	2874628802
4648	2874649811
4649	2876768920
4650	2876773930
4651	2876815512
4652	2876821810
4653	2879078346
4654	2879085899
4655	2879108556
4656	2879112164
4657	2879130607
4658	2879147116
4659	2881365325
4660	2881668192
4661	2885371035
4662	2885376147
4663	2885388836
4664	2885411669
4665	2888379601
4666	2888390689
4667	2888420314
4668	2889035498
4669	2893067370
4670	2903732190
4671	2903748962
4672	2903770769
4673	2904670271
4674	2904691198
4675	2904708817
4676	2904713171
4677	2906604267
4678	2906613866
4679	2906628964
4680	2906642340
4681	2906649386
4682	2906667368
4683	2908747436
4684	2908756594
4685	2908776270
4686	2917703041
4687	2919073792
4688	2922364007
4689	2922368944
4690	2922392559
4691	2922394232
4692	2922434232
4693	2929618593
4694	2929628722
4695	2932792915
4696	2932794324
4697	2932808082
4698	2932812174
4699	2932823164
4700	2932836080
4701	2933580695
4702	2935615733
4703	2935618513
4704	2935635519
4705	2935641086
4706	2935653649
4707	2935662398
4708	2935670002
4709	2935679149
4710	2935690016
4711	2935698536
4712	2935711472
4713	2935717535
4714	2935723795
4715	2935740004
4716	2935749267
4717	2935757370
4718	2935763544
4719	2935773051
4720	2935782994
4721	2935787960
4722	2935796464
4723	2935809966
4724	2935816272
4725	2935825469
4726	2935835665
4727	2935844616
4728	2935853258
4729	2935862938
4730	2935866680
4731	2935874987
4732	2935890142
4733	2935914731
4734	2935918707
4735	2935931576
4736	2935940173
4737	2935947480
4738	2935956252
4739	2935962629
4740	2935973045
4741	2935980711
4742	2935985135
4743	2935999737
4744	2936010565
4745	2936016700
4746	2936025333
4747	2936034175
4748	2936041277
4749	2936052232
4750	2936056307
4751	2940563283
4752	2941512184
4753	2941519886
4754	2941528173
4755	2941535522
4756	2941543199
4757	3005475054
4758	3005489077
4759	3005509167
4760	3005592218
4761	3005595043
4762	3005710991
4763	3005718296
4764	8006927883
4765	8006936242
4766	8006969353
4767	8006976187
4768	8006990915
4769	8006996518
4770	8016518191
4771	8016526130
4772	8016539742
4773	8016544046
4774	8016549261
4775	8016557686
4776	8016569450
4777	8016582064
4778	8016595719
4779	8016606575
4780	8016618476
4781	8016623168
4782	8016635637
4783	8017058457
4784	8019531018
4785	8019540563
4786	8019550184
4787	8019562402
4788	8019572472
4789	8019577239
4790	8019595319
4791	8019606439
4792	8019612088
4793	8019622962
4794	8019640467
4795	8019666978
4796	8019676735
4797	8019679256
4798	8019696249
4799	8055742443
4800	8056675736
4801	8056687401
4802	8056690951
4803	8056971281
4804	8057532968

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03618

Kinase-PPPase

Kinase/pyrophosphorylase

53

302

0.98 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
7qsq-assembly2.cif.gz_B	permutated n-terminal lobe of the ribose binding protein from thermotoga maritima	0.7552	8	91
1qnl-assembly1.cif.gz_A	amide receptor/negative regulator of the amidase operon of pseudomonas aeruginosa (amic) complexed with butyramide	0.7042	9	91
1qo0-assembly1.cif.gz_B	amide receptor of the amidase operon of pseudomonas aeruginosa (amic) complexed with the negative regulator amir.	0.6942	6	91
5x0o-assembly2.cif.gz_F	regulatory domain of aphb treated with cumene hydroperoxide from vibrio vulnificus	0.686	5	42
5mmh-assembly4.cif.gz_D-5	the x-ray structure of the effector domain of the transcriptional regulator ampr of pseudomonas aeruginosa	0.6817	5	42

ID	Description	Score	Start	End	Superfamily
af_Q69NA5_27_147_3.40.50.2300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator	0.7423	7	91	3.40.50.2300
af_A0A1D6EQP7_1_152_3.40.50.2300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator	0.7413	6	91	3.40.50.2300
af_P77269_27_144_3.40.50.2300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator	0.736	5	91	3.40.50.2300
af_Q69L11_28_153_3.40.50.2300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator	0.7327	4	91	3.40.50.2300
4wutA01	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator	0.7216	9	91	3.40.50.2300

ID	Description	Score	Start	End	GO Terms
AF-A0A519XS76-F1-model_v4	deleted	1.001	4	68
AF-A0A5K1HQ78-F1-model_v4	Phosphoenolpyruvate synthase regulatory protein	1	3	78	GO:0004674 GO:0005524
AF-A0A7Y4K261-F1-model_v4	Kinase/pyrophosphorylase	0.9931	1	83	GO:0004674 GO:0005524
AF-A0A520ELB6-F1-model_v4	deleted	0.987	6	85
AF-A0A528PA80-F1-model_v4	deleted	0.9859	5	104

F496779

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF03618

Kinase-PPPase

Kinase/pyrophosphorylase

53

302

0.98

Structural Annotation

Top 5 Hits

Map