F496791

General Info

Members Datasets Scaffolds Average Seq Length
2415 802 4830 432

Family's Representative Sequence

Representative Sequence 3300038725|Ga0400484_09450|Ga0400484_09450_21486_22931
Length 481
Sequence LTALSKLTPGKAQQRFDTSPQAGTRQLNNNQIVVPGNNPAHIDGTGTMSEINQLSTANNDFWKRLDQLLAWESVSDAGINDTVNQVIRDVRAKGDAALIDFTYRFDRWQAQSTADLEIPPERLEQAWKAIPAEQREALQISANRINAYAEHQIMDSWNYTEPDGTLLGQQVTPLERVGLYVPGGKAAYPSSVLMNAIPAKVAGVGELIMVVPTPNGEANELVLAAAHVSNIDRVFAIGGAQAVAALAYGTESIPPVDKIVGPGNIYVASAKRAVFGQVGIDMVAGPSEILIICDGETNPDWIAMDLFSQAEHDEDAQSILVCPDAAFIGHVSASIDRLLPTMERREIIKTSLQARGALIHVKDMDEAVEVANHIAPEHLELSVANPLDLAKRIKHAGAIFMGRHTAEAMGDYCAGPNHVLPTSRTARFSSPLGVYDFQKRSSLIMASPEGADTLAHTSSVMARGEGLTAHARSAEFRFKPE

Samples

Sample ID Description Type Environment
1 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
8 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
9 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
10 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
11 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
12 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
13 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
14 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
15 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
16 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
17 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
18 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
19 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
20 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
21 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
22 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
23 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
24 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
25 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
26 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
27 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
28 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
29 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
30 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
31 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
32 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
33 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
34 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
35 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
36 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
37 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
38 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
39 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
40 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
41 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
42 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
43 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
44 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
45 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
46 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
47 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
48 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
49 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
50 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
51 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
52 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
53 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
54 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
55 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
56 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
57 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
58 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
59 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
60 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
61 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
62 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
63 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
64 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
65 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
66 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
67 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
68 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
69 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
70 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
71 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
72 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
73 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
74 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
75 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
76 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
77 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
78 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
79 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
80 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
81 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
82 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
83 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
84 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
85 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
86 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
87 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
88 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
89 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
90 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
91 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
92 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
93 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
94 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
95 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
96 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
97 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
98 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
99 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
100 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
101 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
102 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
103 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
104 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
105 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
106 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
107 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
108 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
109 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
110 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
111 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
112 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
113 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
114 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
115 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
116 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
117 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
118 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
119 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
120 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
121 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
122 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
123 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
124 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
125 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
126 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
127 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
128 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
129 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
130 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
131 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
132 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
133 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
134 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
135 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
136 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
137 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
138 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
139 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
140 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
141 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
142 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
143 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
144 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
145 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
146 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
147 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
148 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
149 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
150 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
151 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
152 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
153 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
154 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
155 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
156 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
157 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
158 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
159 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
160 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
161 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
162 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
163 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
164 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
165 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
166 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
167 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
168 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
169 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
170 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
171 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
172 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
173 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
174 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
175 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
176 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
177 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
178 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
184 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
185 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
186 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
187 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
188 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
189 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
190 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
191 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
192 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
193 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
194 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
195 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
196 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
197 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
198 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
199 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
200 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
201 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
202 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
203 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
204 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
205 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
206 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
270 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
271 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
272 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
273 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
274 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
275 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
276 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
277 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
278 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
280 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
281 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
282 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
283 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
284 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
285 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
286 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
287 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
288 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
289 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
290 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
291 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
292 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
293 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
294 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
295 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
296 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
297 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
298 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
299 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
300 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
301 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
302 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
303 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
304 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
305 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
306 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
307 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
308 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
309 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
310 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
311 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
312 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
313 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
314 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
315 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
316 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
317 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
318 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
319 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
320 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
321 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
322 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
323 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
324 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
325 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
326 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
327 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
328 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
329 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
330 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
331 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
332 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
333 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
334 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
335 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
336 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
337 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
338 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
339 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
340 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
341 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
342 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
343 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
344 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
345 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
346 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
347 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
348 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
349 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
350 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
351 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
352 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
353 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
354 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
355 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
356 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
357 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
358 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
359 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
360 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
361 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
362 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
363 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
364 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
365 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
366 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
367 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
368 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
369 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
370 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
371 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
372 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
373 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
374 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
375 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
376 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
377 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
378 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
379 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
380 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
381 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
382 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
383 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
384 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
385 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
386 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
387 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
388 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
389 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
390 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
391 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
392 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
393 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
394 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
395 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
396 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
397 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
398 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
399 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
400 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
401 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
402 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
403 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
404 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
405 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
406 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
407 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
408 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
409 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
410 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
411 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
412 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
413 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
414 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
415 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
416 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
417 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
418 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
419 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
420 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
421 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
422 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
423 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
424 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
425 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
426 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
427 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
428 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
429 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
430 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
431 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
432 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
433 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
434 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
435 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
436 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
437 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
438 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
439 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
440 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
441 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
442 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
443 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
444 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
445 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
446 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
447 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
448 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
449 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
450 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
451 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
452 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
453 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
454 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
455 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
456 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
457 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
458 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
459 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
460 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
461 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
462 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
463 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
464 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
465 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
466 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
467 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
468 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
469 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
470 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
471 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
472 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
473 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
474 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
475 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
476 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
477 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
478 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
479 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
480 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
481 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
482 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
483 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
484 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
485 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
486 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
487 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
488 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
489 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
490 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
491 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
492 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
493 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
494 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
495 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
496 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
497 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
498 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
499 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
500 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
501 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
502 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
503 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
504 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
505 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
506 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
507 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
508 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
509 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
510 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
511 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
512 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
513 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
514 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
515 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
516 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
517 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
518 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
519 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
520 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
521 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
522 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
523 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
524 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
525 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
526 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
527 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
528 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
529 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
530 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
531 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
532 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
533 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
534 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
535 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
536 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
537 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
538 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
539 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
540 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
541 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
542 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
543 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
544 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
545 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
546 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
547 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
548 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
549 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
550 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
551 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
552 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
553 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
554 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
555 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
556 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
557 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
558 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
559 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
560 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
561 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
562 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
563 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
564 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
565 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
566 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
567 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
568 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
569 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
570 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
571 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
572 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
573 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
574 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
575 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
576 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
577 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
578 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
579 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
580 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
581 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
582 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
583 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
584 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
585 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
586 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
587 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
588 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
589 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
590 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
591 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
592 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
593 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
594 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
595 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
596 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
597 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
598 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
599 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
600 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
601 2519103095 Burkholderia sp. KJ006 Isolate Nodule
602 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
603 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
604 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
605 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
606 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
607 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
608 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
609 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
610 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
611 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
612 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
613 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
614 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
615 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
616 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
617 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
618 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
619 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
620 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
621 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
622 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
623 2643221556 Massilia sp. Root1485 Isolate Unclassified
624 2643221569 Achromobacter sp. Root565 Isolate Unclassified
625 2643221594 Achromobacter sp. Root170 Isolate Unclassified
626 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
627 2643221621 Achromobacter sp. Root83 Isolate Unclassified
628 2643221645 Massilia sp. Root351 Isolate Unclassified
629 2643221664 Massilia sp. Root418 Isolate Unclassified
630 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
631 2643221684 Massilia sp. Root133 Isolate Unclassified
632 2643221733 Bosea sp. Root381 Isolate Unclassified
633 2643221734 Bosea sp. Root670 Isolate Unclassified
634 2671180694 Paenibacillus sp. A3 Isolate Unclassified
635 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
636 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
637 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
638 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
639 2738541280 Massilia sp. GV090 Isolate Unclassified
640 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
641 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
642 2738541297 Duganella sp. GV083 Isolate Unclassified
643 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
644 2738541300 Massilia sp. GV016 Isolate Unclassified
645 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
646 2738541357 Duganella sp. GV053 Isolate Unclassified
647 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
648 2738543003 Duganella sp. GV066 Isolate Unclassified
649 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
650 2738543018 Massilia sp. GV045 Isolate Unclassified
651 2738543026 Duganella sp. GV089 Isolate Unclassified
652 2738543029 Duganella sp. GV039 Isolate Unclassified
653 2738543030 Massilia sp. GV097 Isolate Unclassified
654 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
655 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
656 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
657 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
658 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
659 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
660 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
661 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
662 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
663 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
664 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
665 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
666 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
667 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
668 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
669 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
670 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
671 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
672 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
673 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
674 2818991436 Collimonas arenae 515 Isolate Unclassified
675 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
676 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
677 2818991450 Burkholderia sp. 604 Isolate Unclassified
678 2818991452 Burkholderia cepacia 561 Isolate Unclassified
679 2818991459 Paenibacillus sp. 597 Isolate Unclassified
680 2818991467 Bosea vestrisii 3192 Isolate Unclassified
681 2821131069 Duganella sp. 1224 Isolate Unclassified
682 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
683 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
684 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
685 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
686 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
687 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
688 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
689 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
690 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
691 2842711865 Duganella sp. R-73148 Isolate Unclassified
692 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
693 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
694 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
695 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
696 2855730933 Achromobacter sp. HZ28 Isolate Nodule
697 2855767633 Achromobacter sp. HZ34 Isolate Nodule
698 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
699 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
700 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
701 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
702 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
703 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
704 2857553236 Duganella sp. R-74557 Isolate Unclassified
705 2857558681 Duganella sp. R-74565 Isolate Unclassified
706 2857564685 Duganella sp. R-74599 Isolate Unclassified
707 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
708 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
709 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
710 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
711 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
712 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
713 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
714 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
715 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
716 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
717 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
718 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
719 2885266251 Ralstonia sp. SET104 Isolate Nodule
720 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
721 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
722 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
723 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
724 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
725 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
726 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
727 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
728 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
729 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
730 2902330777 Methylobacterium sp. 2A Isolate Unclassified
731 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
732 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
733 2904424332 Duganella sp. 1411 Isolate Rhizosphere
734 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
735 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
736 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
737 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
738 2904564687 Burkholderia sp. 571 Isolate Unclassified
739 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
740 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
741 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
742 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
743 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
744 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
745 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
746 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
747 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
748 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
749 2919476304 Duganella sp. 3397 Isolate Unclassified
750 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
751 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
752 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
753 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
754 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
755 2928058823 Ralstonia sp. 1138 Isolate Unclassified
756 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
757 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
758 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
759 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
760 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
761 2928163908 Burkholderia sp. 567 Isolate Unclassified
762 2928170801 Burkholderia sp. 572 Isolate Unclassified
763 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
764 2928536128 Burkholderia sola 565 Isolate Unclassified
765 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
766 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
767 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
768 2941479691
769 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
770 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
771 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
772 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
773 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
774 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
775 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
776 641522639 Methylobacterium sp. 4-46 Isolate Nodule
777 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
778 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
779 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
780 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
781 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
782 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
783 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
784 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
785 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
786 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
787 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
788 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
789 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
790 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
791 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
792 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
793 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
794 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
795 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
796 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified
797 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
798 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere
799 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
800 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule
801 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified
802 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 90.02
Metatranscriptomes 0.83
Isolates 9.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.25
Nodule 1.61
Rhizoplane 2.94
Rhizosphere 76.23
Stem 0
Stem Tuber 0
Unclassified 0.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0400484_09450 3300038725 Bacteria 51957
2 JGI24741J21665_1000028 3300001915 Bacteria 34664
3 JGI24740J21852_10000135 3300001979 Bacteria 28041
4 JGI24740J21852_10000985 3300001979 Bacteria 12731
5 JGI24740J21852_10001768 3300001979 Bacteria 9916
6 JGI24740J21852_10001853 3300001979 Bacteria 9683
7 JGI24739J22299_10001122 3300001989 Bacteria 9981
8 JGI24739J22299_10001794 3300001989 Bacteria 8170
9 JGI24739J22299_10040400 3300001989 Bacteria 1557
10 JGI24737J22298_10002512 3300001990 Bacteria 6511
11 JGI24737J22298_10023652 3300001990 Bacteria 1948
12 JGI24735J21928_10000235 3300002067 Bacteria 19503
13 JGI24735J21928_10000566 3300002067 Bacteria 12974
14 JGI24735J21928_10001052 3300002067 Bacteria 9890
15 JGI24751J29686_10000074 3300002459 Bacteria 56035
16 JGI25155J39150_1000252 3300002704 Bacteria 20486
17 JGI25155J39150_1000471 3300002704 Bacteria 10080
18 JGI25156J39149_1000288 3300002705 Bacteria 33984
19 JGI25156J39149_1002224 3300002705 Bacteria 7180
20 JGI25162J39368_1000040 3300002737 Bacteria 175938
21 JGI25154J39366_1000311 3300002738 Bacteria 28175
22 JGI25154J39366_1000313 3300002738 Bacteria 28101
23 JGI25154J39366_1000782 3300002738 Bacteria 14066
24 JGI25154J39366_1000843 3300002738 Bacteria 13310
25 JGI25157J39369_1000171 3300002741 Bacteria 54600
26 JGI25152J39213_1005962 3300002773 Bacteria 3425
27 JGI25151J46595_10000018 3300003187 Bacteria 238438
28 JGI25151J46595_10000121 3300003187 Bacteria 106308
29 JGI25151J46595_10001594 3300003187 Bacteria 15066
30 JGI25151J46595_10002578 3300003187 Bacteria 10722
31 JGI25151J46595_10004715 3300003187 Bacteria 7166
32 JGI25165J46597_1000051 3300003214 Bacteria 241012
33 JGI25165J46597_1000794 3300003214 Bacteria 23941
34 JGI25165J46597_1002173 3300003214 Bacteria 6998
35 JGI25153J46596_10001401 3300003215 Bacteria 14444
36 JGI25153J46596_10009739 3300003215 Bacteria 4419
37 rootL2_10004552 3300003322 Bacteria 16584
38 JGI25160J50197_1000146 3300003354 Bacteria 63378
39 Ga0007409J51694_1048233 3300003575 Bacteria 4403
40 Ga0006562J51391_1104371 3300003578 Bacteria 2500
41 Ga0006562J51391_1104372 3300003578 Bacteria 2395
42 Ga0055538_1000025 3300003751 Bacteria 241012
43 Ga0055538_1000038 3300003751 Bacteria 186588
44 Ga0055539_1000032 3300003752 Bacteria 241012
45 Ga0055539_1000049 3300003752 Bacteria 186588
46 Ga0055539_1000218 3300003752 Bacteria 40999
47 Ga0055533_1000042 3300003756 Bacteria 241012
48 Ga0055533_1000060 3300003756 Bacteria 186588
49 Ga0055533_1000476 3300003756 Bacteria 15060
50 Ga0055533_1002544 3300003756 Bacteria 4087
51 Ga0055532_1000044 3300003758 Bacteria 191110
52 Ga0055532_1000066 3300003758 Bacteria 139987
53 Ga0055532_1000092 3300003758 Bacteria 103243
54 Ga0055525_1000028 3300003759 Bacteria 331683
55 Ga0055525_1000050 3300003759 Bacteria 241012
56 Ga0055525_1000068 3300003759 Bacteria 186588
57 Ga0055525_1001589 3300003759 Bacteria 3668
58 Ga0055527_1000035 3300003760 Bacteria 138481
59 Ga0055527_1000754 3300003760 Bacteria 9044
60 Ga0055527_1000965 3300003760 Bacteria 7064
61 Ga0055527_1001071 3300003760 Bacteria 6487
62 Ga0055535_1000046 3300003761 Bacteria 139987
63 Ga0055535_1000050 3300003761 Bacteria 138481
64 Ga0055535_1003356 3300003761 Bacteria 4596
65 Ga0055535_1003379 3300003761 Bacteria 4574
66 Ga0055542_1000120 3300003762 Bacteria 103243
67 Ga0055542_1000632 3300003762 Bacteria 29602
68 Ga0055542_1003203 3300003762 Bacteria 4596
69 Ga0055542_1003219 3300003762 Bacteria 4574
70 Ga0055529_1000015 3300003763 Bacteria 366950
71 Ga0055529_1000087 3300003763 Bacteria 139975
72 Ga0055529_1000089 3300003763 Bacteria 138481
73 Ga0055529_1001095 3300003763 Bacteria 12204
74 Ga0055529_1001970 3300003763 Bacteria 4596
75 Ga0055526_1000007 3300003771 Bacteria 321998
76 Ga0055526_1009468 3300003771 Bacteria 4677
77 Ga0055526_1009857 3300003771 Bacteria 4532
78 Ga0055524_1000071 3300003775 Bacteria 127466
79 Ga0055524_1000274 3300003775 Bacteria 51286
80 Ga0055524_1000669 3300003775 Bacteria 24026
81 Ga0055524_1021269 3300003775 Bacteria 2156
82 Ga0055536_1000176 3300003781 Bacteria 53490
83 Ga0055534_1001271 3300003784 Bacteria 10271
84 Ga0055528_1018811 3300003790 Bacteria 2324
85 Ga0055541_1000023 3300003841 Bacteria 241012
86 Ga0055541_1000036 3300003841 Bacteria 186588
87 Ga0055541_1000458 3300003841 Bacteria 11711
88 Ga0058692_1002468 3300003856 Bacteria 6173
89 Ga0058692_1010540 3300003856 Bacteria 2280
90 Ga0065165_1000648 3300005262 Bacteria 50260
91 Ga0065165_1002291 3300005262 Bacteria 16790
92 Ga0065704_10144545 3300005289 Bacteria 1484
93 Ga0070658_10017827 3300005327 Bacteria 5678
94 Ga0070676_10014765 3300005328 Bacteria 4297
95 Ga0070683_100004403 3300005329 Bacteria 11599
96 Ga0070683_100262842 3300005329 Bacteria 1642
97 Ga0070690_100003115 3300005330 Bacteria 9026
98 Ga0070690_100012327 3300005330 Bacteria 5028
99 Ga0070670_100001763 3300005331 Bacteria 17603
100 Ga0070670_100003096 3300005331 Bacteria 13758
101 Ga0070670_100046852 3300005331 Bacteria 3719
102 Ga0070677_10000813 3300005333 Bacteria 10321
103 Ga0068869_100000446 3300005334 Bacteria 22625
104 Ga0068869_100007899 3300005334 Bacteria 6831
105 Ga0070666_10019706 3300005335 Bacteria 4358
106 Ga0070666_10025072 3300005335 Bacteria 3886
107 Ga0070680_100093239 3300005336 Bacteria 2495
108 Ga0068868_100002308 3300005338 Bacteria 13196
109 Ga0070660_100000025 3300005339 Bacteria 90277
110 Ga0070660_100000555 3300005339 Bacteria 25061
111 Ga0070660_100058207 3300005339 Bacteria 2995
112 Ga0070660_100069739 3300005339 Bacteria 2742
113 Ga0070689_100000418 3300005340 Bacteria 25038
114 Ga0070689_100007131 3300005340 Bacteria 7790
115 Ga0070691_10001956 3300005341 Bacteria 9058
116 Ga0070691_10031686 3300005341 Bacteria 2481
117 Ga0070661_100000262 3300005344 Bacteria 43135
118 Ga0070661_100003077 3300005344 Bacteria 11478
119 Ga0070661_100022926 3300005344 Bacteria 4472
120 Ga0070661_100023346 3300005344 Bacteria 4432
121 Ga0070661_100083219 3300005344 Bacteria 2363
122 Ga0070692_10003660 3300005345 Bacteria 6286
123 Ga0070692_10005189 3300005345 Bacteria 5521
124 Ga0070692_10089118 3300005345 Bacteria 1674
125 Ga0070668_100047399 3300005347 Bacteria 3304
126 Ga0070669_100063913 3300005353 Bacteria 2710
127 Ga0070675_100000225 3300005354 Bacteria 36121
128 Ga0070671_100000251 3300005355 Bacteria 35949
129 Ga0070674_100008627 3300005356 Bacteria 6075
130 Ga0070674_100032693 3300005356 Bacteria 3456
131 Ga0070674_100207937 3300005356 Bacteria 1515
132 Ga0070673_100001157 3300005364 Bacteria 15159
133 Ga0070688_100017362 3300005365 Bacteria 4129
134 Ga0070659_100000264 3300005366 Bacteria 41481
135 Ga0070659_100005724 3300005366 Bacteria 8949
136 Ga0070659_100018272 3300005366 Bacteria 5292
137 Ga0070659_100024551 3300005366 Bacteria 4621
138 Ga0070659_100028472 3300005366 Bacteria 4315
139 Ga0070667_100005918 3300005367 Bacteria 10183
140 Ga0070667_100010109 3300005367 Bacteria 7807
141 Ga0070667_100138871 3300005367 Bacteria 2126
142 Ga0070709_10032908 3300005434 Bacteria 3131
143 Ga0070709_10060409 3300005434 Bacteria 2409
144 Ga0070714_100002634 3300005435 Bacteria 13211
145 Ga0070714_100016095 3300005435 Bacteria 6029
146 Ga0070714_100033094 3300005435 Bacteria 4319
147 Ga0070713_100000035 3300005436 Bacteria 86284
148 Ga0070713_100000699 3300005436 Bacteria 21563
149 Ga0070713_100021844 3300005436 Bacteria 4933
150 Ga0070710_10003231 3300005437 Bacteria 7717
151 Ga0070701_10000095 3300005438 Bacteria 24800
152 Ga0070711_100000407 3300005439 Bacteria 22299
153 Ga0070711_100003667 3300005439 Bacteria 8982
154 Ga0070705_100009619 3300005440 Bacteria 4811
155 Ga0070700_100000343 3300005441 Bacteria 23981
156 Ga0070694_100017725 3300005444 Bacteria 4501
157 Ga0070694_100052922 3300005444 Bacteria 2746
158 Ga0070708_100018970 3300005445 Bacteria 5767
159 Ga0070663_100000023 3300005455 Bacteria 111250
160 Ga0070663_100000091 3300005455 Bacteria 40975
161 Ga0070663_100018911 3300005455 Bacteria 4528
162 Ga0070678_100001056 3300005456 Bacteria 14362
163 Ga0070678_100008251 3300005456 Bacteria 6231
164 Ga0070678_100311948 3300005456 Bacteria 1340
165 Ga0070662_100014777 3300005457 Bacteria 5219
166 Ga0070662_100043911 3300005457 Bacteria 3200
167 Ga0070681_10003149 3300005458 Bacteria 15336
168 Ga0070681_10004550 3300005458 Bacteria 13226
169 Ga0068867_100000224 3300005459 Bacteria 37294
170 Ga0068867_100005285 3300005459 Bacteria 9121
171 Ga0068867_100034493 3300005459 Bacteria 3667
172 Ga0070685_10014673 3300005466 Bacteria 4153
173 Ga0070706_100105102 3300005467 Bacteria 2627
174 Ga0070706_100207345 3300005467 Bacteria 1830
175 Ga0070707_100022518 3300005468 Bacteria 5957
176 Ga0070707_100044175 3300005468 Bacteria 4265
177 Ga0070698_100134475 3300005471 Bacteria 2427
178 Ga0070699_100097436 3300005518 Bacteria 2576
179 Ga0070679_100026821 3300005530 Bacteria 5665
180 Ga0070679_100185686 3300005530 Bacteria 2050
181 Ga0070684_100020251 3300005535 Bacteria 5518
182 Ga0070684_100091791 3300005535 Bacteria 2702
183 Ga0070697_100254432 3300005536 Bacteria 1502
184 Ga0068853_100018211 3300005539 Bacteria 5811
185 Ga0068853_100028137 3300005539 Bacteria 4726
186 Ga0068853_100042863 3300005539 Bacteria 3871
187 Ga0068853_100097112 3300005539 Bacteria 2600
188 Ga0068853_100110226 3300005539 Bacteria 2444
189 Ga0070672_100001370 3300005543 Bacteria 15037
190 Ga0070686_100000448 3300005544 Bacteria 25484
191 Ga0070695_100003128 3300005545 Bacteria 9642
192 Ga0070695_100027169 3300005545 Bacteria 3544
193 Ga0070695_100039811 3300005545 Bacteria 2973
194 Ga0070693_100000709 3300005547 Bacteria 14685
195 Ga0070693_100009225 3300005547 Bacteria 4901
196 Ga0070665_100003736 3300005548 Bacteria 16125
197 Ga0070665_100046243 3300005548 Bacteria 4372
198 Ga0070665_100083376 3300005548 Bacteria 3201
199 Ga0070704_100006821 3300005549 Bacteria 6761
200 Ga0070704_100016987 3300005549 Bacteria 4615
201 Ga0070704_100254582 3300005549 Bacteria 1444
202 Ga0068855_100000063 3300005563 Bacteria 131058
203 Ga0068855_100001111 3300005563 Bacteria 33458
204 Ga0068855_100011143 3300005563 Bacteria 10855
205 Ga0068855_100016221 3300005563 Bacteria 8958
206 Ga0068855_100037461 3300005563 Bacteria 5766
207 Ga0068855_100050415 3300005563 Bacteria 4905
208 Ga0068855_100088577 3300005563 Bacteria 3575
209 Ga0068855_100152259 3300005563 Bacteria 2629
210 Ga0068855_100170592 3300005563 Bacteria 2464
211 Ga0068855_100204000 3300005563 Bacteria 2225
212 Ga0068855_100284926 3300005563 Bacteria 1833
213 Ga0068855_100353016 3300005563 Bacteria 1620
214 Ga0070664_100000018 3300005564 Bacteria 125281
215 Ga0070664_100000527 3300005564 Bacteria 29170
216 Ga0070664_100026949 3300005564 Bacteria 4773
217 Ga0070664_100064884 3300005564 Bacteria 3115
218 Ga0070664_100169374 3300005564 Bacteria 1937
219 Ga0068857_100000878 3300005577 Bacteria 22684
220 Ga0068857_100001732 3300005577 Bacteria 17547
221 Ga0068857_100012916 3300005577 Bacteria 7276
222 Ga0068854_100000172 3300005578 Bacteria 43732
223 Ga0068854_100000716 3300005578 Bacteria 19611
224 Ga0068854_100001495 3300005578 Bacteria 14165
225 Ga0068854_100007750 3300005578 Bacteria 6865
226 Ga0068856_100000070 3300005614 Bacteria 95320
227 Ga0068856_100049897 3300005614 Bacteria 4125
228 Ga0068856_100172549 3300005614 Bacteria 2175
229 Ga0070702_100000034 3300005615 Bacteria 36812
230 Ga0068852_100001050 3300005616 Bacteria 18205
231 Ga0068852_100010880 3300005616 Bacteria 6817
232 Ga0068852_100019452 3300005616 Bacteria 5374
233 Ga0068852_100035944 3300005616 Bacteria 4140
234 Ga0068852_100037854 3300005616 Bacteria 4049
235 Ga0068852_100046357 3300005616 Bacteria 3704
236 Ga0068852_100089829 3300005616 Bacteria 2746
237 Ga0068852_100247472 3300005616 Bacteria 1707
238 Ga0068859_100019681 3300005617 Bacteria 6779
239 Ga0068859_100040898 3300005617 Bacteria 4656
240 Ga0068859_100056821 3300005617 Bacteria 3941
241 Ga0068859_100081974 3300005617 Bacteria 3268
242 Ga0068859_100123069 3300005617 Bacteria 2661
243 Ga0068859_100436594 3300005617 Bacteria 1405
244 Ga0068864_100077758 3300005618 Bacteria 2903
245 Ga0068866_10000071 3300005718 Bacteria 40521
246 Ga0068866_10002533 3300005718 Bacteria 7525
247 Ga0068866_10009792 3300005718 Bacteria 4084
248 Ga0068861_100000604 3300005719 Bacteria 21267
249 Ga0068851_10007523 3300005834 Bacteria 5006
250 Ga0068863_100000366 3300005841 Bacteria 45953
251 Ga0068863_100013027 3300005841 Bacteria 8018
252 Ga0068863_100113402 3300005841 Bacteria 2582
253 Ga0068858_100000890 3300005842 Bacteria 31011
254 Ga0068858_100001410 3300005842 Bacteria 24676
255 Ga0068858_100008616 3300005842 Bacteria 9798
256 Ga0068858_100018178 3300005842 Bacteria 6585
257 Ga0068858_100030788 3300005842 Bacteria 4984
258 Ga0068858_100036319 3300005842 Bacteria 4569
259 Ga0068858_100059820 3300005842 Bacteria 3521
260 Ga0068860_100057742 3300005843 Bacteria 3689
261 Ga0068860_100084803 3300005843 Bacteria 3013
262 Ga0068860_100134521 3300005843 Bacteria 2374
263 Ga0068860_100149898 3300005843 Bacteria 2245
264 Ga0068862_100001545 3300005844 Bacteria 21055
265 Ga0081455_10005372 3300005937 Bacteria 14067
266 Ga0081455_10039290 3300005937 Bacteria 4184
267 Ga0081455_10057061 3300005937 Bacteria 3311
268 Ga0081540_1035371 3300005983 Bacteria 2679
269 Ga0070717_10012887 3300006028 Bacteria 6386
270 Ga0070717_10068979 3300006028 Bacteria 2943
271 Ga0075363_100016046 3300006048 Bacteria 3694
272 Ga0075364_10000064 3300006051 Bacteria 40534
273 Ga0075364_10029406 3300006051 Bacteria 3524
274 Ga0075432_10002316 3300006058 Bacteria 6338
275 Ga0070715_10004316 3300006163 Bacteria 4644
276 Ga0070712_100000722 3300006175 Bacteria 19490
277 Ga0070712_100002168 3300006175 Bacteria 12074
278 Ga0070712_100047388 3300006175 Bacteria 2974
279 Ga0075366_10020670 3300006195 Bacteria 3822
280 Ga0097621_100005613 3300006237 Bacteria 8850
281 Ga0097621_100006216 3300006237 Bacteria 8467
282 Ga0068871_100002762 3300006358 Bacteria 11988
283 Ga0068871_100062498 3300006358 Bacteria 3043
284 Ga0075428_100010059 3300006844 Bacteria 10510
285 Ga0075428_100014827 3300006844 Bacteria 8662
286 Ga0075428_100097404 3300006844 Bacteria 3207
287 Ga0075430_100013770 3300006846 Bacteria 6890
288 Ga0075431_100008339 3300006847 Bacteria 10365
289 Ga0075431_100289425 3300006847 Unclassified 1657
290 Ga0075434_100006422 3300006871 Bacteria 10772
291 Ga0075434_100012989 3300006871 Bacteria 7910
292 Ga0075434_100087664 3300006871 Bacteria 3113
293 Ga0075429_100020613 3300006880 Bacteria 5721
294 Ga0068865_100000179 3300006881 Bacteria 35156
295 Ga0075436_100064772 3300006914 Bacteria 2527
296 Ga0097620_100019680 3300006931 Bacteria 6779
297 Ga0097620_100040898 3300006931 Bacteria 4656
298 Ga0097620_100056818 3300006931 Bacteria 3941
299 Ga0097620_100081973 3300006931 Bacteria 3268
300 Ga0097620_100123077 3300006931 Bacteria 2661
301 Ga0097620_100436596 3300006931 Bacteria 1405
302 Ga0079104_1025647 3300006946 Bacteria 1536
303 Ga0099826_10000008 3300006948 Bacteria 380974
304 Ga0075435_100005128 3300007076 Bacteria 9105
305 Ga0075435_100021557 3300007076 Bacteria 4957
306 Ga0099794_10003043 3300007265 Bacteria 6334
307 Ga0105251_10000781 3300009011 Bacteria 28894
308 Ga0105251_10030439 3300009011 Bacteria 2711
309 Ga0105244_10000412 3300009036 Bacteria 39755
310 Ga0105244_10002472 3300009036 Bacteria 13911
311 Ga0105250_10019362 3300009092 Bacteria 2752
312 Ga0105240_10001628 3300009093 Bacteria 38096
313 Ga0105240_10004505 3300009093 Bacteria 21177
314 Ga0105240_10008072 3300009093 Bacteria 15128
315 Ga0105240_10014398 3300009093 Bacteria 10800
316 Ga0105240_10026536 3300009093 Bacteria 7600
317 Ga0105240_10036146 3300009093 Bacteria 6356
318 Ga0105240_10049065 3300009093 Bacteria 5331
319 Ga0105240_10050170 3300009093 Bacteria 5263
320 Ga0105240_10167293 3300009093 Bacteria 2607
321 Ga0105240_10175626 3300009093 Bacteria 2532
322 Ga0105240_10281268 3300009093 Bacteria 1911
323 Ga0105240_10364410 3300009093 Bacteria 1636
324 Ga0111539_10001003 3300009094 Bacteria 36985
325 Ga0111539_10001740 3300009094 Bacteria 28934
326 Ga0111539_10023826 3300009094 Bacteria 7522
327 Ga0111539_10184513 3300009094 Bacteria 2437
328 Ga0111539_10277488 3300009094 Bacteria 1950
329 Ga0105245_10000414 3300009098 Bacteria 39803
330 Ga0105245_10019563 3300009098 Bacteria 5931
331 Ga0105245_10031107 3300009098 Bacteria 4721
332 Ga0105245_10033212 3300009098 Bacteria 4572
333 Ga0105245_10051279 3300009098 Bacteria 3699
334 Ga0105245_10229029 3300009098 Bacteria 1797
335 Ga0105247_10003683 3300009101 Bacteria 9946
336 Ga0105247_10187974 3300009101 Bacteria 1381
337 Ga0114129_10023892 3300009147 Bacteria 8662
338 Ga0114129_10026898 3300009147 Bacteria 8144
339 Ga0105243_10000212 3300009148 Bacteria 67614
340 Ga0105243_10003672 3300009148 Bacteria 12336
341 Ga0105243_10007161 3300009148 Bacteria 8575
342 Ga0105243_10009503 3300009148 Bacteria 7402
343 Ga0105243_10140555 3300009148 Bacteria 2059
344 Ga0105243_10251554 3300009148 Bacteria 1578
345 Ga0105241_10005901 3300009174 Bacteria 9037
346 Ga0105241_10008396 3300009174 Bacteria 7599
347 Ga0105241_10071497 3300009174 Bacteria 2694
348 Ga0105241_10121397 3300009174 Bacteria 2105
349 Ga0105241_10129749 3300009174 Bacteria 2039
350 Ga0105241_10144510 3300009174 Bacteria 1940
351 Ga0105242_10000291 3300009176 Bacteria 39986
352 Ga0105242_10002769 3300009176 Bacteria 13718
353 Ga0105242_10017081 3300009176 Bacteria 5650
354 Ga0105242_10093218 3300009176 Bacteria 2539
355 Ga0105248_10009132 3300009177 Bacteria 10905
356 Ga0105248_10022233 3300009177 Bacteria 7032
357 Ga0105248_10153443 3300009177 Bacteria 2598
358 Ga0105248_10211875 3300009177 Bacteria 2183
359 Ga0105237_10011515 3300009545 Bacteria 9358
360 Ga0105237_10019528 3300009545 Bacteria 7000
361 Ga0105237_10030536 3300009545 Bacteria 5472
362 Ga0105237_10063263 3300009545 Bacteria 3698
363 Ga0105237_10210769 3300009545 Bacteria 1943
364 Ga0105238_10000037 3300009551 Bacteria 163954
365 Ga0105238_10001851 3300009551 Bacteria 21208
366 Ga0105238_10004242 3300009551 Bacteria 14244
367 Ga0105238_10023626 3300009551 Bacteria 6264
368 Ga0105238_10095395 3300009551 Bacteria 2962
369 Ga0105238_10103822 3300009551 Bacteria 2823
370 Ga0105238_10194327 3300009551 Bacteria 2005
371 Ga0105238_10250040 3300009551 Bacteria 1751
372 Ga0105249_10009785 3300009553 Bacteria 8399
373 Ga0105249_10052709 3300009553 Bacteria 3716
374 Ga0105249_10069787 3300009553 Bacteria 3243
375 Ga0105239_10000341 3300010375 Bacteria 68230
376 Ga0105239_10003694 3300010375 Bacteria 18647
377 Ga0105239_10007578 3300010375 Bacteria 12443
378 Ga0105239_10013346 3300010375 Bacteria 9128
379 Ga0105239_10029649 3300010375 Bacteria 6016
380 Ga0105239_10030147 3300010375 Bacteria 5964
381 Ga0105239_10042962 3300010375 Bacteria 4953
382 Ga0105239_10071393 3300010375 Bacteria 3815
383 Ga0105239_10081249 3300010375 Bacteria 3567
384 Ga0105239_10200220 3300010375 Bacteria 2237
385 Ga0105246_10025706 3300011119 Bacteria 3840
386 Ga0157373_10010458 3300013100 Bacteria 6827
387 Ga0157373_10029055 3300013100 Bacteria 3986
388 Ga0157373_10085134 3300013100 Bacteria 2228
389 Ga0157371_10000003 3300013102 Bacteria 543317
390 Ga0157371_10000275 3300013102 Bacteria 69649
391 Ga0157370_10000237 3300013104 Bacteria 70247
392 Ga0157370_10003818 3300013104 Bacteria 17571
393 Ga0157370_10003874 3300013104 Bacteria 17428
394 Ga0157370_10006761 3300013104 Bacteria 12580
395 Ga0157370_10011180 3300013104 Bacteria 9412
396 Ga0157370_10013934 3300013104 Bacteria 8256
397 Ga0157370_10014165 3300013104 Bacteria 8175
398 Ga0157370_10016731 3300013104 Bacteria 7420
399 Ga0157370_10072687 3300013104 Bacteria 3245
400 Ga0157370_10175382 3300013104 Bacteria 1993
401 Ga0157369_10000147 3300013105 Bacteria 100084
402 Ga0157369_10000872 3300013105 Bacteria 38509
403 Ga0157369_10002777 3300013105 Bacteria 20906
404 Ga0157369_10010146 3300013105 Bacteria 10749
405 Ga0157369_10013337 3300013105 Bacteria 9294
406 Ga0157369_10028956 3300013105 Bacteria 6126
407 Ga0157369_10075837 3300013105 Bacteria 3605
408 Ga0157369_10093041 3300013105 Bacteria 3218
409 Ga0157369_10100949 3300013105 Bacteria 3076
410 Ga0157369_10224692 3300013105 Bacteria 1964
411 Ga0171462_1015 3300013250 Bacteria 169578
412 Ga0157374_10000251 3300013296 Bacteria 49614
413 Ga0157374_10003456 3300013296 Bacteria 13270
414 Ga0157374_10007595 3300013296 Bacteria 9253
415 Ga0157378_10001356 3300013297 Bacteria 22016
416 Ga0157378_10004479 3300013297 Bacteria 12266
417 Ga0157378_10166924 3300013297 Bacteria 2062
418 Ga0163162_10005470 3300013306 Bacteria 12276
419 Ga0163162_10016362 3300013306 Bacteria 7249
420 Ga0163162_10048431 3300013306 Bacteria 4258
421 Ga0163162_10106770 3300013306 Bacteria 2895
422 Ga0163162_10113332 3300013306 Bacteria 2810
423 Ga0163162_10217482 3300013306 Bacteria 2041
424 Ga0163162_10297869 3300013306 Bacteria 1745
425 Ga0163162_10478940 3300013306 Bacteria 1376
426 Ga0157372_10000307 3300013307 Bacteria 54398
427 Ga0157372_10000323 3300013307 Bacteria 52602
428 Ga0157372_10161904 3300013307 Bacteria 2586
429 Ga0157375_10004551 3300013308 Bacteria 12049
430 Ga0157375_10118417 3300013308 Bacteria 2755
431 Ga0157375_10121256 3300013308 Bacteria 2724
432 Ga0163163_10000015 3300014325 Bacteria 214881
433 Ga0163163_10000773 3300014325 Bacteria 27136
434 Ga0163163_10074103 3300014325 Bacteria 3395
435 Ga0163163_10074732 3300014325 Bacteria 3382
436 Ga0182008_10008961 3300014497 Bacteria 5424
437 Ga0182008_10018700 3300014497 Bacteria 3586
438 Ga0182008_10089778 3300014497 Bacteria 1514
439 Ga0157377_10005094 3300014745 Bacteria 6142
440 Ga0157379_10001728 3300014968 Bacteria 18073
441 Ga0157379_10003216 3300014968 Bacteria 13843
442 Ga0157379_10008253 3300014968 Bacteria 9048
443 Ga0157379_10045291 3300014968 Bacteria 3927
444 Ga0157376_10137748 3300014969 Bacteria 2186
445 Ga0182006_1000023 3300015261 Bacteria 275031
446 Ga0182006_1000125 3300015261 Bacteria 82143
447 Ga0182006_1000649 3300015261 Bacteria 24690
448 Ga0182006_1010511 3300015261 Bacteria 4112
449 Ga0182007_10000082 3300015262 Bacteria 71660
450 Ga0182007_10000738 3300015262 Bacteria 18494
451 Ga0182007_10000932 3300015262 Bacteria 16098
452 Ga0182007_10009056 3300015262 Bacteria 4048
453 Ga0182007_10026017 3300015262 Bacteria 2033
454 Ga0182005_1000006 3300015265 Bacteria 515188
455 Ga0182005_1000047 3300015265 Bacteria 126754
456 Ga0182005_1005516 3300015265 Bacteria 3945
457 Ga0183361_10015 3300016635 Bacteria 166772
458 Ga0163161_10002855 3300017792 Bacteria 12252
459 Ga0163161_10047226 3300017792 Bacteria 3110
460 Ga0163161_10189363 3300017792 Bacteria 1581
461 Ga0197907_11373382 3300020069 Bacteria 2061
462 Ga0206356_11205717 3300020070 Bacteria 3217
463 Ga0206351_10335588 3300020077 Bacteria 14215
464 Ga0206353_10079450 3300020082 Bacteria 2901
465 Ga0213872_10000024 3300021361 Bacteria 155437
466 Ga0213872_10000344 3300021361 Bacteria 39221
467 Ga0213872_10000532 3300021361 Bacteria 29832
468 Ga0213872_10001257 3300021361 Bacteria 17069
469 Ga0213872_10006253 3300021361 Bacteria 6014
470 Ga0213872_10008476 3300021361 Bacteria 4974
471 Ga0213872_10013257 3300021361 Bacteria 3865
472 Ga0213872_10014575 3300021361 Bacteria 3666
473 Ga0213872_10015809 3300021361 Bacteria 3506
474 Ga0213872_10027484 3300021361 Bacteria 2611
475 Ga0213872_10027840 3300021361 Bacteria 2593
476 Ga0213872_10033048 3300021361 Bacteria 2371
477 Ga0213872_10038666 3300021361 Bacteria 2177
478 Ga0213872_10042567 3300021361 Bacteria 2070
479 Ga0213876_10001149 3300021384 Bacteria 16763
480 Ga0213876_10012610 3300021384 Bacteria 4497
481 Ga0213876_10022715 3300021384 Bacteria 3315
482 Ga0213876_10036297 3300021384 Bacteria 2600
483 Ga0213875_10000124 3300021388 Bacteria 86711
484 Ga0213875_10000865 3300021388 Bacteria 22360
485 Ga0213875_10007591 3300021388 Bacteria 5593
486 Ga0213875_10024619 3300021388 Bacteria 2869
487 Ga0224712_10000002 3300022467 Bacteria 45137
488 Ga0209435_100004 3300025206 Bacteria 633417
489 Ga0209435_100168 3300025206 Bacteria 20495
490 Ga0209784_100010 3300025224 Bacteria 683664
491 Ga0209784_100021 3300025224 Bacteria 408534
492 Ga0209784_100052 3300025224 Bacteria 182783
493 Ga0209784_100807 3300025224 Bacteria 7281
494 Ga0209566_100008 3300025225 Bacteria 683664
495 Ga0209566_100039 3300025225 Bacteria 303368
496 Ga0209566_100068 3300025225 Bacteria 177484
497 Ga0209566_100235 3300025225 Bacteria 53611
498 Ga0209566_100312 3300025225 Bacteria 43942
499 Ga0209566_101794 3300025225 Bacteria 4993
500 Ga0209674_100019 3300025226 Bacteria 683664
501 Ga0209674_100036 3300025226 Bacteria 408534
502 Ga0209674_100087 3300025226 Bacteria 182783
503 Ga0209674_100153 3300025226 Bacteria 94333
504 Ga0209674_100296 3300025226 Bacteria 34844
505 Ga0209674_101200 3300025226 Bacteria 7400
506 Ga0209672_100054 3300025228 Bacteria 222217
507 Ga0209672_100072 3300025228 Bacteria 167942
508 Ga0209672_100073 3300025228 Bacteria 166621
509 Ga0209672_100308 3300025228 Bacteria 32831
510 Ga0209672_103908 3300025228 Bacteria 2918
511 Ga0209147_100011 3300025229 Bacteria 702140
512 Ga0209147_100085 3300025229 Bacteria 185813
513 Ga0209147_100090 3300025229 Bacteria 176176
514 Ga0209147_100093 3300025229 Bacteria 167196
515 Ga0209147_100100 3300025229 Bacteria 162747
516 Ga0209563_100011 3300025230 Bacteria 1187808
517 Ga0209563_100021 3300025230 Bacteria 683764
518 Ga0209563_100040 3300025230 Bacteria 408534
519 Ga0209563_100108 3300025230 Bacteria 143470
520 Ga0209563_102096 3300025230 Bacteria 4711
521 Ga0207427_100432 3300025231 Bacteria 23437
522 Ga0207427_101304 3300025231 Bacteria 9393
523 Ga0209437_100019 3300025233 Bacteria 683764
524 Ga0209437_100207 3300025233 Bacteria 112147
525 Ga0209258_100130 3300025242 Bacteria 176078
526 Ga0209258_100140 3300025242 Bacteria 167245
527 Ga0209258_100168 3300025242 Bacteria 145329
528 Ga0209258_100279 3300025242 Bacteria 86008
529 Ga0209258_100397 3300025242 Bacteria 54750
530 Ga0207425_1000176 3300025245 Bacteria 52680
531 Ga0209646_1000119 3300025246 Bacteria 147427
532 Ga0209646_1000125 3300025246 Bacteria 135847
533 Ga0209646_1000140 3300025246 Bacteria 111155
534 Ga0209646_1000205 3300025246 Bacteria 69450
535 Ga0209026_1000066 3300025250 Bacteria 207691
536 Ga0209026_1002319 3300025250 Bacteria 7236
537 Ga0209026_1002536 3300025250 Bacteria 6754
538 Ga0209677_100011 3300025253 Bacteria 683664
539 Ga0209677_100023 3300025253 Bacteria 408534
540 Ga0209677_100043 3300025253 Bacteria 222331
541 Ga0209677_102613 3300025253 Bacteria 6566
542 Ga0209148_1000119 3300025254 Bacteria 188079
543 Ga0209148_1000140 3300025254 Bacteria 166819
544 Ga0209148_1000451 3300025254 Bacteria 45012
545 Ga0209148_1000470 3300025254 Bacteria 42979
546 Ga0209759_1000114 3300025256 Bacteria 142233
547 Ga0209759_1000281 3300025256 Bacteria 71594
548 Ga0209759_1000329 3300025256 Bacteria 62253
549 Ga0209759_1000961 3300025256 Bacteria 20401
550 Ga0209759_1001269 3300025256 Bacteria 15203
551 Ga0209759_1001696 3300025256 Bacteria 11450
552 Ga0209759_1004527 3300025256 Bacteria 5149
553 Ga0209759_1018227 3300025256 Bacteria 1702
554 Ga0209233_1000025 3300025261 Bacteria 683764
555 Ga0209233_1000173 3300025261 Bacteria 145995
556 Ga0209565_1000727 3300025263 Bacteria 19804
557 Ga0209565_1004441 3300025263 Bacteria 4262
558 Ga0209455_1000031 3300025272 Bacteria 519952
559 Ga0209455_1000119 3300025272 Bacteria 174994
560 Ga0209455_1000125 3300025272 Bacteria 166819
561 Ga0209455_1000217 3300025272 Bacteria 80610
562 Ga0209455_1002842 3300025272 Bacteria 6428
563 Ga0209455_1007044 3300025272 Bacteria 3229
564 Ga0209455_1008304 3300025272 Bacteria 2833
565 Ga0209673_1000098 3300025273 Bacteria 193352
566 Ga0209675_1000684 3300025291 Bacteria 23603
567 Ga0209675_1001176 3300025291 Bacteria 15864
568 Ga0209675_1002424 3300025291 Bacteria 9606
569 Ga0209676_1000331 3300025292 Bacteria 90857
570 Ga0209676_1006101 3300025292 Bacteria 6052
571 Ga0209025_1000010 3300025294 Bacteria 986612
572 Ga0209025_1000019 3300025294 Bacteria 631548
573 Ga0209025_1000485 3300025294 Bacteria 76825
574 Ga0209025_1000823 3300025294 Bacteria 49464
575 Ga0209025_1000853 3300025294 Bacteria 48270
576 Ga0209025_1001173 3300025294 Bacteria 37118
577 Ga0209025_1003577 3300025294 Bacteria 14530
578 Ga0209025_1041469 3300025294 Bacteria 1971
579 Ga0209564_1000010 3300025295 Bacteria 885399
580 Ga0209564_1000019 3300025295 Bacteria 573686
581 Ga0209564_1000034 3300025295 Bacteria 444284
582 Ga0209564_1000042 3300025295 Bacteria 392805
583 Ga0209564_1001559 3300025295 Bacteria 22537
584 Ga0209564_1003986 3300025295 Bacteria 9373
585 Ga0209758_1000085 3300025297 Bacteria 256191
586 Ga0209758_1000433 3300025297 Bacteria 70750
587 Ga0209758_1013994 3300025297 Bacteria 4312
588 Ga0209050_1011606 3300025298 Bacteria 4151
589 Ga0209256_1000018 3300025299 Bacteria 568467
590 Ga0209256_1000026 3300025299 Bacteria 432835
591 Ga0209256_1000473 3300025299 Bacteria 60415
592 Ga0209256_1000612 3300025299 Bacteria 49490
593 Ga0209256_1000802 3300025299 Bacteria 40206
594 Ga0207426_1000199 3300025302 Bacteria 145826
595 Ga0207426_1005650 3300025302 Bacteria 5656
596 Ga0209051_1007632 3300025303 Bacteria 5884
597 Ga0207697_10014221 3300025315 Bacteria 3306
598 Ga0207656_10009058 3300025321 Bacteria 3689
599 Ga0207696_1014759 3300025711 Bacteria 2668
600 Ga0207655_1001385 3300025728 Bacteria 22650
601 Ga0207655_1001828 3300025728 Bacteria 18397
602 Ga0207713_1000186 3300025735 Bacteria 87336
603 Ga0207713_1002620 3300025735 Bacteria 12942
604 Ga0207682_10003933 3300025893 Bacteria 6345
605 Ga0207682_10005718 3300025893 Bacteria 5042
606 Ga0207692_10036741 3300025898 Bacteria 2391
607 Ga0207642_10001746 3300025899 Bacteria 6707
608 Ga0207642_10009765 3300025899 Bacteria 3351
609 Ga0207710_10027105 3300025900 Bacteria 2479
610 Ga0207688_10000664 3300025901 Bacteria 16982
611 Ga0207680_10003660 3300025903 Bacteria 7223
612 Ga0207680_10045685 3300025903 Bacteria 2584
613 Ga0207680_10055462 3300025903 Bacteria 2388
614 Ga0207647_10000126 3300025904 Bacteria 59628
615 Ga0207647_10002757 3300025904 Bacteria 13254
616 Ga0207647_10006995 3300025904 Bacteria 8180
617 Ga0207647_10007378 3300025904 Bacteria 7949
618 Ga0207647_10020622 3300025904 Bacteria 4416
619 Ga0207685_10004166 3300025905 Bacteria 3634
620 Ga0207645_10003270 3300025907 Bacteria 12373
621 Ga0207705_10005316 3300025909 Bacteria 9636
622 Ga0207705_10014561 3300025909 Bacteria 5659
623 Ga0207684_10039330 3300025910 Bacteria 4012
624 Ga0207684_10045540 3300025910 Bacteria 3720
625 Ga0207684_10204320 3300025910 Bacteria 1704
626 Ga0207654_10015780 3300025911 Bacteria 3926
627 Ga0207707_10031089 3300025912 Bacteria 4671
628 Ga0207707_10046693 3300025912 Bacteria 3772
629 Ga0207695_10000003 3300025913 Bacteria 1368691
630 Ga0207695_10004822 3300025913 Bacteria 18234
631 Ga0207695_10005837 3300025913 Bacteria 16189
632 Ga0207695_10007348 3300025913 Bacteria 14059
633 Ga0207695_10016358 3300025913 Bacteria 8681
634 Ga0207695_10021117 3300025913 Bacteria 7436
635 Ga0207695_10032163 3300025913 Bacteria 5744
636 Ga0207695_10038543 3300025913 Bacteria 5143
637 Ga0207695_10049269 3300025913 Bacteria 4442
638 Ga0207695_10056616 3300025913 Bacteria 4078
639 Ga0207695_10084787 3300025913 Bacteria 3198
640 Ga0207671_10015181 3300025914 Bacteria 6048
641 Ga0207671_10015712 3300025914 Bacteria 5917
642 Ga0207671_10019071 3300025914 Bacteria 5254
643 Ga0207693_10000364 3300025915 Bacteria 41420
644 Ga0207693_10006630 3300025915 Bacteria 9563
645 Ga0207693_10016693 3300025915 Bacteria 5864
646 Ga0207693_10074868 3300025915 Bacteria 2651
647 Ga0207693_10179569 3300025915 Bacteria 1665
648 Ga0207663_10006677 3300025916 Bacteria 5931
649 Ga0207660_10020915 3300025917 Bacteria 4396
650 Ga0207660_10040580 3300025917 Bacteria 3259
651 Ga0207662_10000394 3300025918 Bacteria 19478
652 Ga0207657_10000065 3300025919 Bacteria 98751
653 Ga0207657_10000469 3300025919 Bacteria 42688
654 Ga0207657_10001751 3300025919 Bacteria 23419
655 Ga0207657_10002121 3300025919 Bacteria 21468
656 Ga0207649_10000269 3300025920 Bacteria 41142
657 Ga0207649_10007608 3300025920 Bacteria 5892
658 Ga0207649_10013636 3300025920 Bacteria 4541
659 Ga0207649_10018710 3300025920 Bacteria 3946
660 Ga0207652_10005329 3300025921 Bacteria 10427
661 Ga0207652_10009170 3300025921 Bacteria 7964
662 Ga0207681_10040501 3300025923 Bacteria 3101
663 Ga0207694_10000005 3300025924 Bacteria 823704
664 Ga0207694_10000054 3300025924 Bacteria 152124
665 Ga0207694_10063293 3300025924 Bacteria 2881
666 Ga0207694_10081495 3300025924 Bacteria 2542
667 Ga0207650_10000028 3300025925 Bacteria 236867
668 Ga0207650_10002006 3300025925 Bacteria 14265
669 Ga0207650_10057926 3300025925 Bacteria 2883
670 Ga0207659_10001987 3300025926 Bacteria 12095
671 Ga0207687_10004634 3300025927 Bacteria 9148
672 Ga0207687_10087970 3300025927 Bacteria 2259
673 Ga0207687_10142421 3300025927 Bacteria 1820
674 Ga0207700_10000023 3300025928 Bacteria 152285
675 Ga0207700_10021676 3300025928 Bacteria 4392
676 Ga0207700_10059211 3300025928 Bacteria 2896
677 Ga0207700_10066207 3300025928 Bacteria 2761
678 Ga0207664_10010214 3300025929 Bacteria 6628
679 Ga0207664_10018372 3300025929 Bacteria 5145
680 Ga0207664_10050630 3300025929 Bacteria 3276
681 Ga0207644_10002957 3300025931 Bacteria 10946
682 Ga0207690_10000040 3300025932 Bacteria 130300
683 Ga0207690_10004347 3300025932 Bacteria 8372
684 Ga0207690_10015844 3300025932 Bacteria 4576
685 Ga0207690_10027448 3300025932 Bacteria 3598
686 Ga0207690_10065522 3300025932 Bacteria 2485
687 Ga0207706_10002869 3300025933 Bacteria 16715
688 Ga0207706_10004302 3300025933 Bacteria 13383
689 Ga0207686_10000366 3300025934 Bacteria 31802
690 Ga0207686_10011054 3300025934 Bacteria 4931
691 Ga0207709_10003864 3300025935 Bacteria 8774
692 Ga0207709_10005653 3300025935 Bacteria 7068
693 Ga0207669_10006910 3300025937 Bacteria 5219
694 Ga0207704_10000183 3300025938 Bacteria 32999
695 Ga0207704_10021893 3300025938 Bacteria 3414
696 Ga0207665_10030580 3300025939 Bacteria 3560
697 Ga0207691_10001560 3300025940 Bacteria 22750
698 Ga0207691_10034452 3300025940 Bacteria 4708
699 Ga0207691_10137070 3300025940 Bacteria 2158
700 Ga0207711_10000185 3300025941 Bacteria 66575
701 Ga0207711_10029680 3300025941 Bacteria 4613
702 Ga0207711_10103558 3300025941 Bacteria 2520
703 Ga0207711_10273358 3300025941 Bacteria 1555
704 Ga0207689_10001562 3300025942 Bacteria 21705
705 Ga0207689_10024015 3300025942 Bacteria 5114
706 Ga0207689_10059820 3300025942 Bacteria 3133
707 Ga0207661_10005111 3300025944 Bacteria 9211
708 Ga0207679_10000032 3300025945 Bacteria 158845
709 Ga0207679_10000584 3300025945 Bacteria 24379
710 Ga0207679_10002535 3300025945 Bacteria 11254
711 Ga0207679_10213150 3300025945 Bacteria 1621
712 Ga0207679_10226987 3300025945 Bacteria 1574
713 Ga0207667_10000041 3300025949 Bacteria 272265
714 Ga0207667_10000043 3300025949 Bacteria 261426
715 Ga0207667_10016267 3300025949 Bacteria 8406
716 Ga0207667_10018787 3300025949 Bacteria 7740
717 Ga0207667_10019923 3300025949 Bacteria 7475
718 Ga0207667_10021698 3300025949 Bacteria 7115
719 Ga0207667_10022349 3300025949 Bacteria 6990
720 Ga0207667_10030719 3300025949 Bacteria 5807
721 Ga0207667_10040684 3300025949 Bacteria 4949
722 Ga0207667_10059167 3300025949 Bacteria 4015
723 Ga0207667_10100174 3300025949 Bacteria 2988
724 Ga0207667_10136120 3300025949 Bacteria 2529
725 Ga0207651_10001283 3300025960 Bacteria 11302
726 Ga0207651_10026296 3300025960 Bacteria 3632
727 Ga0207640_10000166 3300025981 Bacteria 47875
728 Ga0207640_10002242 3300025981 Bacteria 10410
729 Ga0207640_10031703 3300025981 Bacteria 3269
730 Ga0207640_10039852 3300025981 Bacteria 2977
731 Ga0207640_10056874 3300025981 Bacteria 2570
732 Ga0207658_10010931 3300025986 Bacteria 6180
733 Ga0207677_10001505 3300026023 Bacteria 12301
734 Ga0207677_10002850 3300026023 Bacteria 9121
735 Ga0207677_10240157 3300026023 Bacteria 1465
736 Ga0207703_10001000 3300026035 Bacteria 27175
737 Ga0207703_10004197 3300026035 Bacteria 11879
738 Ga0207703_10011425 3300026035 Bacteria 6905
739 Ga0207703_10166330 3300026035 Bacteria 1936
740 Ga0207639_10013926 3300026041 Bacteria 5642
741 Ga0207639_10054099 3300026041 Bacteria 3066
742 Ga0207678_10000024 3300026067 Bacteria 125239
743 Ga0207678_10002149 3300026067 Bacteria 17846
744 Ga0207678_10058214 3300026067 Bacteria 3325
745 Ga0207708_10000058 3300026075 Bacteria 95656
746 Ga0207708_10005671 3300026075 Bacteria 9220
747 Ga0207702_10000615 3300026078 Bacteria 39296
748 Ga0207702_10035201 3300026078 Bacteria 4187
749 Ga0207702_10084325 3300026078 Bacteria 2766
750 Ga0207641_10004677 3300026088 Bacteria 11809
751 Ga0207641_10102975 3300026088 Bacteria 2518
752 Ga0207648_10000635 3300026089 Bacteria 39416
753 Ga0207648_10002029 3300026089 Bacteria 22120
754 Ga0207648_10008055 3300026089 Bacteria 10266
755 Ga0207648_10026542 3300026089 Bacteria 5145
756 Ga0207648_10027248 3300026089 Bacteria 5076
757 Ga0207674_10002499 3300026116 Bacteria 23190
758 Ga0207674_10002639 3300026116 Bacteria 22407
759 Ga0207674_10005309 3300026116 Bacteria 15327
760 Ga0207674_10040795 3300026116 Bacteria 4805
761 Ga0207675_100000480 3300026118 Bacteria 38807
762 Ga0207683_10000548 3300026121 Bacteria 34736
763 Ga0207683_10000997 3300026121 Bacteria 25922
764 Ga0207683_10003833 3300026121 Bacteria 13030
765 Ga0207683_10006552 3300026121 Bacteria 9968
766 Ga0207683_10011720 3300026121 Bacteria 7485
767 Ga0207698_10001447 3300026142 Bacteria 13795
768 Ga0207698_10020820 3300026142 Bacteria 4523
769 Ga0207698_10021768 3300026142 Bacteria 4441
770 Ga0207698_10036554 3300026142 Bacteria 3606
771 Ga0207698_10063288 3300026142 Bacteria 2894
772 Ga0207698_10072384 3300026142 Bacteria 2740
773 Ga0207698_10169810 3300026142 Bacteria 1919
774 Ga0207698_10215583 3300026142 Bacteria 1730
775 Ga0209281_1003338 3300027111 Bacteria 5382
776 Ga0209281_1016186 3300027111 Bacteria 1537
777 Ga0209371_1000094 3300027312 Bacteria 170815
778 Ga0209371_1000141 3300027312 Bacteria 118767
779 Ga0209371_1003202 3300027312 Bacteria 8247
780 Ga0209969_1001458 3300027360 Bacteria 3263
781 Ga0209967_1001378 3300027364 Bacteria 3126
782 Ga0209981_1002968 3300027378 Bacteria 2183
783 Ga0209983_1011367 3300027665 Bacteria 1821
784 Ga0209282_1000005 3300027666 Bacteria 380858
785 Ga0209282_1000032 3300027666 Bacteria 149218
786 Ga0209974_10003296 3300027876 Bacteria 5834
787 Ga0207428_10002211 3300027907 Bacteria 19536
788 Ga0207428_10005007 3300027907 Bacteria 12458
789 Ga0207428_10010908 3300027907 Bacteria 8088
790 Ga0207428_10100259 3300027907 Bacteria 2238
791 Ga0268266_10001540 3300028379 Bacteria 26973
792 Ga0268266_10015792 3300028379 Bacteria 6465
793 Ga0268266_10029637 3300028379 Bacteria 4651
794 Ga0268264_10024802 3300028381 Bacteria 4898
795 Ga0268264_10149083 3300028381 Bacteria 2095
796 Ga0265337_1036458 3300028556 Bacteria 1434
797 Ga0265334_10000048 3300028573 Bacteria 90958
798 Ga0307515_10059162 3300028794 Bacteria 5498
799 Ga0265338_10000005 3300028800 Bacteria 571137
800 Ga0265338_10000508 3300028800 Bacteria 68840
801 Ga0265338_10003131 3300028800 Bacteria 23632
802 Ga0265338_10005697 3300028800 Bacteria 16114
803 Ga0265338_10006964 3300028800 Bacteria 14209
804 Ga0265338_10085334 3300028800 Bacteria 2632
805 Ga0268256_1000083 3300030500 Bacteria 170829
806 Ga0268256_1002888 3300030500 Bacteria 8247
807 Ga0268256_1005317 3300030500 Bacteria 5091
808 Ga0307511_10000005 3300030521 Bacteria 175482
809 Ga0316181_1294152 3300030744 Bacteria 5213
810 Ga0265330_10025972 3300031235 Bacteria 2653
811 Ga0265330_10058051 3300031235 Bacteria 1687
812 Ga0265332_10002392 3300031238 Bacteria 9564
813 Ga0265328_10000252 3300031239 Bacteria 24700
814 Ga0265328_10001134 3300031239 Bacteria 12267
815 Ga0265328_10041664 3300031239 Bacteria 1690
816 Ga0265320_10000088 3300031240 Bacteria 77379
817 Ga0265320_10002005 3300031240 Bacteria 14372
818 Ga0265320_10057059 3300031240 Bacteria 1874
819 Ga0265325_10000010 3300031241 Bacteria 172391
820 Ga0265325_10000306 3300031241 Bacteria 34466
821 Ga0265325_10003550 3300031241 Bacteria 10131
822 Ga0265325_10011606 3300031241 Bacteria 5060
823 Ga0265325_10063873 3300031241 Bacteria 1862
824 Ga0265329_10019971 3300031242 Bacteria 2268
825 Ga0265340_10013866 3300031247 Bacteria 4224
826 Ga0265340_10074924 3300031247 Bacteria 1600
827 Ga0265339_10001211 3300031249 Bacteria 19460
828 Ga0265339_10001636 3300031249 Bacteria 16530
829 Ga0265339_10044308 3300031249 Bacteria 2455
830 Ga0265339_10070184 3300031249 Bacteria 1869
831 Ga0265331_10000050 3300031250 Bacteria 181286
832 Ga0265331_10000641 3300031250 Bacteria 30240
833 Ga0265331_10002299 3300031250 Bacteria 13025
834 Ga0265331_10003830 3300031250 Bacteria 9542
835 Ga0265331_10007589 3300031250 Bacteria 6259
836 Ga0265331_10010512 3300031250 Bacteria 5119
837 Ga0265331_10011567 3300031250 Bacteria 4828
838 Ga0265327_10000109 3300031251 Bacteria 181275
839 Ga0265327_10000161 3300031251 Bacteria 144768
840 Ga0265327_10000665 3300031251 Bacteria 55138
841 Ga0265327_10000871 3300031251 Bacteria 44739
842 Ga0265327_10001378 3300031251 Bacteria 31089
843 Ga0265327_10003401 3300031251 Bacteria 15267
844 Ga0265327_10004214 3300031251 Bacteria 12917
845 Ga0265327_10004672 3300031251 Bacteria 12000
846 Ga0265327_10016404 3300031251 Bacteria 4706
847 Ga0265327_10033084 3300031251 Bacteria 2886
848 Ga0265316_10020341 3300031344 Bacteria 5652
849 Ga0265316_10039725 3300031344 Bacteria 3778
850 Ga0265316_10043050 3300031344 Bacteria 3604
851 Ga0265316_10046053 3300031344 Bacteria 3458
852 Ga0307408_100000020 3300031548 Bacteria 340408
853 Ga0307408_100000489 3300031548 Bacteria 34649
854 Ga0307408_100005084 3300031548 Bacteria 8826
855 Ga0265313_10001209 3300031595 Bacteria 24664
856 Ga0265313_10002092 3300031595 Bacteria 17816
857 Ga0265313_10005798 3300031595 Bacteria 8973
858 Ga0265313_10006535 3300031595 Bacteria 8227
859 Ga0265313_10025929 3300031595 Bacteria 3097
860 Ga0316575_10002983 3300031665 Bacteria 5764
861 Ga0316575_10003093 3300031665 Bacteria 5682
862 Ga0316575_10007941 3300031665 Bacteria 3852
863 Ga0316575_10020058 3300031665 Bacteria 2562
864 Ga0316575_10021971 3300031665 Bacteria 2459
865 Ga0316575_10031988 3300031665 Bacteria 2060
866 Ga0316575_10047228 3300031665 Bacteria 1711
867 Ga0316579_10000368 3300031691 Bacteria 14202
868 Ga0316579_10000622 3300031691 Bacteria 12003
869 Ga0316579_10001025 3300031691 Bacteria 9840
870 Ga0316579_10001066 3300031691 Bacteria 9707
871 Ga0316579_10002084 3300031691 Bacteria 7490
872 Ga0316579_10010733 3300031691 Bacteria 3878
873 Ga0316579_10020362 3300031691 Bacteria 2942
874 Ga0316579_10033155 3300031691 Bacteria 2370
875 Ga0316579_10045161 3300031691 Bacteria 2054
876 Ga0265314_10000488 3300031711 Bacteria 51640
877 Ga0265314_10007076 3300031711 Bacteria 9790
878 Ga0265314_10024140 3300031711 Bacteria 4617
879 Ga0265314_10045281 3300031711 Bacteria 3112
880 Ga0265314_10064141 3300031711 Bacteria 2489
881 Ga0265314_10077253 3300031711 Bacteria 2209
882 Ga0265342_10006317 3300031712 Bacteria 8838
883 Ga0316576_10000676 3300031727 Bacteria 16660
884 Ga0316576_10001164 3300031727 Bacteria 13784
885 Ga0316576_10009159 3300031727 Bacteria 6378
886 Ga0316576_10024654 3300031727 Bacteria 4201
887 Ga0316576_10170963 3300031727 Bacteria 1640
888 Ga0316578_10000119 3300031728 Bacteria 19275
889 Ga0316578_10003033 3300031728 Bacteria 7569
890 Ga0316578_10004707 3300031728 Bacteria 6491
891 Ga0316578_10004920 3300031728 Bacteria 6396
892 Ga0316578_10011121 3300031728 Bacteria 4695
893 Ga0316578_10011703 3300031728 Bacteria 4603
894 Ga0316578_10017741 3300031728 Bacteria 3881
895 Ga0316578_10019431 3300031728 Bacteria 3739
896 Ga0316578_10091649 3300031728 Bacteria 1815
897 Ga0316578_10094780 3300031728 Bacteria 1785
898 Ga0307516_10039029 3300031730 Bacteria 4734
899 Ga0307405_10011614 3300031731 Bacteria 4628
900 Ga0316577_10000036 3300031733 Bacteria 29276
901 Ga0316577_10028790 3300031733 Bacteria 3099
902 Ga0316577_10032178 3300031733 Bacteria 2930
903 Ga0316577_10033599 3300031733 Bacteria 2866
904 Ga0316577_10037822 3300031733 Bacteria 2698
905 Ga0316577_10072346 3300031733 Bacteria 1924
906 Ga0307413_10135082 3300031824 Bacteria 1695
907 Ga0307518_10043423 3300031838 Bacteria 3271
908 Ga0307412_10000056 3300031911 Bacteria 145861
909 Ga0307412_10000061 3300031911 Bacteria 126274
910 Ga0307409_100129991 3300031995 Bacteria 2150
911 Ga0307416_100052509 3300032002 Bacteria 3264
912 Ga0307416_100053677 3300032002 Bacteria 3235
913 Ga0307416_100086596 3300032002 Bacteria 2671
914 Ga0307414_10002569 3300032004 Bacteria 9549
915 Ga0316583_10000654 3300032133 Bacteria 10633
916 Ga0316583_10003709 3300032133 Bacteria 5402
917 Ga0316585_10001200 3300032137 Bacteria 6765
918 Ga0316585_10002846 3300032137 Bacteria 4710
919 Ga0316585_10005198 3300032137 Bacteria 3668
920 Ga0316585_10015760 3300032137 Bacteria 2269
921 Ga0316580_10000393 3300032139 Bacteria 9886
922 Ga0316593_10000006 3300032168 Bacteria 20187
923 Ga0316593_10000324 3300032168 Bacteria 8226
924 Ga0316593_10001172 3300032168 Bacteria 5590
925 Ga0316593_10003160 3300032168 Bacteria 4044
926 Ga0316593_10011154 3300032168 Bacteria 2603
927 Ga0316593_10011507 3300032168 Bacteria 2573
928 Ga0316593_10013690 3300032168 Bacteria 2407
929 Ga0316596_1000238 3300033541 Bacteria 8353
930 Ga0316596_1000484 3300033541 Bacteria 6762
931 Ga0316596_1001944 3300033541 Bacteria 4328
932 Ga0316596_1002554 3300033541 Bacteria 3899
933 Ga0373929_0012234 3300035085 Bacteria 1628
934 Ga0373934_0000524 3300035086 Bacteria 13506
935 Ga0373936_0017886 3300035113 Bacteria 2733
936 Ga0373936_0026866 3300035113 Bacteria 2256
937 Ga0373945_0037776 3300035116 Bacteria 1734
938 Ga0373953_0000613 3300035117 Bacteria 9874
939 Ga0373953_0056236 3300035117 Bacteria 1599
940 Ga0373954_0000674 3300035118 Bacteria 13089
941 Ga0373954_0009270 3300035118 Bacteria 4330
942 Ga0373956_0000135 3300035119 Bacteria 26321
943 Ga0373956_0013451 3300035119 Bacteria 3404
944 Ga0373957_0002671 3300035120 Bacteria 5118
945 Ga0373957_0004898 3300035120 Bacteria 4111
946 Ga0373957_0008551 3300035120 Bacteria 3320
947 Ga0373943_0023909 3300035170 Bacteria 2845
948 Ga0373943_0056021 3300035170 Bacteria 1955
949 Ga0373943_0103512 3300035170 Bacteria 1492
950 Ga0373946_0005286 3300035171 Bacteria 4655
951 Ga0373955_0000825 3300035172 Bacteria 13260
952 Ga0373955_0008610 3300035172 Bacteria 4744
953 Ga0373955_0040732 3300035172 Bacteria 2486
954 Ga0373961_0013703 3300035241 Bacteria 2048
955 Ga0316574_0000243 3300035398 Bacteria 19739
956 Ga0316574_0004552 3300035398 Bacteria 7279
957 Ga0316574_0012299 3300035398 Bacteria 4893
958 Ga0316574_0012400 3300035398 Bacteria 4875
959 Ga0316574_0023794 3300035398 Bacteria 3660
960 Ga0316574_0032063 3300035398 Bacteria 3191
961 Ga0316574_0038486 3300035398 Bacteria 2936
962 Ga0316574_0057231 3300035398 Bacteria 2440
963 Ga0316574_0059105 3300035398 Bacteria 2403
964 Ga0316574_0089726 3300035398 Bacteria 1958
965 Ga0373931_0029608 3300035691 Bacteria 2813
966 Ga0373931_0051321 3300035691 Bacteria 2197
967 Ga0373935_0028103 3300035692 Bacteria 3476
968 Ga0373927_0010056 3300035695 Bacteria 6334
969 Ga0373927_0094913 3300035695 Bacteria 1938
970 Ga0373927_0132414 3300035695 Bacteria 1629
971 Ga0373933_0008376 3300035724 Bacteria 5647
972 Ga0373933_0074047 3300035724 Bacteria 2076
973 Ga0373933_0146386 3300035724 Bacteria 1494
974 Ga0373933_0172539 3300035724 Bacteria 1376
975 Ga0373947_0021339 3300035725 Bacteria 3748
976 Ga0373947_0034454 3300035725 Bacteria 2994
977 Ga0373947_0034839 3300035725 Bacteria 2978
978 Ga0373947_0043978 3300035725 Bacteria 2669
979 Ga0373937_0007514 3300036401 Bacteria 9435
980 Ga0373937_0009646 3300036401 Bacteria 8405
981 Ga0373937_0010610 3300036401 Bacteria 8049
982 Ga0373937_0020534 3300036401 Bacteria 5921
983 Ga0373937_0252769 3300036401 Bacteria 1662
984 Ga0373937_0252820 3300036401 Bacteria 1661
985 Ga0316582_0000662 3300036647 Bacteria 13499
986 Ga0316582_0001269 3300036647 Bacteria 10898
987 Ga0316582_0003235 3300036647 Bacteria 7933
988 Ga0316582_0003340 3300036647 Bacteria 7845
989 Ga0316582_0007327 3300036647 Bacteria 5868
990 Ga0316582_0010706 3300036647 Bacteria 5034
991 Ga0316582_0012053 3300036647 Bacteria 4810
992 Ga0316582_0012618 3300036647 Bacteria 4723
993 Ga0316582_0015844 3300036647 Bacteria 4322
994 Ga0316582_0025718 3300036647 Bacteria 3537
995 Ga0316582_0030630 3300036647 Bacteria 3279
996 Ga0316582_0036089 3300036647 Bacteria 3057
997 Ga0316582_0051408 3300036647 Bacteria 2615
998 Ga0316582_0077431 3300036647 Bacteria 2164
999 Ga0316584_0000578 3300036712 Bacteria 19771
1000 Ga0316584_0001110 3300036712 Bacteria 15765
1001 Ga0316584_0018249 3300036712 Bacteria 5059
1002 Ga0316584_0026976 3300036712 Bacteria 4224
1003 Ga0316584_0061658 3300036712 Bacteria 2808
1004 Ga0316584_0064257 3300036712 Bacteria 2748
1005 Ga0316584_0074345 3300036712 Bacteria 2548
1006 Ga0316584_0083798 3300036712 Bacteria 2388
1007 Ga0316584_0091028 3300036712 Bacteria 2284
1008 Ga0316584_0101141 3300036712 Bacteria 2158
1009 Ga0316584_0165995 3300036712 Bacteria 1639
1010 Ga0373925_0028634 3300037068 Bacteria 4081
1011 Ga0373925_0032676 3300037068 Bacteria 3830
1012 Ga0395899_0000078 3300037312 Bacteria 174141
1013 Ga0395899_0000080 3300037312 Bacteria 171568
1014 Ga0395899_0045495 3300037312 Bacteria 3270
1015 Ga0395900_0000087 3300037418 Bacteria 171568
1016 Ga0395900_0000673 3300037418 Bacteria 45477
1017 Ga0395900_0049451 3300037418 Bacteria 4332
1018 Ga0395900_0071176 3300037418 Bacteria 3574
1019 Ga0395900_0081902 3300037418 Bacteria 3315
1020 Ga0395900_0082976 3300037418 Bacteria 3293
1021 Ga0395900_0097488 3300037418 Bacteria 3020
1022 Ga0395900_0113693 3300037418 Bacteria 2778
1023 Ga0395900_0320808 3300037418 Bacteria 1529
1024 Ga0395898_0000448 3300037466 Bacteria 84953
1025 Ga0395898_0003576 3300037466 Bacteria 17324
1026 Ga0395898_0022487 3300037466 Bacteria 6385
1027 Ga0395898_0062519 3300037466 Bacteria 3615
1028 Ga0395898_0076445 3300037466 Bacteria 3233
1029 Ga0395898_0255240 3300037466 Bacteria 1672
1030 Ga0395905_0000166 3300037471 Bacteria 108507
1031 Ga0395905_0002893 3300037471 Bacteria 18759
1032 Ga0395905_0047155 3300037471 Bacteria 4040
1033 Ga0395905_0059658 3300037471 Bacteria 3566
1034 Ga0395905_0155338 3300037471 Bacteria 2152
1035 Ga0316581_0000544 3300037588 Bacteria 7361
1036 Ga0316581_0009818 3300037588 Bacteria 2640
1037 Ga0436364_0541917 3300037853 Bacteria 5083
1038 Ga0436364_0942371 3300037853 Bacteria 8552
1039 Ga0436364_1171513 3300037853 Bacteria 122046
1040 Ga0436364_1451337 3300037853 Bacteria 2303
1041 Ga0436364_1484148 3300037853 Bacteria 6183
1042 Ga0395901_0000053 3300038443 Bacteria 163807
1043 Ga0395901_0000393 3300038443 Bacteria 52127
1044 Ga0395901_0000924 3300038443 Bacteria 31960
1045 Ga0395901_0003786 3300038443 Bacteria 15231
1046 Ga0395901_0006004 3300038443 Bacteria 12301
1047 Ga0395901_0009275 3300038443 Bacteria 9977
1048 Ga0395901_0012912 3300038443 Bacteria 8472
1049 Ga0395901_0155869 3300038443 Bacteria 2399
1050 Ga0395901_0240927 3300038443 Bacteria 1886
1051 Ga0400484_00323 3300038725 Bacteria 2703
1052 Ga0400484_18569 3300038725 Bacteria 7398
1053 Ga0400484_35137 3300038725 Bacteria 4719
1054 Ga0400490_13929 3300038726 Bacteria 3145
1055 Ga0400490_16569 3300038726 Bacteria 23325
1056 Ga0400490_25259 3300038726 Bacteria 11815
1057 Ga0400490_28987 3300038726 Bacteria 57885
1058 Ga0400490_34331 3300038726 Bacteria 51219
1059 Ga0400490_48945 3300038726 Bacteria 9116
1060 Ga0400491_17035 3300038727 Bacteria 3091
1061 Ga0400491_24623 3300038727 Bacteria 2443
1062 Ga0400485_03650 3300038735 Bacteria 14340
1063 Ga0400485_17355 3300038735 Bacteria 1692
1064 Ga0400485_20357 3300038735 Bacteria 55491
1065 Ga0400488_10585 3300038741 Bacteria 5178
1066 Ga0400488_20709 3300038741 Bacteria 2076
1067 Ga0400488_25328 3300038741 Bacteria 3759
1068 Ga0400488_30822 3300038741 Bacteria 8713
1069 Ga0400488_34807 3300038741 Bacteria 2744
1070 Ga0400488_43321 3300038741 Bacteria 14407
1071 Ga0400486_05246 3300038742 Bacteria 75088
1072 Ga0400486_10627 3300038742 Bacteria 2993
1073 Ga0400486_16718 3300038742 Bacteria 4774
1074 Ga0400486_26900 3300038742 Bacteria 4690
1075 Ga0400483_010293 3300039062 Bacteria 7176
1076 Ga0400483_018996 3300039062 Bacteria 2766
1077 Ga0400483_022484 3300039062 Bacteria 6616
1078 Ga0400483_042257 3300039062 Bacteria 9636
1079 Ga0400483_070048 3300039062 Bacteria 1914
1080 Ga0400483_091080 3300039062 Bacteria 9725
1081 Ga0400483_092279 3300039062 Bacteria 3537
1082 Ga0400483_106547 3300039062 Bacteria 6264
1083 Ga0400483_110940 3300039062 Bacteria 25482
1084 Ga0400483_153689 3300039062 Bacteria 9578
1085 Ga0400483_159831 3300039062 Bacteria 3937
1086 Ga0400483_178100 3300039062 Bacteria 2332
1087 Ga0400483_206544 3300039062 Bacteria 1763
1088 Ga0400483_207597 3300039062 Bacteria 2544
1089 Ga0400483_231907 3300039062 Bacteria 8113
1090 Ga0400483_236280 3300039062 Bacteria 2090
1091 Ga0400489_50056 3300039093 Bacteria 1605
1092 Ga0400487_00745 3300039110 Bacteria 8134
1093 Ga0400487_00755 3300039110 Bacteria 32177
1094 Ga0400487_17506 3300039110 Bacteria 28809
1095 Ga0400487_25654 3300039110 Bacteria 4930
1096 Ga0400487_26641 3300039110 Bacteria 5494
1097 Ga0436365_0498837 3300039437 Bacteria 16854
1098 Ga0436365_0713547 3300039437 Bacteria 9954
1099 Ga0436365_0866723 3300039437 Bacteria 7947
1100 Ga0436365_1001160 3300039437 Bacteria 2635
1101 Ga0436365_1339516 3300039437 Bacteria 21592
1102 Ga0436365_1542655 3300039437 Bacteria 11188
1103 Ga0436365_1579892 3300039437 Bacteria 2447
1104 Ga0436360_1121756 3300039438 Bacteria 2101
1105 Ga0436361_0039357 3300039447 Bacteria 2961
1106 Ga0436361_0066621 3300039447 Bacteria 4222
1107 Ga0436361_0136561 3300039447 Bacteria 8645
1108 Ga0436361_0167169 3300039447 Bacteria 2747
1109 Ga0436361_0224368 3300039447 Bacteria 99317
1110 Ga0436361_0291380 3300039447 Bacteria 1855
1111 Ga0436361_0293841 3300039447 Bacteria 85519
1112 Ga0436361_0580184 3300039447 Bacteria 2034
1113 Ga0436361_0599717 3300039447 Bacteria 43072
1114 Ga0436361_0632156 3300039447 Bacteria 31235
1115 Ga0436361_0764009 3300039447 Bacteria 4040
1116 Ga0436361_0894241 3300039447 Bacteria 10135
1117 Ga0436361_1092447 3300039447 Bacteria 2102
1118 Ga0436361_1133501 3300039447 Bacteria 2098
1119 Ga0436361_1159932 3300039447 Bacteria 2473
1120 Ga0436363_0289284 3300039450 Bacteria 9957
1121 Ga0436363_1183271 3300039450 Bacteria 6037
1122 Ga0436362_0763668 3300039453 Bacteria 13939
1123 Ga0439436_0018884 3300041404 Bacteria 2061
1124 Ga0451853_0956153 3300041512 Bacteria 2443
1125 Ga0439448_0004496 3300042005 Bacteria 3936
1126 Ga0450911_000023 3300042115 Bacteria 90815
1127 Ga0450904_000386 3300042139 Bacteria 9139
1128 Ga0439464_0010028 3300042439 Bacteria 2498
1129 Ga0439464_0020468 3300042439 Bacteria 1812
1130 Ga0451577_0000603 3300042876 Bacteria 57862
1131 Ga0451577_0005927 3300042876 Bacteria 12320
1132 Ga0451577_0093045 3300042876 Bacteria 2692
1133 Ga0451577_0150391 3300042876 Bacteria 2095
1134 Ga0451577_0152994 3300042876 Bacteria 2076
1135 Ga0451577_0176050 3300042876 Bacteria 1928
1136 Ga0466969_0000901 3300044656 Bacteria 16055
1137 Ga0466969_0005144 3300044656 Bacteria 6955
1138 Ga0466969_0006652 3300044656 Bacteria 6141
1139 Ga0466972_0000290 3300044658 Bacteria 30636
1140 Ga0466972_0004693 3300044658 Bacteria 6847
1141 Ga0466972_0017282 3300044658 Bacteria 3610
1142 Ga0466973_0033070 3300044659 Bacteria 4929
1143 Ga0466977_0000280 3300044666 Bacteria 14748
1144 Ga0453683_0005270 3300044673 Bacteria 9047
1145 Ga0453683_0028231 3300044673 Bacteria 3553
1146 Ga0453683_0102535 3300044673 Bacteria 1797
1147 Ga0466965_0005814 3300044683 Bacteria 5565
1148 Ga0466965_0019762 3300044683 Bacteria 3235
1149 Ga0466965_0030989 3300044683 Bacteria 2607
1150 Ga0466966_0000070 3300044684 Bacteria 67510
1151 Ga0466966_0001458 3300044684 Bacteria 15214
1152 Ga0466966_0002015 3300044684 Bacteria 13179
1153 Ga0466966_0011833 3300044684 Bacteria 5778
1154 Ga0466966_0031772 3300044684 Bacteria 3424
1155 Ga0466966_0062838 3300044684 Bacteria 2340
1156 Ga0466961_0000382 3300044693 Bacteria 28543
1157 Ga0466961_0000919 3300044693 Bacteria 18224
1158 Ga0466961_0001619 3300044693 Bacteria 13959
1159 Ga0466961_0052302 3300044693 Bacteria 2606
1160 Ga0466963_0000156 3300044694 Bacteria 27358
1161 Ga0466963_0023867 3300044694 Bacteria 3889
1162 Ga0466964_0019148 3300044706 Bacteria 2629
1163 Ga0466964_0025094 3300044706 Bacteria 2326
1164 Ga0466964_0030886 3300044706 Bacteria 2122
1165 Ga0466964_0040404 3300044706 Bacteria 1883
1166 Ga0453684_0000014 3300044712 Bacteria 993311
1167 Ga0453684_0000395 3300044712 Bacteria 179647
1168 Ga0453684_0000566 3300044712 Bacteria 138895
1169 Ga0453684_0000716 3300044712 Bacteria 117287
1170 Ga0453684_0001436 3300044712 Bacteria 68003
1171 Ga0453684_0001602 3300044712 Bacteria 62203
1172 Ga0453684_0003881 3300044712 Bacteria 32897
1173 Ga0453684_0006851 3300044712 Bacteria 21408
1174 Ga0453684_0058625 3300044712 Bacteria 4972
1175 Ga0466971_0003076 3300044719 Bacteria 7087
1176 Ga0466968_0015240 3300044735 Bacteria 3043
1177 Ga0466970_0001718 3300044765 Bacteria 10539
1178 Ga0466970_0023303 3300044765 Bacteria 3232
1179 Ga0466970_0029992 3300044765 Bacteria 2867
1180 Ga0466957_0000646 3300044842 Bacteria 17689
1181 Ga0466957_0006404 3300044842 Bacteria 6648
1182 Ga0466957_0016515 3300044842 Bacteria 4318
1183 Ga0466957_0026257 3300044842 Bacteria 3454
1184 Ga0466957_0072621 3300044842 Bacteria 2130
1185 Ga0466959_0013509 3300045049 Bacteria 5917
1186 Ga0466959_0025943 3300045049 Bacteria 4345
1187 Ga0466959_0034425 3300045049 Bacteria 3746
1188 Ga0466959_0052451 3300045049 Bacteria 2987
1189 Ga0466959_0123065 3300045049 Bacteria 1842
1190 Ga0466959_0151740 3300045049 Bacteria 1633
1191 Ga0451576_0000239 3300045051 Bacteria 134323
1192 Ga0451576_0000313 3300045051 Bacteria 117520
1193 Ga0451576_0000487 3300045051 Bacteria 87753
1194 Ga0451576_0000734 3300045051 Bacteria 65609
1195 Ga0451576_0002171 3300045051 Bacteria 30352
1196 Ga0451576_0007226 3300045051 Bacteria 13379
1197 Ga0451576_0016875 3300045051 Bacteria 8044
1198 Ga0451576_0030534 3300045051 Bacteria 5758
1199 Ga0451576_0046228 3300045051 Bacteria 4584
1200 Ga0451576_0221544 3300045051 Bacteria 1975
1201 Ga0451576_0376523 3300045051 Bacteria 1488
1202 Ga0466958_0002177 3300045836 Bacteria 9770
1203 Ga0466958_0095015 3300045836 Bacteria 1847
1204 Ga0466967_0040690 3300045976 Bacteria 4003
1205 Ga0466967_0041475 3300045976 Bacteria 3968
1206 Ga0466967_0047541 3300045976 Bacteria 3741
1207 Ga0466967_0180938 3300045976 Bacteria 1989
1208 Ga0495617_000010 3300046452 Bacteria 310258
1209 Ga0495617_000020 3300046452 Bacteria 230257
1210 Ga0495617_000338 3300046452 Bacteria 25897
1211 Ga0495617_009279 3300046452 Bacteria 3377
1212 Ga0495627_002330 3300046453 Bacteria 9310
1213 Ga0495592_0007047 3300046454 Bacteria 8409
1214 Ga0495592_0007842 3300046454 Bacteria 7999
1215 Ga0495592_0010390 3300046454 Bacteria 7022
1216 Ga0495592_0014005 3300046454 Bacteria 6092
1217 Ga0495592_0015621 3300046454 Bacteria 5759
1218 Ga0495592_0084819 3300046454 Bacteria 2284
1219 Ga0495603_0004544 3300046455 Bacteria 8279
1220 Ga0495603_0013456 3300046455 Bacteria 4949
1221 Ga0495603_0022383 3300046455 Bacteria 3828
1222 Ga0495603_0025725 3300046455 Bacteria 3558
1223 Ga0495603_0044853 3300046455 Bacteria 2638
1224 Ga0495603_0053485 3300046455 Bacteria 2395
1225 Ga0495590_0000009 3300046457 Bacteria 320425
1226 Ga0495590_0000012 3300046457 Bacteria 303377
1227 Ga0495590_0000811 3300046457 Bacteria 14198
1228 Ga0495590_0002807 3300046457 Bacteria 7196
1229 Ga0495590_0003730 3300046457 Bacteria 6200
1230 Ga0495590_0005189 3300046457 Bacteria 5179
1231 Ga0495590_0008831 3300046457 Bacteria 3831
1232 Ga0495590_0039933 3300046457 Bacteria 1637
1233 Ga0495591_000312 3300046458 Bacteria 44043
1234 Ga0495591_010692 3300046458 Bacteria 3534
1235 Ga0495629_0000162 3300046459 Bacteria 58860
1236 Ga0495629_0000590 3300046459 Bacteria 29493
1237 Ga0495629_0017871 3300046459 Bacteria 5082
1238 Ga0495629_0026088 3300046459 Bacteria 4153
1239 Ga0495629_0042346 3300046459 Bacteria 3201
1240 Ga0495629_0107166 3300046459 Bacteria 1949
1241 Ga0495629_0151676 3300046459 Bacteria 1610
1242 Ga0495638_0000047 3300046460 Bacteria 216004
1243 Ga0495638_0005328 3300046460 Bacteria 9592
1244 Ga0495638_0006905 3300046460 Bacteria 8190
1245 Ga0495638_0008837 3300046460 Bacteria 7112
1246 Ga0495641_0003418 3300046461 Bacteria 11897
1247 Ga0495641_0036191 3300046461 Bacteria 2322
1248 Ga0495641_0060426 3300046461 Bacteria 1712
1249 Ga0495651_0000274 3300046462 Bacteria 40100
1250 Ga0495651_0001676 3300046462 Bacteria 17133
1251 Ga0495651_0119810 3300046462 Bacteria 1935
1252 Ga0495653_0000035 3300046463 Bacteria 129875
1253 Ga0495653_0002868 3300046463 Bacteria 13781
1254 Ga0495653_0005359 3300046463 Bacteria 10436
1255 Ga0495653_0031358 3300046463 Bacteria 4224
1256 Ga0495653_0060862 3300046463 Bacteria 2859
1257 Ga0495653_0111996 3300046463 Bacteria 1959
1258 Ga0495653_0163500 3300046463 Bacteria 1543
1259 Ga0495653_0167219 3300046463 Bacteria 1521
1260 Ga0495650_0000128 3300046471 Bacteria 177256
1261 Ga0495650_0000157 3300046471 Bacteria 155023
1262 Ga0495650_0000167 3300046471 Bacteria 145804
1263 Ga0495650_0000261 3300046471 Bacteria 101830
1264 Ga0495650_0002873 3300046471 Bacteria 13135
1265 Ga0495650_0003960 3300046471 Bacteria 10409
1266 Ga0495650_0015633 3300046471 Bacteria 3884
1267 Ga0495650_0039857 3300046471 Bacteria 2022
1268 Ga0495650_0042609 3300046471 Bacteria 1931
1269 Ga0495650_0053567 3300046471 Bacteria 1651
1270 Ga0495580_0004249 3300046472 Bacteria 12047
1271 Ga0495580_0011235 3300046472 Bacteria 6928
1272 Ga0495580_0030149 3300046472 Bacteria 3929
1273 Ga0495580_0031053 3300046472 Bacteria 3864
1274 Ga0495580_0034358 3300046472 Bacteria 3650
1275 Ga0495580_0061104 3300046472 Bacteria 2646
1276 Ga0495580_0122713 3300046472 Bacteria 1803
1277 Ga0495582_0003873 3300046473 Bacteria 8428
1278 Ga0495582_0033637 3300046473 Bacteria 2818
1279 Ga0495582_0035949 3300046473 Bacteria 2724
1280 Ga0495582_0049401 3300046473 Bacteria 2316
1281 Ga0495582_0078041 3300046473 Bacteria 1836
1282 Ga0495605_0000018 3300046474 Bacteria 270187
1283 Ga0495605_0000055 3300046474 Bacteria 157514
1284 Ga0495605_0000961 3300046474 Bacteria 19587
1285 Ga0495605_0001384 3300046474 Bacteria 15959
1286 Ga0495605_0007115 3300046474 Bacteria 6372
1287 Ga0495605_0010923 3300046474 Bacteria 5072
1288 Ga0495605_0011263 3300046474 Bacteria 4993
1289 Ga0495605_0015947 3300046474 Bacteria 4077
1290 Ga0495605_0034190 3300046474 Bacteria 2575
1291 Ga0495605_0059499 3300046474 Bacteria 1834
1292 Ga0495605_0067680 3300046474 Bacteria 1693
1293 Ga0495639_0002991 3300046475 Bacteria 7359
1294 Ga0495662_0008371 3300046476 Bacteria 5087
1295 Ga0495662_0027907 3300046476 Bacteria 2726
1296 Ga0495662_0051339 3300046476 Bacteria 1990
1297 Ga0495664_0003278 3300046477 Bacteria 8798
1298 Ga0495664_0026439 3300046477 Bacteria 3379
1299 Ga0495584_0000004 3300046491 Bacteria 314714
1300 Ga0495584_0000073 3300046491 Bacteria 72062
1301 Ga0495584_0001460 3300046491 Bacteria 14200
1302 Ga0495584_0002768 3300046491 Bacteria 9803
1303 Ga0495584_0005708 3300046491 Bacteria 6570
1304 Ga0495584_0023301 3300046491 Bacteria 3139
1305 Ga0495584_0031079 3300046491 Bacteria 2703
1306 Ga0495584_0041975 3300046491 Bacteria 2308
1307 Ga0495584_0050364 3300046491 Bacteria 2097
1308 Ga0495584_0067898 3300046491 Bacteria 1791
1309 Ga0495585_0000119 3300046492 Bacteria 85131
1310 Ga0495585_0000859 3300046492 Bacteria 25985
1311 Ga0495585_0001551 3300046492 Bacteria 17822
1312 Ga0495585_0002189 3300046492 Bacteria 14194
1313 Ga0495585_0002462 3300046492 Bacteria 13241
1314 Ga0495585_0065432 3300046492 Bacteria 1991
1315 Ga0495594_0003092 3300046499 Bacteria 8617
1316 Ga0495594_0008963 3300046499 Bacteria 5160
1317 Ga0495594_0021371 3300046499 Bacteria 3454
1318 Ga0495594_0035150 3300046499 Bacteria 2728
1319 Ga0495594_0040861 3300046499 Bacteria 2539
1320 Ga0495596_0000916 3300046500 Bacteria 17571
1321 Ga0495596_0000968 3300046500 Bacteria 17100
1322 Ga0495596_0005030 3300046500 Bacteria 6320
1323 Ga0495596_0009364 3300046500 Bacteria 4309
1324 Ga0495596_0011354 3300046500 Bacteria 3845
1325 Ga0495596_0011865 3300046500 Bacteria 3742
1326 Ga0495596_0016204 3300046500 Bacteria 3100
1327 Ga0495596_0029904 3300046500 Bacteria 2182
1328 Ga0495596_0041322 3300046500 Bacteria 1818
1329 Ga0495596_0047121 3300046500 Bacteria 1691
1330 Ga0495607_0000009 3300046501 Bacteria 216674
1331 Ga0495607_0001276 3300046501 Bacteria 22530
1332 Ga0495607_0006186 3300046501 Bacteria 8459
1333 Ga0495607_0006362 3300046501 Bacteria 8316
1334 Ga0495607_0009405 3300046501 Bacteria 6617
1335 Ga0495607_0011112 3300046501 Bacteria 6010
1336 Ga0495607_0013585 3300046501 Bacteria 5329
1337 Ga0495607_0028869 3300046501 Bacteria 3416
1338 Ga0495607_0031432 3300046501 Bacteria 3250
1339 Ga0495607_0033315 3300046501 Bacteria 3135
1340 Ga0495607_0040955 3300046501 Bacteria 2754
1341 Ga0495583_0000115 3300046506 Bacteria 135762
1342 Ga0495583_0000132 3300046506 Bacteria 125343
1343 Ga0495583_0000493 3300046506 Bacteria 57328
1344 Ga0495583_0001058 3300046506 Bacteria 30795
1345 Ga0495583_0002029 3300046506 Bacteria 18434
1346 Ga0495583_0002050 3300046506 Bacteria 18274
1347 Ga0495583_0002235 3300046506 Bacteria 17049
1348 Ga0495583_0006944 3300046506 Bacteria 7262
1349 Ga0495583_0010382 3300046506 Bacteria 5436
1350 Ga0495583_0010659 3300046506 Bacteria 5342
1351 Ga0495583_0012070 3300046506 Bacteria 4919
1352 Ga0495583_0022321 3300046506 Bacteria 3231
1353 Ga0495606_0000288 3300046507 Bacteria 87389
1354 Ga0495606_0000512 3300046507 Bacteria 63012
1355 Ga0495606_0000790 3300046507 Bacteria 48364
1356 Ga0495606_0001762 3300046507 Bacteria 27726
1357 Ga0495606_0003944 3300046507 Bacteria 15250
1358 Ga0495606_0004472 3300046507 Bacteria 13939
1359 Ga0495606_0010834 3300046507 Bacteria 7513
1360 Ga0495606_0015287 3300046507 Bacteria 5922
1361 Ga0495606_0017462 3300046507 Bacteria 5423
1362 Ga0495606_0026214 3300046507 Bacteria 4156
1363 Ga0495606_0027510 3300046507 Bacteria 4030
1364 Ga0495606_0028829 3300046507 Bacteria 3908
1365 Ga0495606_0058521 3300046507 Bacteria 2476
1366 Ga0495606_0111305 3300046507 Bacteria 1651
1367 Ga0495608_0002285 3300046511 Bacteria 13831
1368 Ga0495608_0009653 3300046511 Bacteria 6733
1369 Ga0495608_0032757 3300046511 Bacteria 3512
1370 Ga0495610_0000014 3300046512 Bacteria 444708
1371 Ga0495610_0001174 3300046512 Bacteria 23735
1372 Ga0495610_0002536 3300046512 Bacteria 15230
1373 Ga0495610_0008287 3300046512 Bacteria 6751
1374 Ga0495610_0011267 3300046512 Bacteria 5480
1375 Ga0495610_0017992 3300046512 Bacteria 4006
1376 Ga0495610_0061222 3300046512 Bacteria 1789
1377 Ga0495616_0000157 3300046513 Bacteria 59518
1378 Ga0495616_0003730 3300046513 Bacteria 9718
1379 Ga0495616_0005975 3300046513 Bacteria 7426
1380 Ga0495616_0006610 3300046513 Bacteria 7004
1381 Ga0495616_0008291 3300046513 Bacteria 6167
1382 Ga0495616_0009471 3300046513 Bacteria 5690
1383 Ga0495616_0013452 3300046513 Bacteria 4615
1384 Ga0495616_0019415 3300046513 Bacteria 3710
1385 Ga0495616_0031569 3300046513 Bacteria 2772
1386 Ga0495616_0045414 3300046513 Bacteria 2223
1387 Ga0495616_0052437 3300046513 Bacteria 2031
1388 Ga0495618_0002173 3300046514 Bacteria 12828
1389 Ga0495618_0004385 3300046514 Bacteria 8678
1390 Ga0495618_0005165 3300046514 Bacteria 7979
1391 Ga0495618_0041033 3300046514 Bacteria 2913
1392 Ga0495618_0149271 3300046514 Bacteria 1493
1393 Ga0495620_0012913 3300046515 Bacteria 4294
1394 Ga0495620_0045387 3300046515 Bacteria 1903
1395 Ga0495628_0001227 3300046516 Bacteria 23459
1396 Ga0495628_0002006 3300046516 Bacteria 18454
1397 Ga0495628_0002322 3300046516 Bacteria 17200
1398 Ga0495628_0009437 3300046516 Bacteria 8329
1399 Ga0495628_0013732 3300046516 Bacteria 6808
1400 Ga0495628_0021622 3300046516 Bacteria 5289
1401 Ga0495628_0101241 3300046516 Bacteria 2223
1402 Ga0495630_0001736 3300046517 Bacteria 15213
1403 Ga0495630_0009319 3300046517 Bacteria 7059
1404 Ga0495630_0010824 3300046517 Bacteria 6587
1405 Ga0495630_0031536 3300046517 Bacteria 3946
1406 Ga0495630_0057825 3300046517 Bacteria 2907
1407 Ga0495630_0189186 3300046517 Bacteria 1570
1408 Ga0495631_0000272 3300046518 Bacteria 36059
1409 Ga0495631_0000791 3300046518 Bacteria 20226
1410 Ga0495631_0009119 3300046518 Bacteria 4968
1411 Ga0495631_0009844 3300046518 Bacteria 4757
1412 Ga0495631_0021780 3300046518 Bacteria 2983
1413 Ga0495631_0045606 3300046518 Bacteria 1930
1414 Ga0495632_0000017 3300046519 Bacteria 228941
1415 Ga0495632_0009675 3300046519 Bacteria 5787
1416 Ga0495632_0011802 3300046519 Bacteria 5084
1417 Ga0495632_0014248 3300046519 Bacteria 4504
1418 Ga0495632_0018300 3300046519 Bacteria 3847
1419 Ga0495637_0000003 3300046520 Bacteria 623293
1420 Ga0495637_0000142 3300046520 Bacteria 54212
1421 Ga0495637_0003152 3300046520 Bacteria 8802
1422 Ga0495637_0010369 3300046520 Bacteria 4511
1423 Ga0495637_0022607 3300046520 Bacteria 2866
1424 Ga0495643_0000082 3300046522 Bacteria 159651
1425 Ga0495643_0000085 3300046522 Bacteria 157223
1426 Ga0495643_0000160 3300046522 Bacteria 107502
1427 Ga0495643_0000399 3300046522 Bacteria 57013
1428 Ga0495643_0000992 3300046522 Bacteria 28984
1429 Ga0495643_0005101 3300046522 Bacteria 8982
1430 Ga0495643_0016840 3300046522 Bacteria 4289
1431 Ga0495643_0032926 3300046522 Bacteria 2871
1432 Ga0495644_0000831 3300046523 Bacteria 12737
1433 Ga0495644_0009921 3300046523 Bacteria 3668
1434 Ga0495644_0019149 3300046523 Bacteria 2613
1435 Ga0495648_0000019 3300046524 Bacteria 276407
1436 Ga0495648_0000052 3300046524 Bacteria 162169
1437 Ga0495648_0000732 3300046524 Bacteria 35084
1438 Ga0495648_0007157 3300046524 Bacteria 8966
1439 Ga0495648_0007724 3300046524 Bacteria 8565
1440 Ga0495648_0012877 3300046524 Bacteria 6213
1441 Ga0495648_0013458 3300046524 Bacteria 6046
1442 Ga0495648_0030425 3300046524 Bacteria 3569
1443 Ga0495663_0007852 3300046525 Bacteria 2949
1444 Ga0495666_0000199 3300046526 Bacteria 25643
1445 Ga0495666_0002778 3300046526 Bacteria 8743
1446 Ga0495666_0003438 3300046526 Bacteria 7983
1447 Ga0495666_0004516 3300046526 Bacteria 7030
1448 Ga0495666_0030497 3300046526 Bacteria 2645
1449 Ga0495666_0063123 3300046526 Bacteria 1768
1450 Ga0495642_0000449 3300046528 Bacteria 21699
1451 Ga0495642_0001035 3300046528 Bacteria 12914
1452 Ga0495642_0006707 3300046528 Bacteria 4419
1453 Ga0495642_0011663 3300046528 Bacteria 3382
1454 Ga0495642_0014960 3300046528 Bacteria 3011
1455 Ga0495642_0036448 3300046528 Bacteria 1987
1456 Ga0495642_0045668 3300046528 Bacteria 1790
1457 Ga0495652_0002976 3300046529 Bacteria 17031
1458 Ga0495652_0005308 3300046529 Bacteria 12152
1459 Ga0495652_0005804 3300046529 Bacteria 11558
1460 Ga0495652_0047949 3300046529 Bacteria 3662
1461 Ga0495652_0057709 3300046529 Bacteria 3290
1462 Ga0495652_0080736 3300046529 Bacteria 2685
1463 Ga0495652_0154788 3300046529 Bacteria 1786
1464 Ga0495654_0000014 3300046530 Bacteria 312126
1465 Ga0495654_0005229 3300046530 Bacteria 7569
1466 Ga0495654_0010327 3300046530 Bacteria 5080
1467 Ga0495654_0012762 3300046530 Bacteria 4510
1468 Ga0495654_0031730 3300046530 Bacteria 2681
1469 Ga0495665_0004802 3300046531 Bacteria 7298
1470 Ga0495665_0006439 3300046531 Bacteria 6339
1471 Ga0495665_0016196 3300046531 Bacteria 4017
1472 Ga0495665_0020312 3300046531 Bacteria 3568
1473 Ga0495665_0029480 3300046531 Bacteria 2939
1474 Ga0495640_0002839 3300046533 Bacteria 13934
1475 Ga0495640_0004166 3300046533 Bacteria 11565
1476 Ga0495640_0005911 3300046533 Bacteria 9704
1477 Ga0495640_0009652 3300046533 Bacteria 7504
1478 Ga0495640_0106448 3300046533 Bacteria 1836
1479 Ga0495586_0004875 3300046535 Bacteria 7177
1480 Ga0495586_0009640 3300046535 Bacteria 5142
1481 Ga0495586_0090358 3300046535 Bacteria 1691
1482 Ga0495586_0105397 3300046535 Bacteria 1567
1483 Ga0495587_0007690 3300046536 Bacteria 6972
1484 Ga0495587_0017118 3300046536 Bacteria 4507
1485 Ga0495587_0026723 3300046536 Bacteria 3516
1486 Ga0495609_0000038 3300046538 Bacteria 182264
1487 Ga0495609_0000434 3300046538 Bacteria 34673
1488 Ga0495609_0000537 3300046538 Bacteria 30126
1489 Ga0495609_0002203 3300046538 Bacteria 12207
1490 Ga0495609_0002312 3300046538 Bacteria 11786
1491 Ga0495609_0014352 3300046538 Bacteria 3726
1492 Ga0495609_0024405 3300046538 Bacteria 2774
1493 Ga0495609_0044822 3300046538 Bacteria 1983
1494 Ga0495621_0028115 3300046539 Bacteria 1910
1495 Ga0495597_0000535 3300046542 Bacteria 31448
1496 Ga0495597_0001237 3300046542 Bacteria 18972
1497 Ga0495597_0002761 3300046542 Bacteria 10816
1498 Ga0495597_0003960 3300046542 Bacteria 8335
1499 Ga0495597_0004345 3300046542 Bacteria 7815
1500 Ga0495597_0004947 3300046542 Bacteria 7163
1501 Ga0495597_0005518 3300046542 Bacteria 6688
1502 Ga0495597_0006195 3300046542 Bacteria 6213
1503 Ga0495597_0056154 3300046542 Bacteria 1725
1504 Ga0495645_0000247 3300046543 Bacteria 39450
1505 Ga0495645_0004493 3300046543 Bacteria 9523
1506 Ga0495645_0041113 3300046543 Bacteria 3371
1507 Ga0495645_0074233 3300046543 Bacteria 2449
1508 Ga0495645_0116787 3300046543 Bacteria 1883
1509 Ga0495645_0117510 3300046543 Bacteria 1876
1510 Ga0495622_0000034 3300046557 Bacteria 123671
1511 Ga0495622_0000071 3300046557 Bacteria 89071
1512 Ga0495622_0000349 3300046557 Bacteria 32902
1513 Ga0495622_0008287 3300046557 Bacteria 4814
1514 Ga0495622_0021691 3300046557 Bacteria 2990
1515 Ga0495622_0053050 3300046557 Bacteria 1881
1516 Ga0495633_0000086 3300046558 Bacteria 124357
1517 Ga0495633_0000217 3300046558 Bacteria 71892
1518 Ga0495633_0007711 3300046558 Bacteria 6157
1519 Ga0495633_0009061 3300046558 Bacteria 5534
1520 Ga0495633_0034401 3300046558 Bacteria 2437
1521 Ga0495633_0043439 3300046558 Bacteria 2132
1522 Ga0495633_0049078 3300046558 Bacteria 1992
1523 Ga0495633_0054526 3300046558 Bacteria 1880
1524 Ga0495633_0060795 3300046558 Bacteria 1769
1525 Ga0495633_0076119 3300046558 Bacteria 1562
1526 Ga0495667_0019475 3300046559 Bacteria 4579
1527 Ga0495667_0051037 3300046559 Bacteria 2729
1528 Ga0495667_0056055 3300046559 Bacteria 2592
1529 Ga0495668_0000231 3300046616 Bacteria 79433
1530 Ga0495668_0000308 3300046616 Bacteria 67599
1531 Ga0495668_0000822 3300046616 Bacteria 35513
1532 Ga0495668_0001569 3300046616 Bacteria 21645
1533 Ga0495668_0002035 3300046616 Bacteria 17616
1534 Ga0495668_0002722 3300046616 Bacteria 14158
1535 Ga0495668_0003129 3300046616 Bacteria 12780
1536 Ga0495668_0047238 3300046616 Bacteria 2390
1537 Ga0495668_0092212 3300046616 Bacteria 1659
1538 Ga0495634_0004419 3300046642 Bacteria 11046
1539 Ga0495634_0008989 3300046642 Bacteria 7394
1540 Ga0495611_0008271 3300046648 Bacteria 4410
1541 Ga0495611_0011942 3300046648 Bacteria 3688
1542 Ga0495611_0063754 3300046648 Bacteria 1677
1543 Ga0495611_0066798 3300046648 Bacteria 1640
1544 Ga0495611_0092627 3300046648 Bacteria 1397
1545 Ga0495625_0000447 3300046660 Bacteria 62017
1546 Ga0495625_0008737 3300046660 Bacteria 8587
1547 Ga0495625_0009504 3300046660 Bacteria 8125
1548 Ga0495625_0010695 3300046660 Bacteria 7559
1549 Ga0495625_0011910 3300046660 Bacteria 7061
1550 Ga0495625_0025498 3300046660 Bacteria 4483
1551 Ga0495625_0032036 3300046660 Bacteria 3904
1552 Ga0495635_0008843 3300046663 Bacteria 7031
1553 Ga0495635_0010196 3300046663 Bacteria 6568
1554 Ga0495635_0011715 3300046663 Bacteria 6148
1555 Ga0495635_0021754 3300046663 Bacteria 4470
1556 Ga0495635_0036085 3300046663 Bacteria 3428
1557 Ga0495635_0038909 3300046663 Bacteria 3292
1558 Ga0495659_0000272 3300046664 Bacteria 21144
1559 Ga0495659_0026864 3300046664 Bacteria 1982
1560 Ga0495661_0001562 3300046665 Bacteria 18875
1561 Ga0495661_0001766 3300046665 Bacteria 17376
1562 Ga0495661_0002878 3300046665 Bacteria 13018
1563 Ga0495661_0005985 3300046665 Bacteria 8586
1564 Ga0495661_0007699 3300046665 Bacteria 7501
1565 Ga0495661_0007851 3300046665 Bacteria 7424
1566 Ga0495661_0017607 3300046665 Bacteria 4717
1567 Ga0495661_0025557 3300046665 Bacteria 3812
1568 Ga0495661_0038428 3300046665 Bacteria 2981
1569 Ga0495661_0039078 3300046665 Bacteria 2950
1570 Ga0495661_0040712 3300046665 Bacteria 2879
1571 Ga0495661_0041600 3300046665 Bacteria 2841
1572 Ga0495661_0068835 3300046665 Bacteria 2076
1573 Ga0495588_0000156 3300046674 Bacteria 93559
1574 Ga0495588_0010066 3300046674 Bacteria 4384
1575 Ga0495588_0013550 3300046674 Bacteria 3886
1576 Ga0495588_0023485 3300046674 Bacteria 3053
1577 Ga0495588_0047528 3300046674 Bacteria 2204
1578 Ga0495588_0076250 3300046674 Bacteria 1747
1579 Ga0495588_0080376 3300046674 Bacteria 1701
1580 Ga0495657_0009194 3300046675 Bacteria 7501
1581 Ga0495599_0000345 3300046678 Bacteria 27538
1582 Ga0495599_0003910 3300046678 Bacteria 8768
1583 Ga0495599_0020682 3300046678 Bacteria 4101
1584 Ga0495599_0020769 3300046678 Bacteria 4091
1585 Ga0495599_0054235 3300046678 Bacteria 2511
1586 Ga0495599_0058521 3300046678 Bacteria 2410
1587 Ga0495623_0004581 3300046679 Bacteria 9082
1588 Ga0495623_0017479 3300046679 Bacteria 4634
1589 Ga0495623_0019318 3300046679 Bacteria 4405
1590 Ga0495623_0020589 3300046679 Bacteria 4263
1591 Ga0495623_0040395 3300046679 Bacteria 2979
1592 Ga0495646_0004004 3300046680 Bacteria 9228
1593 Ga0495646_0007283 3300046680 Bacteria 7026
1594 Ga0495646_0010465 3300046680 Bacteria 5892
1595 Ga0495646_0011678 3300046680 Bacteria 5582
1596 Ga0495646_0062765 3300046680 Bacteria 2208
1597 Ga0495647_0002049 3300046681 Bacteria 6309
1598 Ga0495647_0013319 3300046681 Bacteria 2847
1599 Ga0495658_0081552 3300046683 Bacteria 1899
1600 Ga0495669_0000032 3300046684 Bacteria 100472
1601 Ga0495669_0002103 3300046684 Bacteria 8161
1602 Ga0495669_0025637 3300046684 Bacteria 2572
1603 Ga0495669_0026320 3300046684 Bacteria 2542
1604 Ga0495669_0031466 3300046684 Bacteria 2330
1605 Ga0495669_0043492 3300046684 Bacteria 2000
1606 Ga0495613_0002201 3300046689 Bacteria 14753
1607 Ga0495613_0027279 3300046689 Bacteria 4250
1608 Ga0495613_0042351 3300046689 Bacteria 3369
1609 Ga0495613_0049296 3300046689 Bacteria 3108
1610 Ga0495613_0065453 3300046689 Bacteria 2656
1611 Ga0495613_0079918 3300046689 Bacteria 2377
1612 Ga0495613_0141158 3300046689 Bacteria 1721
1613 Ga0495624_0001654 3300046690 Bacteria 17089
1614 Ga0495624_0014854 3300046690 Bacteria 5274
1615 Ga0495624_0053602 3300046690 Bacteria 2546
1616 Ga0495624_0066848 3300046690 Bacteria 2243
1617 Ga0495624_0132125 3300046690 Bacteria 1530
1618 Ga0495624_0147497 3300046690 Bacteria 1439
1619 Ga0495670_0000920 3300046691 Bacteria 14206
1620 Ga0495670_0004415 3300046691 Bacteria 6901
1621 Ga0495670_0017378 3300046691 Bacteria 3539
1622 Ga0495670_0017711 3300046691 Bacteria 3508
1623 Ga0495670_0028611 3300046691 Bacteria 2762
1624 Ga0495670_0040494 3300046691 Bacteria 2323
1625 Ga0495670_0090162 3300046691 Bacteria 1568
1626 Ga0495671_0000005 3300046692 Bacteria 509397
1627 Ga0495671_0001606 3300046692 Bacteria 14869
1628 Ga0495671_0001885 3300046692 Bacteria 13469
1629 Ga0495671_0016807 3300046692 Bacteria 3901
1630 Ga0495649_0001623 3300046694 Bacteria 16726
1631 Ga0495649_0002812 3300046694 Bacteria 12114
1632 Ga0495649_0008870 3300046694 Bacteria 6020
1633 Ga0495649_0008873 3300046694 Bacteria 6019
1634 Ga0495649_0014241 3300046694 Bacteria 4566
1635 Ga0495649_0017212 3300046694 Bacteria 4082
1636 Ga0495649_0017985 3300046694 Bacteria 3983
1637 Ga0495649_0032362 3300046694 Bacteria 2880
1638 Ga0495649_0039696 3300046694 Bacteria 2580
1639 Ga0495589_0000074 3300046794 Bacteria 93716
1640 Ga0495589_0000099 3300046794 Bacteria 83606
1641 Ga0495589_0001423 3300046794 Bacteria 13829
1642 Ga0495589_0006294 3300046794 Bacteria 6269
1643 Ga0495589_0006917 3300046794 Bacteria 5957
1644 Ga0495589_0017339 3300046794 Bacteria 3697
1645 Ga0495600_0001954 3300046809 Bacteria 11584
1646 Ga0495600_0006364 3300046809 Bacteria 7184
1647 Ga0495600_0009048 3300046809 Bacteria 6138
1648 Ga0495600_0082094 3300046809 Bacteria 2103
1649 Ga0495600_0118576 3300046809 Bacteria 1721
1650 Ga0495600_0138134 3300046809 Bacteria 1582
1651 Ga0495660_0000047 3300046810 Bacteria 149291
1652 Ga0495660_0010921 3300046810 Bacteria 5277
1653 Ga0495660_0012239 3300046810 Bacteria 4978
1654 Ga0495660_0014380 3300046810 Bacteria 4580
1655 Ga0495660_0028815 3300046810 Bacteria 3135
1656 Ga0495660_0081233 3300046810 Bacteria 1699
1657 Ga0495660_0082492 3300046810 Bacteria 1683
1658 Ga0495581_0000213 3300047315 Bacteria 27408
1659 Ga0495581_0003264 3300047315 Bacteria 9298
1660 Ga0495581_0036333 3300047315 Bacteria 2850
1661 Ga0495604_0015545 3300047317 Bacteria 6075
1662 Ga0495604_0015812 3300047317 Bacteria 6022
1663 Ga0495604_0024936 3300047317 Bacteria 4768
1664 Ga0495604_0047889 3300047317 Bacteria 3327
1665 Ga0495604_0048118 3300047317 Bacteria 3317
1666 Ga0495604_0067800 3300047317 Bacteria 2710
1667 Ga0495636_0000635 3300047318 Bacteria 12874
1668 Ga0495636_0012512 3300047318 Bacteria 3360
1669 Ga0495674_0005197 3300047319 Bacteria 12503
1670 Ga0495674_0012431 3300047319 Bacteria 8022
1671 Ga0495674_0015155 3300047319 Bacteria 7211
1672 Ga0495674_0032425 3300047319 Bacteria 4737
1673 Ga0495674_0046861 3300047319 Bacteria 3835
1674 Ga0495674_0098320 3300047319 Bacteria 2492
1675 Ga0495674_0282145 3300047319 Bacteria 1360
1676 Ga0495672_0000026 3300047320 Bacteria 340319
1677 Ga0495672_0000081 3300047320 Bacteria 159863
1678 Ga0495672_0000256 3300047320 Bacteria 74232
1679 Ga0495672_0000421 3300047320 Bacteria 50887
1680 Ga0495672_0000532 3300047320 Bacteria 43305
1681 Ga0495672_0001024 3300047320 Bacteria 28735
1682 Ga0495672_0001885 3300047320 Bacteria 19961
1683 Ga0495672_0005608 3300047320 Bacteria 9909
1684 Ga0495672_0015255 3300047320 Bacteria 5223
1685 Ga0495672_0015962 3300047320 Bacteria 5084
1686 Ga0495672_0078650 3300047320 Bacteria 1844
1687 Ga0495676_0000031 3300047321 Bacteria 132364
1688 Ga0495676_0015996 3300047321 Bacteria 6662
1689 Ga0495676_0019848 3300047321 Bacteria 5906
1690 Ga0495676_0032388 3300047321 Bacteria 4412
1691 Ga0495680_0003749 3300047322 Bacteria 14816
1692 Ga0495680_0006910 3300047322 Bacteria 10471
1693 Ga0495680_0009905 3300047322 Bacteria 8542
1694 Ga0495680_0024413 3300047322 Bacteria 5015
1695 Ga0495680_0042030 3300047322 Bacteria 3630
1696 Ga0495680_0064052 3300047322 Bacteria 2820
1697 Ga0495680_0074276 3300047322 Bacteria 2582
1698 Ga0495683_0000211 3300047323 Bacteria 55182
1699 Ga0495683_0000799 3300047323 Bacteria 22405
1700 Ga0495683_0001275 3300047323 Bacteria 17066
1701 Ga0495683_0005185 3300047323 Bacteria 7257
1702 Ga0495683_0007236 3300047323 Bacteria 6023
1703 Ga0495683_0013201 3300047323 Bacteria 4325
1704 Ga0495683_0022535 3300047323 Bacteria 3238
1705 Ga0495683_0030361 3300047323 Bacteria 2757
1706 Ga0495683_0046539 3300047323 Bacteria 2177
1707 Ga0495687_000071 3300047443 Bacteria 159096
1708 Ga0495687_000172 3300047443 Bacteria 95963
1709 Ga0495687_000216 3300047443 Bacteria 81734
1710 Ga0495687_000238 3300047443 Bacteria 76186
1711 Ga0495687_000446 3300047443 Bacteria 50964
1712 Ga0495687_000699 3300047443 Bacteria 37523
1713 Ga0495687_000941 3300047443 Bacteria 30047
1714 Ga0495687_004764 3300047443 Bacteria 8963
1715 Ga0495687_006200 3300047443 Bacteria 7387
1716 Ga0495687_008808 3300047443 Bacteria 5723
1717 Ga0495687_008897 3300047443 Bacteria 5685
1718 Ga0495687_015441 3300047443 Bacteria 3883
1719 Ga0495675_0004732 3300047444 Bacteria 8263
1720 Ga0495675_0005062 3300047444 Bacteria 8022
1721 Ga0495675_0006408 3300047444 Bacteria 7203
1722 Ga0495675_0007491 3300047444 Bacteria 6723
1723 Ga0495675_0013243 3300047444 Bacteria 5205
1724 Ga0495675_0016025 3300047444 Bacteria 4739
1725 Ga0495675_0035531 3300047444 Bacteria 3182
1726 Ga0495677_0000016 3300047445 Bacteria 126981
1727 Ga0495677_0005954 3300047445 Bacteria 4618
1728 Ga0495677_0007648 3300047445 Bacteria 4032
1729 Ga0495677_0008031 3300047445 Bacteria 3921
1730 Ga0495677_0009052 3300047445 Bacteria 3682
1731 Ga0495677_0028623 3300047445 Bacteria 2024
1732 Ga0495679_000742 3300047446 Bacteria 20949
1733 Ga0495679_003724 3300047446 Bacteria 7254
1734 Ga0495679_004470 3300047446 Bacteria 6435
1735 Ga0495679_012149 3300047446 Bacteria 3289
1736 Ga0495679_017101 3300047446 Bacteria 2604
1737 Ga0495679_022901 3300047446 Bacteria 2129
1738 Ga0495685_000034 3300047447 Bacteria 56654
1739 Ga0495685_026406 3300047447 Bacteria 1998
1740 Ga0495673_0000008 3300047469 Bacteria 752462
1741 Ga0495673_0000009 3300047469 Bacteria 731993
1742 Ga0495673_0000012 3300047469 Bacteria 656908
1743 Ga0495673_0006968 3300047469 Bacteria 6577
1744 Ga0495673_0013138 3300047469 Bacteria 4360
1745 Ga0495681_0000455 3300047470 Bacteria 31371
1746 Ga0495681_0001167 3300047470 Bacteria 19943
1747 Ga0495681_0003571 3300047470 Bacteria 10824
1748 Ga0495681_0004083 3300047470 Bacteria 10043
1749 Ga0495681_0005081 3300047470 Bacteria 8869
1750 Ga0495681_0049198 3300047470 Bacteria 1993
1751 Ga0495684_0021144 3300047471 Bacteria 5013
1752 Ga0495684_0049257 3300047471 Bacteria 3219
1753 Ga0495684_0050172 3300047471 Bacteria 3187
1754 Ga0495686_0000114 3300047472 Bacteria 167232
1755 Ga0495686_0000130 3300047472 Bacteria 152244
1756 Ga0495686_0000214 3300047472 Bacteria 106493
1757 Ga0495686_0000677 3300047472 Bacteria 46044
1758 Ga0495686_0023072 3300047472 Bacteria 4111
1759 Ga0495686_0053852 3300047472 Bacteria 2520
1760 Ga0495686_0060701 3300047472 Bacteria 2350
1761 Ga0495593_0002595 3300047673 Bacteria 10859
1762 Ga0495593_0003130 3300047673 Bacteria 9940
1763 Ga0495593_0004295 3300047673 Bacteria 8474
1764 Ga0495593_0035125 3300047673 Bacteria 2723
1765 Ga0495593_0036769 3300047673 Bacteria 2653
1766 Ga0495593_0042247 3300047673 Bacteria 2447
1767 Ga0495593_0080895 3300047673 Bacteria 1680
1768 Ga0495602_0013599 3300048088 Bacteria 8310
1769 Ga0495602_0015119 3300048088 Bacteria 7802
1770 Ga0495602_0015582 3300048088 Bacteria 7666
1771 Ga0495602_0038338 3300048088 Bacteria 4432
1772 Ga0495602_0057560 3300048088 Bacteria 3408
1773 Ga0495602_0202675 3300048088 Bacteria 1512
1774 Ga0495614_0001631 3300048089 Bacteria 9774
1775 Ga0495614_0004355 3300048089 Bacteria 6380
1776 Ga0495614_0013928 3300048089 Bacteria 3524
1777 Ga0495614_0039468 3300048089 Bacteria 2026
1778 Ga0495614_0046472 3300048089 Bacteria 1861
1779 Ga0495626_0000005 3300048091 Bacteria 337534
1780 Ga0495626_0000042 3300048091 Bacteria 169058
1781 Ga0495626_0002637 3300048091 Bacteria 12188
1782 Ga0495626_0003725 3300048091 Bacteria 9629
1783 Ga0495626_0009196 3300048091 Bacteria 5349
1784 Ga0495626_0009568 3300048091 Bacteria 5232
1785 Ga0495626_0010342 3300048091 Bacteria 4986
1786 Ga0495626_0021029 3300048091 Bacteria 3244
1787 Ga0495626_0049242 3300048091 Bacteria 1951
1788 Ga0495626_0054323 3300048091 Bacteria 1839
1789 Ga0495626_0064342 3300048091 Bacteria 1661
1790 Ga0495626_0070338 3300048091 Bacteria 1574
1791 Ga0496100_0021845 3300048903 Bacteria 3861
1792 Ga0496100_0025897 3300048903 Bacteria 3590
1793 Ga0496100_0034135 3300048903 Bacteria 3189
1794 Ga0496100_0123011 3300048903 Bacteria 1818
1795 Ga0496101_0007572 3300048904 Bacteria 7045
1796 Ga0496101_0033588 3300048904 Bacteria 3618
1797 Ga0496101_0089511 3300048904 Bacteria 2287
1798 Ga0496101_0231120 3300048904 Bacteria 1437
1799 Ga0496102_0000153 3300048905 Bacteria 94014
1800 Ga0496102_0010940 3300048905 Bacteria 7815
1801 Ga0496102_0014119 3300048905 Bacteria 6938
1802 Ga0496102_0018573 3300048905 Bacteria 6113
1803 Ga0496102_0021473 3300048905 Bacteria 5709
1804 Ga0496102_0040268 3300048905 Bacteria 4226
1805 Ga0496102_0042124 3300048905 Bacteria 4137
1806 Ga0496102_0070985 3300048905 Bacteria 3198
1807 Ga0496102_0100936 3300048905 Bacteria 2680
1808 Ga0496103_0006283 3300048906 Bacteria 7105
1809 Ga0496103_0007774 3300048906 Bacteria 6376
1810 Ga0496103_0025854 3300048906 Bacteria 3550
1811 Ga0496103_0030757 3300048906 Bacteria 3268
1812 Ga0496103_0055585 3300048906 Bacteria 2455
1813 Ga0496104_0000891 3300048907 Bacteria 25675
1814 Ga0496104_0066672 3300048907 Bacteria 3418
1815 Ga0496104_0161055 3300048907 Bacteria 2152
1816 Ga0496104_0162804 3300048907 Bacteria 2140
1817 Ga0496104_0170620 3300048907 Bacteria 2086
1818 Ga0496105_0005306 3300048908 Bacteria 9770
1819 Ga0496105_0006907 3300048908 Bacteria 8738
1820 Ga0496105_0040631 3300048908 Bacteria 3835
1821 Ga0496105_0128961 3300048908 Bacteria 2086
1822 Ga0496106_0000162 3300048909 Bacteria 48305
1823 Ga0496106_0004246 3300048909 Bacteria 10663
1824 Ga0496106_0008554 3300048909 Bacteria 7572
1825 Ga0496106_0056835 3300048909 Bacteria 2958
1826 Ga0496106_0063207 3300048909 Bacteria 2813
1827 Ga0496106_0064254 3300048909 Bacteria 2791
1828 Ga0496106_0094273 3300048909 Bacteria 2314
1829 Ga0496106_0101891 3300048909 Bacteria 2227
1830 Ga0496107_0019168 3300048910 Bacteria 4826
1831 Ga0496107_0102590 3300048910 Bacteria 2098
1832 Ga0496108_0006422 3300048911 Bacteria 9533
1833 Ga0496109_0068437 3300048912 Bacteria 3255
1834 Ga0496109_0129450 3300048912 Bacteria 2355
1835 Ga0496110_0001119 3300048913 Bacteria 18923
1836 Ga0496110_0002372 3300048913 Bacteria 14103
1837 Ga0496110_0014359 3300048913 Bacteria 6574
1838 Ga0496111_0035464 3300048914 Bacteria 3565
1839 Ga0496111_0064487 3300048914 Bacteria 2657
1840 Ga0496112_0003046 3300048915 Bacteria 13716
1841 Ga0496112_0003721 3300048915 Bacteria 12730
1842 Ga0496112_0069434 3300048915 Bacteria 3481
1843 Ga0496113_0140577 3300048916 Bacteria 1899
1844 Ga0496114_0006589 3300048917 Bacteria 9155
1845 Ga0496114_0032115 3300048917 Bacteria 4320
1846 Ga0496114_0068335 3300048917 Bacteria 2983
1847 Ga0496114_0207294 3300048917 Bacteria 1719
1848 Ga0496115_0086587 3300048918 Bacteria 2556
1849 Ga0496115_0092277 3300048918 Bacteria 2475
1850 Ga0496115_0186053 3300048918 Bacteria 1716
1851 Ga0496116_0002301 3300048919 Bacteria 20255
1852 Ga0496116_0003977 3300048919 Bacteria 14348
1853 Ga0496116_0006519 3300048919 Bacteria 10578
1854 Ga0496116_0033932 3300048919 Bacteria 3611
1855 Ga0496116_0070262 3300048919 Bacteria 2222
1856 Ga0496117_0000075 3300048920 Bacteria 232451
1857 Ga0496117_0002965 3300048920 Bacteria 20478
1858 Ga0496117_0007390 3300048920 Bacteria 10751
1859 Ga0496117_0020664 3300048920 Bacteria 5359
1860 Ga0496117_0037899 3300048920 Bacteria 3584
1861 Ga0496117_0056524 3300048920 Bacteria 2732
1862 Ga0496117_0059875 3300048920 Bacteria 2627
1863 Ga0496117_0064872 3300048920 Bacteria 2486
1864 Ga0496118_0000055 3300048921 Bacteria 232451
1865 Ga0496118_0012622 3300048921 Bacteria 8084
1866 Ga0496118_0018649 3300048921 Bacteria 6241
1867 Ga0496118_0021867 3300048921 Bacteria 5611
1868 Ga0496118_0040006 3300048921 Bacteria 3733
1869 Ga0496118_0040474 3300048921 Bacteria 3705
1870 Ga0496118_0109880 3300048921 Bacteria 1833
1871 Ga0496119_0004847 3300048922 Bacteria 13183
1872 Ga0496120_0004304 3300048923 Bacteria 12065
1873 Ga0496120_0025949 3300048923 Bacteria 3628
1874 Ga0496121_0000647 3300048924 Bacteria 65033
1875 Ga0496121_0003706 3300048924 Bacteria 21439
1876 Ga0496121_0009309 3300048924 Bacteria 11329
1877 Ga0496121_0013029 3300048924 Bacteria 8981
1878 Ga0496121_0022462 3300048924 Bacteria 6122
1879 Ga0496121_0026544 3300048924 Bacteria 5452
1880 Ga0496121_0033030 3300048924 Bacteria 4692
1881 Ga0496121_0037380 3300048924 Bacteria 4313
1882 Ga0496121_0039504 3300048924 Bacteria 4156
1883 Ga0496121_0088281 3300048924 Bacteria 2431
1884 Ga0496121_0098437 3300048924 Bacteria 2263
1885 Ga0496122_0000482 3300048925 Bacteria 82868
1886 Ga0496122_0000905 3300048925 Bacteria 54607
1887 Ga0496122_0003062 3300048925 Bacteria 22564
1888 Ga0496122_0003176 3300048925 Bacteria 21923
1889 Ga0496122_0022840 3300048925 Bacteria 5541
1890 Ga0496122_0042082 3300048925 Bacteria 3598
1891 Ga0496122_0051482 3300048925 Bacteria 3128
1892 Ga0496122_0066745 3300048925 Bacteria 2596
1893 Ga0496122_0086861 3300048925 Bacteria 2151
1894 Ga0496123_0000227 3300048926 Bacteria 113878
1895 Ga0496123_0000662 3300048926 Bacteria 56930
1896 Ga0496123_0002506 3300048926 Bacteria 22588
1897 Ga0496123_0008164 3300048926 Bacteria 9657
1898 Ga0496123_0009479 3300048926 Bacteria 8763
1899 Ga0496123_0011695 3300048926 Bacteria 7572
1900 Ga0496123_0025307 3300048926 Bacteria 4478
1901 Ga0496123_0031320 3300048926 Bacteria 3872
1902 Ga0496123_0076376 3300048926 Bacteria 2062
1903 Ga0496124_0000013 3300048927 Bacteria 484884
1904 Ga0496124_0005752 3300048927 Bacteria 13803
1905 Ga0496124_0049431 3300048927 Bacteria 3587
1906 Ga0496124_0078498 3300048927 Bacteria 2720
1907 Ga0496124_0100082 3300048927 Bacteria 2350
1908 Ga0496124_0125218 3300048927 Bacteria 2048
1909 Ga0496124_0151366 3300048927 Bacteria 1819
1910 Ga0496124_0202477 3300048927 Bacteria 1508
1911 Ga0496125_0000051 3300048928 Bacteria 285754
1912 Ga0496125_0000713 3300048928 Bacteria 54953
1913 Ga0496125_0001380 3300048928 Bacteria 35616
1914 Ga0496125_0004412 3300048928 Bacteria 16261
1915 Ga0496125_0004939 3300048928 Bacteria 15088
1916 Ga0496125_0005828 3300048928 Bacteria 13535
1917 Ga0496125_0041655 3300048928 Bacteria 3923
1918 Ga0496125_0049459 3300048928 Bacteria 3493
1919 Ga0496126_0001364 3300048929 Bacteria 38662
1920 Ga0496126_0008185 3300048929 Bacteria 11309
1921 Ga0496126_0028130 3300048929 Bacteria 5360
1922 Ga0496126_0032216 3300048929 Bacteria 4941
1923 Ga0496126_0204684 3300048929 Bacteria 1664
1924 Ga0495678_000027 3300049459 Bacteria 222075
1925 Ga0495678_000346 3300049459 Bacteria 48212
1926 Ga0495678_000353 3300049459 Bacteria 47333
1927 Ga0495678_000660 3300049459 Bacteria 31650
1928 Ga0495678_001631 3300049459 Bacteria 17084
1929 Ga0495678_008424 3300049459 Bacteria 5201
1930 Ga0495678_008745 3300049459 Bacteria 5075
1931 Ga0495678_011978 3300049459 Bacteria 4128
1932 Ga0495678_031217 3300049459 Bacteria 2223
1933 Ga0495682_0000226 3300049460 Bacteria 44179
1934 Ga0495682_0004354 3300049460 Bacteria 6079
1935 Ga0495682_0005090 3300049460 Bacteria 5513
1936 Ga0501031_0006864 3300049568 Bacteria 7429
1937 Ga0501031_0027564 3300049568 Bacteria 3703
1938 Ga0501031_0032072 3300049568 Bacteria 3426
1939 Ga0501032_0000221 3300049569 Bacteria 47402
1940 Ga0501032_0000970 3300049569 Bacteria 23236
1941 Ga0501032_0008286 3300049569 Bacteria 7573
1942 Ga0501032_0008735 3300049569 Bacteria 7379
1943 Ga0501032_0010987 3300049569 Bacteria 6509
1944 Ga0501032_0017436 3300049569 Bacteria 5044
1945 Ga0501032_0033277 3300049569 Bacteria 3532
1946 Ga0501032_0086149 3300049569 Bacteria 2088
1947 Ga0501032_0207753 3300049569 Bacteria 1277
1948 Ga0501033_0000668 3300049570 Bacteria 31668
1949 Ga0501033_0007516 3300049570 Bacteria 8480
1950 Ga0501033_0019907 3300049570 Bacteria 5072
1951 Ga0501033_0032391 3300049570 Bacteria 3926
1952 Ga0501033_0061546 3300049570 Bacteria 2766
1953 Ga0501033_0069036 3300049570 Bacteria 2598
1954 Ga0501034_0000134 3300049571 Bacteria 137745
1955 Ga0501034_0000759 3300049571 Bacteria 48520
1956 Ga0501034_0005349 3300049571 Bacteria 14062
1957 Ga0501034_0008519 3300049571 Bacteria 10824
1958 Ga0501034_0017542 3300049571 Bacteria 7342
1959 Ga0501034_0024667 3300049571 Bacteria 6115
1960 Ga0501034_0032264 3300049571 Bacteria 5321
1961 Ga0501034_0110282 3300049571 Bacteria 2743
1962 Ga0501034_0115501 3300049571 Bacteria 2673
1963 Ga0501034_0131147 3300049571 Bacteria 2489
1964 Ga0501034_0187591 3300049571 Bacteria 2031
1965 Ga0501036_0000552 3300049572 Bacteria 26879
1966 Ga0501036_0001501 3300049572 Bacteria 17997
1967 Ga0501036_0001538 3300049572 Bacteria 17824
1968 Ga0501036_0009445 3300049572 Bacteria 8021
1969 Ga0501036_0019041 3300049572 Bacteria 5760
1970 Ga0501036_0048043 3300049572 Bacteria 3614
1971 Ga0501036_0096500 3300049572 Bacteria 2499
1972 Ga0501036_0196801 3300049572 Bacteria 1696
1973 Ga0501037_0000686 3300049573 Bacteria 25818
1974 Ga0501037_0002298 3300049573 Bacteria 13792
1975 Ga0501037_0004363 3300049573 Bacteria 10269
1976 Ga0501037_0017144 3300049573 Bacteria 5330
1977 Ga0501037_0085314 3300049573 Bacteria 2286
1978 Ga0501037_0144999 3300049573 Bacteria 1698
1979 Ga0501037_0158841 3300049573 Bacteria 1612
1980 Ga0501037_0194478 3300049573 Bacteria 1435
1981 Ga0501038_0000960 3300049574 Bacteria 25782
1982 Ga0501038_0002842 3300049574 Bacteria 16112
1983 Ga0501038_0003252 3300049574 Bacteria 15152
1984 Ga0501038_0003593 3300049574 Bacteria 14430
1985 Ga0501038_0004394 3300049574 Bacteria 13119
1986 Ga0501038_0008551 3300049574 Bacteria 9398
1987 Ga0501038_0012847 3300049574 Bacteria 7643
1988 Ga0501038_0015525 3300049574 Bacteria 6923
1989 Ga0501038_0022931 3300049574 Bacteria 5587
1990 Ga0501038_0029026 3300049574 Bacteria 4906
1991 Ga0501038_0099959 3300049574 Bacteria 2417
1992 Ga0501038_0125604 3300049574 Bacteria 2112
1993 Ga0501039_0007282 3300049575 Bacteria 8427
1994 Ga0501039_0016968 3300049575 Bacteria 5581
1995 Ga0501039_0025173 3300049575 Bacteria 4572
1996 Ga0501039_0032691 3300049575 Bacteria 4011
1997 Ga0501039_0041643 3300049575 Bacteria 3548
1998 Ga0501039_0060266 3300049575 Bacteria 2939
1999 Ga0501039_0103080 3300049575 Bacteria 2227
2000 Ga0501040_0014410 3300049576 Bacteria 5209
2001 Ga0501040_0075461 3300049576 Bacteria 2330
2002 Ga0501041_0008018 3300049577 Bacteria 6214
2003 Ga0501041_0047625 3300049577 Bacteria 2610
2004 Ga0501042_0000507 3300049578 Bacteria 20293
2005 Ga0501042_0017864 3300049578 Bacteria 4901
2006 Ga0501042_0100461 3300049578 Bacteria 2080
2007 Ga0501043_0000590 3300049579 Bacteria 32162
2008 Ga0501043_0006325 3300049579 Bacteria 9511
2009 Ga0501043_0009032 3300049579 Bacteria 7841
2010 Ga0501043_0011435 3300049579 Bacteria 6949
2011 Ga0501043_0011488 3300049579 Bacteria 6931
2012 Ga0501043_0017915 3300049579 Bacteria 5555
2013 Ga0501043_0041120 3300049579 Bacteria 3632
2014 Ga0501043_0041412 3300049579 Bacteria 3619
2015 Ga0501043_0075125 3300049579 Bacteria 2655
2016 Ga0501046_0001415 3300049580 Bacteria 23077
2017 Ga0501046_0001675 3300049580 Bacteria 21213
2018 Ga0501046_0001989 3300049580 Bacteria 19418
2019 Ga0501046_0002058 3300049580 Bacteria 19092
2020 Ga0501046_0003768 3300049580 Bacteria 13880
2021 Ga0501046_0016345 3300049580 Bacteria 6217
2022 Ga0501046_0080284 3300049580 Bacteria 2521
2023 Ga0501047_0002329 3300049581 Bacteria 18145
2024 Ga0501047_0004747 3300049581 Bacteria 12779
2025 Ga0501047_0005593 3300049581 Bacteria 11834
2026 Ga0501047_0007469 3300049581 Bacteria 10288
2027 Ga0501047_0011407 3300049581 Bacteria 8411
2028 Ga0501047_0016356 3300049581 Bacteria 7080
2029 Ga0501047_0039260 3300049581 Bacteria 4579
2030 Ga0501047_0096933 3300049581 Bacteria 2827
2031 Ga0501048_0002597 3300049582 Bacteria 13843
2032 Ga0501048_0036116 3300049582 Bacteria 3553
2033 Ga0501067_0002250 3300049583 Bacteria 10653
2034 Ga0501067_0003668 3300049583 Bacteria 8461
2035 Ga0501067_0009429 3300049583 Bacteria 5409
2036 Ga0501068_0001005 3300049584 Bacteria 14851
2037 Ga0501068_0001270 3300049584 Bacteria 13395
2038 Ga0501068_0017117 3300049584 Bacteria 4189
2039 Ga0501068_0017863 3300049584 Bacteria 4106
2040 Ga0501068_0019551 3300049584 Bacteria 3936
2041 Ga0501069_0004273 3300049585 Bacteria 7384
2042 Ga0501069_0015372 3300049585 Bacteria 4101
2043 Ga0501069_0050503 3300049585 Bacteria 2313
2044 Ga0501069_0122061 3300049585 Bacteria 1488
2045 Ga0501070_0002752 3300049586 Bacteria 15349
2046 Ga0501070_0008651 3300049586 Bacteria 8603
2047 Ga0501070_0015005 3300049586 Bacteria 6518
2048 Ga0501070_0019636 3300049586 Bacteria 5666
2049 Ga0501070_0070123 3300049586 Bacteria 2902
2050 Ga0501070_0202207 3300049586 Bacteria 1631
2051 Ga0501071_0007920 3300049587 Bacteria 7006
2052 Ga0501071_0056320 3300049587 Bacteria 2839
2053 Ga0501071_0110353 3300049587 Bacteria 2033
2054 Ga0501072_0000721 3300049588 Bacteria 24037
2055 Ga0501072_0001241 3300049588 Bacteria 19034
2056 Ga0501072_0008347 3300049588 Bacteria 7866
2057 Ga0501072_0018503 3300049588 Bacteria 5366
2058 Ga0501073_0001319 3300049589 Bacteria 18263
2059 Ga0501073_0008012 3300049589 Bacteria 7845
2060 Ga0501073_0010466 3300049589 Bacteria 6801
2061 Ga0501074_0000084 3300049590 Bacteria 45955
2062 Ga0501074_0001435 3300049590 Bacteria 15927
2063 Ga0501074_0013097 3300049590 Bacteria 6029
2064 Ga0501074_0018070 3300049590 Bacteria 5123
2065 Ga0501074_0024532 3300049590 Bacteria 4383
2066 Ga0501074_0026813 3300049590 Bacteria 4177
2067 Ga0501074_0032543 3300049590 Bacteria 3777
2068 Ga0501074_0056238 3300049590 Bacteria 2836
2069 Ga0501074_0084198 3300049590 Bacteria 2280
2070 Ga0501075_0000035 3300049591 Bacteria 55355
2071 Ga0501075_0044205 3300049591 Bacteria 3341
2072 Ga0501076_0000199 3300049592 Bacteria 36171
2073 Ga0501076_0040681 3300049592 Bacteria 3654
2074 Ga0501076_0106281 3300049592 Bacteria 2265
2075 Ga0501077_0001173 3300049593 Bacteria 15848
2076 Ga0501077_0058351 3300049593 Bacteria 2450
2077 Ga0501209_001565 3300049656 Bacteria 3271
2078 Ga0501238_000551 3300049671 Bacteria 4317
2079 Ga0501079_0000770 3300049741 Bacteria 21928
2080 Ga0501079_0001484 3300049741 Bacteria 16607
2081 Ga0501079_0013290 3300049741 Bacteria 6277
2082 Ga0501079_0266696 3300049741 Bacteria 1338
2083 Ga0501080_0002074 3300049742 Bacteria 17377
2084 Ga0501080_0004675 3300049742 Bacteria 12215
2085 Ga0501080_0004781 3300049742 Bacteria 12080
2086 Ga0501080_0014265 3300049742 Bacteria 7317
2087 Ga0501080_0015482 3300049742 Bacteria 7031
2088 Ga0501080_0093425 3300049742 Bacteria 2793
2089 Ga0501080_0229633 3300049742 Bacteria 1696
2090 Ga0501081_0083308 3300049743 Bacteria 2241
2091 Ga0501081_0094342 3300049743 Bacteria 2108
2092 Ga0501083_0000252 3300049744 Bacteria 34143
2093 Ga0501083_0012538 3300049744 Bacteria 5930
2094 Ga0501083_0019326 3300049744 Bacteria 4746
2095 Ga0501083_0035807 3300049744 Bacteria 3390
2096 Ga0501269_000005 3300049766 Bacteria 77832
2097 Ga0501035_0003996 3300049822 Bacteria 14068
2098 Ga0501035_0007059 3300049822 Bacteria 10500
2099 Ga0501035_0007618 3300049822 Bacteria 10114
2100 Ga0501035_0008306 3300049822 Bacteria 9669
2101 Ga0501035_0009986 3300049822 Bacteria 8812
2102 Ga0501035_0010699 3300049822 Bacteria 8492
2103 Ga0501035_0012660 3300049822 Bacteria 7795
2104 Ga0501035_0012793 3300049822 Bacteria 7750
2105 Ga0501035_0013910 3300049822 Bacteria 7425
2106 Ga0501035_0020342 3300049822 Bacteria 6094
2107 Ga0501035_0064350 3300049822 Bacteria 3259
2108 Ga0501035_0128242 3300049822 Bacteria 2213
2109 Ga0501035_0253547 3300049822 Bacteria 1493
2110 Ga0501044_0000316 3300049823 Bacteria 61151
2111 Ga0501044_0000326 3300049823 Bacteria 60246
2112 Ga0501044_0001129 3300049823 Bacteria 31721
2113 Ga0501044_0001555 3300049823 Bacteria 26866
2114 Ga0501044_0006705 3300049823 Bacteria 12695
2115 Ga0501044_0007680 3300049823 Bacteria 11859
2116 Ga0501044_0013340 3300049823 Bacteria 8891
2117 Ga0501044_0018312 3300049823 Bacteria 7505
2118 Ga0501044_0029893 3300049823 Bacteria 5744
2119 Ga0501044_0035724 3300049823 Bacteria 5202
2120 Ga0501044_0037542 3300049823 Bacteria 5063
2121 Ga0501044_0048347 3300049823 Bacteria 4394
2122 Ga0501044_0102509 3300049823 Bacteria 2877
2123 Ga0501044_0238228 3300049823 Bacteria 1764
2124 Ga0501045_0001357 3300049824 Bacteria 16252
2125 Ga0501045_0001528 3300049824 Bacteria 15404
2126 Ga0501045_0038435 3300049824 Bacteria 3481
2127 Ga0501045_0068470 3300049824 Bacteria 2608
2128 Ga0501045_0076552 3300049824 Bacteria 2465
2129 Ga0501045_0123882 3300049824 Bacteria 1919
2130 Ga0501226_000002 3300049853 Bacteria 426935
2131 nmdc:mga03n38_43531_c1 3300050490 Bacteria 1968
2132 nmdc:mga00v17_14033_c1 3300050491 Bacteria 4463
2133 nmdc:mga00v17_170_c1 3300050491 Bacteria 38298
2134 nmdc:mga0k408_12785_c2 3300050493 Bacteria 4293
2135 nmdc:mga0k408_30518_c1 3300050493 Bacteria 3073
2136 nmdc:mga07m45_7326_c1 3300050496 Bacteria 5630
2137 nmdc:mga05p37_17300_c1 3300050507 Bacteria 8697
2138 nmdc:mga05p37_241_c1 3300050507 Bacteria 55841
2139 nmdc:mga09592_19325_c1 3300050508 Bacteria 5595
2140 nmdc:mga0qj67_143521_c1 3300050509 Unclassified 1936
2141 nmdc:mga0qj67_16366_c1 3300050509 Bacteria 5623
2142 nmdc:mga06r32_13918_c1 3300050510 Bacteria 7299
2143 nmdc:mga06r32_157901_c1 3300050510 Unclassified 2250
2144 nmdc:mga08y16_1258_c1 3300050511 Bacteria 25159
2145 nmdc:mga08y16_22715_c1 3300050511 Bacteria 5370
2146 nmdc:mga08y16_2325_c1 3300050511 Bacteria 19487
2147 nmdc:mga08y16_96759_c1 3300050511 Bacteria 3074
2148 nmdc:mga0n895_254085_c1 3300050512 Bacteria 1784
2149 nmdc:mga0n895_2883_c1 3300050512 Bacteria 13647
2150 nmdc:mga0rr50_5789_c1 3300050513 Bacteria 7423
2151 nmdc:mga0rr50_96357_c1 3300050513 Bacteria 2315
2152 nmdc:mga08x19_35328_c1 3300050514 Bacteria 3161
2153 nmdc:mga0a205_11980_c1 3300050515 Bacteria 8009
2154 nmdc:mga0a205_20190_c1 3300050515 Bacteria 6285
2155 Ga0495601_0003245 3300053077 Bacteria 9294
2156 Ga0495601_0004054 3300053077 Bacteria 8445
2157 Ga0495601_0005234 3300053077 Bacteria 7545
2158 Ga0495601_0012179 3300053077 Bacteria 5156
2159 Ga0495601_0021328 3300053077 Bacteria 3967
2160 Ga0495612_0001760 3300053078 Bacteria 8874
2161 Ga0495612_0015128 3300053078 Bacteria 3094
2162 Ga0495595_0000266 3300053084 Bacteria 20675
2163 Ga0495595_0001876 3300053084 Bacteria 8156
2164 Ga0495595_0012372 3300053084 Bacteria 3586
2165 Ga0495619_0002774 3300053085 Bacteria 11431
2166 Ga0495619_0026517 3300053085 Bacteria 3728
2167 Ga0495619_0061876 3300053085 Bacteria 2491
2168 Ga0495619_0163697 3300053085 Bacteria 1537
2169 Ga0500595_001195 3300053119 Bacteria 14339
2170 Ga0500595_024135 3300053119 Bacteria 2126
2171 Ga0500607_014149 3300053121 Bacteria 4635
2172 Ga0500618_000170 3300053125 Bacteria 54570
2173 Ga0500618_012824 3300053125 Bacteria 2183
2174 Ga0500642_0004977 3300053130 Bacteria 4233
2175 Ga0500655_014423 3300053133 Bacteria 1446
2176 Ga0500622_0000029 3300053156 Bacteria 213762
2177 Ga0500634_0031295 3300053161 Bacteria 2901
2178 Ga0500636_0000050 3300053177 Bacteria 56422
2179 Ga0500636_0003155 3300053177 Bacteria 9239
2180 Ga0501084_0000666 3300054114 Bacteria 26202
2181 Ga0501084_0003446 3300054114 Bacteria 12844
2182 Ga0501084_0006302 3300054114 Bacteria 9749
2183 Ga0501084_0020546 3300054114 Bacteria 5507
2184 Ga0501084_0023895 3300054114 Bacteria 5099
2185 Ga0501084_0055409 3300054114 Bacteria 3317
2186 Ga0500661_011237 3300055283 Bacteria 1622
2187 Ga0587083_0009977 3300059505 Bacteria 1527
2188 Ga0501082_0000640 3300060353 Bacteria 30915
2189 Ga0501082_0000750 3300060353 Bacteria 28493
2190 Ga0501082_0004946 3300060353 Bacteria 11625
2191 Ga0501082_0028353 3300060353 Bacteria 4824
2192 Ga0501082_0189801 3300060353 Bacteria 1788
2193 Ga0466962_0001912 3300061719 Bacteria 9801
2194 Ga0466962_0006689 3300061719 Bacteria 5526
2195 2501075053 2501025501 Bacteria 7768574
2196 2501084061 2501025502 Bacteria 9641094
2197 2501412748 2501025504 Bacteria 8008976
2198 2509130784 2508501125 Bacteria 7208311
2199 2511093384 2510917013 Bacteria 9951648
2200 2511099834 2510917014 Bacteria 8296963
2201 2511102395 2510917015 Bacteria 7950052
2202 2511249687 2511231003 Bacteria 5606035
2203 2511385817 2511231026 Bacteria 5225445
2204 2512348380 2512047030 Bacteria 9031815
2205 2513556089 2513237082 Bacteria 8640282
2206 2513564275 2513237083 Bacteria 8410967
2207 2513956681 2513237150 Bacteria 6553639
2208 2513962660 2513237151 Bacteria 6309801
2209 2514044489 2513237165 Bacteria 6771773
2210 2514050840 2513237166 Bacteria 10373764
2211 2515684800 2515154122 Bacteria 8609520
2212 2515690883 2515154123 Bacteria 6387382
2213 2516022286 2515154189 Bacteria 9629850
2214 2519457571 2519103095 Bacteria 6629912
2215 2521560068 2521172590 Bacteria 5047645
2216 2527079968 2526164713 Bacteria 6780608
2217 2545676817 2545555834 Bacteria 8130841
2218 2547376143 2547132103 Bacteria 5115736
2219 2550695172 2548876994 Bacteria 4904866
2220 2553008062 2551306416 Bacteria 6152985
2221 2563061589 2562617112 Bacteria 10918404
2222 2585294094 2582581311 Bacteria 6763856
2223 2587741905 2585428059 Bacteria 8696589
2224 2595318734 2593339198 Bacteria 7267884
2225 2596377259 2595698237 Bacteria 6712432
2226 2597031591 2596583598 Bacteria 5251611
2227 2599448056 2599185178 Bacteria 5365746
2228 2599741101 2599185239 Bacteria 8686614
2229 2599748408 2599185240 Bacteria 7968121
2230 2599902787 2599185292 Bacteria 6290804
2231 2600210320 2599185355 Bacteria 7968906
2232 2600443529 2600254954 Bacteria 5100516
2233 2600813853 2600255067 Bacteria 6795583
2234 2601666859 2600255292 Bacteria 6300551
2235 2602009017 2600255389 Bacteria 5275336
2236 2643800950 2643221556 Bacteria 7251154
2237 2643861624 2643221569 Bacteria 6064337
2238 2643980044 2643221594 Bacteria 5811388
2239 2644027013 2643221603 Bacteria 6147767
2240 2644123610 2643221621 Bacteria 6212786
2241 2644250543 2643221645 Bacteria 7207331
2242 2644358864 2643221664 Bacteria 7272945
2243 2644422612 2643221676 Bacteria 8119172
2244 2644471316 2643221684 Bacteria 7145183
2245 2644728173 2643221733 Bacteria 5690728
2246 2644733988 2643221734 Bacteria 5365412
2247 2673820518 2671180694 Bacteria 7506943
2248 2676745755 2675903129 Bacteria 7964495
2249 2713478545 2711768613 Bacteria 11048459
2250 2719641621 2718217991 Bacteria 7829542
2251 2729146288 2728369097 Bacteria 4333476
2252 2738738684 2738541280 Bacteria 6630198
2253 2738744940 2738541281 Bacteria 5112672
2254 2738823965 2738541296 Bacteria 7285013
2255 2738826218 2738541297 Bacteria 6549566
2256 2738836356 2738541298 Bacteria 7286732
2257 2738842498 2738541300 Bacteria 6675882
2258 2738877886 2738541306 Bacteria 7284992
2259 2739150015 2738541357 Bacteria 6549408
2260 2739189592 2738543002 Bacteria 7284546
2261 2739191934 2738543003 Bacteria 6549560
2262 2739224479 2738543008 Bacteria 7282815
2263 2739273245 2738543018 Bacteria 6718814
2264 2739318411 2738543026 Bacteria 6549408
2265 2739336652 2738543029 Bacteria 6549249
2266 2739342289 2738543030 Bacteria 6719714
2267 2739354170 2738543032 Bacteria 5115625
2268 2739611312 2739367655 Bacteria 4051151
2269 2746087287 2744054900 Bacteria 8399525
2270 2746093206 2744054901 Bacteria 8397047
2271 2753566138 2751185846 Bacteria 7242164
2272 2765571247 2765235838 Bacteria 5445269
2273 2792837007 2791355137 Bacteria 9654227
2274 2808905193 2808606373 Bacteria 4423627
2275 2808942290 2808606379 Bacteria 5022697
2276 2808972912 2808606384 Bacteria 8474373
2277 2808982586 2808606386 Bacteria 4471946
2278 2809007923 2808606390 Bacteria 8476311
2279 2809015437 2808606391 Bacteria 8308166
2280 2809033127 2808606395 Bacteria 6020352
2281 2809129587 2808606415 Bacteria 4576710
2282 2809146398 2808606418 Bacteria 6724496
2283 2809149358 2808606419 Bacteria 4576925
2284 2817259761 2816332253 Bacteria 6764532
2285 2817277430 2816332256 Bacteria 6891714
2286 2817453596 2816332286 Bacteria 6853759
2287 2819543794 2818991436 Bacteria 5376622
2288 2819592779 2818991445 Bacteria 4955017
2289 2819616431 2818991449 Bacteria 5518009
2290 2819624225 2818991450 Bacteria 6962147
2291 2819636857 2818991452 Bacteria 8442785
2292 2819675466 2818991459 Bacteria 8736032
2293 2819716733 2818991467 Bacteria 5893227
2294 2821134979 2821131069 Bacteria 6108407
2295 2823425135 2823421272 Bacteria 5372474
2296 2829748774 2829745981 Bacteria 5406054
2297 2839099088 2839094727 Bacteria 5534556
2298 2841915413 2841911363 Bacteria 6173697
2299 2841920615 2841917233 Bacteria 6173500
2300 2842332123 2842324504 Bacteria 9364110
2301 2842356425 2842348783 Bacteria 9002918
2302 2842461221 2842454564 Bacteria 8730687
2303 2842699705 2842698319 Bacteria 5190321
2304 2842715838 2842711865 Bacteria 7155354
2305 2842809172 2842805378 Bacteria 5385175
2306 2843695250 2843690924 Bacteria 5169057
2307 2846041668 2846037992 Bacteria 4526407
2308 2852619500 2852618963 Bacteria 4577824
2309 2855732817 2855730933 Bacteria 7047938
2310 2855771569 2855767633 Bacteria 7049357
2311 2856289350 2856287931 Bacteria 7223934
2312 2857362223 2857357740 Bacteria 9937880
2313 2857459632 2857453340 Bacteria 8090534
2314 2857542505 2857537821 Bacteria 5248181
2315 2857543364 2857542790 Bacteria 5326616
2316 2857552748 2857547612 Bacteria 6179999
2317 2857558122 2857553236 Bacteria 6166726
2318 2857558771 2857558681 Bacteria 6617694
2319 2857569648 2857564685 Bacteria 6290584
2320 2857578019 2857576091 Bacteria 5465855
2321 2861691963 2861691609 Bacteria 5628931
2322 2863426437 2863421361 Bacteria 7300805
2323 2870069343 2870068957 Bacteria 8925310
2324 2881929872 2881927736 Bacteria 3993927
2325 2883091381 2883087390 Bacteria 9532701
2326 2883295769 2883291878 Bacteria 5894118
2327 2883358547 2883354860 Bacteria 5865246
2328 2884815963 2884811622 Bacteria 5552861
2329 2884838654 2884836552 Bacteria 5219991
2330 2884854945 2884852848 Bacteria 5221161
2331 2885086328 2885080285 Bacteria 6355622
2332 2885269472 2885266251 Bacteria 4796748
2333 2885272423 2885270888 Bacteria 9831543
2334 2887376224 2887375801 Bacteria 5334027
2335 2889308487 2889306138 Bacteria 6358934
2336 2894655458 2894652903 Bacteria 4587256
2337 2895515745 2895511927 Bacteria 6802080
2338 2896156386 2896154374 Bacteria 5221518
2339 2898798534 2898795034 Bacteria 4294459
2340 2899275972 2899275550 Bacteria 3958688
2341 2900580406 2900577576 Bacteria 5438534
2342 2900637134 2900634093 Bacteria 10263517
2343 2902334115 2902330777 Bacteria 6395352
2344 2902410634 2902405164 Bacteria 6784948
2345 2902686738 2902682994 Bacteria 8951596
2346 2904428343 2904424332 Bacteria 7633521
2347 2904439042 2904434214 Bacteria 6230908
2348 2904440898 2904439833 Bacteria 5931679
2349 2904490179 2904483920 Bacteria 7545285
2350 2904535500 2904530477 Bacteria 5876334
2351 2904569398 2904564687 Bacteria 7609577
2352 2904576765 2904571731 Bacteria 7608790
2353 2904588359 2904584206 Bacteria 6028872
2354 2904594753 2904589729 Bacteria 6113573
2355 2904606016 2904601388 Bacteria 5884906
2356 2904621507 2904615490 Bacteria 10047340
2357 2904761707 2904755435 Bacteria 7986759
2358 2917701753 2917699015 Bacteria 7043791
2359 2919049065 2919046199 Bacteria 5567169
2360 2919084674 2919079590 Bacteria 5946433
2361 2919430065 2919425241 Bacteria 8055701
2362 2919476430 2919476304 Bacteria 5888696
2363 2919501856 2919501602 Bacteria 5286340
2364 2919533348 2919527303 Bacteria 7718827
2365 2921647675 2921643360 Bacteria 11448031
2366 2923513799 2923510766 Bacteria 5926163
2367 2926063529 2926063275 Bacteria 5285848
2368 2928063671 2928058823 Bacteria 5520022
2369 2928114149 2928108538 Bacteria 7360024
2370 2928127701 2928125067 Bacteria 5937560
2371 2928134361 2928130867 Bacteria 5467269
2372 2928141103 2928135762 Bacteria 7259641
2373 2928163105 2928157003 Bacteria 7522202
2374 2928170145 2928163908 Bacteria 7561269
2375 2928176275 2928170801 Bacteria 8785406
2376 2928509144 2928503688 Bacteria 7268108
2377 2928542075 2928536128 Bacteria 7657547
2378 2929207190 2929206907 Bacteria 5918291
2379 2932415681 2932410948 Bacteria 6312192
2380 2932421671 2932416698 Bacteria 6315112
2381 2941482631
2382 2945934503 2945934425 Bacteria 7444609
2383 2971412746 2971410472 Bacteria 8311090
2384 2981996048 2981990288 Bacteria 7590678
2385 2990704938 2990703756 Bacteria 7715990
2386 3003669793 3003665799 Bacteria 7279786
2387 3007254172 3007252601 Bacteria 4559114
2388 3007317089 3007315729 Bacteria 5076637
2389 641642852 641522639 Bacteria 7737025
2390 642426602 641736151 Bacteria 7477263
2391 642416514 641736154 Bacteria 7689995
2392 642594555 642555112 Bacteria 8676562
2393 642623140 642555113 Bacteria 8214658
2394 643602431 643348564 Bacteria 8839022
2395 644749192 644736347 Bacteria 6476522
2396 8002395900 8002392321 Bacteria 4159911
2397 8003402208 8003400568 Bacteria 5535898
2398 8003956767 8003955200 Bacteria 8601927
2399 8018847988 8018845410 Bacteria 8933938
2400 8020813973 8020807995 Bacteria 6801506
2401 8020938987 8020938398 Bacteria 7472757
2402 8020947703 8020945358 Bacteria 8467355
2403 8020953466 8020953355 Bacteria 7439080
2404 8021127572 8021120328 Bacteria 8782274
2405 8034963110 8034962539 Bacteria 4884839
2406 8039099722 8039098773 Bacteria 6602928
2407 8040174164 8040173305 Bacteria 6827067
2408 8047674663 8047673197 Bacteria 7395230
2409 8048747539 8048746797 Bacteria 3557226
2410 8054565985 8054563764 Bacteria 5592885
2411 8055228455 8055225921 Bacteria 3341787
2412 8055269488 8055266321 Bacteria 7999742
2413 8055307350 8055301274 Bacteria 8587385
2414 8055636750 8055632911 Bacteria 5283357
2415 8056536144 8056533031 Bacteria 8964429
2416 Ga0400484_09450
2417 JGI24741J21665_1000028
2418 JGI24740J21852_10000135
2419 JGI24740J21852_10000985
2420 JGI24740J21852_10001768
2421 JGI24740J21852_10001853
2422 JGI24739J22299_10001122
2423 JGI24739J22299_10001794
2424 JGI24739J22299_10040400
2425 JGI24737J22298_10002512
2426 JGI24737J22298_10023652
2427 JGI24735J21928_10000235
2428 JGI24735J21928_10000566
2429 JGI24735J21928_10001052
2430 JGI24751J29686_10000074
2431 JGI25155J39150_1000252
2432 JGI25155J39150_1000471
2433 JGI25156J39149_1000288
2434 JGI25156J39149_1002224
2435 JGI25162J39368_1000040
2436 JGI25154J39366_1000311
2437 JGI25154J39366_1000313
2438 JGI25154J39366_1000782
2439 JGI25154J39366_1000843
2440 JGI25157J39369_1000171
2441 JGI25152J39213_1005962
2442 JGI25151J46595_10000018
2443 JGI25151J46595_10000121
2444 JGI25151J46595_10001594
2445 JGI25151J46595_10002578
2446 JGI25151J46595_10004715
2447 JGI25165J46597_1000051
2448 JGI25165J46597_1000794
2449 JGI25165J46597_1002173
2450 JGI25153J46596_10001401
2451 JGI25153J46596_10009739
2452 rootL2_10004552
2453 JGI25160J50197_1000146
2454 Ga0007409J51694_1048233
2455 Ga0006562J51391_1104371
2456 Ga0006562J51391_1104372
2457 Ga0055538_1000025
2458 Ga0055538_1000038
2459 Ga0055539_1000032
2460 Ga0055539_1000049
2461 Ga0055539_1000218
2462 Ga0055533_1000042
2463 Ga0055533_1000060
2464 Ga0055533_1000476
2465 Ga0055533_1002544
2466 Ga0055532_1000044
2467 Ga0055532_1000066
2468 Ga0055532_1000092
2469 Ga0055525_1000028
2470 Ga0055525_1000050
2471 Ga0055525_1000068
2472 Ga0055525_1001589
2473 Ga0055527_1000035
2474 Ga0055527_1000754
2475 Ga0055527_1000965
2476 Ga0055527_1001071
2477 Ga0055535_1000046
2478 Ga0055535_1000050
2479 Ga0055535_1003356
2480 Ga0055535_1003379
2481 Ga0055542_1000120
2482 Ga0055542_1000632
2483 Ga0055542_1003203
2484 Ga0055542_1003219
2485 Ga0055529_1000015
2486 Ga0055529_1000087
2487 Ga0055529_1000089
2488 Ga0055529_1001095
2489 Ga0055529_1001970
2490 Ga0055526_1000007
2491 Ga0055526_1009468
2492 Ga0055526_1009857
2493 Ga0055524_1000071
2494 Ga0055524_1000274
2495 Ga0055524_1000669
2496 Ga0055524_1021269
2497 Ga0055536_1000176
2498 Ga0055534_1001271
2499 Ga0055528_1018811
2500 Ga0055541_1000023
2501 Ga0055541_1000036
2502 Ga0055541_1000458
2503 Ga0058692_1002468
2504 Ga0058692_1010540
2505 Ga0065165_1000648
2506 Ga0065165_1002291
2507 Ga0065704_10144545
2508 Ga0070658_10017827
2509 Ga0070676_10014765
2510 Ga0070683_100004403
2511 Ga0070683_100262842
2512 Ga0070690_100003115
2513 Ga0070690_100012327
2514 Ga0070670_100001763
2515 Ga0070670_100003096
2516 Ga0070670_100046852
2517 Ga0070677_10000813
2518 Ga0068869_100000446
2519 Ga0068869_100007899
2520 Ga0070666_10019706
2521 Ga0070666_10025072
2522 Ga0070680_100093239
2523 Ga0068868_100002308
2524 Ga0070660_100000025
2525 Ga0070660_100000555
2526 Ga0070660_100058207
2527 Ga0070660_100069739
2528 Ga0070689_100000418
2529 Ga0070689_100007131
2530 Ga0070691_10001956
2531 Ga0070691_10031686
2532 Ga0070661_100000262
2533 Ga0070661_100003077
2534 Ga0070661_100022926
2535 Ga0070661_100023346
2536 Ga0070661_100083219
2537 Ga0070692_10003660
2538 Ga0070692_10005189
2539 Ga0070692_10089118
2540 Ga0070668_100047399
2541 Ga0070669_100063913
2542 Ga0070675_100000225
2543 Ga0070671_100000251
2544 Ga0070674_100008627
2545 Ga0070674_100032693
2546 Ga0070674_100207937
2547 Ga0070673_100001157
2548 Ga0070688_100017362
2549 Ga0070659_100000264
2550 Ga0070659_100005724
2551 Ga0070659_100018272
2552 Ga0070659_100024551
2553 Ga0070659_100028472
2554 Ga0070667_100005918
2555 Ga0070667_100010109
2556 Ga0070667_100138871
2557 Ga0070709_10032908
2558 Ga0070709_10060409
2559 Ga0070714_100002634
2560 Ga0070714_100016095
2561 Ga0070714_100033094
2562 Ga0070713_100000035
2563 Ga0070713_100000699
2564 Ga0070713_100021844
2565 Ga0070710_10003231
2566 Ga0070701_10000095
2567 Ga0070711_100000407
2568 Ga0070711_100003667
2569 Ga0070705_100009619
2570 Ga0070700_100000343
2571 Ga0070694_100017725
2572 Ga0070694_100052922
2573 Ga0070708_100018970
2574 Ga0070663_100000023
2575 Ga0070663_100000091
2576 Ga0070663_100018911
2577 Ga0070678_100001056
2578 Ga0070678_100008251
2579 Ga0070678_100311948
2580 Ga0070662_100014777
2581 Ga0070662_100043911
2582 Ga0070681_10003149
2583 Ga0070681_10004550
2584 Ga0068867_100000224
2585 Ga0068867_100005285
2586 Ga0068867_100034493
2587 Ga0070685_10014673
2588 Ga0070706_100105102
2589 Ga0070706_100207345
2590 Ga0070707_100022518
2591 Ga0070707_100044175
2592 Ga0070698_100134475
2593 Ga0070699_100097436
2594 Ga0070679_100026821
2595 Ga0070679_100185686
2596 Ga0070684_100020251
2597 Ga0070684_100091791
2598 Ga0070697_100254432
2599 Ga0068853_100018211
2600 Ga0068853_100028137
2601 Ga0068853_100042863
2602 Ga0068853_100097112
2603 Ga0068853_100110226
2604 Ga0070672_100001370
2605 Ga0070686_100000448
2606 Ga0070695_100003128
2607 Ga0070695_100027169
2608 Ga0070695_100039811
2609 Ga0070693_100000709
2610 Ga0070693_100009225
2611 Ga0070665_100003736
2612 Ga0070665_100046243
2613 Ga0070665_100083376
2614 Ga0070704_100006821
2615 Ga0070704_100016987
2616 Ga0070704_100254582
2617 Ga0068855_100000063
2618 Ga0068855_100001111
2619 Ga0068855_100011143
2620 Ga0068855_100016221
2621 Ga0068855_100037461
2622 Ga0068855_100050415
2623 Ga0068855_100088577
2624 Ga0068855_100152259
2625 Ga0068855_100170592
2626 Ga0068855_100204000
2627 Ga0068855_100284926
2628 Ga0068855_100353016
2629 Ga0070664_100000018
2630 Ga0070664_100000527
2631 Ga0070664_100026949
2632 Ga0070664_100064884
2633 Ga0070664_100169374
2634 Ga0068857_100000878
2635 Ga0068857_100001732
2636 Ga0068857_100012916
2637 Ga0068854_100000172
2638 Ga0068854_100000716
2639 Ga0068854_100001495
2640 Ga0068854_100007750
2641 Ga0068856_100000070
2642 Ga0068856_100049897
2643 Ga0068856_100172549
2644 Ga0070702_100000034
2645 Ga0068852_100001050
2646 Ga0068852_100010880
2647 Ga0068852_100019452
2648 Ga0068852_100035944
2649 Ga0068852_100037854
2650 Ga0068852_100046357
2651 Ga0068852_100089829
2652 Ga0068852_100247472
2653 Ga0068859_100019681
2654 Ga0068859_100040898
2655 Ga0068859_100056821
2656 Ga0068859_100081974
2657 Ga0068859_100123069
2658 Ga0068859_100436594
2659 Ga0068864_100077758
2660 Ga0068866_10000071
2661 Ga0068866_10002533
2662 Ga0068866_10009792
2663 Ga0068861_100000604
2664 Ga0068851_10007523
2665 Ga0068863_100000366
2666 Ga0068863_100013027
2667 Ga0068863_100113402
2668 Ga0068858_100000890
2669 Ga0068858_100001410
2670 Ga0068858_100008616
2671 Ga0068858_100018178
2672 Ga0068858_100030788
2673 Ga0068858_100036319
2674 Ga0068858_100059820
2675 Ga0068860_100057742
2676 Ga0068860_100084803
2677 Ga0068860_100134521
2678 Ga0068860_100149898
2679 Ga0068862_100001545
2680 Ga0081455_10005372
2681 Ga0081455_10039290
2682 Ga0081455_10057061
2683 Ga0081540_1035371
2684 Ga0070717_10012887
2685 Ga0070717_10068979
2686 Ga0075363_100016046
2687 Ga0075364_10000064
2688 Ga0075364_10029406
2689 Ga0075432_10002316
2690 Ga0070715_10004316
2691 Ga0070712_100000722
2692 Ga0070712_100002168
2693 Ga0070712_100047388
2694 Ga0075366_10020670
2695 Ga0097621_100005613
2696 Ga0097621_100006216
2697 Ga0068871_100002762
2698 Ga0068871_100062498
2699 Ga0075428_100010059
2700 Ga0075428_100014827
2701 Ga0075428_100097404
2702 Ga0075430_100013770
2703 Ga0075431_100008339
2704 Ga0075431_100289425
2705 Ga0075434_100006422
2706 Ga0075434_100012989
2707 Ga0075434_100087664
2708 Ga0075429_100020613
2709 Ga0068865_100000179
2710 Ga0075436_100064772
2711 Ga0097620_100019680
2712 Ga0097620_100040898
2713 Ga0097620_100056818
2714 Ga0097620_100081973
2715 Ga0097620_100123077
2716 Ga0097620_100436596
2717 Ga0079104_1025647
2718 Ga0099826_10000008
2719 Ga0075435_100005128
2720 Ga0075435_100021557
2721 Ga0099794_10003043
2722 Ga0105251_10000781
2723 Ga0105251_10030439
2724 Ga0105244_10000412
2725 Ga0105244_10002472
2726 Ga0105250_10019362
2727 Ga0105240_10001628
2728 Ga0105240_10004505
2729 Ga0105240_10008072
2730 Ga0105240_10014398
2731 Ga0105240_10026536
2732 Ga0105240_10036146
2733 Ga0105240_10049065
2734 Ga0105240_10050170
2735 Ga0105240_10167293
2736 Ga0105240_10175626
2737 Ga0105240_10281268
2738 Ga0105240_10364410
2739 Ga0111539_10001003
2740 Ga0111539_10001740
2741 Ga0111539_10023826
2742 Ga0111539_10184513
2743 Ga0111539_10277488
2744 Ga0105245_10000414
2745 Ga0105245_10019563
2746 Ga0105245_10031107
2747 Ga0105245_10033212
2748 Ga0105245_10051279
2749 Ga0105245_10229029
2750 Ga0105247_10003683
2751 Ga0105247_10187974
2752 Ga0114129_10023892
2753 Ga0114129_10026898
2754 Ga0105243_10000212
2755 Ga0105243_10003672
2756 Ga0105243_10007161
2757 Ga0105243_10009503
2758 Ga0105243_10140555
2759 Ga0105243_10251554
2760 Ga0105241_10005901
2761 Ga0105241_10008396
2762 Ga0105241_10071497
2763 Ga0105241_10121397
2764 Ga0105241_10129749
2765 Ga0105241_10144510
2766 Ga0105242_10000291
2767 Ga0105242_10002769
2768 Ga0105242_10017081
2769 Ga0105242_10093218
2770 Ga0105248_10009132
2771 Ga0105248_10022233
2772 Ga0105248_10153443
2773 Ga0105248_10211875
2774 Ga0105237_10011515
2775 Ga0105237_10019528
2776 Ga0105237_10030536
2777 Ga0105237_10063263
2778 Ga0105237_10210769
2779 Ga0105238_10000037
2780 Ga0105238_10001851
2781 Ga0105238_10004242
2782 Ga0105238_10023626
2783 Ga0105238_10095395
2784 Ga0105238_10103822
2785 Ga0105238_10194327
2786 Ga0105238_10250040
2787 Ga0105249_10009785
2788 Ga0105249_10052709
2789 Ga0105249_10069787
2790 Ga0105239_10000341
2791 Ga0105239_10003694
2792 Ga0105239_10007578
2793 Ga0105239_10013346
2794 Ga0105239_10029649
2795 Ga0105239_10030147
2796 Ga0105239_10042962
2797 Ga0105239_10071393
2798 Ga0105239_10081249
2799 Ga0105239_10200220
2800 Ga0105246_10025706
2801 Ga0157373_10010458
2802 Ga0157373_10029055
2803 Ga0157373_10085134
2804 Ga0157371_10000003
2805 Ga0157371_10000275
2806 Ga0157370_10000237
2807 Ga0157370_10003818
2808 Ga0157370_10003874
2809 Ga0157370_10006761
2810 Ga0157370_10011180
2811 Ga0157370_10013934
2812 Ga0157370_10014165
2813 Ga0157370_10016731
2814 Ga0157370_10072687
2815 Ga0157370_10175382
2816 Ga0157369_10000147
2817 Ga0157369_10000872
2818 Ga0157369_10002777
2819 Ga0157369_10010146
2820 Ga0157369_10013337
2821 Ga0157369_10028956
2822 Ga0157369_10075837
2823 Ga0157369_10093041
2824 Ga0157369_10100949
2825 Ga0157369_10224692
2826 Ga0171462_1015
2827 Ga0157374_10000251
2828 Ga0157374_10003456
2829 Ga0157374_10007595
2830 Ga0157378_10001356
2831 Ga0157378_10004479
2832 Ga0157378_10166924
2833 Ga0163162_10005470
2834 Ga0163162_10016362
2835 Ga0163162_10048431
2836 Ga0163162_10106770
2837 Ga0163162_10113332
2838 Ga0163162_10217482
2839 Ga0163162_10297869
2840 Ga0163162_10478940
2841 Ga0157372_10000307
2842 Ga0157372_10000323
2843 Ga0157372_10161904
2844 Ga0157375_10004551
2845 Ga0157375_10118417
2846 Ga0157375_10121256
2847 Ga0163163_10000015
2848 Ga0163163_10000773
2849 Ga0163163_10074103
2850 Ga0163163_10074732
2851 Ga0182008_10008961
2852 Ga0182008_10018700
2853 Ga0182008_10089778
2854 Ga0157377_10005094
2855 Ga0157379_10001728
2856 Ga0157379_10003216
2857 Ga0157379_10008253
2858 Ga0157379_10045291
2859 Ga0157376_10137748
2860 Ga0182006_1000023
2861 Ga0182006_1000125
2862 Ga0182006_1000649
2863 Ga0182006_1010511
2864 Ga0182007_10000082
2865 Ga0182007_10000738
2866 Ga0182007_10000932
2867 Ga0182007_10009056
2868 Ga0182007_10026017
2869 Ga0182005_1000006
2870 Ga0182005_1000047
2871 Ga0182005_1005516
2872 Ga0183361_10015
2873 Ga0163161_10002855
2874 Ga0163161_10047226
2875 Ga0163161_10189363
2876 Ga0197907_11373382
2877 Ga0206356_11205717
2878 Ga0206351_10335588
2879 Ga0206353_10079450
2880 Ga0213872_10000024
2881 Ga0213872_10000344
2882 Ga0213872_10000532
2883 Ga0213872_10001257
2884 Ga0213872_10006253
2885 Ga0213872_10008476
2886 Ga0213872_10013257
2887 Ga0213872_10014575
2888 Ga0213872_10015809
2889 Ga0213872_10027484
2890 Ga0213872_10027840
2891 Ga0213872_10033048
2892 Ga0213872_10038666
2893 Ga0213872_10042567
2894 Ga0213876_10001149
2895 Ga0213876_10012610
2896 Ga0213876_10022715
2897 Ga0213876_10036297
2898 Ga0213875_10000124
2899 Ga0213875_10000865
2900 Ga0213875_10007591
2901 Ga0213875_10024619
2902 Ga0224712_10000002
2903 Ga0209435_100004
2904 Ga0209435_100168
2905 Ga0209784_100010
2906 Ga0209784_100021
2907 Ga0209784_100052
2908 Ga0209784_100807
2909 Ga0209566_100008
2910 Ga0209566_100039
2911 Ga0209566_100068
2912 Ga0209566_100235
2913 Ga0209566_100312
2914 Ga0209566_101794
2915 Ga0209674_100019
2916 Ga0209674_100036
2917 Ga0209674_100087
2918 Ga0209674_100153
2919 Ga0209674_100296
2920 Ga0209674_101200
2921 Ga0209672_100054
2922 Ga0209672_100072
2923 Ga0209672_100073
2924 Ga0209672_100308
2925 Ga0209672_103908
2926 Ga0209147_100011
2927 Ga0209147_100085
2928 Ga0209147_100090
2929 Ga0209147_100093
2930 Ga0209147_100100
2931 Ga0209563_100011
2932 Ga0209563_100021
2933 Ga0209563_100040
2934 Ga0209563_100108
2935 Ga0209563_102096
2936 Ga0207427_100432
2937 Ga0207427_101304
2938 Ga0209437_100019
2939 Ga0209437_100207
2940 Ga0209258_100130
2941 Ga0209258_100140
2942 Ga0209258_100168
2943 Ga0209258_100279
2944 Ga0209258_100397
2945 Ga0207425_1000176
2946 Ga0209646_1000119
2947 Ga0209646_1000125
2948 Ga0209646_1000140
2949 Ga0209646_1000205
2950 Ga0209026_1000066
2951 Ga0209026_1002319
2952 Ga0209026_1002536
2953 Ga0209677_100011
2954 Ga0209677_100023
2955 Ga0209677_100043
2956 Ga0209677_102613
2957 Ga0209148_1000119
2958 Ga0209148_1000140
2959 Ga0209148_1000451
2960 Ga0209148_1000470
2961 Ga0209759_1000114
2962 Ga0209759_1000281
2963 Ga0209759_1000329
2964 Ga0209759_1000961
2965 Ga0209759_1001269
2966 Ga0209759_1001696
2967 Ga0209759_1004527
2968 Ga0209759_1018227
2969 Ga0209233_1000025
2970 Ga0209233_1000173
2971 Ga0209565_1000727
2972 Ga0209565_1004441
2973 Ga0209455_1000031
2974 Ga0209455_1000119
2975 Ga0209455_1000125
2976 Ga0209455_1000217
2977 Ga0209455_1002842
2978 Ga0209455_1007044
2979 Ga0209455_1008304
2980 Ga0209673_1000098
2981 Ga0209675_1000684
2982 Ga0209675_1001176
2983 Ga0209675_1002424
2984 Ga0209676_1000331
2985 Ga0209676_1006101
2986 Ga0209025_1000010
2987 Ga0209025_1000019
2988 Ga0209025_1000485
2989 Ga0209025_1000823
2990 Ga0209025_1000853
2991 Ga0209025_1001173
2992 Ga0209025_1003577
2993 Ga0209025_1041469
2994 Ga0209564_1000010
2995 Ga0209564_1000019
2996 Ga0209564_1000034
2997 Ga0209564_1000042
2998 Ga0209564_1001559
2999 Ga0209564_1003986
3000 Ga0209758_1000085
3001 Ga0209758_1000433
3002 Ga0209758_1013994
3003 Ga0209050_1011606
3004 Ga0209256_1000018
3005 Ga0209256_1000026
3006 Ga0209256_1000473
3007 Ga0209256_1000612
3008 Ga0209256_1000802
3009 Ga0207426_1000199
3010 Ga0207426_1005650
3011 Ga0209051_1007632
3012 Ga0207697_10014221
3013 Ga0207656_10009058
3014 Ga0207696_1014759
3015 Ga0207655_1001385
3016 Ga0207655_1001828
3017 Ga0207713_1000186
3018 Ga0207713_1002620
3019 Ga0207682_10003933
3020 Ga0207682_10005718
3021 Ga0207692_10036741
3022 Ga0207642_10001746
3023 Ga0207642_10009765
3024 Ga0207710_10027105
3025 Ga0207688_10000664
3026 Ga0207680_10003660
3027 Ga0207680_10045685
3028 Ga0207680_10055462
3029 Ga0207647_10000126
3030 Ga0207647_10002757
3031 Ga0207647_10006995
3032 Ga0207647_10007378
3033 Ga0207647_10020622
3034 Ga0207685_10004166
3035 Ga0207645_10003270
3036 Ga0207705_10005316
3037 Ga0207705_10014561
3038 Ga0207684_10039330
3039 Ga0207684_10045540
3040 Ga0207684_10204320
3041 Ga0207654_10015780
3042 Ga0207707_10031089
3043 Ga0207707_10046693
3044 Ga0207695_10000003
3045 Ga0207695_10004822
3046 Ga0207695_10005837
3047 Ga0207695_10007348
3048 Ga0207695_10016358
3049 Ga0207695_10021117
3050 Ga0207695_10032163
3051 Ga0207695_10038543
3052 Ga0207695_10049269
3053 Ga0207695_10056616
3054 Ga0207695_10084787
3055 Ga0207671_10015181
3056 Ga0207671_10015712
3057 Ga0207671_10019071
3058 Ga0207693_10000364
3059 Ga0207693_10006630
3060 Ga0207693_10016693
3061 Ga0207693_10074868
3062 Ga0207693_10179569
3063 Ga0207663_10006677
3064 Ga0207660_10020915
3065 Ga0207660_10040580
3066 Ga0207662_10000394
3067 Ga0207657_10000065
3068 Ga0207657_10000469
3069 Ga0207657_10001751
3070 Ga0207657_10002121
3071 Ga0207649_10000269
3072 Ga0207649_10007608
3073 Ga0207649_10013636
3074 Ga0207649_10018710
3075 Ga0207652_10005329
3076 Ga0207652_10009170
3077 Ga0207681_10040501
3078 Ga0207694_10000005
3079 Ga0207694_10000054
3080 Ga0207694_10063293
3081 Ga0207694_10081495
3082 Ga0207650_10000028
3083 Ga0207650_10002006
3084 Ga0207650_10057926
3085 Ga0207659_10001987
3086 Ga0207687_10004634
3087 Ga0207687_10087970
3088 Ga0207687_10142421
3089 Ga0207700_10000023
3090 Ga0207700_10021676
3091 Ga0207700_10059211
3092 Ga0207700_10066207
3093 Ga0207664_10010214
3094 Ga0207664_10018372
3095 Ga0207664_10050630
3096 Ga0207644_10002957
3097 Ga0207690_10000040
3098 Ga0207690_10004347
3099 Ga0207690_10015844
3100 Ga0207690_10027448
3101 Ga0207690_10065522
3102 Ga0207706_10002869
3103 Ga0207706_10004302
3104 Ga0207686_10000366
3105 Ga0207686_10011054
3106 Ga0207709_10003864
3107 Ga0207709_10005653
3108 Ga0207669_10006910
3109 Ga0207704_10000183
3110 Ga0207704_10021893
3111 Ga0207665_10030580
3112 Ga0207691_10001560
3113 Ga0207691_10034452
3114 Ga0207691_10137070
3115 Ga0207711_10000185
3116 Ga0207711_10029680
3117 Ga0207711_10103558
3118 Ga0207711_10273358
3119 Ga0207689_10001562
3120 Ga0207689_10024015
3121 Ga0207689_10059820
3122 Ga0207661_10005111
3123 Ga0207679_10000032
3124 Ga0207679_10000584
3125 Ga0207679_10002535
3126 Ga0207679_10213150
3127 Ga0207679_10226987
3128 Ga0207667_10000041
3129 Ga0207667_10000043
3130 Ga0207667_10016267
3131 Ga0207667_10018787
3132 Ga0207667_10019923
3133 Ga0207667_10021698
3134 Ga0207667_10022349
3135 Ga0207667_10030719
3136 Ga0207667_10040684
3137 Ga0207667_10059167
3138 Ga0207667_10100174
3139 Ga0207667_10136120
3140 Ga0207651_10001283
3141 Ga0207651_10026296
3142 Ga0207640_10000166
3143 Ga0207640_10002242
3144 Ga0207640_10031703
3145 Ga0207640_10039852
3146 Ga0207640_10056874
3147 Ga0207658_10010931
3148 Ga0207677_10001505
3149 Ga0207677_10002850
3150 Ga0207677_10240157
3151 Ga0207703_10001000
3152 Ga0207703_10004197
3153 Ga0207703_10011425
3154 Ga0207703_10166330
3155 Ga0207639_10013926
3156 Ga0207639_10054099
3157 Ga0207678_10000024
3158 Ga0207678_10002149
3159 Ga0207678_10058214
3160 Ga0207708_10000058
3161 Ga0207708_10005671
3162 Ga0207702_10000615
3163 Ga0207702_10035201
3164 Ga0207702_10084325
3165 Ga0207641_10004677
3166 Ga0207641_10102975
3167 Ga0207648_10000635
3168 Ga0207648_10002029
3169 Ga0207648_10008055
3170 Ga0207648_10026542
3171 Ga0207648_10027248
3172 Ga0207674_10002499
3173 Ga0207674_10002639
3174 Ga0207674_10005309
3175 Ga0207674_10040795
3176 Ga0207675_100000480
3177 Ga0207683_10000548
3178 Ga0207683_10000997
3179 Ga0207683_10003833
3180 Ga0207683_10006552
3181 Ga0207683_10011720
3182 Ga0207698_10001447
3183 Ga0207698_10020820
3184 Ga0207698_10021768
3185 Ga0207698_10036554
3186 Ga0207698_10063288
3187 Ga0207698_10072384
3188 Ga0207698_10169810
3189 Ga0207698_10215583
3190 Ga0209281_1003338
3191 Ga0209281_1016186
3192 Ga0209371_1000094
3193 Ga0209371_1000141
3194 Ga0209371_1003202
3195 Ga0209969_1001458
3196 Ga0209967_1001378
3197 Ga0209981_1002968
3198 Ga0209983_1011367
3199 Ga0209282_1000005
3200 Ga0209282_1000032
3201 Ga0209974_10003296
3202 Ga0207428_10002211
3203 Ga0207428_10005007
3204 Ga0207428_10010908
3205 Ga0207428_10100259
3206 Ga0268266_10001540
3207 Ga0268266_10015792
3208 Ga0268266_10029637
3209 Ga0268264_10024802
3210 Ga0268264_10149083
3211 Ga0265337_1036458
3212 Ga0265334_10000048
3213 Ga0307515_10059162
3214 Ga0265338_10000005
3215 Ga0265338_10000508
3216 Ga0265338_10003131
3217 Ga0265338_10005697
3218 Ga0265338_10006964
3219 Ga0265338_10085334
3220 Ga0268256_1000083
3221 Ga0268256_1002888
3222 Ga0268256_1005317
3223 Ga0307511_10000005
3224 Ga0316181_1294152
3225 Ga0265330_10025972
3226 Ga0265330_10058051
3227 Ga0265332_10002392
3228 Ga0265328_10000252
3229 Ga0265328_10001134
3230 Ga0265328_10041664
3231 Ga0265320_10000088
3232 Ga0265320_10002005
3233 Ga0265320_10057059
3234 Ga0265325_10000010
3235 Ga0265325_10000306
3236 Ga0265325_10003550
3237 Ga0265325_10011606
3238 Ga0265325_10063873
3239 Ga0265329_10019971
3240 Ga0265340_10013866
3241 Ga0265340_10074924
3242 Ga0265339_10001211
3243 Ga0265339_10001636
3244 Ga0265339_10044308
3245 Ga0265339_10070184
3246 Ga0265331_10000050
3247 Ga0265331_10000641
3248 Ga0265331_10002299
3249 Ga0265331_10003830
3250 Ga0265331_10007589
3251 Ga0265331_10010512
3252 Ga0265331_10011567
3253 Ga0265327_10000109
3254 Ga0265327_10000161
3255 Ga0265327_10000665
3256 Ga0265327_10000871
3257 Ga0265327_10001378
3258 Ga0265327_10003401
3259 Ga0265327_10004214
3260 Ga0265327_10004672
3261 Ga0265327_10016404
3262 Ga0265327_10033084
3263 Ga0265316_10020341
3264 Ga0265316_10039725
3265 Ga0265316_10043050
3266 Ga0265316_10046053
3267 Ga0307408_100000020
3268 Ga0307408_100000489
3269 Ga0307408_100005084
3270 Ga0265313_10001209
3271 Ga0265313_10002092
3272 Ga0265313_10005798
3273 Ga0265313_10006535
3274 Ga0265313_10025929
3275 Ga0316575_10002983
3276 Ga0316575_10003093
3277 Ga0316575_10007941
3278 Ga0316575_10020058
3279 Ga0316575_10021971
3280 Ga0316575_10031988
3281 Ga0316575_10047228
3282 Ga0316579_10000368
3283 Ga0316579_10000622
3284 Ga0316579_10001025
3285 Ga0316579_10001066
3286 Ga0316579_10002084
3287 Ga0316579_10010733
3288 Ga0316579_10020362
3289 Ga0316579_10033155
3290 Ga0316579_10045161
3291 Ga0265314_10000488
3292 Ga0265314_10007076
3293 Ga0265314_10024140
3294 Ga0265314_10045281
3295 Ga0265314_10064141
3296 Ga0265314_10077253
3297 Ga0265342_10006317
3298 Ga0316576_10000676
3299 Ga0316576_10001164
3300 Ga0316576_10009159
3301 Ga0316576_10024654
3302 Ga0316576_10170963
3303 Ga0316578_10000119
3304 Ga0316578_10003033
3305 Ga0316578_10004707
3306 Ga0316578_10004920
3307 Ga0316578_10011121
3308 Ga0316578_10011703
3309 Ga0316578_10017741
3310 Ga0316578_10019431
3311 Ga0316578_10091649
3312 Ga0316578_10094780
3313 Ga0307516_10039029
3314 Ga0307405_10011614
3315 Ga0316577_10000036
3316 Ga0316577_10028790
3317 Ga0316577_10032178
3318 Ga0316577_10033599
3319 Ga0316577_10037822
3320 Ga0316577_10072346
3321 Ga0307413_10135082
3322 Ga0307518_10043423
3323 Ga0307412_10000056
3324 Ga0307412_10000061
3325 Ga0307409_100129991
3326 Ga0307416_100052509
3327 Ga0307416_100053677
3328 Ga0307416_100086596
3329 Ga0307414_10002569
3330 Ga0316583_10000654
3331 Ga0316583_10003709
3332 Ga0316585_10001200
3333 Ga0316585_10002846
3334 Ga0316585_10005198
3335 Ga0316585_10015760
3336 Ga0316580_10000393
3337 Ga0316593_10000006
3338 Ga0316593_10000324
3339 Ga0316593_10001172
3340 Ga0316593_10003160
3341 Ga0316593_10011154
3342 Ga0316593_10011507
3343 Ga0316593_10013690
3344 Ga0316596_1000238
3345 Ga0316596_1000484
3346 Ga0316596_1001944
3347 Ga0316596_1002554
3348 Ga0373929_0012234
3349 Ga0373934_0000524
3350 Ga0373936_0017886
3351 Ga0373936_0026866
3352 Ga0373945_0037776
3353 Ga0373953_0000613
3354 Ga0373953_0056236
3355 Ga0373954_0000674
3356 Ga0373954_0009270
3357 Ga0373956_0000135
3358 Ga0373956_0013451
3359 Ga0373957_0002671
3360 Ga0373957_0004898
3361 Ga0373957_0008551
3362 Ga0373943_0023909
3363 Ga0373943_0056021
3364 Ga0373943_0103512
3365 Ga0373946_0005286
3366 Ga0373955_0000825
3367 Ga0373955_0008610
3368 Ga0373955_0040732
3369 Ga0373961_0013703
3370 Ga0316574_0000243
3371 Ga0316574_0004552
3372 Ga0316574_0012299
3373 Ga0316574_0012400
3374 Ga0316574_0023794
3375 Ga0316574_0032063
3376 Ga0316574_0038486
3377 Ga0316574_0057231
3378 Ga0316574_0059105
3379 Ga0316574_0089726
3380 Ga0373931_0029608
3381 Ga0373931_0051321
3382 Ga0373935_0028103
3383 Ga0373927_0010056
3384 Ga0373927_0094913
3385 Ga0373927_0132414
3386 Ga0373933_0008376
3387 Ga0373933_0074047
3388 Ga0373933_0146386
3389 Ga0373933_0172539
3390 Ga0373947_0021339
3391 Ga0373947_0034454
3392 Ga0373947_0034839
3393 Ga0373947_0043978
3394 Ga0373937_0007514
3395 Ga0373937_0009646
3396 Ga0373937_0010610
3397 Ga0373937_0020534
3398 Ga0373937_0252769
3399 Ga0373937_0252820
3400 Ga0316582_0000662
3401 Ga0316582_0001269
3402 Ga0316582_0003235
3403 Ga0316582_0003340
3404 Ga0316582_0007327
3405 Ga0316582_0010706
3406 Ga0316582_0012053
3407 Ga0316582_0012618
3408 Ga0316582_0015844
3409 Ga0316582_0025718
3410 Ga0316582_0030630
3411 Ga0316582_0036089
3412 Ga0316582_0051408
3413 Ga0316582_0077431
3414 Ga0316584_0000578
3415 Ga0316584_0001110
3416 Ga0316584_0018249
3417 Ga0316584_0026976
3418 Ga0316584_0061658
3419 Ga0316584_0064257
3420 Ga0316584_0074345
3421 Ga0316584_0083798
3422 Ga0316584_0091028
3423 Ga0316584_0101141
3424 Ga0316584_0165995
3425 Ga0373925_0028634
3426 Ga0373925_0032676
3427 Ga0395899_0000078
3428 Ga0395899_0000080
3429 Ga0395899_0045495
3430 Ga0395900_0000087
3431 Ga0395900_0000673
3432 Ga0395900_0049451
3433 Ga0395900_0071176
3434 Ga0395900_0081902
3435 Ga0395900_0082976
3436 Ga0395900_0097488
3437 Ga0395900_0113693
3438 Ga0395900_0320808
3439 Ga0395898_0000448
3440 Ga0395898_0003576
3441 Ga0395898_0022487
3442 Ga0395898_0062519
3443 Ga0395898_0076445
3444 Ga0395898_0255240
3445 Ga0395905_0000166
3446 Ga0395905_0002893
3447 Ga0395905_0047155
3448 Ga0395905_0059658
3449 Ga0395905_0155338
3450 Ga0316581_0000544
3451 Ga0316581_0009818
3452 Ga0436364_0541917
3453 Ga0436364_0942371
3454 Ga0436364_1171513
3455 Ga0436364_1451337
3456 Ga0436364_1484148
3457 Ga0395901_0000053
3458 Ga0395901_0000393
3459 Ga0395901_0000924
3460 Ga0395901_0003786
3461 Ga0395901_0006004
3462 Ga0395901_0009275
3463 Ga0395901_0012912
3464 Ga0395901_0155869
3465 Ga0395901_0240927
3466 Ga0400484_00323
3467 Ga0400484_18569
3468 Ga0400484_35137
3469 Ga0400490_13929
3470 Ga0400490_16569
3471 Ga0400490_25259
3472 Ga0400490_28987
3473 Ga0400490_34331
3474 Ga0400490_48945
3475 Ga0400491_17035
3476 Ga0400491_24623
3477 Ga0400485_03650
3478 Ga0400485_17355
3479 Ga0400485_20357
3480 Ga0400488_10585
3481 Ga0400488_20709
3482 Ga0400488_25328
3483 Ga0400488_30822
3484 Ga0400488_34807
3485 Ga0400488_43321
3486 Ga0400486_05246
3487 Ga0400486_10627
3488 Ga0400486_16718
3489 Ga0400486_26900
3490 Ga0400483_010293
3491 Ga0400483_018996
3492 Ga0400483_022484
3493 Ga0400483_042257
3494 Ga0400483_070048
3495 Ga0400483_091080
3496 Ga0400483_092279
3497 Ga0400483_106547
3498 Ga0400483_110940
3499 Ga0400483_153689
3500 Ga0400483_159831
3501 Ga0400483_178100
3502 Ga0400483_206544
3503 Ga0400483_207597
3504 Ga0400483_231907
3505 Ga0400483_236280
3506 Ga0400489_50056
3507 Ga0400487_00745
3508 Ga0400487_00755
3509 Ga0400487_17506
3510 Ga0400487_25654
3511 Ga0400487_26641
3512 Ga0436365_0498837
3513 Ga0436365_0713547
3514 Ga0436365_0866723
3515 Ga0436365_1001160
3516 Ga0436365_1339516
3517 Ga0436365_1542655
3518 Ga0436365_1579892
3519 Ga0436360_1121756
3520 Ga0436361_0039357
3521 Ga0436361_0066621
3522 Ga0436361_0136561
3523 Ga0436361_0167169
3524 Ga0436361_0224368
3525 Ga0436361_0291380
3526 Ga0436361_0293841
3527 Ga0436361_0580184
3528 Ga0436361_0599717
3529 Ga0436361_0632156
3530 Ga0436361_0764009
3531 Ga0436361_0894241
3532 Ga0436361_1092447
3533 Ga0436361_1133501
3534 Ga0436361_1159932
3535 Ga0436363_0289284
3536 Ga0436363_1183271
3537 Ga0436362_0763668
3538 Ga0439436_0018884
3539 Ga0451853_0956153
3540 Ga0439448_0004496
3541 Ga0450911_000023
3542 Ga0450904_000386
3543 Ga0439464_0010028
3544 Ga0439464_0020468
3545 Ga0451577_0000603
3546 Ga0451577_0005927
3547 Ga0451577_0093045
3548 Ga0451577_0150391
3549 Ga0451577_0152994
3550 Ga0451577_0176050
3551 Ga0466969_0000901
3552 Ga0466969_0005144
3553 Ga0466969_0006652
3554 Ga0466972_0000290
3555 Ga0466972_0004693
3556 Ga0466972_0017282
3557 Ga0466973_0033070
3558 Ga0466977_0000280
3559 Ga0453683_0005270
3560 Ga0453683_0028231
3561 Ga0453683_0102535
3562 Ga0466965_0005814
3563 Ga0466965_0019762
3564 Ga0466965_0030989
3565 Ga0466966_0000070
3566 Ga0466966_0001458
3567 Ga0466966_0002015
3568 Ga0466966_0011833
3569 Ga0466966_0031772
3570 Ga0466966_0062838
3571 Ga0466961_0000382
3572 Ga0466961_0000919
3573 Ga0466961_0001619
3574 Ga0466961_0052302
3575 Ga0466963_0000156
3576 Ga0466963_0023867
3577 Ga0466964_0019148
3578 Ga0466964_0025094
3579 Ga0466964_0030886
3580 Ga0466964_0040404
3581 Ga0453684_0000014
3582 Ga0453684_0000395
3583 Ga0453684_0000566
3584 Ga0453684_0000716
3585 Ga0453684_0001436
3586 Ga0453684_0001602
3587 Ga0453684_0003881
3588 Ga0453684_0006851
3589 Ga0453684_0058625
3590 Ga0466971_0003076
3591 Ga0466968_0015240
3592 Ga0466970_0001718
3593 Ga0466970_0023303
3594 Ga0466970_0029992
3595 Ga0466957_0000646
3596 Ga0466957_0006404
3597 Ga0466957_0016515
3598 Ga0466957_0026257
3599 Ga0466957_0072621
3600 Ga0466959_0013509
3601 Ga0466959_0025943
3602 Ga0466959_0034425
3603 Ga0466959_0052451
3604 Ga0466959_0123065
3605 Ga0466959_0151740
3606 Ga0451576_0000239
3607 Ga0451576_0000313
3608 Ga0451576_0000487
3609 Ga0451576_0000734
3610 Ga0451576_0002171
3611 Ga0451576_0007226
3612 Ga0451576_0016875
3613 Ga0451576_0030534
3614 Ga0451576_0046228
3615 Ga0451576_0221544
3616 Ga0451576_0376523
3617 Ga0466958_0002177
3618 Ga0466958_0095015
3619 Ga0466967_0040690
3620 Ga0466967_0041475
3621 Ga0466967_0047541
3622 Ga0466967_0180938
3623 Ga0495617_000010
3624 Ga0495617_000020
3625 Ga0495617_000338
3626 Ga0495617_009279
3627 Ga0495627_002330
3628 Ga0495592_0007047
3629 Ga0495592_0007842
3630 Ga0495592_0010390
3631 Ga0495592_0014005
3632 Ga0495592_0015621
3633 Ga0495592_0084819
3634 Ga0495603_0004544
3635 Ga0495603_0013456
3636 Ga0495603_0022383
3637 Ga0495603_0025725
3638 Ga0495603_0044853
3639 Ga0495603_0053485
3640 Ga0495590_0000009
3641 Ga0495590_0000012
3642 Ga0495590_0000811
3643 Ga0495590_0002807
3644 Ga0495590_0003730
3645 Ga0495590_0005189
3646 Ga0495590_0008831
3647 Ga0495590_0039933
3648 Ga0495591_000312
3649 Ga0495591_010692
3650 Ga0495629_0000162
3651 Ga0495629_0000590
3652 Ga0495629_0017871
3653 Ga0495629_0026088
3654 Ga0495629_0042346
3655 Ga0495629_0107166
3656 Ga0495629_0151676
3657 Ga0495638_0000047
3658 Ga0495638_0005328
3659 Ga0495638_0006905
3660 Ga0495638_0008837
3661 Ga0495641_0003418
3662 Ga0495641_0036191
3663 Ga0495641_0060426
3664 Ga0495651_0000274
3665 Ga0495651_0001676
3666 Ga0495651_0119810
3667 Ga0495653_0000035
3668 Ga0495653_0002868
3669 Ga0495653_0005359
3670 Ga0495653_0031358
3671 Ga0495653_0060862
3672 Ga0495653_0111996
3673 Ga0495653_0163500
3674 Ga0495653_0167219
3675 Ga0495650_0000128
3676 Ga0495650_0000157
3677 Ga0495650_0000167
3678 Ga0495650_0000261
3679 Ga0495650_0002873
3680 Ga0495650_0003960
3681 Ga0495650_0015633
3682 Ga0495650_0039857
3683 Ga0495650_0042609
3684 Ga0495650_0053567
3685 Ga0495580_0004249
3686 Ga0495580_0011235
3687 Ga0495580_0030149
3688 Ga0495580_0031053
3689 Ga0495580_0034358
3690 Ga0495580_0061104
3691 Ga0495580_0122713
3692 Ga0495582_0003873
3693 Ga0495582_0033637
3694 Ga0495582_0035949
3695 Ga0495582_0049401
3696 Ga0495582_0078041
3697 Ga0495605_0000018
3698 Ga0495605_0000055
3699 Ga0495605_0000961
3700 Ga0495605_0001384
3701 Ga0495605_0007115
3702 Ga0495605_0010923
3703 Ga0495605_0011263
3704 Ga0495605_0015947
3705 Ga0495605_0034190
3706 Ga0495605_0059499
3707 Ga0495605_0067680
3708 Ga0495639_0002991
3709 Ga0495662_0008371
3710 Ga0495662_0027907
3711 Ga0495662_0051339
3712 Ga0495664_0003278
3713 Ga0495664_0026439
3714 Ga0495584_0000004
3715 Ga0495584_0000073
3716 Ga0495584_0001460
3717 Ga0495584_0002768
3718 Ga0495584_0005708
3719 Ga0495584_0023301
3720 Ga0495584_0031079
3721 Ga0495584_0041975
3722 Ga0495584_0050364
3723 Ga0495584_0067898
3724 Ga0495585_0000119
3725 Ga0495585_0000859
3726 Ga0495585_0001551
3727 Ga0495585_0002189
3728 Ga0495585_0002462
3729 Ga0495585_0065432
3730 Ga0495594_0003092
3731 Ga0495594_0008963
3732 Ga0495594_0021371
3733 Ga0495594_0035150
3734 Ga0495594_0040861
3735 Ga0495596_0000916
3736 Ga0495596_0000968
3737 Ga0495596_0005030
3738 Ga0495596_0009364
3739 Ga0495596_0011354
3740 Ga0495596_0011865
3741 Ga0495596_0016204
3742 Ga0495596_0029904
3743 Ga0495596_0041322
3744 Ga0495596_0047121
3745 Ga0495607_0000009
3746 Ga0495607_0001276
3747 Ga0495607_0006186
3748 Ga0495607_0006362
3749 Ga0495607_0009405
3750 Ga0495607_0011112
3751 Ga0495607_0013585
3752 Ga0495607_0028869
3753 Ga0495607_0031432
3754 Ga0495607_0033315
3755 Ga0495607_0040955
3756 Ga0495583_0000115
3757 Ga0495583_0000132
3758 Ga0495583_0000493
3759 Ga0495583_0001058
3760 Ga0495583_0002029
3761 Ga0495583_0002050
3762 Ga0495583_0002235
3763 Ga0495583_0006944
3764 Ga0495583_0010382
3765 Ga0495583_0010659
3766 Ga0495583_0012070
3767 Ga0495583_0022321
3768 Ga0495606_0000288
3769 Ga0495606_0000512
3770 Ga0495606_0000790
3771 Ga0495606_0001762
3772 Ga0495606_0003944
3773 Ga0495606_0004472
3774 Ga0495606_0010834
3775 Ga0495606_0015287
3776 Ga0495606_0017462
3777 Ga0495606_0026214
3778 Ga0495606_0027510
3779 Ga0495606_0028829
3780 Ga0495606_0058521
3781 Ga0495606_0111305
3782 Ga0495608_0002285
3783 Ga0495608_0009653
3784 Ga0495608_0032757
3785 Ga0495610_0000014
3786 Ga0495610_0001174
3787 Ga0495610_0002536
3788 Ga0495610_0008287
3789 Ga0495610_0011267
3790 Ga0495610_0017992
3791 Ga0495610_0061222
3792 Ga0495616_0000157
3793 Ga0495616_0003730
3794 Ga0495616_0005975
3795 Ga0495616_0006610
3796 Ga0495616_0008291
3797 Ga0495616_0009471
3798 Ga0495616_0013452
3799 Ga0495616_0019415
3800 Ga0495616_0031569
3801 Ga0495616_0045414
3802 Ga0495616_0052437
3803 Ga0495618_0002173
3804 Ga0495618_0004385
3805 Ga0495618_0005165
3806 Ga0495618_0041033
3807 Ga0495618_0149271
3808 Ga0495620_0012913
3809 Ga0495620_0045387
3810 Ga0495628_0001227
3811 Ga0495628_0002006
3812 Ga0495628_0002322
3813 Ga0495628_0009437
3814 Ga0495628_0013732
3815 Ga0495628_0021622
3816 Ga0495628_0101241
3817 Ga0495630_0001736
3818 Ga0495630_0009319
3819 Ga0495630_0010824
3820 Ga0495630_0031536
3821 Ga0495630_0057825
3822 Ga0495630_0189186
3823 Ga0495631_0000272
3824 Ga0495631_0000791
3825 Ga0495631_0009119
3826 Ga0495631_0009844
3827 Ga0495631_0021780
3828 Ga0495631_0045606
3829 Ga0495632_0000017
3830 Ga0495632_0009675
3831 Ga0495632_0011802
3832 Ga0495632_0014248
3833 Ga0495632_0018300
3834 Ga0495637_0000003
3835 Ga0495637_0000142
3836 Ga0495637_0003152
3837 Ga0495637_0010369
3838 Ga0495637_0022607
3839 Ga0495643_0000082
3840 Ga0495643_0000085
3841 Ga0495643_0000160
3842 Ga0495643_0000399
3843 Ga0495643_0000992
3844 Ga0495643_0005101
3845 Ga0495643_0016840
3846 Ga0495643_0032926
3847 Ga0495644_0000831
3848 Ga0495644_0009921
3849 Ga0495644_0019149
3850 Ga0495648_0000019
3851 Ga0495648_0000052
3852 Ga0495648_0000732
3853 Ga0495648_0007157
3854 Ga0495648_0007724
3855 Ga0495648_0012877
3856 Ga0495648_0013458
3857 Ga0495648_0030425
3858 Ga0495663_0007852
3859 Ga0495666_0000199
3860 Ga0495666_0002778
3861 Ga0495666_0003438
3862 Ga0495666_0004516
3863 Ga0495666_0030497
3864 Ga0495666_0063123
3865 Ga0495642_0000449
3866 Ga0495642_0001035
3867 Ga0495642_0006707
3868 Ga0495642_0011663
3869 Ga0495642_0014960
3870 Ga0495642_0036448
3871 Ga0495642_0045668
3872 Ga0495652_0002976
3873 Ga0495652_0005308
3874 Ga0495652_0005804
3875 Ga0495652_0047949
3876 Ga0495652_0057709
3877 Ga0495652_0080736
3878 Ga0495652_0154788
3879 Ga0495654_0000014
3880 Ga0495654_0005229
3881 Ga0495654_0010327
3882 Ga0495654_0012762
3883 Ga0495654_0031730
3884 Ga0495665_0004802
3885 Ga0495665_0006439
3886 Ga0495665_0016196
3887 Ga0495665_0020312
3888 Ga0495665_0029480
3889 Ga0495640_0002839
3890 Ga0495640_0004166
3891 Ga0495640_0005911
3892 Ga0495640_0009652
3893 Ga0495640_0106448
3894 Ga0495586_0004875
3895 Ga0495586_0009640
3896 Ga0495586_0090358
3897 Ga0495586_0105397
3898 Ga0495587_0007690
3899 Ga0495587_0017118
3900 Ga0495587_0026723
3901 Ga0495609_0000038
3902 Ga0495609_0000434
3903 Ga0495609_0000537
3904 Ga0495609_0002203
3905 Ga0495609_0002312
3906 Ga0495609_0014352
3907 Ga0495609_0024405
3908 Ga0495609_0044822
3909 Ga0495621_0028115
3910 Ga0495597_0000535
3911 Ga0495597_0001237
3912 Ga0495597_0002761
3913 Ga0495597_0003960
3914 Ga0495597_0004345
3915 Ga0495597_0004947
3916 Ga0495597_0005518
3917 Ga0495597_0006195
3918 Ga0495597_0056154
3919 Ga0495645_0000247
3920 Ga0495645_0004493
3921 Ga0495645_0041113
3922 Ga0495645_0074233
3923 Ga0495645_0116787
3924 Ga0495645_0117510
3925 Ga0495622_0000034
3926 Ga0495622_0000071
3927 Ga0495622_0000349
3928 Ga0495622_0008287
3929 Ga0495622_0021691
3930 Ga0495622_0053050
3931 Ga0495633_0000086
3932 Ga0495633_0000217
3933 Ga0495633_0007711
3934 Ga0495633_0009061
3935 Ga0495633_0034401
3936 Ga0495633_0043439
3937 Ga0495633_0049078
3938 Ga0495633_0054526
3939 Ga0495633_0060795
3940 Ga0495633_0076119
3941 Ga0495667_0019475
3942 Ga0495667_0051037
3943 Ga0495667_0056055
3944 Ga0495668_0000231
3945 Ga0495668_0000308
3946 Ga0495668_0000822
3947 Ga0495668_0001569
3948 Ga0495668_0002035
3949 Ga0495668_0002722
3950 Ga0495668_0003129
3951 Ga0495668_0047238
3952 Ga0495668_0092212
3953 Ga0495634_0004419
3954 Ga0495634_0008989
3955 Ga0495611_0008271
3956 Ga0495611_0011942
3957 Ga0495611_0063754
3958 Ga0495611_0066798
3959 Ga0495611_0092627
3960 Ga0495625_0000447
3961 Ga0495625_0008737
3962 Ga0495625_0009504
3963 Ga0495625_0010695
3964 Ga0495625_0011910
3965 Ga0495625_0025498
3966 Ga0495625_0032036
3967 Ga0495635_0008843
3968 Ga0495635_0010196
3969 Ga0495635_0011715
3970 Ga0495635_0021754
3971 Ga0495635_0036085
3972 Ga0495635_0038909
3973 Ga0495659_0000272
3974 Ga0495659_0026864
3975 Ga0495661_0001562
3976 Ga0495661_0001766
3977 Ga0495661_0002878
3978 Ga0495661_0005985
3979 Ga0495661_0007699
3980 Ga0495661_0007851
3981 Ga0495661_0017607
3982 Ga0495661_0025557
3983 Ga0495661_0038428
3984 Ga0495661_0039078
3985 Ga0495661_0040712
3986 Ga0495661_0041600
3987 Ga0495661_0068835
3988 Ga0495588_0000156
3989 Ga0495588_0010066
3990 Ga0495588_0013550
3991 Ga0495588_0023485
3992 Ga0495588_0047528
3993 Ga0495588_0076250
3994 Ga0495588_0080376
3995 Ga0495657_0009194
3996 Ga0495599_0000345
3997 Ga0495599_0003910
3998 Ga0495599_0020682
3999 Ga0495599_0020769
4000 Ga0495599_0054235
4001 Ga0495599_0058521
4002 Ga0495623_0004581
4003 Ga0495623_0017479
4004 Ga0495623_0019318
4005 Ga0495623_0020589
4006 Ga0495623_0040395
4007 Ga0495646_0004004
4008 Ga0495646_0007283
4009 Ga0495646_0010465
4010 Ga0495646_0011678
4011 Ga0495646_0062765
4012 Ga0495647_0002049
4013 Ga0495647_0013319
4014 Ga0495658_0081552
4015 Ga0495669_0000032
4016 Ga0495669_0002103
4017 Ga0495669_0025637
4018 Ga0495669_0026320
4019 Ga0495669_0031466
4020 Ga0495669_0043492
4021 Ga0495613_0002201
4022 Ga0495613_0027279
4023 Ga0495613_0042351
4024 Ga0495613_0049296
4025 Ga0495613_0065453
4026 Ga0495613_0079918
4027 Ga0495613_0141158
4028 Ga0495624_0001654
4029 Ga0495624_0014854
4030 Ga0495624_0053602
4031 Ga0495624_0066848
4032 Ga0495624_0132125
4033 Ga0495624_0147497
4034 Ga0495670_0000920
4035 Ga0495670_0004415
4036 Ga0495670_0017378
4037 Ga0495670_0017711
4038 Ga0495670_0028611
4039 Ga0495670_0040494
4040 Ga0495670_0090162
4041 Ga0495671_0000005
4042 Ga0495671_0001606
4043 Ga0495671_0001885
4044 Ga0495671_0016807
4045 Ga0495649_0001623
4046 Ga0495649_0002812
4047 Ga0495649_0008870
4048 Ga0495649_0008873
4049 Ga0495649_0014241
4050 Ga0495649_0017212
4051 Ga0495649_0017985
4052 Ga0495649_0032362
4053 Ga0495649_0039696
4054 Ga0495589_0000074
4055 Ga0495589_0000099
4056 Ga0495589_0001423
4057 Ga0495589_0006294
4058 Ga0495589_0006917
4059 Ga0495589_0017339
4060 Ga0495600_0001954
4061 Ga0495600_0006364
4062 Ga0495600_0009048
4063 Ga0495600_0082094
4064 Ga0495600_0118576
4065 Ga0495600_0138134
4066 Ga0495660_0000047
4067 Ga0495660_0010921
4068 Ga0495660_0012239
4069 Ga0495660_0014380
4070 Ga0495660_0028815
4071 Ga0495660_0081233
4072 Ga0495660_0082492
4073 Ga0495581_0000213
4074 Ga0495581_0003264
4075 Ga0495581_0036333
4076 Ga0495604_0015545
4077 Ga0495604_0015812
4078 Ga0495604_0024936
4079 Ga0495604_0047889
4080 Ga0495604_0048118
4081 Ga0495604_0067800
4082 Ga0495636_0000635
4083 Ga0495636_0012512
4084 Ga0495674_0005197
4085 Ga0495674_0012431
4086 Ga0495674_0015155
4087 Ga0495674_0032425
4088 Ga0495674_0046861
4089 Ga0495674_0098320
4090 Ga0495674_0282145
4091 Ga0495672_0000026
4092 Ga0495672_0000081
4093 Ga0495672_0000256
4094 Ga0495672_0000421
4095 Ga0495672_0000532
4096 Ga0495672_0001024
4097 Ga0495672_0001885
4098 Ga0495672_0005608
4099 Ga0495672_0015255
4100 Ga0495672_0015962
4101 Ga0495672_0078650
4102 Ga0495676_0000031
4103 Ga0495676_0015996
4104 Ga0495676_0019848
4105 Ga0495676_0032388
4106 Ga0495680_0003749
4107 Ga0495680_0006910
4108 Ga0495680_0009905
4109 Ga0495680_0024413
4110 Ga0495680_0042030
4111 Ga0495680_0064052
4112 Ga0495680_0074276
4113 Ga0495683_0000211
4114 Ga0495683_0000799
4115 Ga0495683_0001275
4116 Ga0495683_0005185
4117 Ga0495683_0007236
4118 Ga0495683_0013201
4119 Ga0495683_0022535
4120 Ga0495683_0030361
4121 Ga0495683_0046539
4122 Ga0495687_000071
4123 Ga0495687_000172
4124 Ga0495687_000216
4125 Ga0495687_000238
4126 Ga0495687_000446
4127 Ga0495687_000699
4128 Ga0495687_000941
4129 Ga0495687_004764
4130 Ga0495687_006200
4131 Ga0495687_008808
4132 Ga0495687_008897
4133 Ga0495687_015441
4134 Ga0495675_0004732
4135 Ga0495675_0005062
4136 Ga0495675_0006408
4137 Ga0495675_0007491
4138 Ga0495675_0013243
4139 Ga0495675_0016025
4140 Ga0495675_0035531
4141 Ga0495677_0000016
4142 Ga0495677_0005954
4143 Ga0495677_0007648
4144 Ga0495677_0008031
4145 Ga0495677_0009052
4146 Ga0495677_0028623
4147 Ga0495679_000742
4148 Ga0495679_003724
4149 Ga0495679_004470
4150 Ga0495679_012149
4151 Ga0495679_017101
4152 Ga0495679_022901
4153 Ga0495685_000034
4154 Ga0495685_026406
4155 Ga0495673_0000008
4156 Ga0495673_0000009
4157 Ga0495673_0000012
4158 Ga0495673_0006968
4159 Ga0495673_0013138
4160 Ga0495681_0000455
4161 Ga0495681_0001167
4162 Ga0495681_0003571
4163 Ga0495681_0004083
4164 Ga0495681_0005081
4165 Ga0495681_0049198
4166 Ga0495684_0021144
4167 Ga0495684_0049257
4168 Ga0495684_0050172
4169 Ga0495686_0000114
4170 Ga0495686_0000130
4171 Ga0495686_0000214
4172 Ga0495686_0000677
4173 Ga0495686_0023072
4174 Ga0495686_0053852
4175 Ga0495686_0060701
4176 Ga0495593_0002595
4177 Ga0495593_0003130
4178 Ga0495593_0004295
4179 Ga0495593_0035125
4180 Ga0495593_0036769
4181 Ga0495593_0042247
4182 Ga0495593_0080895
4183 Ga0495602_0013599
4184 Ga0495602_0015119
4185 Ga0495602_0015582
4186 Ga0495602_0038338
4187 Ga0495602_0057560
4188 Ga0495602_0202675
4189 Ga0495614_0001631
4190 Ga0495614_0004355
4191 Ga0495614_0013928
4192 Ga0495614_0039468
4193 Ga0495614_0046472
4194 Ga0495626_0000005
4195 Ga0495626_0000042
4196 Ga0495626_0002637
4197 Ga0495626_0003725
4198 Ga0495626_0009196
4199 Ga0495626_0009568
4200 Ga0495626_0010342
4201 Ga0495626_0021029
4202 Ga0495626_0049242
4203 Ga0495626_0054323
4204 Ga0495626_0064342
4205 Ga0495626_0070338
4206 Ga0496100_0021845
4207 Ga0496100_0025897
4208 Ga0496100_0034135
4209 Ga0496100_0123011
4210 Ga0496101_0007572
4211 Ga0496101_0033588
4212 Ga0496101_0089511
4213 Ga0496101_0231120
4214 Ga0496102_0000153
4215 Ga0496102_0010940
4216 Ga0496102_0014119
4217 Ga0496102_0018573
4218 Ga0496102_0021473
4219 Ga0496102_0040268
4220 Ga0496102_0042124
4221 Ga0496102_0070985
4222 Ga0496102_0100936
4223 Ga0496103_0006283
4224 Ga0496103_0007774
4225 Ga0496103_0025854
4226 Ga0496103_0030757
4227 Ga0496103_0055585
4228 Ga0496104_0000891
4229 Ga0496104_0066672
4230 Ga0496104_0161055
4231 Ga0496104_0162804
4232 Ga0496104_0170620
4233 Ga0496105_0005306
4234 Ga0496105_0006907
4235 Ga0496105_0040631
4236 Ga0496105_0128961
4237 Ga0496106_0000162
4238 Ga0496106_0004246
4239 Ga0496106_0008554
4240 Ga0496106_0056835
4241 Ga0496106_0063207
4242 Ga0496106_0064254
4243 Ga0496106_0094273
4244 Ga0496106_0101891
4245 Ga0496107_0019168
4246 Ga0496107_0102590
4247 Ga0496108_0006422
4248 Ga0496109_0068437
4249 Ga0496109_0129450
4250 Ga0496110_0001119
4251 Ga0496110_0002372
4252 Ga0496110_0014359
4253 Ga0496111_0035464
4254 Ga0496111_0064487
4255 Ga0496112_0003046
4256 Ga0496112_0003721
4257 Ga0496112_0069434
4258 Ga0496113_0140577
4259 Ga0496114_0006589
4260 Ga0496114_0032115
4261 Ga0496114_0068335
4262 Ga0496114_0207294
4263 Ga0496115_0086587
4264 Ga0496115_0092277
4265 Ga0496115_0186053
4266 Ga0496116_0002301
4267 Ga0496116_0003977
4268 Ga0496116_0006519
4269 Ga0496116_0033932
4270 Ga0496116_0070262
4271 Ga0496117_0000075
4272 Ga0496117_0002965
4273 Ga0496117_0007390
4274 Ga0496117_0020664
4275 Ga0496117_0037899
4276 Ga0496117_0056524
4277 Ga0496117_0059875
4278 Ga0496117_0064872
4279 Ga0496118_0000055
4280 Ga0496118_0012622
4281 Ga0496118_0018649
4282 Ga0496118_0021867
4283 Ga0496118_0040006
4284 Ga0496118_0040474
4285 Ga0496118_0109880
4286 Ga0496119_0004847
4287 Ga0496120_0004304
4288 Ga0496120_0025949
4289 Ga0496121_0000647
4290 Ga0496121_0003706
4291 Ga0496121_0009309
4292 Ga0496121_0013029
4293 Ga0496121_0022462
4294 Ga0496121_0026544
4295 Ga0496121_0033030
4296 Ga0496121_0037380
4297 Ga0496121_0039504
4298 Ga0496121_0088281
4299 Ga0496121_0098437
4300 Ga0496122_0000482
4301 Ga0496122_0000905
4302 Ga0496122_0003062
4303 Ga0496122_0003176
4304 Ga0496122_0022840
4305 Ga0496122_0042082
4306 Ga0496122_0051482
4307 Ga0496122_0066745
4308 Ga0496122_0086861
4309 Ga0496123_0000227
4310 Ga0496123_0000662
4311 Ga0496123_0002506
4312 Ga0496123_0008164
4313 Ga0496123_0009479
4314 Ga0496123_0011695
4315 Ga0496123_0025307
4316 Ga0496123_0031320
4317 Ga0496123_0076376
4318 Ga0496124_0000013
4319 Ga0496124_0005752
4320 Ga0496124_0049431
4321 Ga0496124_0078498
4322 Ga0496124_0100082
4323 Ga0496124_0125218
4324 Ga0496124_0151366
4325 Ga0496124_0202477
4326 Ga0496125_0000051
4327 Ga0496125_0000713
4328 Ga0496125_0001380
4329 Ga0496125_0004412
4330 Ga0496125_0004939
4331 Ga0496125_0005828
4332 Ga0496125_0041655
4333 Ga0496125_0049459
4334 Ga0496126_0001364
4335 Ga0496126_0008185
4336 Ga0496126_0028130
4337 Ga0496126_0032216
4338 Ga0496126_0204684
4339 Ga0495678_000027
4340 Ga0495678_000346
4341 Ga0495678_000353
4342 Ga0495678_000660
4343 Ga0495678_001631
4344 Ga0495678_008424
4345 Ga0495678_008745
4346 Ga0495678_011978
4347 Ga0495678_031217
4348 Ga0495682_0000226
4349 Ga0495682_0004354
4350 Ga0495682_0005090
4351 Ga0501031_0006864
4352 Ga0501031_0027564
4353 Ga0501031_0032072
4354 Ga0501032_0000221
4355 Ga0501032_0000970
4356 Ga0501032_0008286
4357 Ga0501032_0008735
4358 Ga0501032_0010987
4359 Ga0501032_0017436
4360 Ga0501032_0033277
4361 Ga0501032_0086149
4362 Ga0501032_0207753
4363 Ga0501033_0000668
4364 Ga0501033_0007516
4365 Ga0501033_0019907
4366 Ga0501033_0032391
4367 Ga0501033_0061546
4368 Ga0501033_0069036
4369 Ga0501034_0000134
4370 Ga0501034_0000759
4371 Ga0501034_0005349
4372 Ga0501034_0008519
4373 Ga0501034_0017542
4374 Ga0501034_0024667
4375 Ga0501034_0032264
4376 Ga0501034_0110282
4377 Ga0501034_0115501
4378 Ga0501034_0131147
4379 Ga0501034_0187591
4380 Ga0501036_0000552
4381 Ga0501036_0001501
4382 Ga0501036_0001538
4383 Ga0501036_0009445
4384 Ga0501036_0019041
4385 Ga0501036_0048043
4386 Ga0501036_0096500
4387 Ga0501036_0196801
4388 Ga0501037_0000686
4389 Ga0501037_0002298
4390 Ga0501037_0004363
4391 Ga0501037_0017144
4392 Ga0501037_0085314
4393 Ga0501037_0144999
4394 Ga0501037_0158841
4395 Ga0501037_0194478
4396 Ga0501038_0000960
4397 Ga0501038_0002842
4398 Ga0501038_0003252
4399 Ga0501038_0003593
4400 Ga0501038_0004394
4401 Ga0501038_0008551
4402 Ga0501038_0012847
4403 Ga0501038_0015525
4404 Ga0501038_0022931
4405 Ga0501038_0029026
4406 Ga0501038_0099959
4407 Ga0501038_0125604
4408 Ga0501039_0007282
4409 Ga0501039_0016968
4410 Ga0501039_0025173
4411 Ga0501039_0032691
4412 Ga0501039_0041643
4413 Ga0501039_0060266
4414 Ga0501039_0103080
4415 Ga0501040_0014410
4416 Ga0501040_0075461
4417 Ga0501041_0008018
4418 Ga0501041_0047625
4419 Ga0501042_0000507
4420 Ga0501042_0017864
4421 Ga0501042_0100461
4422 Ga0501043_0000590
4423 Ga0501043_0006325
4424 Ga0501043_0009032
4425 Ga0501043_0011435
4426 Ga0501043_0011488
4427 Ga0501043_0017915
4428 Ga0501043_0041120
4429 Ga0501043_0041412
4430 Ga0501043_0075125
4431 Ga0501046_0001415
4432 Ga0501046_0001675
4433 Ga0501046_0001989
4434 Ga0501046_0002058
4435 Ga0501046_0003768
4436 Ga0501046_0016345
4437 Ga0501046_0080284
4438 Ga0501047_0002329
4439 Ga0501047_0004747
4440 Ga0501047_0005593
4441 Ga0501047_0007469
4442 Ga0501047_0011407
4443 Ga0501047_0016356
4444 Ga0501047_0039260
4445 Ga0501047_0096933
4446 Ga0501048_0002597
4447 Ga0501048_0036116
4448 Ga0501067_0002250
4449 Ga0501067_0003668
4450 Ga0501067_0009429
4451 Ga0501068_0001005
4452 Ga0501068_0001270
4453 Ga0501068_0017117
4454 Ga0501068_0017863
4455 Ga0501068_0019551
4456 Ga0501069_0004273
4457 Ga0501069_0015372
4458 Ga0501069_0050503
4459 Ga0501069_0122061
4460 Ga0501070_0002752
4461 Ga0501070_0008651
4462 Ga0501070_0015005
4463 Ga0501070_0019636
4464 Ga0501070_0070123
4465 Ga0501070_0202207
4466 Ga0501071_0007920
4467 Ga0501071_0056320
4468 Ga0501071_0110353
4469 Ga0501072_0000721
4470 Ga0501072_0001241
4471 Ga0501072_0008347
4472 Ga0501072_0018503
4473 Ga0501073_0001319
4474 Ga0501073_0008012
4475 Ga0501073_0010466
4476 Ga0501074_0000084
4477 Ga0501074_0001435
4478 Ga0501074_0013097
4479 Ga0501074_0018070
4480 Ga0501074_0024532
4481 Ga0501074_0026813
4482 Ga0501074_0032543
4483 Ga0501074_0056238
4484 Ga0501074_0084198
4485 Ga0501075_0000035
4486 Ga0501075_0044205
4487 Ga0501076_0000199
4488 Ga0501076_0040681
4489 Ga0501076_0106281
4490 Ga0501077_0001173
4491 Ga0501077_0058351
4492 Ga0501209_001565
4493 Ga0501238_000551
4494 Ga0501079_0000770
4495 Ga0501079_0001484
4496 Ga0501079_0013290
4497 Ga0501079_0266696
4498 Ga0501080_0002074
4499 Ga0501080_0004675
4500 Ga0501080_0004781
4501 Ga0501080_0014265
4502 Ga0501080_0015482
4503 Ga0501080_0093425
4504 Ga0501080_0229633
4505 Ga0501081_0083308
4506 Ga0501081_0094342
4507 Ga0501083_0000252
4508 Ga0501083_0012538
4509 Ga0501083_0019326
4510 Ga0501083_0035807
4511 Ga0501269_000005
4512 Ga0501035_0003996
4513 Ga0501035_0007059
4514 Ga0501035_0007618
4515 Ga0501035_0008306
4516 Ga0501035_0009986
4517 Ga0501035_0010699
4518 Ga0501035_0012660
4519 Ga0501035_0012793
4520 Ga0501035_0013910
4521 Ga0501035_0020342
4522 Ga0501035_0064350
4523 Ga0501035_0128242
4524 Ga0501035_0253547
4525 Ga0501044_0000316
4526 Ga0501044_0000326
4527 Ga0501044_0001129
4528 Ga0501044_0001555
4529 Ga0501044_0006705
4530 Ga0501044_0007680
4531 Ga0501044_0013340
4532 Ga0501044_0018312
4533 Ga0501044_0029893
4534 Ga0501044_0035724
4535 Ga0501044_0037542
4536 Ga0501044_0048347
4537 Ga0501044_0102509
4538 Ga0501044_0238228
4539 Ga0501045_0001357
4540 Ga0501045_0001528
4541 Ga0501045_0038435
4542 Ga0501045_0068470
4543 Ga0501045_0076552
4544 Ga0501045_0123882
4545 Ga0501226_000002
4546 nmdc:mga03n38_43531_c1
4547 nmdc:mga00v17_14033_c1
4548 nmdc:mga00v17_170_c1
4549 nmdc:mga0k408_12785_c2
4550 nmdc:mga0k408_30518_c1
4551 nmdc:mga07m45_7326_c1
4552 nmdc:mga05p37_17300_c1
4553 nmdc:mga05p37_241_c1
4554 nmdc:mga09592_19325_c1
4555 nmdc:mga0qj67_143521_c1
4556 nmdc:mga0qj67_16366_c1
4557 nmdc:mga06r32_13918_c1
4558 nmdc:mga06r32_157901_c1
4559 nmdc:mga08y16_1258_c1
4560 nmdc:mga08y16_22715_c1
4561 nmdc:mga08y16_2325_c1
4562 nmdc:mga08y16_96759_c1
4563 nmdc:mga0n895_254085_c1
4564 nmdc:mga0n895_2883_c1
4565 nmdc:mga0rr50_5789_c1
4566 nmdc:mga0rr50_96357_c1
4567 nmdc:mga08x19_35328_c1
4568 nmdc:mga0a205_11980_c1
4569 nmdc:mga0a205_20190_c1
4570 Ga0495601_0003245
4571 Ga0495601_0004054
4572 Ga0495601_0005234
4573 Ga0495601_0012179
4574 Ga0495601_0021328
4575 Ga0495612_0001760
4576 Ga0495612_0015128
4577 Ga0495595_0000266
4578 Ga0495595_0001876
4579 Ga0495595_0012372
4580 Ga0495619_0002774
4581 Ga0495619_0026517
4582 Ga0495619_0061876
4583 Ga0495619_0163697
4584 Ga0500595_001195
4585 Ga0500595_024135
4586 Ga0500607_014149
4587 Ga0500618_000170
4588 Ga0500618_012824
4589 Ga0500642_0004977
4590 Ga0500655_014423
4591 Ga0500622_0000029
4592 Ga0500634_0031295
4593 Ga0500636_0000050
4594 Ga0500636_0003155
4595 Ga0501084_0000666
4596 Ga0501084_0003446
4597 Ga0501084_0006302
4598 Ga0501084_0020546
4599 Ga0501084_0023895
4600 Ga0501084_0055409
4601 Ga0500661_011237
4602 Ga0587083_0009977
4603 Ga0501082_0000640
4604 Ga0501082_0000750
4605 Ga0501082_0004946
4606 Ga0501082_0028353
4607 Ga0501082_0189801
4608 Ga0466962_0001912
4609 Ga0466962_0006689
4610 2501075053
4611 2501084061
4612 2501412748
4613 2509130784
4614 2511093384
4615 2511099834
4616 2511102395
4617 2511249687
4618 2511385817
4619 2512348380
4620 2513556089
4621 2513564275
4622 2513956681
4623 2513962660
4624 2514044489
4625 2514050840
4626 2515684800
4627 2515690883
4628 2516022286
4629 2519457571
4630 2521560068
4631 2527079968
4632 2545676817
4633 2547376143
4634 2550695172
4635 2553008062
4636 2563061589
4637 2585294094
4638 2587741905
4639 2595318734
4640 2596377259
4641 2597031591
4642 2599448056
4643 2599741101
4644 2599748408
4645 2599902787
4646 2600210320
4647 2600443529
4648 2600813853
4649 2601666859
4650 2602009017
4651 2643800950
4652 2643861624
4653 2643980044
4654 2644027013
4655 2644123610
4656 2644250543
4657 2644358864
4658 2644422612
4659 2644471316
4660 2644728173
4661 2644733988
4662 2673820518
4663 2676745755
4664 2713478545
4665 2719641621
4666 2729146288
4667 2738738684
4668 2738744940
4669 2738823965
4670 2738826218
4671 2738836356
4672 2738842498
4673 2738877886
4674 2739150015
4675 2739189592
4676 2739191934
4677 2739224479
4678 2739273245
4679 2739318411
4680 2739336652
4681 2739342289
4682 2739354170
4683 2739611312
4684 2746087287
4685 2746093206
4686 2753566138
4687 2765571247
4688 2792837007
4689 2808905193
4690 2808942290
4691 2808972912
4692 2808982586
4693 2809007923
4694 2809015437
4695 2809033127
4696 2809129587
4697 2809146398
4698 2809149358
4699 2817259761
4700 2817277430
4701 2817453596
4702 2819543794
4703 2819592779
4704 2819616431
4705 2819624225
4706 2819636857
4707 2819675466
4708 2819716733
4709 2821134979
4710 2823425135
4711 2829748774
4712 2839099088
4713 2841915413
4714 2841920615
4715 2842332123
4716 2842356425
4717 2842461221
4718 2842699705
4719 2842715838
4720 2842809172
4721 2843695250
4722 2846041668
4723 2852619500
4724 2855732817
4725 2855771569
4726 2856289350
4727 2857362223
4728 2857459632
4729 2857542505
4730 2857543364
4731 2857552748
4732 2857558122
4733 2857558771
4734 2857569648
4735 2857578019
4736 2861691963
4737 2863426437
4738 2870069343
4739 2881929872
4740 2883091381
4741 2883295769
4742 2883358547
4743 2884815963
4744 2884838654
4745 2884854945
4746 2885086328
4747 2885269472
4748 2885272423
4749 2887376224
4750 2889308487
4751 2894655458
4752 2895515745
4753 2896156386
4754 2898798534
4755 2899275972
4756 2900580406
4757 2900637134
4758 2902334115
4759 2902410634
4760 2902686738
4761 2904428343
4762 2904439042
4763 2904440898
4764 2904490179
4765 2904535500
4766 2904569398
4767 2904576765
4768 2904588359
4769 2904594753
4770 2904606016
4771 2904621507
4772 2904761707
4773 2917701753
4774 2919049065
4775 2919084674
4776 2919430065
4777 2919476430
4778 2919501856
4779 2919533348
4780 2921647675
4781 2923513799
4782 2926063529
4783 2928063671
4784 2928114149
4785 2928127701
4786 2928134361
4787 2928141103
4788 2928163105
4789 2928170145
4790 2928176275
4791 2928509144
4792 2928542075
4793 2929207190
4794 2932415681
4795 2932421671
4796 2941482631
4797 2945934503
4798 2971412746
4799 2981996048
4800 2990704938
4801 3003669793
4802 3007254172
4803 3007317089
4804 641642852
4805 642426602
4806 642416514
4807 642594555
4808 642623140
4809 643602431
4810 644749192
4811 8002395900
4812 8003402208
4813 8003956767
4814 8018847988
4815 8020813973
4816 8020938987
4817 8020947703
4818 8020953466
4819 8021127572
4820 8034963110
4821 8039099722
4822 8040174164
4823 8047674663
4824 8048747539
4825 8054565985
4826 8055228455
4827 8055269488
4828 8055307350
4829 8055636750
4830 8056536144

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00815

Histidinol_dh

Histidinol dehydrogenase

70

478

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4g09-assembly1.cif.gz_A-2 the crystal structure of the c366s mutant of hdh from brucella suis in complex with a substituted benzyl ketone 0.9726 5 435
4g07-assembly1.cif.gz_A-2 the crystal structure of the c366s mutant of hdh from brucella suis 0.9693 5 435
4gic-assembly1.cif.gz_B crystal structure of a putative histidinol dehydrogenase (target psi-014034) from methylococcus capsulatus 0.9583 1 405
4gic-assembly1.cif.gz_B crystal structure of a putative histidinol dehydrogenase (target psi-014034) from methylococcus capsulatus 0.9559 1 405
4g09-assembly1.cif.gz_A-2 the crystal structure of the c366s mutant of hdh from brucella suis in complex with a substituted benzyl ketone 0.9461 5 435
ID Description Score Start End Superfamily
af_P9WNW9_250_396_3.40.50.1980 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.978 242 387 3.40.50.1980
4g07A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.9743 33 238 3.40.50.1980
4g07A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.9712 243 387 3.40.50.1980
af_Q2FUT8_220_366_3.40.50.1980 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.9666 241 387 3.40.50.1980
af_P9WNW9_250_396_3.40.50.1980 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.965 242 387 3.40.50.1980
ID Description Score Start End GO Terms
AF-A0A3D2F981-F1-model_v4 Histidinol dehydrogenase 0.9989 130 242 GO:0000105
GO:0004399
GO:0005829
GO:0046872
GO:0051287
AF-A0A348N1P0-F1-model_v4 Histidinol dehydrogenase 0.9934 228 337 GO:0000105
GO:0004399
GO:0005829
GO:0046872
GO:0051287
AF-A0A536UMU2-F1-model_v4 Histidinol dehydrogenase (HDH) (EC 1.1.1.23) 0.9921 2 438 GO:0000105
GO:0004399
GO:0005829
GO:0008270
GO:0051287
AF-A0A259CVS0-F1-model_v4 Histidinol dehydrogenase 0.9919 1 300 GO:0000105
GO:0004399
GO:0005829
GO:0046872
GO:0051287
AF-A0A139BWV5-F1-model_v4 Histidinol dehydrogenase (HDH) (EC 1.1.1.23) 0.9918 4 435 GO:0000105
GO:0004399
GO:0005829
GO:0008270
GO:0051287

Map