F496887

General Info

Members Datasets Scaffolds Average Seq Length
2527 758 4948 405

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8016583857|8016591556
Length 480
Sequence SIASFLLGTALALASTSGAMAQDKTIKVGVLTDNSGLYADLGGPGSTLAAQMAIEDSGLAAKGWKVDLISADHQNKPDIGTAIARQWIDVEKIDVFMDVLNSGVALAVNNVVREKNAILIDTGAATSDLTNAQCSPNTIHWVYDTYMLANSTGQALVKAGGDTWYFLTADYAFGHALERDTAAVVVKSGGKVIGSVKHPLNTADFSSFLLQAQASKAKIIGMANAGGDTTNTIKQAAEFGIVAGGQKLAGLLLFITDVHALGLKVAQGLNFTETFYWDLNDGTRAFSKRFSERMKNKAMPSMVQAGVYSGLIHYFKTLEALGGNPHDGTKVVAKMKEMPTDDPLFGQGTIRADGRKLHPAYLFEVKKPEESKGPWDYYKLIGTTPADQAFRPLSDSACSAGEEVTPTAPAGGRCQQQNGTGCGIDAGSLRSATGGIDQRLVLRAAQSRACRDLRHAQHHQFRPRRALHDGRVRRLFPAQQ

Samples

Sample ID Description Type Environment
1 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
12 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
13 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
14 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
15 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
41 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
42 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
52 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
53 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
54 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
61 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
80 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
81 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
82 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
83 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
84 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
85 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
86 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
87 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
88 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
89 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
90 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
91 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
92 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
93 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
94 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
96 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
97 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
98 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
99 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
100 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
101 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
102 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
103 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
104 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
106 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
107 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
108 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
109 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
110 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
111 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
112 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
113 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
114 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
115 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
116 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
117 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
118 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
119 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
120 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
121 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
122 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
123 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
124 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
125 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
126 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
127 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
128 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
129 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
130 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
131 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
132 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
133 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
134 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
135 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
136 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
137 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
138 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
139 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
140 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
141 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
142 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
143 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
144 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
145 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
146 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
148 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
151 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
153 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
154 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
155 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
156 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
221 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
222 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
224 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
225 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
226 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
231 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
233 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
237 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
238 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
239 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
240 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
241 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
242 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
243 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
244 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
245 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
246 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
247 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
248 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
249 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
250 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
251 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
252 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
253 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
254 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
255 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
256 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
257 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
258 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
259 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
260 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
261 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
262 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
263 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
264 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
265 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
266 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
267 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
268 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
269 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
270 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
271 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
272 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
273 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
274 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
275 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
276 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
277 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
278 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
279 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
280 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
281 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
282 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
283 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
284 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
285 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
286 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
287 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
288 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
289 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
290 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
291 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
292 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
293 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
294 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
295 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
296 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
297 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
298 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
299 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
300 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
301 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
302 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
303 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
304 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
305 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
306 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
307 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
308 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
309 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
310 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
311 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
312 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
313 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
314 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
315 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
316 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
317 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
318 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
319 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
320 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
321 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
322 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
323 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
324 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
325 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
326 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
327 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
328 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
329 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
330 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
331 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
332 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
333 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
334 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
335 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
336 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
337 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
338 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
339 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
340 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
341 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
342 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
343 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
344 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
345 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
346 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
347 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
348 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
349 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
350 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
351 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
352 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
353 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
354 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
355 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
356 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
357 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
358 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
359 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
360 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
361 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
362 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
363 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
364 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
365 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
366 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
367 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
368 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
369 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
370 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
371 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
372 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
373 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
374 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
375 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
376 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
377 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
378 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
379 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
380 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
381 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
382 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
383 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
384 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
385 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
386 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
387 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
388 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
389 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
390 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
391 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
392 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
393 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
394 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
395 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
396 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
397 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
398 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
399 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
400 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
401 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
402 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
403 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
404 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
405 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
406 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
407 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
408 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
409 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
410 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
411 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
412 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
413 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
414 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
415 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
416 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
417 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
418 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
419 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
420 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
421 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
422 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
423 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
424 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
425 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
426 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
427 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
428 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
429 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
430 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
431 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
432 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
433 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
434 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
435 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
436 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
437 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
438 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
439 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
440 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
441 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
442 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
443 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
444 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
445 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
446 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
447 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
448 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
449 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
450 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
451 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
452 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
453 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
454 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
455 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
456 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
457 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
458 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
459 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
460 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
461 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
462 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
463 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
464 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
465 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
466 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
467 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
468 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
469 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
470 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
471 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
472 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
473 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
474 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
475 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
476 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
477 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
478 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
479 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
480 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
481 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
482 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
483 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
484 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
485 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
486 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
487 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
488 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
489 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
490 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
491 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
492 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
493 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
494 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
495 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
496 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
497 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
498 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
499 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
500 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
501 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
502 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
503 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
504 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
505 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
506 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
507 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
508 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
509 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
510 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
511 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
512 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
513 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
514 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
515 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
516 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
517 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
518 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
519 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
520 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
521 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
522 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
523 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
524 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
525 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
526 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
527 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
528 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
529 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
530 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
531 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
532 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
533 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
534 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
535 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
536 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
537 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
538 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
539 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
540 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
541 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
542 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
543 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
544 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
545 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
546 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
547 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
548 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
549 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
550 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
551 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
552 2643221651 Afipia sp. Root123D2 Isolate Unclassified
553 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
554 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
555 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
556 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
557 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
558 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
559 2791355199
560 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
561 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
562 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
563 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
564 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
565 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
566 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
567 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
568 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
569 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
570 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
571 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
572 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
573 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
574 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
575 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
576 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
577 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
578 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
579 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
580 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
581 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
582 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
583 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
584 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
585 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
586 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
587 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
588 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
589 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
590 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
591 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
592 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
593 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
594 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
595 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
596 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
597 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
598 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
599 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
600 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
601 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
602 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
603 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
604 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
605 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
606 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
607 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
608 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
609 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
610 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
611 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
612 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
613 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
614 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
615 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
616 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
617 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
618 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
619 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
620 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
621 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
622 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
623 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
624 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
625 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
626 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
627 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
628 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
629 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
630 2904699407
631 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
632 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
633 2906610324
634 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
635 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
636 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
637 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
638 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
639 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
640 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
641 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
642 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
643 2922368715
644 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
645 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
646 2922425934
647 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
648 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
649 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
650 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
651 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
652 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
653 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
654 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
655 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
656 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
657 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
658 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
659 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
660 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
661 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
662 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
663 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
664 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
665 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
666 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
667 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
668 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
669 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
670 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
671 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
672 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
673 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
674 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
675 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
676 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
677 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
678 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
679 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
680 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
681 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
682 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
683 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
684 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
685 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
686 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
687 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
688 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
689 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
690 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
691 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
692 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
693 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
694 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
695 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
696 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
697 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
698 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
699 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
700 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
701 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
702 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
703 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
704 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
705 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
706 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
707 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
708 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
709 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
710 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
711 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
712 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
713 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
714 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
715 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
716 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
717 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
718 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
719 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
720 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
721 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
722 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
723 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
724 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
725 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
726 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
727 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
728 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
729 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
730 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
731 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
732 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
733 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
734 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
735 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
736 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
737 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
738 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
739 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
740 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
741 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
742 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
743 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
744 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
745 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
746 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
747 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
748 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
749 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
750 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
751 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
752 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
753 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
754 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
755 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
756 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
757 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
758 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 80.58
Metatranscriptomes 0.04
Isolates 19.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.12
Nodule 15.55
Rhizoplane 5.26
Rhizosphere 57.1
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1003744 3300001904 Bacteria 2624
2 JGI24740J21852_10013130 3300001979 Bacteria 3102
3 JGI24739J22299_10002406 3300001989 Bacteria 7218
4 JGI24737J22298_10002958 3300001990 Bacteria 6023
5 JGI24735J21928_10030063 3300002067 Bacteria 1614
6 JGI24738J21930_10010688 3300002075 Bacteria 2037
7 JGI25406J46586_10000018 3300003203 Bacteria 88860
8 JGI25406J46586_10000047 3300003203 Bacteria 54770
9 JGI25406J46586_10000078 3300003203 Bacteria 44054
10 JGI25406J46586_10011634 3300003203 Bacteria 3853
11 JGI25406J46586_10015609 3300003203 Bacteria 3197
12 JGI25153J46596_10000767 3300003215 Bacteria 19660
13 JGI25153J46596_10003048 3300003215 Bacteria 9466
14 JGI25153J46596_10006696 3300003215 Bacteria 5792
15 JGI25153J46596_10009098 3300003215 Bacteria 4662
16 JGI25153J46596_10011019 3300003215 Bacteria 4032
17 JGI25153J46596_10012096 3300003215 Bacteria 3759
18 JGI25153J46596_10030267 3300003215 Bacteria 1844
19 JGI25153J46596_10031973 3300003215 Bacteria 1762
20 JGI25153J46596_10037987 3300003215 Bacteria 1524
21 rootH1_10038628 3300003323 Bacteria 2062
22 JGI25160J50197_1000847 3300003354 Bacteria 16257
23 JGI25160J50197_1001193 3300003354 Bacteria 13206
24 JGI25160J50197_1001218 3300003354 Bacteria 13076
25 JGI25160J50197_1004453 3300003354 Bacteria 6056
26 JGI25160J50197_1004825 3300003354 Bacteria 5747
27 JGI25160J50197_1028395 3300003354 Bacteria 1503
28 JGI25404J52841_10007069 3300003659 Bacteria 2365
29 JGI25404J52841_10011788 3300003659 Bacteria 1888
30 JGI25404J52841_10016974 3300003659 Bacteria 1579
31 Ga0055531_10007226 3300003794 Bacteria 6107
32 Ga0055543_1005693 3300004625 Bacteria 3140
33 Ga0065165_1000348 3300005262 Bacteria 75762
34 Ga0065165_1001524 3300005262 Bacteria 24366
35 Ga0065165_1003137 3300005262 Bacteria 12207
36 Ga0065165_1003351 3300005262 Bacteria 11391
37 Ga0065165_1010602 3300005262 Bacteria 3957
38 Ga0065165_1011649 3300005262 Bacteria 3640
39 Ga0065165_1020475 3300005262 Bacteria 2326
40 Ga0065165_1039787 3300005262 Bacteria 1405
41 Ga0065715_10099425 3300005293 Bacteria 3414
42 Ga0065715_10143551 3300005293 Bacteria 1819
43 Ga0065707_10013358 3300005295 Bacteria 3021
44 Ga0070683_100011949 3300005329 Bacteria 7531
45 Ga0070690_100087730 3300005330 Bacteria 2044
46 Ga0070670_100104274 3300005331 Bacteria 2443
47 Ga0070677_10003948 3300005333 Bacteria 4815
48 Ga0068869_100001877 3300005334 Bacteria 12626
49 Ga0068869_100019670 3300005334 Bacteria 4619
50 Ga0068869_100078244 3300005334 Bacteria 2462
51 Ga0068869_100086684 3300005334 Bacteria 2347
52 Ga0068869_100217356 3300005334 Bacteria 1513
53 Ga0070666_10156910 3300005335 Bacteria 1590
54 Ga0070680_100001711 3300005336 Bacteria 16114
55 Ga0070680_100018006 3300005336 Bacteria 5578
56 Ga0070680_100026234 3300005336 Bacteria 4659
57 Ga0070680_100029010 3300005336 Bacteria 4443
58 Ga0070680_100043257 3300005336 Bacteria 3659
59 Ga0070680_100049897 3300005336 Bacteria 3413
60 Ga0070680_100086668 3300005336 Bacteria 2589
61 Ga0070680_100134802 3300005336 Bacteria 2068
62 Ga0070682_100015659 3300005337 Bacteria 4396
63 Ga0070682_100039303 3300005337 Bacteria 2907
64 Ga0068868_100014107 3300005338 Bacteria 5882
65 Ga0068868_100015336 3300005338 Bacteria 5665
66 Ga0068868_100025540 3300005338 Bacteria 4495
67 Ga0070660_100000724 3300005339 Bacteria 21893
68 Ga0070660_100109780 3300005339 Bacteria 2193
69 Ga0070660_100120710 3300005339 Bacteria 2091
70 Ga0070660_100226163 3300005339 Bacteria 1522
71 Ga0070660_100266697 3300005339 Bacteria 1399
72 Ga0070689_100090135 3300005340 Bacteria 2416
73 Ga0070689_100188949 3300005340 Bacteria 1677
74 Ga0070691_10078724 3300005341 Bacteria 1610
75 Ga0070661_100019484 3300005344 Bacteria 4837
76 Ga0070661_100051071 3300005344 Bacteria 3026
77 Ga0070668_100019213 3300005347 Bacteria 5141
78 Ga0070668_100095175 3300005347 Bacteria 2352
79 Ga0070668_100169920 3300005347 Bacteria 1774
80 Ga0070668_100192764 3300005347 Bacteria 1670
81 Ga0070675_100128068 3300005354 Bacteria 2161
82 Ga0070671_100023164 3300005355 Bacteria 5078
83 Ga0070671_100045047 3300005355 Bacteria 3667
84 Ga0070674_100120886 3300005356 Bacteria 1939
85 Ga0070674_100143937 3300005356 Bacteria 1792
86 Ga0070688_100023196 3300005365 Bacteria 3647
87 Ga0070688_100048956 3300005365 Bacteria 2628
88 Ga0070659_100002581 3300005366 Bacteria 12874
89 Ga0070659_100009498 3300005366 Bacteria 7146
90 Ga0070659_100026271 3300005366 Bacteria 4478
91 Ga0070659_100055803 3300005366 Bacteria 3114
92 Ga0070659_100079965 3300005366 Bacteria 2609
93 Ga0070667_100099088 3300005367 Bacteria 2515
94 Ga0070667_100183437 3300005367 Bacteria 1851
95 Ga0070709_10004463 3300005434 Bacteria 7552
96 Ga0070709_10005128 3300005434 Bacteria 7085
97 Ga0070709_10008476 3300005434 Bacteria 5648
98 Ga0070709_10037311 3300005434 Bacteria 2967
99 Ga0070709_10082645 3300005434 Bacteria 2099
100 Ga0070709_10084828 3300005434 Bacteria 2076
101 Ga0070714_100001950 3300005435 Bacteria 15066
102 Ga0070714_100009084 3300005435 Bacteria 7794
103 Ga0070714_100033046 3300005435 Bacteria 4323
104 Ga0070714_100040248 3300005435 Bacteria 3938
105 Ga0070714_100055472 3300005435 Bacteria 3386
106 Ga0070714_100063580 3300005435 Bacteria 3174
107 Ga0070714_100171348 3300005435 Bacteria 1970
108 Ga0070714_100214858 3300005435 Bacteria 1765
109 Ga0070713_100015728 3300005436 Bacteria 5668
110 Ga0070713_100036242 3300005436 Bacteria 3979
111 Ga0070713_100094317 3300005436 Bacteria 2580
112 Ga0070713_100160266 3300005436 Bacteria 2007
113 Ga0070713_100165992 3300005436 Bacteria 1974
114 Ga0070713_100178753 3300005436 Bacteria 1905
115 Ga0070710_10001928 3300005437 Bacteria 9829
116 Ga0070710_10006419 3300005437 Bacteria 5648
117 Ga0070710_10023896 3300005437 Bacteria 3219
118 Ga0070710_10044123 3300005437 Bacteria 2472
119 Ga0070710_10114129 3300005437 Bacteria 1627
120 Ga0070701_10055284 3300005438 Bacteria 2073
121 Ga0070701_10059601 3300005438 Bacteria 2007
122 Ga0070711_100000566 3300005439 Bacteria 19333
123 Ga0070711_100004427 3300005439 Bacteria 8290
124 Ga0070711_100004672 3300005439 Bacteria 8106
125 Ga0070711_100004805 3300005439 Bacteria 8013
126 Ga0070711_100010118 3300005439 Bacteria 5828
127 Ga0070711_100039439 3300005439 Bacteria 3182
128 Ga0070700_100084101 3300005441 Bacteria 2061
129 Ga0070700_100095059 3300005441 Bacteria 1952
130 Ga0070700_100143850 3300005441 Bacteria 1623
131 Ga0070708_100003380 3300005445 Bacteria 12502
132 Ga0070708_100029812 3300005445 Bacteria 4709
133 Ga0070708_100043098 3300005445 Bacteria 3964
134 Ga0070708_100249120 3300005445 Bacteria 1668
135 Ga0070663_100005434 3300005455 Bacteria 7566
136 Ga0070663_100023049 3300005455 Bacteria 4168
137 Ga0070663_100025725 3300005455 Bacteria 3977
138 Ga0070663_100061701 3300005455 Bacteria 2700
139 Ga0070663_100080927 3300005455 Bacteria 2386
140 Ga0070663_100083288 3300005455 Bacteria 2355
141 Ga0070663_100100599 3300005455 Bacteria 2156
142 Ga0070663_100206390 3300005455 Bacteria 1536
143 Ga0070678_100016197 3300005456 Bacteria 4760
144 Ga0070678_100086598 3300005456 Bacteria 2390
145 Ga0070678_100146943 3300005456 Bacteria 1894
146 Ga0070678_100171935 3300005456 Bacteria 1765
147 Ga0070678_100180985 3300005456 Bacteria 1725
148 Ga0070662_100010579 3300005457 Bacteria 6063
149 Ga0070681_10005696 3300005458 Bacteria 12042
150 Ga0070681_10042460 3300005458 Bacteria 4556
151 Ga0070681_10054701 3300005458 Bacteria 3977
152 Ga0070681_10075588 3300005458 Bacteria 3328
153 Ga0070681_10136004 3300005458 Bacteria 2388
154 Ga0070681_10149222 3300005458 Bacteria 2265
155 Ga0070681_10160678 3300005458 Bacteria 2171
156 Ga0070681_10212702 3300005458 Bacteria 1849
157 Ga0068867_100052680 3300005459 Bacteria 3003
158 Ga0070685_10146011 3300005466 Bacteria 1494
159 Ga0070706_100006190 3300005467 Bacteria 11322
160 Ga0070706_100074414 3300005467 Bacteria 3144
161 Ga0070707_100001543 3300005468 Bacteria 22396
162 Ga0070707_100001868 3300005468 Bacteria 20255
163 Ga0070707_100090611 3300005468 Bacteria 2959
164 Ga0070698_100006229 3300005471 Bacteria 12983
165 Ga0070698_100174065 3300005471 Bacteria 2092
166 Ga0070699_100002671 3300005518 Bacteria 15939
167 Ga0070699_100018233 3300005518 Bacteria 6031
168 Ga0070679_100003053 3300005530 Bacteria 15300
169 Ga0070679_100005756 3300005530 Bacteria 11497
170 Ga0070679_100012175 3300005530 Bacteria 8217
171 Ga0070679_100013007 3300005530 Bacteria 7970
172 Ga0070679_100022370 3300005530 Bacteria 6180
173 Ga0070679_100053055 3300005530 Bacteria 4036
174 Ga0070679_100104357 3300005530 Bacteria 2821
175 Ga0070679_100186692 3300005530 Bacteria 2043
176 Ga0070679_100206005 3300005530 Bacteria 1931
177 Ga0070684_100034917 3300005535 Bacteria 4302
178 Ga0070684_100040713 3300005535 Bacteria 4002
179 Ga0070684_100040868 3300005535 Bacteria 3995
180 Ga0070684_100046980 3300005535 Bacteria 3741
181 Ga0070684_100157478 3300005535 Bacteria 2060
182 Ga0070697_100018950 3300005536 Bacteria 5429
183 Ga0070697_100162013 3300005536 Bacteria 1890
184 Ga0068853_100005841 3300005539 Bacteria 9693
185 Ga0068853_100014456 3300005539 Bacteria 6464
186 Ga0068853_100016544 3300005539 Bacteria 6073
187 Ga0068853_100043255 3300005539 Bacteria 3853
188 Ga0068853_100062551 3300005539 Bacteria 3221
189 Ga0068853_100123466 3300005539 Bacteria 2312
190 Ga0070672_100055148 3300005543 Bacteria 3113
191 Ga0070672_100240481 3300005543 Bacteria 1522
192 Ga0070696_100138420 3300005546 Bacteria 1776
193 Ga0070693_100086592 3300005547 Bacteria 1880
194 Ga0070665_100033305 3300005548 Bacteria 5185
195 Ga0070665_100052425 3300005548 Bacteria 4091
196 Ga0070665_100064957 3300005548 Bacteria 3661
197 Ga0070665_100077795 3300005548 Bacteria 3323
198 Ga0070665_100133383 3300005548 Bacteria 2485
199 Ga0070665_100178559 3300005548 Bacteria 2124
200 Ga0070665_100232028 3300005548 Bacteria 1846
201 Ga0070665_100290544 3300005548 Bacteria 1637
202 Ga0070665_100363408 3300005548 Bacteria 1453
203 Ga0070704_100012912 3300005549 Bacteria 5168
204 Ga0070704_100040512 3300005549 Bacteria 3207
205 Ga0070704_100088145 3300005549 Bacteria 2305
206 Ga0068855_100007720 3300005563 Bacteria 12990
207 Ga0068855_100012186 3300005563 Bacteria 10389
208 Ga0068855_100015651 3300005563 Bacteria 9126
209 Ga0068855_100025903 3300005563 Bacteria 7015
210 Ga0068855_100027404 3300005563 Bacteria 6815
211 Ga0068855_100033743 3300005563 Bacteria 6106
212 Ga0068855_100055016 3300005563 Bacteria 4675
213 Ga0068855_100076921 3300005563 Bacteria 3872
214 Ga0068855_100120242 3300005563 Bacteria 3006
215 Ga0068855_100152792 3300005563 Bacteria 2624
216 Ga0068855_100274524 3300005563 Bacteria 1874
217 Ga0070664_100003967 3300005564 Bacteria 11906
218 Ga0070664_100118752 3300005564 Bacteria 2313
219 Ga0070664_100285662 3300005564 Bacteria 1488
220 Ga0068857_100022565 3300005577 Bacteria 5535
221 Ga0068857_100031478 3300005577 Bacteria 4688
222 Ga0068857_100065118 3300005577 Bacteria 3240
223 Ga0068857_100088899 3300005577 Bacteria 2764
224 Ga0068857_100106543 3300005577 Bacteria 2517
225 Ga0068857_100234053 3300005577 Bacteria 1681
226 Ga0068854_100031940 3300005578 Bacteria 3661
227 Ga0068854_100044708 3300005578 Bacteria 3145
228 Ga0068854_100159820 3300005578 Bacteria 1744
229 Ga0068856_100000197 3300005614 Bacteria 63857
230 Ga0068856_100000535 3300005614 Bacteria 41862
231 Ga0068856_100001185 3300005614 Bacteria 27475
232 Ga0068856_100006599 3300005614 Bacteria 11374
233 Ga0068856_100020287 3300005614 Bacteria 6455
234 Ga0068856_100281841 3300005614 Bacteria 1678
235 Ga0068856_100430281 3300005614 Bacteria 1340
236 Ga0068852_100009344 3300005616 Bacteria 7278
237 Ga0068852_100015291 3300005616 Bacteria 5943
238 Ga0068852_100025264 3300005616 Bacteria 4810
239 Ga0068852_100043131 3300005616 Bacteria 3824
240 Ga0068852_100049908 3300005616 Bacteria 3582
241 Ga0068852_100109115 3300005616 Bacteria 2513
242 Ga0068852_100217465 3300005616 Bacteria 1816
243 Ga0068852_100220431 3300005616 Bacteria 1804
244 Ga0068852_100234016 3300005616 Bacteria 1752
245 Ga0068859_100052906 3300005617 Bacteria 4083
246 Ga0068859_100160203 3300005617 Bacteria 2329
247 Ga0068859_100244868 3300005617 Bacteria 1882
248 Ga0068859_100272312 3300005617 Bacteria 1785
249 Ga0068864_100035170 3300005618 Bacteria 4264
250 Ga0068864_100200244 3300005618 Bacteria 1834
251 Ga0068864_100217014 3300005618 Bacteria 1763
252 Ga0068864_100236581 3300005618 Bacteria 1691
253 Ga0068866_10006508 3300005718 Bacteria 4868
254 Ga0068866_10028243 3300005718 Bacteria 2671
255 Ga0068861_100015012 3300005719 Bacteria 5449
256 Ga0068861_100129684 3300005719 Bacteria 2045
257 Ga0068851_10003594 3300005834 Bacteria 6913
258 Ga0068851_10003991 3300005834 Bacteria 6619
259 Ga0068851_10011381 3300005834 Bacteria 4170
260 Ga0068863_100306665 3300005841 Bacteria 1540
261 Ga0068858_100044329 3300005842 Bacteria 4123
262 Ga0068858_100077486 3300005842 Bacteria 3088
263 Ga0068858_100122486 3300005842 Bacteria 2433
264 Ga0068858_100333229 3300005842 Bacteria 1452
265 Ga0068860_100002461 3300005843 Bacteria 19440
266 Ga0068860_100010373 3300005843 Bacteria 9215
267 Ga0068860_100079139 3300005843 Bacteria 3125
268 Ga0068862_100051983 3300005844 Bacteria 3505
269 Ga0068862_100121209 3300005844 Bacteria 2305
270 Ga0068862_100185231 3300005844 Bacteria 1870
271 Ga0068862_100222708 3300005844 Bacteria 1708
272 Ga0068862_100293704 3300005844 Bacteria 1493
273 Ga0081455_10001796 3300005937 Bacteria 25915
274 Ga0081455_10006892 3300005937 Bacteria 12092
275 Ga0081455_10006941 3300005937 Bacteria 12041
276 Ga0081455_10007694 3300005937 Bacteria 11311
277 Ga0081455_10010171 3300005937 Bacteria 9579
278 Ga0081455_10023773 3300005937 Bacteria 5694
279 Ga0081455_10034950 3300005937 Bacteria 4498
280 Ga0081455_10056843 3300005937 Bacteria 3320
281 Ga0081455_10063680 3300005937 Bacteria 3093
282 Ga0081455_10095415 3300005937 Bacteria 2400
283 Ga0081455_10166935 3300005937 Bacteria 1681
284 Ga0081455_10218283 3300005937 Bacteria 1415
285 Ga0081538_10021648 3300005981 Bacteria 4682
286 Ga0081538_10051228 3300005981 Bacteria 2482
287 Ga0081540_1000430 3300005983 Bacteria 41337
288 Ga0081540_1000979 3300005983 Bacteria 25757
289 Ga0081540_1002120 3300005983 Bacteria 16520
290 Ga0081540_1004076 3300005983 Bacteria 11311
291 Ga0081540_1004971 3300005983 Bacteria 9998
292 Ga0081540_1009134 3300005983 Bacteria 6842
293 Ga0081540_1009393 3300005983 Bacteria 6742
294 Ga0081540_1011445 3300005983 Bacteria 5927
295 Ga0081540_1012053 3300005983 Bacteria 5720
296 Ga0081540_1012218 3300005983 Bacteria 5677
297 Ga0081540_1012797 3300005983 Bacteria 5490
298 Ga0081540_1016805 3300005983 Bacteria 4561
299 Ga0081540_1018169 3300005983 Bacteria 4325
300 Ga0081540_1018760 3300005983 Bacteria 4229
301 Ga0081540_1022988 3300005983 Bacteria 3664
302 Ga0081540_1030591 3300005983 Bacteria 2978
303 Ga0081540_1034249 3300005983 Bacteria 2743
304 Ga0081540_1034270 3300005983 Bacteria 2742
305 Ga0081540_1035864 3300005983 Bacteria 2654
306 Ga0081540_1059102 3300005983 Bacteria 1843
307 Ga0081540_1065898 3300005983 Bacteria 1700
308 Ga0081539_10000003 3300005985 Bacteria 594833
309 Ga0081539_10000140 3300005985 Bacteria 166746
310 Ga0081539_10000273 3300005985 Bacteria 117936
311 Ga0081539_10000423 3300005985 Bacteria 89970
312 Ga0081539_10001457 3300005985 Bacteria 40268
313 Ga0081539_10016652 3300005985 Bacteria 5228
314 Ga0081539_10037373 3300005985 Bacteria 2893
315 Ga0081539_10044785 3300005985 Bacteria 2551
316 Ga0070717_10002238 3300006028 Bacteria 13559
317 Ga0070717_10004040 3300006028 Bacteria 10570
318 Ga0070717_10006817 3300006028 Bacteria 8433
319 Ga0070717_10107879 3300006028 Bacteria 2372
320 Ga0070717_10149515 3300006028 Bacteria 2019
321 Ga0075365_10021616 3300006038 Bacteria 4016
322 Ga0075365_10027419 3300006038 Bacteria 3625
323 Ga0075365_10030380 3300006038 Bacteria 3460
324 Ga0075365_10033601 3300006038 Bacteria 3307
325 Ga0075365_10064340 3300006038 Bacteria 2457
326 Ga0075365_10066431 3300006038 Bacteria 2419
327 Ga0075365_10075469 3300006038 Bacteria 2275
328 Ga0075365_10076083 3300006038 Bacteria 2267
329 Ga0075365_10101918 3300006038 Bacteria 1966
330 Ga0075365_10131483 3300006038 Bacteria 1732
331 Ga0075365_10142797 3300006038 Bacteria 1662
332 Ga0075365_10180367 3300006038 Bacteria 1476
333 Ga0075365_10212801 3300006038 Bacteria 1355
334 Ga0075368_10000258 3300006042 Bacteria 15196
335 Ga0075368_10015526 3300006042 Bacteria 2827
336 Ga0075368_10017178 3300006042 Bacteria 2705
337 Ga0075368_10038842 3300006042 Bacteria 1864
338 Ga0075368_10041672 3300006042 Bacteria 1804
339 Ga0075368_10056194 3300006042 Bacteria 1570
340 Ga0075363_100002988 3300006048 Bacteria 7065
341 Ga0075363_100056792 3300006048 Bacteria 2099
342 Ga0075363_100082840 3300006048 Bacteria 1757
343 Ga0075364_10010235 3300006051 Bacteria 5657
344 Ga0075364_10031243 3300006051 Bacteria 3421
345 Ga0075364_10068592 3300006051 Bacteria 2332
346 Ga0070715_10000273 3300006163 Bacteria 12463
347 Ga0070715_10000384 3300006163 Bacteria 11062
348 Ga0070716_100022330 3300006173 Bacteria 3343
349 Ga0070716_100030811 3300006173 Bacteria 2914
350 Ga0070712_100000721 3300006175 Bacteria 19494
351 Ga0070712_100006564 3300006175 Bacteria 7221
352 Ga0070712_100013148 3300006175 Bacteria 5281
353 Ga0070712_100016629 3300006175 Bacteria 4752
354 Ga0070712_100022457 3300006175 Bacteria 4157
355 Ga0070712_100036232 3300006175 Bacteria 3355
356 Ga0070712_100070119 3300006175 Bacteria 2503
357 Ga0075367_10001631 3300006178 Bacteria 9753
358 Ga0075367_10004888 3300006178 Bacteria 6600
359 Ga0075367_10004919 3300006178 Bacteria 6582
360 Ga0075367_10013998 3300006178 Bacteria 4332
361 Ga0075367_10041096 3300006178 Bacteria 2702
362 Ga0075367_10122777 3300006178 Bacteria 1601
363 Ga0075369_10022486 3300006186 Bacteria 2600
364 Ga0075369_10037855 3300006186 Bacteria 2056
365 Ga0075369_10042989 3300006186 Bacteria 1938
366 Ga0075369_10050537 3300006186 Bacteria 1798
367 Ga0075369_10057775 3300006186 Bacteria 1688
368 Ga0075366_10029384 3300006195 Bacteria 3229
369 Ga0075366_10046116 3300006195 Bacteria 2582
370 Ga0075366_10080724 3300006195 Bacteria 1942
371 Ga0075366_10087436 3300006195 Bacteria 1865
372 Ga0097621_100110600 3300006237 Bacteria 2321
373 Ga0097621_100269548 3300006237 Bacteria 1495
374 Ga0075370_10018963 3300006353 Bacteria 3737
375 Ga0075370_10019487 3300006353 Bacteria 3696
376 Ga0075370_10075597 3300006353 Bacteria 1931
377 Ga0075370_10098650 3300006353 Bacteria 1689
378 Ga0075428_100000643 3300006844 Bacteria 35894
379 Ga0075428_100006057 3300006844 Bacteria 13440
380 Ga0075428_100056741 3300006844 Bacteria 4288
381 Ga0075428_100323286 3300006844 Bacteria 1657
382 Ga0075430_100000052 3300006846 Bacteria 60703
383 Ga0075430_100010397 3300006846 Bacteria 7881
384 Ga0075430_100025544 3300006846 Bacteria 5026
385 Ga0075430_100177411 3300006846 Bacteria 1772
386 Ga0075431_100000441 3300006847 Bacteria 33990
387 Ga0075431_100000802 3300006847 Bacteria 27440
388 Ga0075431_100003541 3300006847 Bacteria 15120
389 Ga0075431_100063661 3300006847 Bacteria 3806
390 Ga0075431_100114539 3300006847 Bacteria 2783
391 Ga0075431_100199693 3300006847 Bacteria 2046
392 Ga0075431_100364748 3300006847 Bacteria 1450
393 Ga0075433_10000633 3300006852 Bacteria 23526
394 Ga0075433_10014960 3300006852 Bacteria 6352
395 Ga0075433_10084163 3300006852 Bacteria 2807
396 Ga0075433_10085821 3300006852 Bacteria 2779
397 Ga0075433_10193242 3300006852 Bacteria 1810
398 Ga0075433_10241491 3300006852 Bacteria 1603
399 Ga0075434_100029033 3300006871 Bacteria 5439
400 Ga0075434_100097215 3300006871 Bacteria 2949
401 Ga0075434_100109276 3300006871 Bacteria 2776
402 Ga0075434_100280969 3300006871 Bacteria 1684
403 Ga0075429_100001562 3300006880 Bacteria 18820
404 Ga0075429_100021707 3300006880 Bacteria 5565
405 Ga0075429_100059216 3300006880 Bacteria 3336
406 Ga0075429_100232329 3300006880 Bacteria 1615
407 Ga0068865_100025011 3300006881 Bacteria 3923
408 Ga0068865_100080168 3300006881 Bacteria 2340
409 Ga0075436_100023912 3300006914 Bacteria 4199
410 Ga0097620_100052905 3300006931 Bacteria 4083
411 Ga0097620_100160199 3300006931 Bacteria 2329
412 Ga0097620_100244881 3300006931 Bacteria 1882
413 Ga0097620_100272308 3300006931 Bacteria 1785
414 Ga0099824_1004403 3300006942 Bacteria 20285
415 Ga0099824_1006748 3300006942 Bacteria 15616
416 Ga0099824_1027442 3300006942 Bacteria 2749
417 Ga0099822_1004857 3300006943 Bacteria 17534
418 Ga0099822_1018335 3300006943 Bacteria 7305
419 Ga0099823_1031333 3300006944 Bacteria 4393
420 Ga0099823_1052075 3300006944 Bacteria 2455
421 Ga0075435_100012560 3300007076 Bacteria 6274
422 Ga0075435_100036737 3300007076 Bacteria 3895
423 Ga0075435_100056799 3300007076 Bacteria 3165
424 Ga0099794_10014454 3300007265 Bacteria 3459
425 Ga0099794_10016781 3300007265 Bacteria 3252
426 Ga0099794_10018817 3300007265 Bacteria 3102
427 Ga0099795_10005356 3300007788 Bacteria 3404
428 Ga0105240_10002078 3300009093 Bacteria 32819
429 Ga0105240_10027569 3300009093 Bacteria 7435
430 Ga0105240_10029263 3300009093 Bacteria 7181
431 Ga0105240_10032127 3300009093 Bacteria 6798
432 Ga0105240_10038351 3300009093 Bacteria 6146
433 Ga0105240_10041521 3300009093 Bacteria 5870
434 Ga0105240_10073858 3300009093 Bacteria 4211
435 Ga0105240_10114272 3300009093 Bacteria 3261
436 Ga0105240_10118520 3300009093 Bacteria 3190
437 Ga0105240_10180331 3300009093 Bacteria 2493
438 Ga0105240_10249402 3300009093 Bacteria 2054
439 Ga0111539_10006916 3300009094 Bacteria 14566
440 Ga0111539_10013178 3300009094 Bacteria 10337
441 Ga0111539_10032630 3300009094 Bacteria 6322
442 Ga0111539_10074229 3300009094 Bacteria 4008
443 Ga0105245_10037871 3300009098 Bacteria 4288
444 Ga0105245_10143359 3300009098 Bacteria 2252
445 Ga0105245_10174669 3300009098 Bacteria 2048
446 Ga0105245_10271600 3300009098 Bacteria 1654
447 Ga0105247_10025745 3300009101 Bacteria 3551
448 Ga0105247_10033351 3300009101 Bacteria 3131
449 Ga0105247_10050897 3300009101 Bacteria 2549
450 Ga0105247_10110734 3300009101 Bacteria 1767
451 Ga0114129_10002725 3300009147 Bacteria 24625
452 Ga0114129_10038145 3300009147 Bacteria 6780
453 Ga0114129_10040031 3300009147 Bacteria 6610
454 Ga0114129_10040610 3300009147 Bacteria 6558
455 Ga0114129_10103836 3300009147 Bacteria 3929
456 Ga0114129_10180769 3300009147 Bacteria 2870
457 Ga0114129_10308898 3300009147 Bacteria 2105
458 Ga0105243_10098942 3300009148 Bacteria 2417
459 Ga0105243_10362515 3300009148 Bacteria 1334
460 Ga0105241_10011171 3300009174 Bacteria 6585
461 Ga0105241_10042448 3300009174 Bacteria 3441
462 Ga0105241_10076695 3300009174 Bacteria 2607
463 Ga0105248_10043613 3300009177 Bacteria 5030
464 Ga0105248_10132194 3300009177 Bacteria 2816
465 Ga0105248_10212164 3300009177 Bacteria 2181
466 Ga0105237_10007647 3300009545 Bacteria 11810
467 Ga0105237_10023507 3300009545 Bacteria 6314
468 Ga0105237_10027425 3300009545 Bacteria 5815
469 Ga0105237_10047336 3300009545 Bacteria 4323
470 Ga0105237_10053351 3300009545 Bacteria 4055
471 Ga0105237_10070520 3300009545 Bacteria 3491
472 Ga0105237_10086279 3300009545 Bacteria 3129
473 Ga0105237_10128445 3300009545 Bacteria 2529
474 Ga0105237_10227803 3300009545 Bacteria 1864
475 Ga0105238_10020769 3300009551 Bacteria 6688
476 Ga0105238_10029110 3300009551 Bacteria 5627
477 Ga0105238_10040037 3300009551 Bacteria 4750
478 Ga0105238_10055590 3300009551 Bacteria 3972
479 Ga0105238_10056096 3300009551 Bacteria 3953
480 Ga0105238_10164509 3300009551 Bacteria 2194
481 Ga0105238_10195133 3300009551 Bacteria 2000
482 Ga0105238_10233232 3300009551 Bacteria 1817
483 Ga0105249_10026667 3300009553 Bacteria 5209
484 Ga0099796_10060610 3300010159 Bacteria 1340
485 Ga0105239_10005426 3300010375 Bacteria 14965
486 Ga0105239_10009271 3300010375 Bacteria 11127
487 Ga0105239_10044848 3300010375 Bacteria 4846
488 Ga0105239_10049782 3300010375 Bacteria 4595
489 Ga0105239_10060186 3300010375 Bacteria 4168
490 Ga0105239_10063610 3300010375 Bacteria 4051
491 Ga0105239_10071911 3300010375 Bacteria 3801
492 Ga0105239_10117803 3300010375 Bacteria 2947
493 Ga0105239_10165128 3300010375 Bacteria 2475
494 Ga0105239_10188796 3300010375 Bacteria 2307
495 Ga0105239_10208529 3300010375 Bacteria 2190
496 Ga0105239_10289133 3300010375 Bacteria 1846
497 Ga0105239_10319652 3300010375 Bacteria 1750
498 Ga0105246_10003677 3300011119 Bacteria 9284
499 Ga0105246_10194990 3300011119 Bacteria 1570
500 Ga0157373_10014696 3300013100 Bacteria 5735
501 Ga0157371_10001965 3300013102 Bacteria 20388
502 Ga0157371_10032595 3300013102 Bacteria 3749
503 Ga0157370_10012436 3300013104 Bacteria 8824
504 Ga0157369_10003343 3300013105 Bacteria 19049
505 Ga0157369_10006140 3300013105 Bacteria 13943
506 Ga0157369_10028862 3300013105 Bacteria 6136
507 Ga0157369_10042205 3300013105 Bacteria 4977
508 Ga0157369_10047137 3300013105 Bacteria 4682
509 Ga0157369_10134876 3300013105 Bacteria 2614
510 Ga0157369_10135833 3300013105 Bacteria 2604
511 Ga0157374_10020915 3300013296 Bacteria 5813
512 Ga0157378_10010352 3300013297 Bacteria 8141
513 Ga0157378_10027154 3300013297 Bacteria 5051
514 Ga0157378_10044937 3300013297 Bacteria 3923
515 Ga0157378_10203353 3300013297 Bacteria 1874
516 Ga0163162_10229895 3300013306 Bacteria 1985
517 Ga0163162_10298978 3300013306 Bacteria 1741
518 Ga0163162_10344586 3300013306 Bacteria 1623
519 Ga0157372_10001631 3300013307 Bacteria 24355
520 Ga0157372_10133750 3300013307 Bacteria 2855
521 Ga0157372_10157824 3300013307 Bacteria 2621
522 Ga0157372_10305280 3300013307 Bacteria 1852
523 Ga0157372_10337132 3300013307 Bacteria 1756
524 Ga0157375_10055282 3300013308 Bacteria 3914
525 Ga0157375_10204944 3300013308 Bacteria 2129
526 Ga0157375_10543501 3300013308 Bacteria 1324
527 Ga0163163_10005862 3300014325 Bacteria 10689
528 Ga0163163_10023786 3300014325 Bacteria 5820
529 Ga0163163_10067632 3300014325 Bacteria 3552
530 Ga0163163_10112333 3300014325 Bacteria 2754
531 Ga0163163_10194274 3300014325 Bacteria 2077
532 Ga0163163_10232078 3300014325 Bacteria 1894
533 Ga0163163_10236479 3300014325 Bacteria 1876
534 Ga0163163_10467499 3300014325 Bacteria 1322
535 Ga0182008_10109937 3300014497 Bacteria 1366
536 Ga0157379_10014180 3300014968 Bacteria 6989
537 Ga0157376_10008383 3300014969 Bacteria 7455
538 Ga0157376_10266738 3300014969 Bacteria 1606
539 Ga0163161_10004994 3300017792 Bacteria 9229
540 Ga0163161_10089270 3300017792 Bacteria 2280
541 Ga0214544_1000002 3300021320 Bacteria 753857
542 Ga0214542_1000001 3300021321 Bacteria 1018696
543 Ga0214545_1000001 3300021324 Bacteria 1092817
544 Ga0214543_1000001 3300021327 Bacteria 776921
545 Ga0213873_10004466 3300021358 Bacteria 2613
546 Ga0213876_10001690 3300021384 Bacteria 13424
547 Ga0213876_10091430 3300021384 Bacteria 1612
548 Ga0213871_10001515 3300021441 Bacteria 3933
549 Ga0209563_100864 3300025230 Bacteria 9008
550 Ga0207425_1006454 3300025245 Bacteria 3205
551 Ga0209677_100537 3300025253 Bacteria 21070
552 Ga0209677_103297 3300025253 Bacteria 5335
553 Ga0209677_104828 3300025253 Bacteria 3725
554 Ga0209148_1000613 3300025254 Bacteria 31818
555 Ga0209148_1000841 3300025254 Bacteria 21793
556 Ga0209148_1005138 3300025254 Bacteria 3058
557 Ga0209233_1001871 3300025261 Bacteria 8085
558 Ga0209233_1004495 3300025261 Bacteria 4732
559 Ga0209233_1008594 3300025261 Bacteria 3147
560 Ga0209455_1001277 3300025272 Bacteria 11778
561 Ga0209455_1003926 3300025272 Bacteria 5064
562 Ga0209455_1004047 3300025272 Bacteria 4951
563 Ga0209564_1003012 3300025295 Bacteria 12050
564 Ga0209564_1003264 3300025295 Bacteria 11319
565 Ga0209564_1008506 3300025295 Bacteria 5050
566 Ga0209564_1012867 3300025295 Bacteria 3606
567 Ga0209564_1014212 3300025295 Bacteria 3327
568 Ga0209758_1000140 3300025297 Bacteria 174267
569 Ga0209758_1000164 3300025297 Bacteria 151759
570 Ga0209758_1001346 3300025297 Bacteria 29651
571 Ga0209758_1001601 3300025297 Bacteria 25859
572 Ga0209758_1002251 3300025297 Bacteria 20027
573 Ga0209758_1002397 3300025297 Bacteria 19252
574 Ga0209758_1002853 3300025297 Bacteria 16777
575 Ga0209758_1003241 3300025297 Bacteria 15100
576 Ga0209758_1003800 3300025297 Bacteria 13297
577 Ga0209758_1006517 3300025297 Bacteria 8334
578 Ga0209758_1007245 3300025297 Bacteria 7628
579 Ga0209758_1007676 3300025297 Bacteria 7258
580 Ga0209758_1017749 3300025297 Bacteria 3523
581 Ga0209758_1038310 3300025297 Bacteria 1840
582 Ga0209256_1006146 3300025299 Bacteria 6496
583 Ga0209256_1009403 3300025299 Bacteria 4294
584 Ga0209256_1018544 3300025299 Bacteria 2254
585 Ga0207426_1000626 3300025302 Bacteria 44875
586 Ga0207426_1000822 3300025302 Bacteria 33249
587 Ga0207426_1001216 3300025302 Bacteria 22731
588 Ga0207426_1001803 3300025302 Bacteria 15932
589 Ga0207426_1002280 3300025302 Bacteria 12650
590 Ga0207426_1002722 3300025302 Bacteria 10753
591 Ga0207426_1009840 3300025302 Bacteria 3749
592 Ga0207426_1011102 3300025302 Bacteria 3454
593 Ga0207426_1013581 3300025302 Bacteria 3012
594 Ga0207426_1027750 3300025302 Bacteria 1882
595 Ga0209257_1002059 3300025304 Bacteria 21302
596 Ga0209257_1002227 3300025304 Bacteria 19938
597 Ga0209257_1026420 3300025304 Bacteria 1957
598 Ga0209257_1033673 3300025304 Bacteria 1608
599 Ga0207697_10004888 3300025315 Bacteria 6320
600 Ga0207697_10016374 3300025315 Bacteria 3054
601 Ga0207697_10073450 3300025315 Bacteria 1436
602 Ga0207656_10007922 3300025321 Bacteria 3893
603 Ga0207656_10027596 3300025321 Bacteria 2323
604 Ga0207682_10000233 3300025893 Bacteria 24983
605 Ga0207692_10000214 3300025898 Bacteria 19493
606 Ga0207692_10009204 3300025898 Bacteria 4116
607 Ga0207692_10060872 3300025898 Bacteria 1954
608 Ga0207642_10013332 3300025899 Bacteria 2997
609 Ga0207710_10048973 3300025900 Bacteria 1892
610 Ga0207710_10117111 3300025900 Bacteria 1269
611 Ga0207688_10050156 3300025901 Bacteria 2335
612 Ga0207688_10085575 3300025901 Bacteria 1805
613 Ga0207688_10096000 3300025901 Bacteria 1707
614 Ga0207688_10149583 3300025901 Bacteria 1378
615 Ga0207680_10022163 3300025903 Bacteria 3450
616 Ga0207680_10140666 3300025903 Bacteria 1600
617 Ga0207647_10000712 3300025904 Bacteria 26107
618 Ga0207647_10025278 3300025904 Bacteria 3905
619 Ga0207647_10033656 3300025904 Bacteria 3280
620 Ga0207647_10063221 3300025904 Bacteria 2251
621 Ga0207685_10005804 3300025905 Bacteria 3299
622 Ga0207699_10000379 3300025906 Bacteria 23393
623 Ga0207699_10001095 3300025906 Bacteria 12787
624 Ga0207699_10027860 3300025906 Bacteria 3133
625 Ga0207699_10045190 3300025906 Bacteria 2569
626 Ga0207645_10019420 3300025907 Bacteria 4455
627 Ga0207645_10032640 3300025907 Bacteria 3347
628 Ga0207643_10028396 3300025908 Bacteria 3107
629 Ga0207705_10035725 3300025909 Bacteria 3555
630 Ga0207684_10002538 3300025910 Bacteria 18333
631 Ga0207684_10002971 3300025910 Bacteria 16802
632 Ga0207684_10027469 3300025910 Bacteria 4849
633 Ga0207684_10045020 3300025910 Bacteria 3743
634 Ga0207684_10212938 3300025910 Bacteria 1667
635 Ga0207654_10002421 3300025911 Bacteria 9531
636 Ga0207654_10006353 3300025911 Bacteria 5942
637 Ga0207654_10012132 3300025911 Bacteria 4410
638 Ga0207654_10012820 3300025911 Bacteria 4302
639 Ga0207654_10023984 3300025911 Bacteria 3274
640 Ga0207707_10000359 3300025912 Bacteria 47942
641 Ga0207707_10002327 3300025912 Bacteria 17115
642 Ga0207707_10004014 3300025912 Bacteria 13065
643 Ga0207707_10007742 3300025912 Bacteria 9352
644 Ga0207707_10008741 3300025912 Bacteria 8790
645 Ga0207707_10013921 3300025912 Bacteria 7014
646 Ga0207707_10035480 3300025912 Bacteria 4361
647 Ga0207707_10043631 3300025912 Bacteria 3910
648 Ga0207707_10093928 3300025912 Bacteria 2620
649 Ga0207707_10119750 3300025912 Bacteria 2301
650 Ga0207707_10215459 3300025912 Bacteria 1672
651 Ga0207707_10227195 3300025912 Bacteria 1624
652 Ga0207695_10000910 3300025913 Bacteria 53286
653 Ga0207695_10001998 3300025913 Bacteria 31500
654 Ga0207695_10035157 3300025913 Bacteria 5438
655 Ga0207695_10068321 3300025913 Bacteria 3641
656 Ga0207695_10069051 3300025913 Bacteria 3618
657 Ga0207695_10073106 3300025913 Bacteria 3495
658 Ga0207695_10293540 3300025913 Bacteria 1518
659 Ga0207695_10308493 3300025913 Bacteria 1473
660 Ga0207695_10356756 3300025913 Bacteria 1349
661 Ga0207671_10002587 3300025914 Bacteria 19123
662 Ga0207671_10006943 3300025914 Bacteria 9965
663 Ga0207671_10014047 3300025914 Bacteria 6349
664 Ga0207671_10020564 3300025914 Bacteria 5022
665 Ga0207671_10025479 3300025914 Bacteria 4443
666 Ga0207671_10052004 3300025914 Bacteria 3035
667 Ga0207671_10107404 3300025914 Bacteria 2120
668 Ga0207671_10216729 3300025914 Bacteria 1499
669 Ga0207693_10001226 3300025915 Bacteria 22876
670 Ga0207693_10003562 3300025915 Bacteria 13302
671 Ga0207693_10009473 3300025915 Bacteria 7932
672 Ga0207693_10010251 3300025915 Bacteria 7607
673 Ga0207693_10017377 3300025915 Bacteria 5738
674 Ga0207693_10024965 3300025915 Bacteria 4740
675 Ga0207693_10026683 3300025915 Bacteria 4570
676 Ga0207693_10057257 3300025915 Bacteria 3055
677 Ga0207693_10073149 3300025915 Bacteria 2683
678 Ga0207663_10000628 3300025916 Bacteria 15643
679 Ga0207663_10002632 3300025916 Bacteria 8644
680 Ga0207663_10009673 3300025916 Bacteria 5103
681 Ga0207663_10027788 3300025916 Bacteria 3302
682 Ga0207663_10097600 3300025916 Bacteria 1965
683 Ga0207663_10220692 3300025916 Bacteria 1379
684 Ga0207660_10008313 3300025917 Bacteria 6708
685 Ga0207660_10045952 3300025917 Bacteria 3079
686 Ga0207660_10054672 3300025917 Bacteria 2850
687 Ga0207662_10101648 3300025918 Bacteria 1782
688 Ga0207657_10000371 3300025919 Bacteria 47425
689 Ga0207657_10002789 3300025919 Bacteria 18797
690 Ga0207657_10008747 3300025919 Bacteria 10247
691 Ga0207657_10016670 3300025919 Bacteria 7079
692 Ga0207657_10019432 3300025919 Bacteria 6451
693 Ga0207649_10044696 3300025920 Bacteria 2713
694 Ga0207652_10010009 3300025921 Bacteria 7636
695 Ga0207652_10018726 3300025921 Bacteria 5682
696 Ga0207652_10030769 3300025921 Bacteria 4498
697 Ga0207652_10032026 3300025921 Bacteria 4417
698 Ga0207652_10034932 3300025921 Bacteria 4240
699 Ga0207652_10037570 3300025921 Bacteria 4099
700 Ga0207652_10058518 3300025921 Bacteria 3321
701 Ga0207652_10092077 3300025921 Bacteria 2666
702 Ga0207646_10001054 3300025922 Bacteria 35091
703 Ga0207646_10005295 3300025922 Bacteria 13598
704 Ga0207646_10007223 3300025922 Bacteria 11333
705 Ga0207646_10059976 3300025922 Bacteria 3397
706 Ga0207646_10144919 3300025922 Bacteria 2140
707 Ga0207694_10000157 3300025924 Bacteria 70076
708 Ga0207694_10053295 3300025924 Bacteria 3136
709 Ga0207694_10055889 3300025924 Bacteria 3065
710 Ga0207694_10109193 3300025924 Bacteria 2199
711 Ga0207694_10280143 3300025924 Bacteria 1369
712 Ga0207650_10005860 3300025925 Bacteria 8389
713 Ga0207650_10036096 3300025925 Bacteria 3594
714 Ga0207650_10090519 3300025925 Bacteria 2337
715 Ga0207659_10003917 3300025926 Bacteria 8979
716 Ga0207659_10017546 3300025926 Bacteria 4678
717 Ga0207659_10173002 3300025926 Bacteria 1705
718 Ga0207687_10072339 3300025927 Bacteria 2466
719 Ga0207687_10118367 3300025927 Bacteria 1977
720 Ga0207687_10138239 3300025927 Bacteria 1845
721 Ga0207700_10006989 3300025928 Bacteria 6868
722 Ga0207700_10010013 3300025928 Bacteria 5957
723 Ga0207700_10017812 3300025928 Bacteria 4754
724 Ga0207700_10023291 3300025928 Bacteria 4266
725 Ga0207700_10043564 3300025928 Bacteria 3297
726 Ga0207700_10139046 3300025928 Bacteria 1993
727 Ga0207700_10163270 3300025928 Bacteria 1852
728 Ga0207700_10241838 3300025928 Bacteria 1539
729 Ga0207664_10008537 3300025929 Bacteria 7154
730 Ga0207664_10027649 3300025929 Bacteria 4303
731 Ga0207664_10040218 3300025929 Bacteria 3634
732 Ga0207664_10042081 3300025929 Bacteria 3564
733 Ga0207664_10100541 3300025929 Bacteria 2388
734 Ga0207664_10186531 3300025929 Bacteria 1783
735 Ga0207664_10195437 3300025929 Bacteria 1743
736 Ga0207664_10227587 3300025929 Bacteria 1620
737 Ga0207644_10014609 3300025931 Bacteria 5257
738 Ga0207644_10065259 3300025931 Bacteria 2647
739 Ga0207644_10077073 3300025931 Bacteria 2454
740 Ga0207644_10153702 3300025931 Bacteria 1783
741 Ga0207690_10001921 3300025932 Bacteria 12738
742 Ga0207690_10050336 3300025932 Bacteria 2781
743 Ga0207706_10000179 3300025933 Bacteria 70768
744 Ga0207706_10008198 3300025933 Bacteria 9637
745 Ga0207706_10011412 3300025933 Bacteria 8094
746 Ga0207706_10032041 3300025933 Bacteria 4682
747 Ga0207706_10146897 3300025933 Bacteria 2074
748 Ga0207706_10277773 3300025933 Bacteria 1461
749 Ga0207709_10117562 3300025935 Bacteria 1789
750 Ga0207709_10191009 3300025935 Bacteria 1455
751 Ga0207670_10061736 3300025936 Bacteria 2558
752 Ga0207669_10026912 3300025937 Bacteria 3137
753 Ga0207669_10065085 3300025937 Bacteria 2259
754 Ga0207704_10053582 3300025938 Bacteria 2453
755 Ga0207665_10001305 3300025939 Bacteria 16794
756 Ga0207665_10055356 3300025939 Bacteria 2676
757 Ga0207665_10109693 3300025939 Bacteria 1937
758 Ga0207691_10005440 3300025940 Bacteria 12297
759 Ga0207691_10071690 3300025940 Bacteria 3126
760 Ga0207691_10110729 3300025940 Bacteria 2442
761 Ga0207711_10035548 3300025941 Bacteria 4224
762 Ga0207711_10132179 3300025941 Bacteria 2239
763 Ga0207689_10011579 3300025942 Bacteria 7557
764 Ga0207689_10135761 3300025942 Bacteria 2025
765 Ga0207661_10006014 3300025944 Bacteria 8571
766 Ga0207661_10006099 3300025944 Bacteria 8514
767 Ga0207661_10009972 3300025944 Bacteria 6825
768 Ga0207661_10018653 3300025944 Bacteria 5156
769 Ga0207661_10100386 3300025944 Bacteria 2429
770 Ga0207661_10148136 3300025944 Bacteria 2027
771 Ga0207679_10211546 3300025945 Bacteria 1626
772 Ga0207667_10011520 3300025949 Bacteria 10275
773 Ga0207667_10016633 3300025949 Bacteria 8304
774 Ga0207667_10026324 3300025949 Bacteria 6358
775 Ga0207667_10047244 3300025949 Bacteria 4557
776 Ga0207667_10060098 3300025949 Bacteria 3979
777 Ga0207667_10085227 3300025949 Bacteria 3271
778 Ga0207667_10106279 3300025949 Bacteria 2895
779 Ga0207667_10111037 3300025949 Bacteria 2828
780 Ga0207667_10147724 3300025949 Bacteria 2419
781 Ga0207651_10151632 3300025960 Bacteria 1805
782 Ga0207668_10009212 3300025972 Bacteria 5906
783 Ga0207668_10016413 3300025972 Bacteria 4621
784 Ga0207668_10030484 3300025972 Bacteria 3544
785 Ga0207640_10042167 3300025981 Bacteria 2908
786 Ga0207677_10044918 3300026023 Bacteria 2947
787 Ga0207677_10062741 3300026023 Bacteria 2579
788 Ga0207703_10067369 3300026035 Bacteria 2946
789 Ga0207703_10168578 3300026035 Bacteria 1924
790 Ga0207703_10282785 3300026035 Bacteria 1507
791 Ga0207639_10030650 3300026041 Bacteria 3946
792 Ga0207639_10034004 3300026041 Bacteria 3765
793 Ga0207639_10044374 3300026041 Bacteria 3343
794 Ga0207639_10073521 3300026041 Bacteria 2680
795 Ga0207639_10098703 3300026041 Bacteria 2355
796 Ga0207639_10106443 3300026041 Bacteria 2276
797 Ga0207639_10220099 3300026041 Bacteria 1639
798 Ga0207639_10249787 3300026041 Bacteria 1546
799 Ga0207678_10006632 3300026067 Bacteria 10261
800 Ga0207678_10007352 3300026067 Bacteria 9752
801 Ga0207678_10044979 3300026067 Bacteria 3818
802 Ga0207678_10054731 3300026067 Bacteria 3436
803 Ga0207678_10061977 3300026067 Bacteria 3216
804 Ga0207678_10079940 3300026067 Bacteria 2799
805 Ga0207678_10113616 3300026067 Bacteria 2310
806 Ga0207678_10122698 3300026067 Bacteria 2217
807 Ga0207678_10131781 3300026067 Bacteria 2133
808 Ga0207678_10150261 3300026067 Bacteria 1988
809 Ga0207678_10232846 3300026067 Bacteria 1577
810 Ga0207708_10027461 3300026075 Bacteria 4309
811 Ga0207702_10000002 3300026078 Bacteria 491507
812 Ga0207702_10000044 3300026078 Bacteria 149419
813 Ga0207702_10000081 3300026078 Bacteria 108009
814 Ga0207702_10000997 3300026078 Bacteria 29032
815 Ga0207702_10032981 3300026078 Bacteria 4323
816 Ga0207702_10104157 3300026078 Bacteria 2510
817 Ga0207702_10148419 3300026078 Bacteria 2130
818 Ga0207702_10253604 3300026078 Bacteria 1653
819 Ga0207702_10319707 3300026078 Bacteria 1478
820 Ga0207641_10114037 3300026088 Bacteria 2401
821 Ga0207641_10398181 3300026088 Bacteria 1321
822 Ga0207648_10003625 3300026089 Bacteria 16145
823 Ga0207648_10044202 3300026089 Bacteria 3908
824 Ga0207648_10109161 3300026089 Bacteria 2429
825 Ga0207648_10139548 3300026089 Bacteria 2136
826 Ga0207676_10013792 3300026095 Bacteria 5802
827 Ga0207676_10090780 3300026095 Bacteria 2508
828 Ga0207676_10173041 3300026095 Bacteria 1883
829 Ga0207676_10215008 3300026095 Bacteria 1708
830 Ga0207676_10326140 3300026095 Bacteria 1411
831 Ga0207674_10009531 3300026116 Bacteria 11081
832 Ga0207674_10018412 3300026116 Bacteria 7592
833 Ga0207674_10023874 3300026116 Bacteria 6541
834 Ga0207674_10041515 3300026116 Bacteria 4757
835 Ga0207674_10153455 3300026116 Bacteria 2259
836 Ga0207674_10322592 3300026116 Bacteria 1494
837 Ga0207675_100002865 3300026118 Bacteria 16968
838 Ga0207675_100021301 3300026118 Bacteria 6038
839 Ga0207675_100031537 3300026118 Bacteria 4936
840 Ga0207675_100120126 3300026118 Bacteria 2486
841 Ga0207675_100133127 3300026118 Bacteria 2357
842 Ga0207675_100168586 3300026118 Bacteria 2092
843 Ga0207675_100292939 3300026118 Bacteria 1583
844 Ga0207683_10019414 3300026121 Bacteria 5805
845 Ga0207683_10019699 3300026121 Bacteria 5765
846 Ga0207683_10030000 3300026121 Bacteria 4711
847 Ga0207683_10037080 3300026121 Bacteria 4246
848 Ga0207683_10110859 3300026121 Bacteria 2457
849 Ga0207683_10277308 3300026121 Bacteria 1532
850 Ga0207698_10015437 3300026142 Bacteria 5113
851 Ga0207698_10027206 3300026142 Bacteria 4057
852 Ga0207698_10037047 3300026142 Bacteria 3588
853 Ga0207698_10098849 3300026142 Bacteria 2412
854 Ga0207698_10102070 3300026142 Bacteria 2380
855 Ga0209389_1000061 3300027296 Bacteria 105698
856 Ga0209389_1000201 3300027296 Bacteria 42938
857 Ga0209389_1000233 3300027296 Bacteria 36791
858 Ga0209589_1000001 3300027357 Bacteria 794224
859 Ga0209589_1000465 3300027357 Bacteria 56891
860 Ga0209969_1002972 3300027360 Bacteria 2348
861 Ga0209489_100001 3300027361 Bacteria 794224
862 Ga0209489_100006 3300027361 Bacteria 475698
863 Ga0209489_100035 3300027361 Bacteria 168255
864 Ga0209489_102560 3300027361 Bacteria 36742
865 Ga0209700_100001 3300027363 Bacteria 794224
866 Ga0209700_100005 3300027363 Bacteria 573969
867 Ga0209700_100062 3300027363 Bacteria 145471
868 Ga0209967_1003797 3300027364 Bacteria 1994
869 Ga0209179_1007355 3300027512 Bacteria 1816
870 Ga0209983_1002077 3300027665 Bacteria 4417
871 Ga0209588_1004305 3300027671 Bacteria 4006
872 Ga0209971_1006564 3300027682 Bacteria 2751
873 Ga0209813_10000241 3300027866 Bacteria 16251
874 Ga0209974_10000323 3300027876 Bacteria 15625
875 Ga0207428_10000018 3300027907 Bacteria 293117
876 Ga0207428_10064578 3300027907 Bacteria 2890
877 Ga0268266_10002410 3300028379 Bacteria 20158
878 Ga0268266_10003390 3300028379 Bacteria 15951
879 Ga0268266_10005649 3300028379 Bacteria 11601
880 Ga0268266_10025598 3300028379 Bacteria 5019
881 Ga0268266_10030373 3300028379 Bacteria 4590
882 Ga0268266_10034718 3300028379 Bacteria 4289
883 Ga0268266_10094186 3300028379 Bacteria 2628
884 Ga0268266_10124114 3300028379 Bacteria 2301
885 Ga0268266_10143239 3300028379 Bacteria 2146
886 Ga0268266_10165099 3300028379 Bacteria 2005
887 Ga0268265_10036239 3300028380 Bacteria 3612
888 Ga0268265_10038885 3300028380 Bacteria 3502
889 Ga0268265_10085253 3300028380 Bacteria 2506
890 Ga0268264_10000149 3300028381 Bacteria 163972
891 Ga0268264_10016783 3300028381 Bacteria 5992
892 Ga0268264_10141726 3300028381 Bacteria 2144
893 Ga0265337_1016243 3300028556 Bacteria 2411
894 Ga0265326_10002417 3300028558 Bacteria 6290
895 Ga0265319_1003112 3300028563 Bacteria 8766
896 Ga0265319_1019665 3300028563 Bacteria 2516
897 Ga0265334_10004574 3300028573 Bacteria 6128
898 Ga0265334_10006531 3300028573 Bacteria 5018
899 Ga0265318_10002252 3300028577 Bacteria 10404
900 Ga0265323_10000280 3300028653 Bacteria 29540
901 Ga0265323_10004599 3300028653 Bacteria 5932
902 Ga0265322_10017668 3300028654 Bacteria 2053
903 Ga0265336_10000434 3300028666 Bacteria 25752
904 Ga0265336_10001016 3300028666 Bacteria 13775
905 Ga0307517_10000008 3300028786 Bacteria 243202
906 Ga0307517_10000772 3300028786 Bacteria 55020
907 Ga0307517_10011552 3300028786 Bacteria 12229
908 Ga0307517_10042025 3300028786 Bacteria 4918
909 Ga0307515_10038891 3300028794 Bacteria 7588
910 Ga0307515_10243880 3300028794 Bacteria 1562
911 Ga0265338_10000776 3300028800 Bacteria 54431
912 Ga0265338_10001205 3300028800 Bacteria 42738
913 Ga0265324_10004764 3300029957 Bacteria 6007
914 Ga0265324_10006841 3300029957 Bacteria 4700
915 Ga0307511_10107907 3300030521 Bacteria 1789
916 Ga0265330_10024452 3300031235 Bacteria 2740
917 Ga0265332_10023610 3300031238 Bacteria 2712
918 Ga0265325_10003329 3300031241 Bacteria 10565
919 Ga0265340_10000903 3300031247 Bacteria 16830
920 Ga0265339_10028260 3300031249 Bacteria 3191
921 Ga0307513_10005868 3300031456 Bacteria 16133
922 Ga0307513_10220710 3300031456 Bacteria 1717
923 Ga0307509_10037791 3300031507 Bacteria 5275
924 Ga0307509_10093588 3300031507 Bacteria 3066
925 Ga0307508_10000009 3300031616 Bacteria 256966
926 Ga0307508_10000213 3300031616 Bacteria 70156
927 Ga0307508_10008975 3300031616 Bacteria 9213
928 Ga0307508_10009580 3300031616 Bacteria 8900
929 Ga0307508_10036557 3300031616 Bacteria 4421
930 Ga0307508_10044235 3300031616 Bacteria 3985
931 Ga0307508_10076621 3300031616 Bacteria 2922
932 Ga0307508_10093534 3300031616 Bacteria 2596
933 Ga0265314_10002371 3300031711 Bacteria 19414
934 Ga0265314_10005412 3300031711 Bacteria 11534
935 Ga0265314_10009299 3300031711 Bacteria 8318
936 Ga0265314_10025825 3300031711 Bacteria 4423
937 Ga0265314_10027041 3300031711 Bacteria 4300
938 Ga0265314_10085675 3300031711 Bacteria 2065
939 Ga0265342_10067315 3300031712 Bacteria 2096
940 Ga0307516_10002828 3300031730 Bacteria 22862
941 Ga0307516_10005403 3300031730 Bacteria 15313
942 Ga0307516_10008211 3300031730 Bacteria 11855
943 Ga0307516_10013909 3300031730 Bacteria 8540
944 Ga0307516_10044284 3300031730 Bacteria 4404
945 Ga0307516_10052133 3300031730 Bacteria 4007
946 Ga0307516_10078013 3300031730 Bacteria 3159
947 Ga0307516_10147974 3300031730 Bacteria 2112
948 Ga0307410_10081736 3300031852 Bacteria 2271
949 Ga0307412_10160792 3300031911 Bacteria 1668
950 Ga0307416_100048634 3300032002 Bacteria 3366
951 Ga0307416_100067979 3300032002 Bacteria 2942
952 Ga0307416_100072477 3300032002 Bacteria 2867
953 Ga0307414_10196208 3300032004 Bacteria 1638
954 Ga0307411_10055799 3300032005 Bacteria 2601
955 Ga0307411_10081443 3300032005 Bacteria 2229
956 Ga0307411_10318101 3300032005 Bacteria 1255
957 Ga0307507_10059932 3300033179 Bacteria 3559
958 Ga0307510_10005184 3300033180 Bacteria 15491
959 Ga0307510_10024366 3300033180 Bacteria 6992
960 Ga0307510_10030365 3300033180 Bacteria 6126
961 Ga0307510_10052336 3300033180 Bacteria 4306
962 Ga0307510_10063180 3300033180 Bacteria 3774
963 Ga0307510_10064293 3300033180 Bacteria 3727
964 Ga0307510_10148559 3300033180 Bacteria 1969
965 Ga0307510_10159470 3300033180 Bacteria 1856
966 Ga0315911_1000001 3300033442 Bacteria 1088602
967 Ga0315911_1000006 3300033442 Bacteria 414563
968 Ga0316215_1003151 3300033544 Bacteria 1568
969 Ga0373926_0006210 3300035083 Bacteria 3964
970 Ga0373951_0021202 3300035091 Bacteria 1492
971 Ga0373923_0047531 3300035111 Bacteria 1789
972 Ga0373936_0000012 3300035113 Bacteria 228915
973 Ga0373936_0012550 3300035113 Bacteria 3225
974 Ga0373939_0015998 3300035114 Bacteria 1972
975 Ga0373941_0055204 3300035115 Bacteria 1276
976 Ga0373945_0005196 3300035116 Bacteria 4160
977 Ga0373953_0060402 3300035117 Bacteria 1549
978 Ga0373954_0005241 3300035118 Bacteria 5601
979 Ga0373954_0011301 3300035118 Bacteria 3954
980 Ga0373954_0023809 3300035118 Bacteria 2788
981 Ga0373956_0023481 3300035119 Bacteria 2647
982 Ga0373956_0026692 3300035119 Bacteria 2503
983 Ga0373957_0010573 3300035120 Bacteria 3055
984 Ga0373957_0017756 3300035120 Bacteria 2484
985 Ga0373957_0039787 3300035120 Bacteria 1765
986 Ga0373957_0070331 3300035120 Bacteria 1368
987 Ga0373943_0059921 3300035170 Bacteria 1899
988 Ga0373943_0087722 3300035170 Bacteria 1606
989 Ga0373955_0000210 3300035172 Bacteria 24373
990 Ga0373955_0021420 3300035172 Bacteria 3263
991 Ga0373955_0028931 3300035172 Bacteria 2877
992 Ga0373955_0035358 3300035172 Bacteria 2645
993 Ga0373955_0174155 3300035172 Bacteria 1275
994 Ga0373961_0010213 3300035241 Bacteria 2310
995 Ga0373961_0019772 3300035241 Bacteria 1773
996 Ga0373931_0001664 3300035691 Bacteria 9623
997 Ga0373931_0001805 3300035691 Bacteria 9315
998 Ga0373935_0000146 3300035692 Bacteria 32473
999 Ga0373935_0000382 3300035692 Bacteria 22745
1000 Ga0373935_0000602 3300035692 Bacteria 18790
1001 Ga0373935_0017006 3300035692 Bacteria 4405
1002 Ga0373935_0051822 3300035692 Bacteria 2607
1003 Ga0373927_0000069 3300035695 Bacteria 74096
1004 Ga0373927_0007415 3300035695 Bacteria 7427
1005 Ga0373927_0008315 3300035695 Bacteria 6986
1006 Ga0373927_0009820 3300035695 Bacteria 6415
1007 Ga0373927_0025913 3300035695 Bacteria 3832
1008 Ga0373927_0051893 3300035695 Bacteria 2652
1009 Ga0373927_0052766 3300035695 Bacteria 2629
1010 Ga0373927_0057746 3300035695 Bacteria 2509
1011 Ga0373927_0062734 3300035695 Bacteria 2403
1012 Ga0373927_0108626 3300035695 Bacteria 1807
1013 Ga0373927_0120305 3300035695 Bacteria 1714
1014 Ga0373933_0000445 3300035724 Bacteria 25820
1015 Ga0373933_0001755 3300035724 Bacteria 12583
1016 Ga0373933_0009054 3300035724 Bacteria 5433
1017 Ga0373933_0012105 3300035724 Bacteria 4763
1018 Ga0373933_0080933 3300035724 Bacteria 1992
1019 Ga0373947_0000385 3300035725 Bacteria 24888
1020 Ga0373947_0002022 3300035725 Bacteria 12373
1021 Ga0373947_0010182 3300035725 Bacteria 5398
1022 Ga0373947_0024081 3300035725 Bacteria 3545
1023 Ga0373947_0042886 3300035725 Bacteria 2701
1024 Ga0373947_0042950 3300035725 Bacteria 2699
1025 Ga0373947_0109264 3300035725 Bacteria 1745
1026 Ga0373947_0133007 3300035725 Bacteria 1589
1027 Ga0373947_0137542 3300035725 Bacteria 1564
1028 Ga0373947_0198619 3300035725 Bacteria 1311
1029 Ga0373937_0011760 3300036401 Bacteria 7678
1030 Ga0373937_0038193 3300036401 Bacteria 4376
1031 Ga0373937_0044445 3300036401 Bacteria 4057
1032 Ga0373937_0047885 3300036401 Bacteria 3911
1033 Ga0373937_0049800 3300036401 Bacteria 3836
1034 Ga0373937_0049980 3300036401 Bacteria 3829
1035 Ga0373937_0076440 3300036401 Bacteria 3092
1036 Ga0373937_0086387 3300036401 Bacteria 2903
1037 Ga0373937_0128498 3300036401 Bacteria 2365
1038 Ga0373925_0022731 3300037068 Bacteria 4575
1039 Ga0373925_0023950 3300037068 Bacteria 4454
1040 Ga0373925_0031253 3300037068 Bacteria 3912
1041 Ga0373925_0093009 3300037068 Bacteria 2307
1042 Ga0373925_0096352 3300037068 Bacteria 2268
1043 Ga0373925_0209660 3300037068 Bacteria 1552
1044 Ga0395899_0012313 3300037312 Bacteria 6553
1045 Ga0395899_0051385 3300037312 Bacteria 3059
1046 Ga0395900_0001120 3300037418 Bacteria 33947
1047 Ga0395900_0008437 3300037418 Bacteria 10598
1048 Ga0395900_0019170 3300037418 Bacteria 6975
1049 Ga0395900_0057396 3300037418 Bacteria 4008
1050 Ga0395900_0125874 3300037418 Bacteria 2628
1051 Ga0395900_0203299 3300037418 Bacteria 2003
1052 Ga0395898_0012798 3300037466 Bacteria 8662
1053 Ga0395898_0017966 3300037466 Bacteria 7216
1054 Ga0395898_0136444 3300037466 Bacteria 2349
1055 Ga0395898_0141457 3300037466 Bacteria 2303
1056 Ga0395898_0142442 3300037466 Bacteria 2295
1057 Ga0395898_0291364 3300037466 Bacteria 1557
1058 Ga0395905_0038754 3300037471 Bacteria 4470
1059 Ga0395905_0045219 3300037471 Bacteria 4129
1060 Ga0395905_0191275 3300037471 Bacteria 1919
1061 Ga0436364_0154921 3300037853 Bacteria 3496
1062 Ga0436364_0794198 3300037853 Bacteria 1904
1063 Ga0436364_1394003 3300037853 Bacteria 2778
1064 Ga0395901_0002127 3300038443 Bacteria 20290
1065 Ga0395901_0029033 3300038443 Bacteria 5690
1066 Ga0395901_0077651 3300038443 Bacteria 3466
1067 Ga0395901_0131762 3300038443 Bacteria 2627
1068 Ga0395901_0239417 3300038443 Bacteria 1893
1069 Ga0395901_0240634 3300038443 Bacteria 1888
1070 Ga0395901_0407197 3300038443 Bacteria 1397
1071 Ga0395901_0489680 3300038443 Bacteria 1253
1072 Ga0436365_0613407 3300039437 Bacteria 2810
1073 Ga0436365_0655688 3300039437 Bacteria 1706
1074 Ga0436365_1233295 3300039437 Bacteria 2685
1075 Ga0436365_1440273 3300039437 Bacteria 9786
1076 Ga0436365_1540038 3300039437 Bacteria 1524
1077 Ga0436360_1071774 3300039438 Bacteria 1297
1078 Ga0436360_1105678 3300039438 Bacteria 2638
1079 Ga0436361_0209695 3300039447 Bacteria 1480
1080 Ga0436361_0549184 3300039447 Bacteria 2976
1081 Ga0436361_0848594 3300039447 Bacteria 1945
1082 Ga0436361_0904316 3300039447 Bacteria 2028
1083 Ga0436363_0361238 3300039450 Bacteria 3058
1084 Ga0436363_0814578 3300039450 Bacteria 1322
1085 Ga0436363_0918081 3300039450 Bacteria 3766
1086 Ga0436363_1092037 3300039450 Bacteria 1728
1087 Ga0436362_0554704 3300039453 Bacteria 1270
1088 Ga0436362_0680219 3300039453 Bacteria 2614
1089 Ga0439441_002408 3300042001 Bacteria 2633
1090 Ga0439435_0007906 3300042436 Bacteria 2454
1091 Ga0439460_0018470 3300042461 Bacteria 1878
1092 Ga0451577_0001635 3300042876 Bacteria 29060
1093 Ga0451577_0013589 3300042876 Bacteria 7614
1094 Ga0466969_0049680 3300044656 Bacteria 2069
1095 Ga0466972_0000189 3300044658 Bacteria 47501
1096 Ga0466972_0007356 3300044658 Bacteria 5533
1097 Ga0466972_0021981 3300044658 Bacteria 3177
1098 Ga0453683_0005342 3300044673 Bacteria 8976
1099 Ga0453683_0005758 3300044673 Bacteria 8595
1100 Ga0453683_0006980 3300044673 Bacteria 7698
1101 Ga0453683_0020767 3300044673 Bacteria 4196
1102 Ga0466965_0003215 3300044683 Bacteria 7142
1103 Ga0466966_0000196 3300044684 Bacteria 40708
1104 Ga0466966_0000655 3300044684 Bacteria 22032
1105 Ga0466966_0016313 3300044684 Bacteria 4912
1106 Ga0466961_0000239 3300044693 Bacteria 36887
1107 Ga0466961_0001465 3300044693 Bacteria 14665
1108 Ga0466963_0035708 3300044694 Bacteria 3239
1109 Ga0466963_0054556 3300044694 Bacteria 2657
1110 Ga0466963_0116741 3300044694 Bacteria 1834
1111 Ga0466964_0039299 3300044706 Bacteria 1906
1112 Ga0453684_0026520 3300044712 Bacteria 8362
1113 Ga0453684_0049587 3300044712 Bacteria 5534
1114 Ga0466968_0003867 3300044735 Bacteria 5560
1115 Ga0466960_0037541 3300044901 Bacteria 2273
1116 Ga0466959_0021923 3300045049 Bacteria 4718
1117 Ga0466959_0043086 3300045049 Bacteria 3329
1118 Ga0466959_0095878 3300045049 Bacteria 2127
1119 Ga0451576_0021367 3300045051 Bacteria 7033
1120 Ga0466967_0024787 3300045976 Bacteria 4937
1121 Ga0466967_0115555 3300045976 Bacteria 2471
1122 Ga0466967_0135163 3300045976 Bacteria 2293
1123 Ga0466967_0135494 3300045976 Bacteria 2290
1124 Ga0495617_027881 3300046452 Bacteria 1899
1125 Ga0495592_0004668 3300046454 Bacteria 10040
1126 Ga0495592_0036870 3300046454 Bacteria 3681
1127 Ga0495592_0047310 3300046454 Bacteria 3203
1128 Ga0495592_0057851 3300046454 Bacteria 2861
1129 Ga0495592_0066030 3300046454 Bacteria 2648
1130 Ga0495592_0087144 3300046454 Bacteria 2247
1131 Ga0495592_0089703 3300046454 Bacteria 2207
1132 Ga0495603_0000191 3300046455 Bacteria 32052
1133 Ga0495603_0000429 3300046455 Bacteria 23279
1134 Ga0495603_0000499 3300046455 Bacteria 21732
1135 Ga0495603_0004726 3300046455 Bacteria 8135
1136 Ga0495603_0009824 3300046455 Bacteria 5790
1137 Ga0495603_0010882 3300046455 Bacteria 5520
1138 Ga0495603_0017980 3300046455 Bacteria 4278
1139 Ga0495603_0031657 3300046455 Bacteria 3184
1140 Ga0495603_0041717 3300046455 Bacteria 2744
1141 Ga0495603_0058221 3300046455 Bacteria 2285
1142 Ga0495629_0000083 3300046459 Bacteria 83715
1143 Ga0495629_0000500 3300046459 Bacteria 32861
1144 Ga0495629_0000721 3300046459 Bacteria 26824
1145 Ga0495638_0004605 3300046460 Bacteria 10436
1146 Ga0495638_0015687 3300046460 Bacteria 5081
1147 Ga0495638_0019634 3300046460 Bacteria 4470
1148 Ga0495638_0052980 3300046460 Bacteria 2525
1149 Ga0495638_0098190 3300046460 Bacteria 1755
1150 Ga0495638_0103032 3300046460 Bacteria 1704
1151 Ga0495638_0110496 3300046460 Bacteria 1633
1152 Ga0495641_0001436 3300046461 Bacteria 20225
1153 Ga0495641_0062784 3300046461 Bacteria 1675
1154 Ga0495651_0000395 3300046462 Bacteria 33751
1155 Ga0495651_0013879 3300046462 Bacteria 6233
1156 Ga0495651_0019048 3300046462 Bacteria 5318
1157 Ga0495651_0040157 3300046462 Bacteria 3640
1158 Ga0495651_0064755 3300046462 Bacteria 2793
1159 Ga0495653_0004234 3300046463 Bacteria 11627
1160 Ga0495653_0034425 3300046463 Bacteria 4007
1161 Ga0495580_0000143 3300046472 Bacteria 51276
1162 Ga0495580_0000716 3300046472 Bacteria 28310
1163 Ga0495580_0001842 3300046472 Bacteria 18644
1164 Ga0495580_0010080 3300046472 Bacteria 7381
1165 Ga0495582_0000094 3300046473 Bacteria 45642
1166 Ga0495582_0000251 3300046473 Bacteria 29816
1167 Ga0495582_0036966 3300046473 Bacteria 2686
1168 Ga0495639_0000077 3300046475 Bacteria 46394
1169 Ga0495639_0000150 3300046475 Bacteria 36003
1170 Ga0495639_0000926 3300046475 Bacteria 13254
1171 Ga0495639_0039079 3300046475 Bacteria 2132
1172 Ga0495662_0000080 3300046476 Bacteria 34571
1173 Ga0495662_0000826 3300046476 Bacteria 15060
1174 Ga0495662_0031332 3300046476 Bacteria 2569
1175 Ga0495664_0005360 3300046477 Bacteria 7035
1176 Ga0495664_0014962 3300046477 Bacteria 4405
1177 Ga0495664_0028264 3300046477 Bacteria 3275
1178 Ga0495664_0045999 3300046477 Bacteria 2589
1179 Ga0495664_0065612 3300046477 Bacteria 2164
1180 Ga0495584_0042407 3300046491 Bacteria 2297
1181 Ga0495584_0061875 3300046491 Bacteria 1882
1182 Ga0495584_0092153 3300046491 Bacteria 1528
1183 Ga0495585_0061664 3300046492 Bacteria 2061
1184 Ga0495594_0000433 3300046499 Bacteria 21075
1185 Ga0495594_0000648 3300046499 Bacteria 17955
1186 Ga0495594_0001874 3300046499 Bacteria 10943
1187 Ga0495594_0039280 3300046499 Bacteria 2588
1188 Ga0495606_0001450 3300046507 Bacteria 31779
1189 Ga0495606_0002520 3300046507 Bacteria 21082
1190 Ga0495606_0002700 3300046507 Bacteria 20045
1191 Ga0495606_0032276 3300046507 Bacteria 3630
1192 Ga0495606_0049185 3300046507 Bacteria 2767
1193 Ga0495606_0056101 3300046507 Bacteria 2544
1194 Ga0495606_0058297 3300046507 Bacteria 2482
1195 Ga0495606_0085077 3300046507 Bacteria 1957
1196 Ga0495606_0106427 3300046507 Bacteria 1698
1197 Ga0495608_0020761 3300046511 Bacteria 4512
1198 Ga0495608_0037629 3300046511 Bacteria 3253
1199 Ga0495608_0055907 3300046511 Bacteria 2607
1200 Ga0495610_0084470 3300046512 Bacteria 1451
1201 Ga0495618_0026652 3300046514 Bacteria 3596
1202 Ga0495618_0092429 3300046514 Bacteria 1935
1203 Ga0495620_0052979 3300046515 Bacteria 1720
1204 Ga0495628_0003637 3300046516 Bacteria 13765
1205 Ga0495628_0026802 3300046516 Bacteria 4693
1206 Ga0495628_0026806 3300046516 Bacteria 4692
1207 Ga0495628_0064553 3300046516 Bacteria 2866
1208 Ga0495628_0068444 3300046516 Bacteria 2770
1209 Ga0495628_0228721 3300046516 Bacteria 1395
1210 Ga0495630_0003796 3300046517 Bacteria 10535
1211 Ga0495630_0111703 3300046517 Bacteria 2070
1212 Ga0495630_0128620 3300046517 Bacteria 1923
1213 Ga0495631_0060901 3300046518 Bacteria 1637
1214 Ga0495632_0105296 3300046519 Bacteria 1327
1215 Ga0495637_0045179 3300046520 Bacteria 1871
1216 Ga0495643_0006299 3300046522 Bacteria 7849
1217 Ga0495643_0015625 3300046522 Bacteria 4480
1218 Ga0495643_0052418 3300046522 Bacteria 2191
1219 Ga0495644_0046239 3300046523 Bacteria 1636
1220 Ga0495648_0013070 3300046524 Bacteria 6158
1221 Ga0495648_0017835 3300046524 Bacteria 5058
1222 Ga0495648_0039534 3300046524 Bacteria 3001
1223 Ga0495648_0066948 3300046524 Bacteria 2103
1224 Ga0495663_0042220 3300046525 Bacteria 1389
1225 Ga0495666_0099252 3300046526 Bacteria 1372
1226 Ga0495642_0020776 3300046528 Bacteria 2581
1227 Ga0495652_0006074 3300046529 Bacteria 11294
1228 Ga0495652_0019988 3300046529 Bacteria 5956
1229 Ga0495652_0028621 3300046529 Bacteria 4901
1230 Ga0495652_0030569 3300046529 Bacteria 4722
1231 Ga0495652_0031471 3300046529 Bacteria 4646
1232 Ga0495652_0080952 3300046529 Bacteria 2680
1233 Ga0495652_0102748 3300046529 Bacteria 2315
1234 Ga0495652_0110898 3300046529 Bacteria 2206
1235 Ga0495652_0143984 3300046529 Bacteria 1871
1236 Ga0495652_0195722 3300046529 Bacteria 1539
1237 Ga0495654_0044567 3300046530 Bacteria 2194
1238 Ga0495665_0000784 3300046531 Bacteria 16556
1239 Ga0495665_0003088 3300046531 Bacteria 9016
1240 Ga0495665_0016458 3300046531 Bacteria 3985
1241 Ga0495665_0021744 3300046531 Bacteria 3450
1242 Ga0495640_0003320 3300046533 Bacteria 12954
1243 Ga0495640_0011232 3300046533 Bacteria 6895
1244 Ga0495640_0013662 3300046533 Bacteria 6171
1245 Ga0495640_0018041 3300046533 Bacteria 5246
1246 Ga0495640_0025555 3300046533 Bacteria 4281
1247 Ga0495640_0031230 3300046533 Bacteria 3803
1248 Ga0495586_0044679 3300046535 Bacteria 2387
1249 Ga0495587_0008275 3300046536 Bacteria 6696
1250 Ga0495587_0017472 3300046536 Bacteria 4456
1251 Ga0495587_0080594 3300046536 Bacteria 1886
1252 Ga0495621_0031684 3300046539 Bacteria 1815
1253 Ga0495597_0004537 3300046542 Bacteria 7597
1254 Ga0495645_0000805 3300046543 Bacteria 21490
1255 Ga0495645_0020048 3300046543 Bacteria 4820
1256 Ga0495645_0021210 3300046543 Bacteria 4695
1257 Ga0495645_0058920 3300046543 Bacteria 2785
1258 Ga0495645_0082855 3300046543 Bacteria 2299
1259 Ga0495622_0001916 3300046557 Bacteria 10222
1260 Ga0495622_0008222 3300046557 Bacteria 4833
1261 Ga0495622_0028444 3300046557 Bacteria 2611
1262 Ga0495622_0037832 3300046557 Bacteria 2247
1263 Ga0495622_0050528 3300046557 Bacteria 1929
1264 Ga0495622_0068828 3300046557 Bacteria 1635
1265 Ga0495633_0059289 3300046558 Bacteria 1795
1266 Ga0495667_0005217 3300046559 Bacteria 8782
1267 Ga0495667_0007037 3300046559 Bacteria 7634
1268 Ga0495667_0008195 3300046559 Bacteria 7092
1269 Ga0495667_0010501 3300046559 Bacteria 6266
1270 Ga0495667_0041370 3300046559 Bacteria 3057
1271 Ga0495667_0059642 3300046559 Bacteria 2504
1272 Ga0495667_0139449 3300046559 Bacteria 1563
1273 Ga0495656_0006988 3300046615 Bacteria 3973
1274 Ga0495656_0053353 3300046615 Bacteria 1737
1275 Ga0495668_0103416 3300046616 Bacteria 1558
1276 Ga0495668_0107575 3300046616 Bacteria 1525
1277 Ga0495668_0138146 3300046616 Bacteria 1334
1278 Ga0495634_0001187 3300046642 Bacteria 24132
1279 Ga0495634_0002836 3300046642 Bacteria 14230
1280 Ga0495634_0017869 3300046642 Bacteria 5055
1281 Ga0495634_0020590 3300046642 Bacteria 4676
1282 Ga0495634_0026647 3300046642 Bacteria 4032
1283 Ga0495634_0104942 3300046642 Bacteria 1822
1284 Ga0495625_0104872 3300046660 Bacteria 1937
1285 Ga0495635_0000229 3300046663 Bacteria 35647
1286 Ga0495635_0000425 3300046663 Bacteria 26748
1287 Ga0495635_0001333 3300046663 Bacteria 16433
1288 Ga0495635_0009501 3300046663 Bacteria 6797
1289 Ga0495635_0026189 3300046663 Bacteria 4061
1290 Ga0495635_0048856 3300046663 Bacteria 2916
1291 Ga0495635_0063005 3300046663 Bacteria 2546
1292 Ga0495659_0061544 3300046664 Bacteria 1387
1293 Ga0495661_0050951 3300046665 Bacteria 2502
1294 Ga0495588_0007431 3300046674 Bacteria 4986
1295 Ga0495588_0029437 3300046674 Bacteria 2754
1296 Ga0495588_0034106 3300046674 Bacteria 2574
1297 Ga0495657_0005171 3300046675 Bacteria 10333
1298 Ga0495657_0010875 3300046675 Bacteria 6831
1299 Ga0495657_0020820 3300046675 Bacteria 4713
1300 Ga0495657_0036819 3300046675 Bacteria 3378
1301 Ga0495657_0150771 3300046675 Bacteria 1443
1302 Ga0495599_0000421 3300046678 Bacteria 24238
1303 Ga0495599_0001555 3300046678 Bacteria 13210
1304 Ga0495599_0016576 3300046678 Bacteria 4575
1305 Ga0495599_0044339 3300046678 Bacteria 2789
1306 Ga0495599_0050075 3300046678 Bacteria 2618
1307 Ga0495599_0077243 3300046678 Bacteria 2079
1308 Ga0495599_0078053 3300046678 Bacteria 2067
1309 Ga0495599_0082341 3300046678 Bacteria 2010
1310 Ga0495599_0126498 3300046678 Bacteria 1588
1311 Ga0495599_0156362 3300046678 Bacteria 1410
1312 Ga0495623_0007010 3300046679 Bacteria 7325
1313 Ga0495623_0009021 3300046679 Bacteria 6470
1314 Ga0495623_0026676 3300046679 Bacteria 3717
1315 Ga0495623_0052619 3300046679 Bacteria 2572
1316 Ga0495646_0019582 3300046680 Bacteria 4281
1317 Ga0495646_0031778 3300046680 Bacteria 3288
1318 Ga0495646_0037047 3300046680 Bacteria 3019
1319 Ga0495646_0070124 3300046680 Bacteria 2065
1320 Ga0495647_0002127 3300046681 Bacteria 6194
1321 Ga0495647_0008621 3300046681 Bacteria 3430
1322 Ga0495658_0000334 3300046683 Bacteria 26467
1323 Ga0495658_0001408 3300046683 Bacteria 12626
1324 Ga0495658_0002435 3300046683 Bacteria 9368
1325 Ga0495658_0031544 3300046683 Bacteria 2887
1326 Ga0495669_0027773 3300046684 Bacteria 2476
1327 Ga0495669_0028233 3300046684 Bacteria 2456
1328 Ga0495613_0010577 3300046689 Bacteria 6844
1329 Ga0495613_0028367 3300046689 Bacteria 4162
1330 Ga0495613_0048297 3300046689 Bacteria 3143
1331 Ga0495613_0056346 3300046689 Bacteria 2886
1332 Ga0495624_0000096 3300046690 Bacteria 59307
1333 Ga0495624_0000786 3300046690 Bacteria 24993
1334 Ga0495624_0000818 3300046690 Bacteria 24567
1335 Ga0495624_0042731 3300046690 Bacteria 2896
1336 Ga0495624_0094070 3300046690 Bacteria 1848
1337 Ga0495670_0034442 3300046691 Bacteria 2522
1338 Ga0495670_0104087 3300046691 Bacteria 1464
1339 Ga0495649_0010278 3300046694 Bacteria 5526
1340 Ga0495649_0069484 3300046694 Bacteria 1889
1341 Ga0495600_0000440 3300046809 Bacteria 21379
1342 Ga0495600_0003908 3300046809 Bacteria 8849
1343 Ga0495600_0011116 3300046809 Bacteria 5604
1344 Ga0495600_0012843 3300046809 Bacteria 5246
1345 Ga0495600_0083511 3300046809 Bacteria 2084
1346 Ga0495600_0159146 3300046809 Bacteria 1460
1347 Ga0495581_0000095 3300047315 Bacteria 36670
1348 Ga0495581_0009576 3300047315 Bacteria 5602
1349 Ga0495581_0024060 3300047315 Bacteria 3529
1350 Ga0495604_0000797 3300047317 Bacteria 26510
1351 Ga0495604_0017963 3300047317 Bacteria 5659
1352 Ga0495604_0024509 3300047317 Bacteria 4813
1353 Ga0495604_0024712 3300047317 Bacteria 4793
1354 Ga0495604_0066064 3300047317 Bacteria 2752
1355 Ga0495604_0138526 3300047317 Bacteria 1741
1356 Ga0495674_0001326 3300047319 Bacteria 24110
1357 Ga0495674_0001342 3300047319 Bacteria 23999
1358 Ga0495674_0002711 3300047319 Bacteria 17225
1359 Ga0495674_0017800 3300047319 Bacteria 6616
1360 Ga0495674_0048096 3300047319 Bacteria 3777
1361 Ga0495674_0048881 3300047319 Bacteria 3740
1362 Ga0495674_0098531 3300047319 Bacteria 2489
1363 Ga0495674_0099667 3300047319 Bacteria 2473
1364 Ga0495674_0188994 3300047319 Bacteria 1712
1365 Ga0495672_0010757 3300047320 Bacteria 6494
1366 Ga0495672_0029155 3300047320 Bacteria 3480
1367 Ga0495672_0031567 3300047320 Bacteria 3306
1368 Ga0495672_0079353 3300047320 Bacteria 1833
1369 Ga0495676_0035190 3300047321 Bacteria 4191
1370 Ga0495676_0051777 3300047321 Bacteria 3282
1371 Ga0495676_0053391 3300047321 Bacteria 3221
1372 Ga0495676_0061193 3300047321 Bacteria 2946
1373 Ga0495676_0185413 3300047321 Bacteria 1455
1374 Ga0495680_0002991 3300047322 Bacteria 16880
1375 Ga0495680_0004264 3300047322 Bacteria 13730
1376 Ga0495680_0008649 3300047322 Bacteria 9238
1377 Ga0495683_0063682 3300047323 Bacteria 1822
1378 Ga0495687_009315 3300047443 Bacteria 5503
1379 Ga0495675_0042433 3300047444 Bacteria 2897
1380 Ga0495675_0091167 3300047444 Bacteria 1913
1381 Ga0495677_0031930 3300047445 Bacteria 1917
1382 Ga0495673_0055053 3300047469 Bacteria 1727
1383 Ga0495684_0001579 3300047471 Bacteria 18262
1384 Ga0495684_0019491 3300047471 Bacteria 5225
1385 Ga0495684_0045177 3300047471 Bacteria 3371
1386 Ga0495684_0066747 3300047471 Bacteria 2735
1387 Ga0495684_0089076 3300047471 Bacteria 2338
1388 Ga0495684_0145377 3300047471 Bacteria 1776
1389 Ga0495686_0104291 3300047472 Bacteria 1707
1390 Ga0495686_0158388 3300047472 Bacteria 1325
1391 Ga0495593_0000071 3300047673 Bacteria 43314
1392 Ga0495593_0000192 3300047673 Bacteria 32140
1393 Ga0495593_0000531 3300047673 Bacteria 21606
1394 Ga0495593_0004346 3300047673 Bacteria 8432
1395 Ga0495593_0004557 3300047673 Bacteria 8236
1396 Ga0495602_0002266 3300048088 Bacteria 19452
1397 Ga0495602_0032999 3300048088 Bacteria 4864
1398 Ga0495602_0046834 3300048088 Bacteria 3902
1399 Ga0495602_0058117 3300048088 Bacteria 3388
1400 Ga0495602_0061680 3300048088 Bacteria 3258
1401 Ga0495614_0008512 3300048089 Bacteria 4560
1402 Ga0495614_0014224 3300048089 Bacteria 3487
1403 Ga0495626_0079765 3300048091 Bacteria 1456
1404 Ga0496100_0017746 3300048903 Bacteria 4209
1405 Ga0496100_0048864 3300048903 Bacteria 2733
1406 Ga0496101_0002722 3300048904 Bacteria 10847
1407 Ga0496101_0050241 3300048904 Bacteria 3001
1408 Ga0496101_0070462 3300048904 Bacteria 2560
1409 Ga0496101_0081798 3300048904 Bacteria 2389
1410 Ga0496101_0112214 3300048904 Bacteria 2053
1411 Ga0496101_0181810 3300048904 Bacteria 1619
1412 Ga0496101_0199879 3300048904 Bacteria 1545
1413 Ga0496101_0221803 3300048904 Bacteria 1467
1414 Ga0496102_0006460 3300048905 Bacteria 9999
1415 Ga0496102_0013510 3300048905 Bacteria 7074
1416 Ga0496102_0014728 3300048905 Bacteria 6798
1417 Ga0496102_0023779 3300048905 Bacteria 5444
1418 Ga0496102_0035750 3300048905 Bacteria 4473
1419 Ga0496102_0047263 3300048905 Bacteria 3910
1420 Ga0496102_0056044 3300048905 Bacteria 3595
1421 Ga0496102_0069039 3300048905 Bacteria 3244
1422 Ga0496102_0130421 3300048905 Bacteria 2352
1423 Ga0496102_0216315 3300048905 Bacteria 1806
1424 Ga0496102_0289006 3300048905 Bacteria 1545
1425 Ga0496103_0006318 3300048906 Bacteria 7084
1426 Ga0496103_0034796 3300048906 Bacteria 3082
1427 Ga0496103_0063663 3300048906 Bacteria 2298
1428 Ga0496103_0092632 3300048906 Bacteria 1907
1429 Ga0496103_0125495 3300048906 Bacteria 1637
1430 Ga0496103_0186500 3300048906 Bacteria 1333
1431 Ga0496104_0003416 3300048907 Bacteria 13701
1432 Ga0496104_0006365 3300048907 Bacteria 10386
1433 Ga0496104_0007294 3300048907 Bacteria 9756
1434 Ga0496104_0007469 3300048907 Bacteria 9661
1435 Ga0496104_0013863 3300048907 Bacteria 7272
1436 Ga0496104_0020552 3300048907 Bacteria 6052
1437 Ga0496104_0028484 3300048907 Bacteria 5177
1438 Ga0496104_0050018 3300048907 Bacteria 3943
1439 Ga0496104_0082079 3300048907 Bacteria 3074
1440 Ga0496104_0305797 3300048907 Bacteria 1502
1441 Ga0496105_0000885 3300048908 Bacteria 20493
1442 Ga0496105_0002584 3300048908 Bacteria 13164
1443 Ga0496105_0003408 3300048908 Bacteria 11760
1444 Ga0496105_0020255 3300048908 Bacteria 5374
1445 Ga0496105_0033690 3300048908 Bacteria 4208
1446 Ga0496105_0035975 3300048908 Bacteria 4077
1447 Ga0496105_0083660 3300048908 Bacteria 2635
1448 Ga0496105_0114640 3300048908 Bacteria 2223
1449 Ga0496106_0001915 3300048909 Bacteria 15604
1450 Ga0496106_0007345 3300048909 Bacteria 8144
1451 Ga0496106_0022766 3300048909 Bacteria 4655
1452 Ga0496106_0030731 3300048909 Bacteria 4003
1453 Ga0496106_0037921 3300048909 Bacteria 3606
1454 Ga0496106_0088810 3300048909 Bacteria 2383
1455 Ga0496106_0118644 3300048909 Bacteria 2066
1456 Ga0496106_0127378 3300048909 Bacteria 1994
1457 Ga0496106_0145099 3300048909 Bacteria 1869
1458 Ga0496106_0150552 3300048909 Bacteria 1835
1459 Ga0496107_0012151 3300048910 Bacteria 6006
1460 Ga0496107_0016613 3300048910 Bacteria 5170
1461 Ga0496107_0027783 3300048910 Bacteria 4019
1462 Ga0496107_0038938 3300048910 Bacteria 3410
1463 Ga0496107_0053387 3300048910 Bacteria 2915
1464 Ga0496107_0055102 3300048910 Bacteria 2872
1465 Ga0496107_0098347 3300048910 Bacteria 2143
1466 Ga0496107_0188217 3300048910 Bacteria 1533
1467 Ga0496108_0003824 3300048911 Bacteria 12064
1468 Ga0496108_0017452 3300048911 Bacteria 5873
1469 Ga0496108_0030364 3300048911 Bacteria 4479
1470 Ga0496108_0036356 3300048911 Bacteria 4097
1471 Ga0496108_0040146 3300048911 Bacteria 3900
1472 Ga0496108_0160188 3300048911 Bacteria 1944
1473 Ga0496108_0178103 3300048911 Bacteria 1841
1474 Ga0496108_0253998 3300048911 Bacteria 1529
1475 Ga0496108_0327267 3300048911 Bacteria 1336
1476 Ga0496109_0004518 3300048912 Bacteria 11631
1477 Ga0496109_0032449 3300048912 Bacteria 4695
1478 Ga0496109_0035989 3300048912 Bacteria 4469
1479 Ga0496109_0041003 3300048912 Bacteria 4194
1480 Ga0496109_0154347 3300048912 Bacteria 2150
1481 Ga0496109_0201653 3300048912 Bacteria 1870
1482 Ga0496109_0288186 3300048912 Bacteria 1548
1483 Ga0496110_0014347 3300048913 Bacteria 6575
1484 Ga0496110_0049494 3300048913 Bacteria 3686
1485 Ga0496110_0233224 3300048913 Bacteria 1674
1486 Ga0496110_0238793 3300048913 Bacteria 1653
1487 Ga0496111_0002213 3300048914 Bacteria 11663
1488 Ga0496111_0025164 3300048914 Bacteria 4198
1489 Ga0496111_0030899 3300048914 Bacteria 3811
1490 Ga0496111_0036997 3300048914 Bacteria 3492
1491 Ga0496111_0066009 3300048914 Bacteria 2627
1492 Ga0496111_0072734 3300048914 Bacteria 2503
1493 Ga0496111_0219523 3300048914 Bacteria 1412
1494 Ga0496112_0000004 3300048915 Bacteria 553294
1495 Ga0496112_0000021 3300048915 Bacteria 156561
1496 Ga0496112_0009718 3300048915 Bacteria 8683
1497 Ga0496112_0011381 3300048915 Bacteria 8122
1498 Ga0496112_0012673 3300048915 Bacteria 7753
1499 Ga0496112_0014868 3300048915 Bacteria 7241
1500 Ga0496112_0024366 3300048915 Bacteria 5792
1501 Ga0496112_0034410 3300048915 Bacteria 4931
1502 Ga0496112_0035695 3300048915 Bacteria 4845
1503 Ga0496112_0039660 3300048915 Bacteria 4603
1504 Ga0496112_0069176 3300048915 Bacteria 3488
1505 Ga0496112_0079666 3300048915 Bacteria 3240
1506 Ga0496112_0101340 3300048915 Bacteria 2849
1507 Ga0496112_0104503 3300048915 Bacteria 2802
1508 Ga0496112_0132785 3300048915 Bacteria 2460
1509 Ga0496112_0207383 3300048915 Bacteria 1917
1510 Ga0496113_0001858 3300048916 Bacteria 12026
1511 Ga0496113_0004219 3300048916 Bacteria 8792
1512 Ga0496113_0043607 3300048916 Bacteria 3320
1513 Ga0496113_0045592 3300048916 Bacteria 3252
1514 Ga0496113_0053851 3300048916 Bacteria 3009
1515 Ga0496113_0101787 3300048916 Bacteria 2227
1516 Ga0496113_0106471 3300048916 Bacteria 2178
1517 Ga0496113_0142693 3300048916 Bacteria 1885
1518 Ga0496113_0145583 3300048916 Bacteria 1866
1519 Ga0496114_0002125 3300048917 Bacteria 15068
1520 Ga0496114_0010449 3300048917 Bacteria 7386
1521 Ga0496114_0011440 3300048917 Bacteria 7091
1522 Ga0496114_0043187 3300048917 Bacteria 3738
1523 Ga0496114_0085349 3300048917 Bacteria 2674
1524 Ga0496115_0012349 3300048918 Bacteria 6423
1525 Ga0496115_0054052 3300048918 Bacteria 3224
1526 Ga0496115_0062305 3300048918 Bacteria 3008
1527 Ga0496115_0063546 3300048918 Bacteria 2978
1528 Ga0496115_0088782 3300048918 Bacteria 2524
1529 Ga0496115_0096715 3300048918 Bacteria 2418
1530 Ga0496115_0111608 3300048918 Bacteria 2246
1531 Ga0496115_0134043 3300048918 Bacteria 2042
1532 Ga0496116_0027209 3300048919 Bacteria 4166
1533 Ga0496116_0045503 3300048919 Bacteria 2970
1534 Ga0496116_0123106 3300048919 Bacteria 1496
1535 Ga0496117_0165819 3300048920 Bacteria 1288
1536 Ga0496118_0008788 3300048921 Bacteria 10358
1537 Ga0496118_0011620 3300048921 Bacteria 8564
1538 Ga0496118_0016895 3300048921 Bacteria 6667
1539 Ga0496118_0017343 3300048921 Bacteria 6557
1540 Ga0496118_0018968 3300048921 Bacteria 6167
1541 Ga0496118_0044117 3300048921 Bacteria 3495
1542 Ga0496118_0048374 3300048921 Bacteria 3286
1543 Ga0496118_0100933 3300048921 Bacteria 1950
1544 Ga0496118_0131137 3300048921 Bacteria 1609
1545 Ga0496119_0020237 3300048922 Bacteria 4861
1546 Ga0496119_0070625 3300048922 Bacteria 2047
1547 Ga0496119_0074171 3300048922 Bacteria 1982
1548 Ga0496119_0079911 3300048922 Bacteria 1887
1549 Ga0496119_0090397 3300048922 Bacteria 1741
1550 Ga0496119_0104706 3300048922 Bacteria 1582
1551 Ga0496120_0040496 3300048923 Bacteria 2738
1552 Ga0496121_0000937 3300048924 Bacteria 52775
1553 Ga0496121_0001335 3300048924 Bacteria 42241
1554 Ga0496121_0001474 3300048924 Bacteria 39613
1555 Ga0496121_0005471 3300048924 Bacteria 16264
1556 Ga0496121_0007499 3300048924 Bacteria 13165
1557 Ga0496121_0007715 3300048924 Bacteria 12909
1558 Ga0496121_0014083 3300048924 Bacteria 8529
1559 Ga0496121_0026412 3300048924 Bacteria 5473
1560 Ga0496121_0041760 3300048924 Bacteria 4003
1561 Ga0496121_0073661 3300048924 Bacteria 2735
1562 Ga0496121_0081235 3300048924 Bacteria 2566
1563 Ga0496121_0093945 3300048924 Bacteria 2334
1564 Ga0496121_0137266 3300048924 Bacteria 1820
1565 Ga0496121_0156348 3300048924 Bacteria 1672
1566 Ga0496122_0040041 3300048925 Bacteria 3730
1567 Ga0496122_0068684 3300048925 Bacteria 2542
1568 Ga0496122_0096640 3300048925 Bacteria 1991
1569 Ga0496122_0107191 3300048925 Bacteria 1847
1570 Ga0496123_0051156 3300048926 Bacteria 2753
1571 Ga0496123_0059734 3300048926 Bacteria 2462
1572 Ga0496123_0144221 3300048926 Bacteria 1296
1573 Ga0496124_0000837 3300048927 Bacteria 50140
1574 Ga0496124_0043395 3300048927 Bacteria 3866
1575 Ga0496124_0060408 3300048927 Bacteria 3180
1576 Ga0496124_0139227 3300048927 Bacteria 1917
1577 Ga0496125_0000272 3300048928 Bacteria 105490
1578 Ga0496125_0002607 3300048928 Bacteria 23149
1579 Ga0496125_0003504 3300048928 Bacteria 18949
1580 Ga0496125_0005748 3300048928 Bacteria 13643
1581 Ga0496125_0007108 3300048928 Bacteria 11948
1582 Ga0496125_0018180 3300048928 Bacteria 6680
1583 Ga0496125_0048277 3300048928 Bacteria 3551
1584 Ga0496125_0054870 3300048928 Bacteria 3253
1585 Ga0496125_0076497 3300048928 Bacteria 2584
1586 Ga0496125_0101821 3300048928 Bacteria 2112
1587 Ga0496125_0133241 3300048928 Bacteria 1744
1588 Ga0496126_0003412 3300048929 Bacteria 20085
1589 Ga0496126_0004659 3300048929 Bacteria 16215
1590 Ga0496126_0009003 3300048929 Bacteria 10678
1591 Ga0496126_0012203 3300048929 Bacteria 8815
1592 Ga0496126_0012755 3300048929 Bacteria 8591
1593 Ga0496126_0013528 3300048929 Bacteria 8292
1594 Ga0496126_0018680 3300048929 Bacteria 6860
1595 Ga0496126_0019511 3300048929 Bacteria 6675
1596 Ga0496126_0023543 3300048929 Bacteria 5967
1597 Ga0496126_0023619 3300048929 Bacteria 5956
1598 Ga0496126_0025545 3300048929 Bacteria 5680
1599 Ga0496126_0028347 3300048929 Bacteria 5338
1600 Ga0496126_0030336 3300048929 Bacteria 5124
1601 Ga0496126_0032620 3300048929 Bacteria 4905
1602 Ga0496126_0034632 3300048929 Bacteria 4741
1603 Ga0496126_0044721 3300048929 Bacteria 4075
1604 Ga0496126_0055970 3300048929 Bacteria 3566
1605 Ga0496126_0082690 3300048929 Bacteria 2836
1606 Ga0496126_0092699 3300048929 Bacteria 2653
1607 Ga0496126_0131750 3300048929 Bacteria 2160
1608 Ga0496126_0142588 3300048929 Bacteria 2061
1609 Ga0496126_0151118 3300048929 Bacteria 1990
1610 Ga0496126_0170032 3300048929 Bacteria 1857
1611 Ga0496126_0173685 3300048929 Bacteria 1834
1612 Ga0496126_0251839 3300048929 Bacteria 1471
1613 Ga0496126_0279475 3300048929 Bacteria 1383
1614 Ga0501031_0000910 3300049568 Bacteria 17813
1615 Ga0501031_0001421 3300049568 Bacteria 14827
1616 Ga0501031_0002962 3300049568 Bacteria 10865
1617 Ga0501031_0010568 3300049568 Bacteria 6009
1618 Ga0501031_0016428 3300049568 Bacteria 4807
1619 Ga0501032_0000129 3300049569 Bacteria 62082
1620 Ga0501032_0000421 3300049569 Bacteria 35100
1621 Ga0501032_0000537 3300049569 Bacteria 30708
1622 Ga0501032_0006576 3300049569 Bacteria 8534
1623 Ga0501032_0145628 3300049569 Bacteria 1559
1624 Ga0501033_0000124 3300049570 Bacteria 74731
1625 Ga0501033_0000864 3300049570 Bacteria 27713
1626 Ga0501033_0001179 3300049570 Bacteria 23588
1627 Ga0501033_0002170 3300049570 Bacteria 16951
1628 Ga0501033_0025694 3300049570 Bacteria 4437
1629 Ga0501034_0000503 3300049571 Bacteria 63099
1630 Ga0501034_0012060 3300049571 Bacteria 8935
1631 Ga0501034_0014541 3300049571 Bacteria 8105
1632 Ga0501034_0089178 3300049571 Bacteria 3082
1633 Ga0501036_0000232 3300049572 Bacteria 37236
1634 Ga0501036_0001453 3300049572 Bacteria 18220
1635 Ga0501036_0002128 3300049572 Bacteria 15451
1636 Ga0501036_0018030 3300049572 Bacteria 5909
1637 Ga0501036_0023998 3300049572 Bacteria 5140
1638 Ga0501036_0081321 3300049572 Bacteria 2738
1639 Ga0501036_0294028 3300049572 Bacteria 1359
1640 Ga0501037_0000106 3300049573 Bacteria 79430
1641 Ga0501037_0000469 3300049573 Bacteria 32951
1642 Ga0501037_0002855 3300049573 Bacteria 12528
1643 Ga0501037_0005891 3300049573 Bacteria 8954
1644 Ga0501037_0158054 3300049573 Bacteria 1617
1645 Ga0501038_0000041 3300049574 Bacteria 120557
1646 Ga0501038_0000108 3300049574 Bacteria 70323
1647 Ga0501038_0000274 3300049574 Bacteria 43657
1648 Ga0501038_0001655 3300049574 Bacteria 20704
1649 Ga0501038_0003879 3300049574 Bacteria 13900
1650 Ga0501038_0008504 3300049574 Bacteria 9432
1651 Ga0501038_0053911 3300049574 Bacteria 3460
1652 Ga0501038_0143838 3300049574 Bacteria 1949
1653 Ga0501039_0000097 3300049575 Bacteria 60744
1654 Ga0501039_0000416 3300049575 Bacteria 30616
1655 Ga0501039_0000472 3300049575 Bacteria 29218
1656 Ga0501039_0003027 3300049575 Bacteria 12569
1657 Ga0501040_0155305 3300049576 Bacteria 1616
1658 Ga0501040_0189619 3300049576 Bacteria 1458
1659 Ga0501042_0016537 3300049578 Bacteria 5066
1660 Ga0501042_0017067 3300049578 Bacteria 5001
1661 Ga0501042_0022677 3300049578 Bacteria 4386
1662 Ga0501042_0039520 3300049578 Bacteria 3353
1663 Ga0501043_0000035 3300049579 Bacteria 133200
1664 Ga0501043_0000498 3300049579 Bacteria 35297
1665 Ga0501043_0004728 3300049579 Bacteria 11042
1666 Ga0501043_0019247 3300049579 Bacteria 5359
1667 Ga0501043_0130370 3300049579 Bacteria 1970
1668 Ga0501043_0176288 3300049579 Bacteria 1666
1669 Ga0501046_0000235 3300049580 Bacteria 57005
1670 Ga0501046_0000461 3300049580 Bacteria 40695
1671 Ga0501046_0003612 3300049580 Bacteria 14167
1672 Ga0501046_0128024 3300049580 Bacteria 1927
1673 Ga0501047_0000579 3300049581 Bacteria 38948
1674 Ga0501047_0000844 3300049581 Bacteria 31650
1675 Ga0501047_0001740 3300049581 Bacteria 21108
1676 Ga0501047_0015400 3300049581 Bacteria 7284
1677 Ga0501047_0076446 3300049581 Bacteria 3222
1678 Ga0501047_0084470 3300049581 Bacteria 3051
1679 Ga0501047_0108258 3300049581 Bacteria 2661
1680 Ga0501047_0236068 3300049581 Bacteria 1680
1681 Ga0501047_0236159 3300049581 Bacteria 1680
1682 Ga0501048_0000116 3300049582 Bacteria 45512
1683 Ga0501048_0001444 3300049582 Bacteria 18038
1684 Ga0501048_0002032 3300049582 Bacteria 15376
1685 Ga0501048_0013490 3300049582 Bacteria 6065
1686 Ga0501048_0080046 3300049582 Bacteria 2305
1687 Ga0501067_0000160 3300049583 Bacteria 37883
1688 Ga0501067_0001562 3300049583 Bacteria 12506
1689 Ga0501067_0012440 3300049583 Bacteria 4721
1690 Ga0501067_0048969 3300049583 Bacteria 2342
1691 Ga0501067_0077355 3300049583 Bacteria 1844
1692 Ga0501068_0000014 3300049584 Bacteria 62762
1693 Ga0501068_0001689 3300049584 Bacteria 11774
1694 Ga0501068_0002139 3300049584 Bacteria 10521
1695 Ga0501068_0004794 3300049584 Bacteria 7364
1696 Ga0501068_0045654 3300049584 Bacteria 2639
1697 Ga0501069_0003571 3300049585 Bacteria 8013
1698 Ga0501069_0004593 3300049585 Bacteria 7142
1699 Ga0501070_0000175 3300049586 Bacteria 59483
1700 Ga0501070_0000451 3300049586 Bacteria 37429
1701 Ga0501070_0003132 3300049586 Bacteria 14403
1702 Ga0501070_0010549 3300049586 Bacteria 7810
1703 Ga0501070_0012185 3300049586 Bacteria 7255
1704 Ga0501070_0034852 3300049586 Bacteria 4206
1705 Ga0501070_0133927 3300049586 Bacteria 2046
1706 Ga0501070_0171048 3300049586 Bacteria 1789
1707 Ga0501070_0222193 3300049586 Bacteria 1549
1708 Ga0501071_0033623 3300049587 Bacteria 3643
1709 Ga0501072_0001159 3300049588 Bacteria 19618
1710 Ga0501072_0013749 3300049588 Bacteria 6197
1711 Ga0501072_0041392 3300049588 Bacteria 3619
1712 Ga0501072_0047145 3300049588 Bacteria 3393
1713 Ga0501073_0000417 3300049589 Bacteria 29149
1714 Ga0501073_0002573 3300049589 Bacteria 13565
1715 Ga0501073_0012416 3300049589 Bacteria 6216
1716 Ga0501073_0015408 3300049589 Bacteria 5546
1717 Ga0501073_0020039 3300049589 Bacteria 4822
1718 Ga0501073_0020288 3300049589 Bacteria 4795
1719 Ga0501073_0036142 3300049589 Bacteria 3510
1720 Ga0501073_0062358 3300049589 Bacteria 2601
1721 Ga0501074_0000596 3300049590 Bacteria 22464
1722 Ga0501074_0002156 3300049590 Bacteria 13623
1723 Ga0501074_0014111 3300049590 Bacteria 5809
1724 Ga0501074_0018698 3300049590 Bacteria 5035
1725 Ga0501074_0020304 3300049590 Bacteria 4828
1726 Ga0501074_0027193 3300049590 Bacteria 4147
1727 Ga0501074_0036536 3300049590 Bacteria 3558
1728 Ga0501075_0025051 3300049591 Bacteria 4381
1729 Ga0501077_0061693 3300049593 Bacteria 2379
1730 Ga0501079_0000261 3300049741 Bacteria 32317
1731 Ga0501079_0026383 3300049741 Bacteria 4454
1732 Ga0501079_0120547 3300049741 Bacteria 2040
1733 Ga0501080_0000638 3300049742 Bacteria 27778
1734 Ga0501080_0000917 3300049742 Bacteria 24141
1735 Ga0501080_0002860 3300049742 Bacteria 15179
1736 Ga0501080_0016248 3300049742 Bacteria 6873
1737 Ga0501080_0024764 3300049742 Bacteria 5566
1738 Ga0501080_0024865 3300049742 Bacteria 5553
1739 Ga0501080_0034324 3300049742 Bacteria 4734
1740 Ga0501080_0052344 3300049742 Bacteria 3800
1741 Ga0501083_0000301 3300049744 Bacteria 31182
1742 Ga0501035_0000155 3300049822 Bacteria 84012
1743 Ga0501035_0000250 3300049822 Bacteria 64768
1744 Ga0501035_0000324 3300049822 Bacteria 55297
1745 Ga0501035_0005480 3300049822 Bacteria 11991
1746 Ga0501035_0056563 3300049822 Bacteria 3499
1747 Ga0501035_0113570 3300049822 Bacteria 2372
1748 Ga0501035_0195280 3300049822 Bacteria 1738
1749 Ga0501044_0000051 3300049823 Bacteria 143658
1750 Ga0501044_0000393 3300049823 Bacteria 54257
1751 Ga0501044_0006565 3300049823 Bacteria 12844
1752 Ga0501044_0037167 3300049823 Bacteria 5090
1753 Ga0501044_0042768 3300049823 Bacteria 4710
1754 Ga0501044_0061028 3300049823 Bacteria 3858
1755 Ga0501044_0061265 3300049823 Bacteria 3850
1756 Ga0501044_0099578 3300049823 Bacteria 2925
1757 Ga0501044_0130487 3300049823 Bacteria 2507
1758 Ga0501044_0141531 3300049823 Bacteria 2394
1759 Ga0501044_0277526 3300049823 Bacteria 1610
1760 Ga0501044_0325052 3300049823 Bacteria 1462
1761 Ga0501044_0343767 3300049823 Bacteria 1412
1762 Ga0501045_0016881 3300049824 Bacteria 5186
1763 Ga0501045_0122313 3300049824 Bacteria 1932
1764 Ga0501045_0193984 3300049824 Bacteria 1514
1765 nmdc:mga03n38_11031_c1 3300050490 Bacteria 3351
1766 nmdc:mga03n38_1152_c1 3300050490 Bacteria 7330
1767 nmdc:mga03n38_6491_c1 3300050490 Bacteria 4069
1768 nmdc:mga03n38_70748_c1 3300050490 Bacteria 1614
1769 nmdc:mga00v17_5870_c1 3300050491 Bacteria 6485
1770 nmdc:mga00v17_65415_c1 3300050491 Bacteria 2243
1771 nmdc:mga00v17_71047_c1 3300050491 Bacteria 2157
1772 nmdc:mga0yw44_126840_c1 3300050492 Bacteria 1649
1773 nmdc:mga0yw44_132499_c1 3300050492 Bacteria 1615
1774 nmdc:mga0yw44_26596_c1 3300050492 Bacteria 3307
1775 nmdc:mga0yw44_56770_c1 3300050492 Bacteria 2387
1776 nmdc:mga0yw44_58545_c1 3300050492 Bacteria 2354
1777 nmdc:mga0yw44_65387_c1 3300050492 Bacteria 2241
1778 nmdc:mga0yw44_92434_c1 3300050492 Bacteria 1915
1779 nmdc:mga0k408_16450_c2 3300050493 Bacteria 2495
1780 nmdc:mga0k408_48401_c1 3300050493 Bacteria 2459
1781 nmdc:mga0k408_50969_c2 3300050493 Bacteria 1890
1782 nmdc:mga06z11_18028_c1 3300050494 Bacteria 3217
1783 nmdc:mga06z11_265_c1 3300050494 Bacteria 20369
1784 nmdc:mga06z11_29777_c1 3300050494 Bacteria 2634
1785 nmdc:mga06z11_7714_c1 3300050494 Bacteria 4444
1786 nmdc:mga06z11_96712_c1 3300050494 Bacteria 1613
1787 nmdc:mga04h51_277_c1 3300050495 Bacteria 13149
1788 nmdc:mga07m45_13400_c1 3300050496 Bacteria 4350
1789 nmdc:mga07m45_20941_c1 3300050496 Bacteria 3555
1790 nmdc:mga07m45_24289_c1 3300050496 Bacteria 3319
1791 nmdc:mga07m45_25821_c1 3300050496 Bacteria 3225
1792 nmdc:mga07m45_49310_c1 3300050496 Bacteria 2370
1793 nmdc:mga07m45_54286_c1 3300050496 Bacteria 2265
1794 nmdc:mga05p37_133238_c1 3300050507 Bacteria 3048
1795 nmdc:mga05p37_14166_c1 3300050507 Bacteria 9571
1796 nmdc:mga05p37_168429_c1 3300050507 Bacteria 2673
1797 nmdc:mga05p37_19161_c1 3300050507 Bacteria 8276
1798 nmdc:mga05p37_21718_c1 3300050507 Bacteria 7776
1799 nmdc:mga05p37_38812_c1 3300050507 Bacteria 5843
1800 nmdc:mga05p37_56222_c1 3300050507 Bacteria 4844
1801 nmdc:mga05p37_99586_c1 3300050507 Bacteria 3580
1802 nmdc:mga09592_139305_c1 3300050508 Bacteria 2090
1803 nmdc:mga09592_43756_c1 3300050508 Bacteria 3767
1804 nmdc:mga09592_47189_c1 3300050508 Bacteria 3629
1805 nmdc:mga0qj67_1874_c1 3300050509 Bacteria 14910
1806 nmdc:mga0qj67_3798_c1 3300050509 Bacteria 10908
1807 nmdc:mga0qj67_676_c1 3300050509 Bacteria 23252
1808 nmdc:mga0qj67_77360_c1 3300050509 Bacteria 2661
1809 nmdc:mga06r32_109119_c1 3300050510 Bacteria 2721
1810 nmdc:mga06r32_1475_c1 3300050510 Bacteria 21176
1811 nmdc:mga06r32_1637_c1 3300050510 Bacteria 20211
1812 nmdc:mga06r32_33334_c1 3300050510 Bacteria 4850
1813 nmdc:mga06r32_338775_c1 3300050510 Bacteria 1489
1814 nmdc:mga06r32_543_c1 3300050510 Bacteria 32734
1815 nmdc:mga08y16_111404_c1 3300050511 Bacteria 2849
1816 nmdc:mga08y16_1251_c1 3300050511 Bacteria 25187
1817 nmdc:mga08y16_3110_c1 3300050511 Bacteria 17190
1818 nmdc:mga08y16_6269_c1 3300050511 Bacteria 12468
1819 nmdc:mga0n895_127644_c1 3300050512 Bacteria 2567
1820 nmdc:mga0n895_158611_c1 3300050512 Bacteria 2294
1821 nmdc:mga0n895_62290_c1 3300050512 Bacteria 3686
1822 nmdc:mga0n895_6506_c1 3300050512 Bacteria 9936
1823 nmdc:mga0n895_67363_c1 3300050512 Bacteria 3546
1824 nmdc:mga0n895_70689_c1 3300050512 Bacteria 3459
1825 nmdc:mga0n895_71097_c1 3300050512 Bacteria 3450
1826 nmdc:mga0n895_87513_c1 3300050512 Bacteria 3113
1827 nmdc:mga0rr50_14270_c1 3300050513 Bacteria 5205
1828 nmdc:mga0rr50_57318_c1 3300050513 Bacteria 2914
1829 nmdc:mga08x19_211757_c1 3300050514 Bacteria 1330
1830 nmdc:mga08x19_6146_c1 3300050514 Bacteria 7105
1831 nmdc:mga08x19_69282_c1 3300050514 Bacteria 2297
1832 nmdc:mga0a205_11259_c1 3300050515 Bacteria 8233
1833 nmdc:mga0a205_12648_c1 3300050515 Bacteria 7816
1834 nmdc:mga0a205_16908_c1 3300050515 Bacteria 6829
1835 nmdc:mga0a205_32349_c1 3300050515 Bacteria 5016
1836 nmdc:mga0a205_38197_c1 3300050515 Bacteria 4618
1837 nmdc:mga0a205_53745_c1 3300050515 Bacteria 3887
1838 nmdc:mga0a205_68159_c1 3300050515 Bacteria 3436
1839 nmdc:mga0a205_7303_c1 3300050515 Bacteria 9995
1840 nmdc:mga0sz30_4529_c2 3300050516 Bacteria 2012
1841 nmdc:mga0sz30_48151_c1 3300050516 Bacteria 1803
1842 nmdc:mga0sz30_50417_c1 3300050516 Bacteria 1765
1843 nmdc:mga0sz30_5857_c1 3300050516 Bacteria 4530
1844 nmdc:mga0sz30_72610_c1 3300050516 Bacteria 1483
1845 Ga0495601_0021200 3300053077 Bacteria 3978
1846 Ga0495601_0028822 3300053077 Bacteria 3441
1847 Ga0495601_0131066 3300053077 Bacteria 1633
1848 Ga0495612_0004165 3300053078 Bacteria 5996
1849 Ga0495612_0008179 3300053078 Bacteria 4250
1850 Ga0495612_0036583 3300053078 Bacteria 1992
1851 Ga0500635_0002738 3300053080 Bacteria 4376
1852 Ga0500635_0017508 3300053080 Bacteria 2148
1853 Ga0495619_0000176 3300053085 Bacteria 47128
1854 Ga0495619_0007164 3300053085 Bacteria 7065
1855 Ga0495619_0021997 3300053085 Bacteria 4076
1856 Ga0495619_0030263 3300053085 Bacteria 3504
1857 Ga0495619_0054846 3300053085 Bacteria 2639
1858 Ga0495619_0064738 3300053085 Bacteria 2438
1859 Ga0495619_0093482 3300053085 Bacteria 2038
1860 Ga0500643_000032 3300053087 Bacteria 200350
1861 Ga0500643_015047 3300053087 Bacteria 2665
1862 Ga0500647_0031804 3300053091 Bacteria 2512
1863 Ga0500647_0041985 3300053091 Bacteria 2195
1864 Ga0500566_0000009 3300053094 Bacteria 131668
1865 Ga0500566_0002219 3300053094 Bacteria 11462
1866 Ga0500566_0003778 3300053094 Bacteria 9037
1867 Ga0500566_0005587 3300053094 Bacteria 7469
1868 Ga0500566_0006693 3300053094 Bacteria 6824
1869 Ga0500566_0015610 3300053094 Bacteria 4457
1870 Ga0500566_0019346 3300053094 Bacteria 3997
1871 Ga0500566_0019862 3300053094 Bacteria 3943
1872 Ga0500566_0039944 3300053094 Bacteria 2712
1873 Ga0500640_000068 3300053095 Bacteria 17078
1874 Ga0500640_049776 3300053095 Bacteria 1834
1875 Ga0500641_0003846 3300053096 Bacteria 5306
1876 Ga0500641_0006701 3300053096 Bacteria 4093
1877 Ga0500641_0025396 3300053096 Bacteria 2291
1878 Ga0500641_0060461 3300053096 Bacteria 1576
1879 Ga0500650_0002825 3300053098 Bacteria 5854
1880 Ga0500554_003367 3300053102 Bacteria 3265
1881 Ga0500554_015669 3300053102 Bacteria 1986
1882 Ga0500556_0000004 3300053104 Bacteria 666287
1883 Ga0500556_0001973 3300053104 Bacteria 7240
1884 Ga0500556_0016734 3300053104 Bacteria 2285
1885 Ga0500557_000004 3300053105 Bacteria 202318
1886 Ga0500562_007827 3300053108 Bacteria 2697
1887 Ga0500569_010111 3300053109 Bacteria 2211
1888 Ga0500572_000070 3300053111 Bacteria 32133
1889 Ga0500572_000148 3300053111 Bacteria 24267
1890 Ga0500572_000326 3300053111 Bacteria 17035
1891 Ga0500572_000505 3300053111 Bacteria 13397
1892 Ga0500595_000152 3300053119 Bacteria 45452
1893 Ga0500595_000480 3300053119 Bacteria 24621
1894 Ga0500595_000735 3300053119 Bacteria 19469
1895 Ga0500595_000759 3300053119 Bacteria 18981
1896 Ga0500595_001524 3300053119 Bacteria 12298
1897 Ga0500595_001714 3300053119 Bacteria 11446
1898 Ga0500595_004779 3300053119 Bacteria 6002
1899 Ga0500595_006746 3300053119 Bacteria 4840
1900 Ga0500608_001229 3300053122 Bacteria 9146
1901 Ga0500614_000329 3300053123 Bacteria 12280
1902 Ga0500614_003149 3300053123 Bacteria 3576
1903 Ga0500614_003281 3300053123 Bacteria 3498
1904 Ga0500642_0000173 3300053130 Bacteria 26732
1905 Ga0500642_0000186 3300053130 Bacteria 25633
1906 Ga0500642_0018753 3300053130 Bacteria 2684
1907 Ga0500642_0044404 3300053130 Bacteria 1935
1908 Ga0500652_011396 3300053131 Bacteria 3078
1909 Ga0500559_0000081 3300053136 Bacteria 75262
1910 Ga0500559_0002268 3300053136 Bacteria 10160
1911 Ga0500559_0008102 3300053136 Bacteria 4622
1912 Ga0500564_032900 3300053138 Bacteria 2392
1913 Ga0500564_065104 3300053138 Bacteria 1650
1914 Ga0500568_0001430 3300053139 Bacteria 15482
1915 Ga0500568_0036451 3300053139 Bacteria 2001
1916 Ga0500577_0000153 3300053142 Bacteria 17131
1917 Ga0500577_0038254 3300053142 Bacteria 1731
1918 Ga0500589_011534 3300053147 Bacteria 3829
1919 Ga0500590_077293 3300053148 Bacteria 1642
1920 Ga0500603_000175 3300053150 Bacteria 16391
1921 Ga0500603_000352 3300053150 Bacteria 12039
1922 Ga0500603_000754 3300053150 Bacteria 7829
1923 Ga0500603_000885 3300053150 Bacteria 7123
1924 Ga0500603_023189 3300053150 Bacteria 1543
1925 Ga0500604_0002499 3300053151 Bacteria 5013
1926 Ga0500604_0010784 3300053151 Bacteria 2448
1927 Ga0500616_0000014 3300053153 Bacteria 637918
1928 Ga0500616_0000372 3300053153 Bacteria 62890
1929 Ga0500619_021446 3300053154 Bacteria 1861
1930 Ga0500619_031021 3300053154 Bacteria 1628
1931 Ga0500620_003626 3300053155 Bacteria 3331
1932 Ga0500620_004101 3300053155 Bacteria 3209
1933 Ga0500622_0000513 3300053156 Bacteria 35999
1934 Ga0500622_0080217 3300053156 Bacteria 1635
1935 Ga0500627_0057982 3300053158 Bacteria 1700
1936 Ga0500630_000849 3300053159 Bacteria 14175
1937 Ga0500633_0009242 3300053160 Bacteria 2583
1938 Ga0500634_0075667 3300053161 Bacteria 1750
1939 Ga0500638_000086 3300053162 Bacteria 16892
1940 Ga0500638_000252 3300053162 Bacteria 11670
1941 Ga0500638_051842 3300053162 Bacteria 1983
1942 Ga0500639_000199 3300053163 Bacteria 29793
1943 Ga0500639_000545 3300053163 Bacteria 18833
1944 Ga0500639_007542 3300053163 Bacteria 5652
1945 Ga0500636_0000122 3300053177 Bacteria 40577
1946 Ga0500636_0001016 3300053177 Bacteria 15031
1947 Ga0500636_0071295 3300053177 Bacteria 2014
1948 Ga0500636_0074876 3300053177 Bacteria 1959
1949 Ga0500636_0127047 3300053177 Bacteria 1424
1950 Ga0500637_0000142 3300053178 Bacteria 26117
1951 Ga0500637_0001163 3300053178 Bacteria 10930
1952 Ga0500637_0005306 3300053178 Bacteria 6228
1953 Ga0500637_0009759 3300053178 Bacteria 4900
1954 Ga0500637_0057366 3300053178 Bacteria 2226
1955 Ga0500637_0078172 3300053178 Bacteria 1909
1956 Ga0500625_007714 3300053729 Bacteria 4698
1957 Ga0500625_014344 3300053729 Bacteria 3659
1958 Ga0500645_008570 3300053730 Bacteria 3484
1959 Ga0500645_021765 3300053730 Bacteria 1976
1960 Ga0500596_000198 3300053735 Bacteria 9955
1961 Ga0500596_003453 3300053735 Bacteria 3002
1962 Ga0500601_000050 3300053737 Bacteria 24752
1963 Ga0500601_000509 3300053737 Bacteria 5981
1964 Ga0501084_0014689 3300054114 Bacteria 6493
1965 Ga0501084_0045232 3300054114 Bacteria 3686
1966 Ga0501084_0109964 3300054114 Bacteria 2316
1967 Ga0501084_0325820 3300054114 Bacteria 1297
1968 Ga0500661_000398 3300055283 Bacteria 8059
1969 Ga0500661_001246 3300055283 Bacteria 4759
1970 Ga0500661_007104 3300055283 Bacteria 2076
1971 Ga0587070_010389 3300059491 Bacteria 1371
1972 Ga0501082_0000965 3300060353 Bacteria 25410
1973 Ga0501082_0018584 3300060353 Bacteria 5991
1974 8016591556 8016583857 Bacteria 10421953
1975 2507508416 2507262055 Bacteria 8048963
1976 2507508430 2507262055 Bacteria 8048963
1977 2508542483 2508501009 Bacteria 7784016
1978 2508542498 2508501009 Bacteria 7784016
1979 2508691729 2508501042 Bacteria 8719808
1980 2508691743 2508501042 Bacteria 8719808
1981 2509150525 2508501128 Bacteria 8613869
1982 2509150550 2508501128 Bacteria 8613869
1983 2511394186 2511231028 Bacteria 8046582
1984 2511400721 2511231028 Bacteria 8046582
1985 2513625537 2513237092 Bacteria 8341956
1986 2513625552 2513237092 Bacteria 8341956
1987 2513644464 2513237094 Bacteria 8789602
1988 2513644478 2513237094 Bacteria 8789602
1989 2513645670 2513237095 Bacteria 8976980
1990 2513645687 2513237095 Bacteria 8976980
1991 2513655082 2513237096 Bacteria 8722461
1992 2513657100 2513237096 Bacteria 8722461
1993 2513658003 2513237096 Bacteria 8722461
1994 2513658023 2513237096 Bacteria 8722461
1995 2513676090 2513237098 Bacteria 9902361
1996 2513676108 2513237098 Bacteria 9902361
1997 2513692719 2513237101 Bacteria 7952346
1998 2513692737 2513237101 Bacteria 7952346
1999 2513701113 2513237102 Bacteria 7703324
2000 2513701127 2513237102 Bacteria 7703324
2001 2513717135 2513237104 Bacteria 10034502
2002 2513717148 2513237104 Bacteria 10034502
2003 2513855542 2513237137 Bacteria 9558895
2004 2513855705 2513237137 Bacteria 9558895
2005 2513855727 2513237137 Bacteria 9558895
2006 2513861105 2513237137 Bacteria 9558895
2007 2513872928 2513237139 Bacteria 8737671
2008 2513872942 2513237139 Bacteria 8737671
2009 2513893981 2513237141 Bacteria 8496279
2010 2513915895 2513237145 Bacteria 8979722
2011 2513918840 2513237145 Bacteria 8979722
2012 2513919883 2513237145 Bacteria 8979722
2013 2513919903 2513237145 Bacteria 8979722
2014 2513920424 2513237145 Bacteria 8979722
2015 2514013687 2513237161 Bacteria 8871253
2016 2514013702 2513237161 Bacteria 8871253
2017 2515627075 2515154112 Bacteria 8294334
2018 2515627091 2515154112 Bacteria 8294334
2019 2517107766 2517093001 Bacteria 9002274
2020 2517107781 2517093001 Bacteria 9002274
2021 2517892087 2517572143 Bacteria 9484767
2022 2517892244 2517572143 Bacteria 9484767
2023 2517892264 2517572143 Bacteria 9484767
2024 2517894800 2517572143 Bacteria 9484767
2025 2524437506 2524023205 Bacteria 8918781
2026 2524437522 2524023205 Bacteria 8918781
2027 2524465664 2524023210 Bacteria 9029266
2028 2524465682 2524023210 Bacteria 9029266
2029 2524534171 2524023228 Bacteria 10118060
2030 2524534554 2524023228 Bacteria 10118060
2031 2524540300 2524023228 Bacteria 10118060
2032 2524540321 2524023228 Bacteria 10118060
2033 2528852385 2528768022 Bacteria 10457665
2034 2528852400 2528768022 Bacteria 10457665
2035 2603859618 2602042107 Bacteria 6226103
2036 2603859619 2602042107 Bacteria 6226103
2037 2617347342 2617270735 Bacteria 9163226
2038 2617347356 2617270735 Bacteria 9163226
2039 2617375575 2617270741 Bacteria 8201522
2040 2617375590 2617270741 Bacteria 8201522
2041 2644288819 2643221651 Bacteria 4798932
2042 2671120488 2667528175 Bacteria 7532676
2043 2671120508 2667528175 Bacteria 7532676
2044 2671121875 2667528175 Bacteria 7532676
2045 2723844884 2721755755 Bacteria 8322773
2046 2723844901 2721755755 Bacteria 8322773
2047 2728747401 2728368998 Bacteria 8720350
2048 2728753301 2728368998 Bacteria 8720350
2049 2745076486 2744054633 Bacteria 8678936
2050 2745076502 2744054633 Bacteria 8678936
2051 2793065422 2791355196 Bacteria 7323613
2052 2793065436 2791355196 Bacteria 7323613
2053 2793068828 2791355197 Bacteria 8420563
2054 2793072395 2791355197 Bacteria 8420563
2055 2793072415 2791355197 Bacteria 8420563
2056 2793082228
2057 2793082245
2058 2805915160 2802429603 Bacteria 8777136
2059 2805915174 2802429603 Bacteria 8777136
2060 2818238713 2816332527 Bacteria 8933356
2061 2818238732 2816332527 Bacteria 8933356
2062 2824604043 2824600985 Bacteria 8488197
2063 2824608164 2824600985 Bacteria 8488197
2064 2824610297 2824609381 Bacteria 8672835
2065 2824610312 2824609381 Bacteria 8672835
2066 2824617890 2824617872 Bacteria 8814715
2067 2824617905 2824617872 Bacteria 8814715
2068 2824626573 2824626560 Bacteria 8813858
2069 2824634355 2824626560 Bacteria 8813858
2070 2824638590 2824635225 Bacteria 8785348
2071 2824643472 2824635225 Bacteria 8785348
2072 2824646058 2824644064 Bacteria 8743947
2073 2824649706 2824644064 Bacteria 8743947
2074 2824658047 2824653114 Bacteria 8493680
2075 2824661154 2824653114 Bacteria 8493680
2076 2824668332 2824661429 Bacteria 9877870
2077 2824669299 2824661429 Bacteria 9877870
2078 2824676871 2824671348 Bacteria 8369588
2079 2824678704 2824671348 Bacteria 8369588
2080 2824684508 2824679649 Bacteria 8248951
2081 2824685182 2824679649 Bacteria 8248951
2082 2824693178 2824687955 Bacteria 8360029
2083 2824695164 2824687955 Bacteria 8360029
2084 2824701479 2824696289 Bacteria 8335049
2085 2824701810 2824696289 Bacteria 8335049
2086 2824708999 2824704595 Bacteria 9667483
2087 2824709046 2824704595 Bacteria 9667483
2088 2824716244 2824714736 Bacteria 8717648
2089 2824722334 2824714736 Bacteria 8717648
2090 2824726543 2824723954 Bacteria 8758240
2091 2824731957 2824723954 Bacteria 8758240
2092 2824735269 2824732956 Bacteria 7810675
2093 2824735284 2824732956 Bacteria 7810675
2094 2824746616 2824746037 Bacteria 7911610
2095 2824752346 2824746037 Bacteria 7911610
2096 2824759581 2824753945 Bacteria 9787441
2097 2824761808 2824753945 Bacteria 9787441
2098 2824770001 2824763712 Bacteria 9792355
2099 2824770016 2824763712 Bacteria 9792355
2100 2824775467 2824773399 Bacteria 8360218
2101 2824780895 2824773399 Bacteria 8360218
2102 2838123566 2838122688 Bacteria 8803140
2103 2838123581 2838122688 Bacteria 8803140
2104 2841946775 2841941048 Bacteria 8688029
2105 2841946789 2841941048 Bacteria 8688029
2106 2841949666 2841949485 Bacteria 8680857
2107 2841949681 2841949485 Bacteria 8680857
2108 2841958817 2841957949 Bacteria 8652217
2109 2841958833 2841957949 Bacteria 8652217
2110 2841971812 2841966195 Bacteria 8673214
2111 2841971827 2841966195 Bacteria 8673214
2112 2841974827 2841974524 Bacteria 8931498
2113 2841974843 2841974524 Bacteria 8931498
2114 2841983596 2841983080 Bacteria 8395090
2115 2841983611 2841983080 Bacteria 8395090
2116 2842038885 2842038055 Bacteria 8002051
2117 2842038901 2842038055 Bacteria 8002051
2118 2842048153 2842045827 Bacteria 8006841
2119 2842048169 2842045827 Bacteria 8006841
2120 2842340784 2842333319 Bacteria 8899485
2121 2844319225 2844315083 Bacteria 8138177
2122 2844319239 2844315083 Bacteria 8138177
2123 2847936377 2847930680 Bacteria 9342022
2124 2847936392 2847930680 Bacteria 9342022
2125 2847946727 2847939898 Bacteria 8606328
2126 2847946741 2847939898 Bacteria 8606328
2127 2849079141 2849076700 Bacteria 7039503
2128 2849079156 2849076700 Bacteria 7039503
2129 2857514127 2857509624 Bacteria 7472071
2130 2857514143 2857509624 Bacteria 7472071
2131 2857528974 2857524615 Bacteria 6615449
2132 2857528975 2857524615 Bacteria 6615449
2133 2874598205 2874590934 Bacteria 8299676
2134 2874598220 2874590934 Bacteria 8299676
2135 2874605378 2874604998 Bacteria 7834745
2136 2874605396 2874604998 Bacteria 7834745
2137 2874615081 2874612657 Bacteria 8252029
2138 2874615098 2874612657 Bacteria 8252029
2139 2874627666 2874620515 Bacteria 8290088
2140 2874627682 2874620515 Bacteria 8290088
2141 2874632016 2874628541 Bacteria 8630250
2142 2874632030 2874628541 Bacteria 8630250
2143 2874652723 2874645413 Bacteria 8214782
2144 2874652738 2874645413 Bacteria 8214782
2145 2876764674 2876761206 Bacteria 10111113
2146 2876764691 2876761206 Bacteria 10111113
2147 2876778302 2876771140 Bacteria 8287509
2148 2876778317 2876771140 Bacteria 8287509
2149 2876809905 2876808645 Bacteria 8824342
2150 2876825814 2876818435 Bacteria 8274608
2151 2876825829 2876818435 Bacteria 8274608
2152 2879082096 2879074833 Bacteria 8279565
2153 2879082111 2879074833 Bacteria 8279565
2154 2879090175 2879083081 Bacteria 8587928
2155 2879090548 2879083081 Bacteria 8587928
2156 2879105730 2879099564 Bacteria 10442239
2157 2879105745 2879099564 Bacteria 10442239
2158 2879110199 2879110137 Bacteria 8907982
2159 2879110218 2879110137 Bacteria 8907982
2160 2879135258 2879127579 Bacteria 8294491
2161 2879150467 2879142872 Bacteria 8267021
2162 2881368667 2881364244 Bacteria 7710352
2163 2881368681 2881364244 Bacteria 7710352
2164 2881673506 2881665667 Bacteria 8175609
2165 2881673522 2881665667 Bacteria 8175609
2166 2885372988 2885366525 Bacteria 8326213
2167 2885373003 2885366525 Bacteria 8326213
2168 2885379555 2885374607 Bacteria 8927485
2169 2885381721 2885374607 Bacteria 8927485
2170 2885381927 2885374607 Bacteria 8927485
2171 2885389913 2885383462 Bacteria 9473874
2172 2885389999 2885383462 Bacteria 9473874
2173 2885411340 2885409591 Bacteria 9235467
2174 2885411447 2885409591 Bacteria 9235467
2175 2888384222 2888378607 Bacteria 9652610
2176 2888384239 2888378607 Bacteria 9652610
2177 2888393634 2888388044 Bacteria 7304136
2178 2888393648 2888388044 Bacteria 7304136
2179 2888424698 2888419890 Bacteria 7857137
2180 2888424713 2888419890 Bacteria 7857137
2181 2889039650 2889033259 Bacteria 9099371
2182 2889039670 2889033259 Bacteria 9099371
2183 2893070431 2893066018 Bacteria 6158120
2184 2893070432 2893066018 Bacteria 6158120
2185 2903731067 2903727486 Bacteria 8281579
2186 2903731081 2903727486 Bacteria 8281579
2187 2903749168 2903748898 Bacteria 9972761
2188 2903753399 2903748898 Bacteria 9972761
2189 2903755251 2903748898 Bacteria 9972761
2190 2903772426 2903768456 Bacteria 9749579
2191 2903776948 2903768456 Bacteria 9749579
2192 2904672998 2904666416 Bacteria 8226587
2193 2904673014 2904666416 Bacteria 8226587
2194 2904694604 2904690495 Bacteria 9412302
2195 2904694621 2904690495 Bacteria 9412302
2196 2904694847 2904690495 Bacteria 9412302
2197 2904697785 2904690495 Bacteria 9412302
2198 2904702207
2199 2904702402
2200 2904702431
2201 2904705945
2202 2904714826 2904711408 Bacteria 9771557
2203 2904714841 2904711408 Bacteria 9771557
2204 2906607412 2906602504 Bacteria 8295279
2205 2906607426 2906602504 Bacteria 8295279
2206 2906617217
2207 2906618759
2208 2906618775
2209 2906626961 2906626472 Bacteria 8826946
2210 2906629729 2906626472 Bacteria 8826946
2211 2906638088 2906635258 Bacteria 8601019
2212 2906642437 2906635258 Bacteria 8601019
2213 2906643124 2906635258 Bacteria 8601019
2214 2906643393 2906635258 Bacteria 8601019
2215 2906649011 2906643746 Bacteria 8722424
2216 2906649025 2906643746 Bacteria 8722424
2217 2906660744 2906660503 Bacteria 8595048
2218 2906662476 2906660503 Bacteria 8595048
2219 2906666216 2906660503 Bacteria 8595048
2220 2906666238 2906660503 Bacteria 8595048
2221 2908742367 2908739725 Bacteria 8628932
2222 2908742524 2908739725 Bacteria 8628932
2223 2908742548 2908739725 Bacteria 8628932
2224 2908757119 2908756301 Bacteria 8864324
2225 2908760011 2908756301 Bacteria 8864324
2226 2908760159 2908756301 Bacteria 8864324
2227 2908760176 2908756301 Bacteria 8864324
2228 2908780343 2908775508 Bacteria 8092255
2229 2908780359 2908775508 Bacteria 8092255
2230 2919076373 2919073203 Bacteria 6531949
2231 2919076374 2919073203 Bacteria 6531949
2232 2922365521 2922361189 Bacteria 7436256
2233 2922365541 2922361189 Bacteria 7436256
2234 2922365655 2922361189 Bacteria 7436256
2235 2922374571
2236 2922374586
2237 2922391147 2922386360 Bacteria 7017218
2238 2922391164 2922386360 Bacteria 7017218
2239 2922400628 2922393267 Bacteria 8285685
2240 2922400643 2922393267 Bacteria 8285685
2241 2922430429
2242 2922430454
2243 2922430611
2244 2929618236 2929615660 Bacteria 9193770
2245 2929618251 2929615660 Bacteria 9193770
2246 2929632424 2929624759 Bacteria 9339455
2247 2929632439 2929624759 Bacteria 9339455
2248 2932790530 2932784394 Bacteria 9704911
2249 2932790545 2932784394 Bacteria 9704911
2250 2932799777 2932794094 Bacteria 7915132
2251 2932799791 2932794094 Bacteria 7915132
2252 2932801095 2932794094 Bacteria 7915132
2253 2932806958 2932801729 Bacteria 7987968
2254 2932806972 2932801729 Bacteria 7987968
2255 2932810951 2932809354 Bacteria 9135765
2256 2932810966 2932809354 Bacteria 9135765
2257 2932823704 2932818245 Bacteria 9955613
2258 2932823719 2932818245 Bacteria 9955613
2259 2932830161 2932828146 Bacteria 9745859
2260 2932830176 2932828146 Bacteria 9745859
2261 2933580164 2933577622 Bacteria 9116884
2262 2933580179 2933577622 Bacteria 9116884
2263 2935609030 2935608549 Bacteria 8203142
2264 2935609044 2935608549 Bacteria 8203142
2265 2935622598 2935616580 Bacteria 9032984
2266 2935622613 2935616580 Bacteria 9032984
2267 2935631224 2935630451 Bacteria 8169952
2268 2935631514 2935630451 Bacteria 8169952
2269 2935631536 2935630451 Bacteria 8169952
2270 2935642587 2935638405 Bacteria 10015038
2271 2935642602 2935638405 Bacteria 10015038
2272 2935653247 2935648319 Bacteria 8801166
2273 2935653262 2935648319 Bacteria 8801166
2274 2935660267 2935656913 Bacteria 8965014
2275 2935660434 2935656913 Bacteria 8965014
2276 2935668094 2935665750 Bacteria 9571747
2277 2935668109 2935665750 Bacteria 9571747
2278 2935676127 2935675223 Bacteria 9928132
2279 2935676142 2935675223 Bacteria 9928132
2280 2935686111 2935684952 Bacteria 9590419
2281 2935686126 2935684952 Bacteria 9590419
2282 2935701248 2935694250 Bacteria 9291695
2283 2935701263 2935694250 Bacteria 9291695
2284 2935705954 2935703347 Bacteria 10242284
2285 2935705969 2935703347 Bacteria 10242284
2286 2935714663 2935713505 Bacteria 9608509
2287 2935714678 2935713505 Bacteria 9608509
2288 2935725282 2935722832 Bacteria 9608746
2289 2935725297 2935722832 Bacteria 9608746
2290 2935732343 2935732158 Bacteria 9706831
2291 2935732358 2935732158 Bacteria 9706831
2292 2935741722 2935741537 Bacteria 9707219
2293 2935741737 2935741537 Bacteria 9707219
2294 2935752076 2935750917 Bacteria 9590372
2295 2935752091 2935750917 Bacteria 9590372
2296 2935766424 2935760218 Bacteria 9817913
2297 2935766439 2935760218 Bacteria 9817913
2298 2935771867 2935769743 Bacteria 7878163
2299 2935771887 2935769743 Bacteria 7878163
2300 2935778681 2935777560 Bacteria 8077691
2301 2935778696 2935777560 Bacteria 8077691
2302 2935788918 2935785616 Bacteria 7962367
2303 2935788933 2935785616 Bacteria 7962367
2304 2935795267 2935793552 Bacteria 8012592
2305 2935795282 2935793552 Bacteria 8012592
2306 2935802953 2935801545 Bacteria 9301974
2307 2935802968 2935801545 Bacteria 9301974
2308 2935814270 2935810662 Bacteria 9401221
2309 2935814285 2935810662 Bacteria 9401221
2310 2935822190 2935819856 Bacteria 8261050
2311 2935822204 2935819856 Bacteria 8261050
2312 2935831407 2935827899 Bacteria 10038562
2313 2935831422 2935827899 Bacteria 10038562
2314 2935838267 2935837841 Bacteria 9454360
2315 2935838282 2935837841 Bacteria 9454360
2316 2935847772 2935847175 Bacteria 8228321
2317 2935847786 2935847175 Bacteria 8228321
2318 2935860847 2935855204 Bacteria 9035059
2319 2935860862 2935855204 Bacteria 9035059
2320 2935869801 2935864058 Bacteria 9784707
2321 2935869816 2935864058 Bacteria 9784707
2322 2935878765 2935873716 Bacteria 9632195
2323 2935878780 2935873716 Bacteria 9632195
2324 2935886904 2935883170 Bacteria 7964738
2325 2935886918 2935883170 Bacteria 7964738
2326 2935908941 2935908558 Bacteria 8568796
2327 2935908956 2935908558 Bacteria 8568796
2328 2935919659 2935916978 Bacteria 9113783
2329 2935919674 2935916978 Bacteria 9113783
2330 2935926470 2935926038 Bacteria 8601059
2331 2935926485 2935926038 Bacteria 8601059
2332 2935934920 2935934488 Bacteria 8602579
2333 2935934935 2935934488 Bacteria 8602579
2334 2935943370 2935942939 Bacteria 8599779
2335 2935943385 2935942939 Bacteria 8599779
2336 2935951808 2935951376 Bacteria 8602333
2337 2935951823 2935951376 Bacteria 8602333
2338 2935960569 2935959822 Bacteria 7869783
2339 2935960584 2935959822 Bacteria 7869783
2340 2935967933 2935967501 Bacteria 8603075
2341 2935967948 2935967501 Bacteria 8603075
2342 2935978558 2935975950 Bacteria 8347125
2343 2935978573 2935975950 Bacteria 8347125
2344 2935987573 2935984226 Bacteria 8302647
2345 2935991274 2935984226 Bacteria 8302647
2346 2935994824 2935992306 Bacteria 9802711
2347 2935994839 2935992306 Bacteria 9802711
2348 2936003466 2936002035 Bacteria 9362176
2349 2936003481 2936002035 Bacteria 9362176
2350 2936016117 2936011229 Bacteria 8801034
2351 2936016132 2936011229 Bacteria 8801034
2352 2936024750 2936019824 Bacteria 8804134
2353 2936024765 2936019824 Bacteria 8804134
2354 2936031846 2936028420 Bacteria 8965941
2355 2936032013 2936028420 Bacteria 8965941
2356 2936039826 2936037263 Bacteria 9446081
2357 2936039841 2936037263 Bacteria 9446081
2358 2936049707 2936046547 Bacteria 8903709
2359 2936049874 2936046547 Bacteria 8903709
2360 2936060811 2936055302 Bacteria 8785755
2361 2936060826 2936055302 Bacteria 8785755
2362 2940557106 2940556831 Bacteria 9590747
2363 2940557121 2940556831 Bacteria 9590747
2364 2941509965 2941507105 Bacteria 8166816
2365 2941511308 2941507105 Bacteria 8166816
2366 2941511330 2941507105 Bacteria 8166816
2367 2941518948 2941515067 Bacteria 8166720
2368 2941519009 2941515067 Bacteria 8166720
2369 2941519031 2941515067 Bacteria 8166720
2370 2941525364 2941523033 Bacteria 8169134
2371 2941526389 2941523033 Bacteria 8169134
2372 2941526411 2941523033 Bacteria 8169134
2373 2941532980 2941531003 Bacteria 7653939
2374 2941532995 2941531003 Bacteria 7653939
2375 2941539050 2941538514 Bacteria 9402094
2376 2941539065 2941538514 Bacteria 9402094
2377 3005480343 3005474847 Bacteria 9259049
2378 3005480365 3005474847 Bacteria 9259049
2379 3005480522 3005474847 Bacteria 9259049
2380 3005484474 3005483717 Bacteria 7877331
2381 3005484489 3005483717 Bacteria 7877331
2382 3005510488 3005506211 Bacteria 6943378
2383 3005510504 3005506211 Bacteria 6943378
2384 3005587870 3005587118 Bacteria 7794411
2385 3005587886 3005587118 Bacteria 7794411
2386 3005599395 3005594810 Bacteria 8716512
2387 3005599409 3005594810 Bacteria 8716512
2388 3005715057 3005710791 Bacteria 7622528
2389 3005715067 3005710791 Bacteria 7622528
2390 3005722470 3005718088 Bacteria 8283608
2391 3005722484 3005718088 Bacteria 8283608
2392 8006929122 8006926726 Bacteria 6749210
2393 8006931876 8006926726 Bacteria 6749210
2394 8006933688 8006933436 Bacteria 10410654
2395 8006940254 8006933436 Bacteria 10410654
2396 8006940509 8006933436 Bacteria 10410654
2397 8006940533 8006933436 Bacteria 10410654
2398 8006967134 8006964411 Bacteria 8966052
2399 8006967153 8006964411 Bacteria 8966052
2400 8006980032 8006973647 Bacteria 10679141
2401 8006980197 8006973647 Bacteria 10679141
2402 8006980222 8006973647 Bacteria 10679141
2403 8006983360 8006973647 Bacteria 10679141
2404 8006986567 8006984368 Bacteria 9651211
2405 8006986585 8006984368 Bacteria 9651211
2406 8006995830 8006994254 Bacteria 8309700
2407 8006995849 8006994254 Bacteria 8309700
2408 8016522134 8016511872 Bacteria 9921665
2409 8016529459 8016522445 Bacteria 8156687
2410 8016534670 8016530956 Bacteria 8155261
2411 8016547873 8016539877 Bacteria 8155419
2412 8016547888 8016539877 Bacteria 8155419
2413 8016554245 8016548790 Bacteria 8155074
2414 8016554261 8016548790 Bacteria 8155074
2415 8016562618 8016557553 Bacteria 8154380
2416 8016562635 8016557553 Bacteria 8154380
2417 8016577151 8016575299 Bacteria 8154085
2418 8016577166 8016575299 Bacteria 8154085
2419 8016600404 8016595262 Bacteria 8149947
2420 8016600419 8016595262 Bacteria 8149947
2421 8016610319 8016603502 Bacteria 8731218
2422 8016610334 8016603502 Bacteria 8731218
2423 8016614596 8016613128 Bacteria 8794220
2424 8016614612 8016613128 Bacteria 8794220
2425 8016626386 8016622563 Bacteria 7999408
2426 8016626403 8016622563 Bacteria 7999408
2427 8016640145 8016630954 Bacteria 9217207
2428 8016640162 8016630954 Bacteria 9217207
2429 8017063519 8017057580 Bacteria 10023680
2430 8017063535 8017057580 Bacteria 10023680
2431 8019534419 8019530166 Bacteria 8155624
2432 8019534435 8019530166 Bacteria 8155624
2433 8019537115 8019530166 Bacteria 8155624
2434 8019545034 8019538911 Bacteria 7872763
2435 8019545050 8019538911 Bacteria 7872763
2436 8019553477 8019547302 Bacteria 7996444
2437 8019556581 8019555841 Bacteria 9642137
2438 8019556599 8019555841 Bacteria 9642137
2439 8019568709 8019565922 Bacteria 9639779
2440 8019568725 8019565922 Bacteria 9639779
2441 8019569072 8019565922 Bacteria 9639779
2442 8019582839 8019576017 Bacteria 10049540
2443 8019582854 8019576017 Bacteria 10049540
2444 8019590633 8019586578 Bacteria 10212056
2445 8019590648 8019586578 Bacteria 10212056
2446 8019600705 8019597564 Bacteria 10041141
2447 8019600721 8019597564 Bacteria 10041141
2448 8019617829 8019608314 Bacteria 10042931
2449 8019617845 8019608314 Bacteria 10042931
2450 8019628358 8019619141 Bacteria 9218857
2451 8019645447 8019638758 Bacteria 9062356
2452 8019645463 8019638758 Bacteria 9062356
2453 8019658562 8019648815 Bacteria 10014479
2454 8019662147 8019659431 Bacteria 8577854
2455 8019662162 8019659431 Bacteria 8577854
2456 8019671662 8019668869 Bacteria 8791617
2457 8019671679 8019668869 Bacteria 8791617
2458 8019684419 8019678201 Bacteria 8863603
2459 8019684437 8019678201 Bacteria 8863603
2460 8019690231 8019687851 Bacteria 8712826
2461 8019690247 8019687851 Bacteria 8712826
2462 8054566151 8054563764 Bacteria 5592885
2463 8055746160 8055742211 Bacteria 9226248
2464 8055746175 8055742211 Bacteria 9226248
2465 8056673668 8056673599 Bacteria 7871253
2466 8056673687 8056673599 Bacteria 7871253
2467 8056686773 8056681323 Bacteria 8472857
2468 8056686796 8056681323 Bacteria 8472857
2469 8056691352 8056689827 Bacteria 6712655
2470 8056691370 8056689827 Bacteria 6712655
2471 8056694260 8056689827 Bacteria 6712655
2472 8056695216 8056689827 Bacteria 6712655
2473 8056968185 8056967851 Bacteria 9038162
2474 8056968200 8056967851 Bacteria 9038162
2475 JGI24736J21556_1003744
2476 JGI24740J21852_10013130
2477 JGI24739J22299_10002406
2478 JGI24737J22298_10002958
2479 JGI24735J21928_10030063
2480 JGI24738J21930_10010688
2481 JGI25406J46586_10000018
2482 JGI25406J46586_10000047
2483 JGI25406J46586_10000078
2484 JGI25406J46586_10011634
2485 JGI25406J46586_10015609
2486 JGI25153J46596_10000767
2487 JGI25153J46596_10003048
2488 JGI25153J46596_10006696
2489 JGI25153J46596_10009098
2490 JGI25153J46596_10011019
2491 JGI25153J46596_10012096
2492 JGI25153J46596_10030267
2493 JGI25153J46596_10031973
2494 JGI25153J46596_10037987
2495 rootH1_10038628
2496 JGI25160J50197_1000847
2497 JGI25160J50197_1001193
2498 JGI25160J50197_1001218
2499 JGI25160J50197_1004453
2500 JGI25160J50197_1004825
2501 JGI25160J50197_1028395
2502 JGI25404J52841_10007069
2503 JGI25404J52841_10011788
2504 JGI25404J52841_10016974
2505 Ga0055531_10007226
2506 Ga0055543_1005693
2507 Ga0065165_1000348
2508 Ga0065165_1001524
2509 Ga0065165_1003137
2510 Ga0065165_1003351
2511 Ga0065165_1010602
2512 Ga0065165_1011649
2513 Ga0065165_1020475
2514 Ga0065165_1039787
2515 Ga0065715_10099425
2516 Ga0065715_10143551
2517 Ga0065707_10013358
2518 Ga0070683_100011949
2519 Ga0070690_100087730
2520 Ga0070670_100104274
2521 Ga0070677_10003948
2522 Ga0068869_100001877
2523 Ga0068869_100019670
2524 Ga0068869_100078244
2525 Ga0068869_100086684
2526 Ga0068869_100217356
2527 Ga0070666_10156910
2528 Ga0070680_100001711
2529 Ga0070680_100018006
2530 Ga0070680_100026234
2531 Ga0070680_100029010
2532 Ga0070680_100043257
2533 Ga0070680_100049897
2534 Ga0070680_100086668
2535 Ga0070680_100134802
2536 Ga0070682_100015659
2537 Ga0070682_100039303
2538 Ga0068868_100014107
2539 Ga0068868_100015336
2540 Ga0068868_100025540
2541 Ga0070660_100000724
2542 Ga0070660_100109780
2543 Ga0070660_100120710
2544 Ga0070660_100226163
2545 Ga0070660_100266697
2546 Ga0070689_100090135
2547 Ga0070689_100188949
2548 Ga0070691_10078724
2549 Ga0070661_100019484
2550 Ga0070661_100051071
2551 Ga0070668_100019213
2552 Ga0070668_100095175
2553 Ga0070668_100169920
2554 Ga0070668_100192764
2555 Ga0070675_100128068
2556 Ga0070671_100023164
2557 Ga0070671_100045047
2558 Ga0070674_100120886
2559 Ga0070674_100143937
2560 Ga0070688_100023196
2561 Ga0070688_100048956
2562 Ga0070659_100002581
2563 Ga0070659_100009498
2564 Ga0070659_100026271
2565 Ga0070659_100055803
2566 Ga0070659_100079965
2567 Ga0070667_100099088
2568 Ga0070667_100183437
2569 Ga0070709_10004463
2570 Ga0070709_10005128
2571 Ga0070709_10008476
2572 Ga0070709_10037311
2573 Ga0070709_10082645
2574 Ga0070709_10084828
2575 Ga0070714_100001950
2576 Ga0070714_100009084
2577 Ga0070714_100033046
2578 Ga0070714_100040248
2579 Ga0070714_100055472
2580 Ga0070714_100063580
2581 Ga0070714_100171348
2582 Ga0070714_100214858
2583 Ga0070713_100015728
2584 Ga0070713_100036242
2585 Ga0070713_100094317
2586 Ga0070713_100160266
2587 Ga0070713_100165992
2588 Ga0070713_100178753
2589 Ga0070710_10001928
2590 Ga0070710_10006419
2591 Ga0070710_10023896
2592 Ga0070710_10044123
2593 Ga0070710_10114129
2594 Ga0070701_10055284
2595 Ga0070701_10059601
2596 Ga0070711_100000566
2597 Ga0070711_100004427
2598 Ga0070711_100004672
2599 Ga0070711_100004805
2600 Ga0070711_100010118
2601 Ga0070711_100039439
2602 Ga0070700_100084101
2603 Ga0070700_100095059
2604 Ga0070700_100143850
2605 Ga0070708_100003380
2606 Ga0070708_100029812
2607 Ga0070708_100043098
2608 Ga0070708_100249120
2609 Ga0070663_100005434
2610 Ga0070663_100023049
2611 Ga0070663_100025725
2612 Ga0070663_100061701
2613 Ga0070663_100080927
2614 Ga0070663_100083288
2615 Ga0070663_100100599
2616 Ga0070663_100206390
2617 Ga0070678_100016197
2618 Ga0070678_100086598
2619 Ga0070678_100146943
2620 Ga0070678_100171935
2621 Ga0070678_100180985
2622 Ga0070662_100010579
2623 Ga0070681_10005696
2624 Ga0070681_10042460
2625 Ga0070681_10054701
2626 Ga0070681_10075588
2627 Ga0070681_10136004
2628 Ga0070681_10149222
2629 Ga0070681_10160678
2630 Ga0070681_10212702
2631 Ga0068867_100052680
2632 Ga0070685_10146011
2633 Ga0070706_100006190
2634 Ga0070706_100074414
2635 Ga0070707_100001543
2636 Ga0070707_100001868
2637 Ga0070707_100090611
2638 Ga0070698_100006229
2639 Ga0070698_100174065
2640 Ga0070699_100002671
2641 Ga0070699_100018233
2642 Ga0070679_100003053
2643 Ga0070679_100005756
2644 Ga0070679_100012175
2645 Ga0070679_100013007
2646 Ga0070679_100022370
2647 Ga0070679_100053055
2648 Ga0070679_100104357
2649 Ga0070679_100186692
2650 Ga0070679_100206005
2651 Ga0070684_100034917
2652 Ga0070684_100040713
2653 Ga0070684_100040868
2654 Ga0070684_100046980
2655 Ga0070684_100157478
2656 Ga0070697_100018950
2657 Ga0070697_100162013
2658 Ga0068853_100005841
2659 Ga0068853_100014456
2660 Ga0068853_100016544
2661 Ga0068853_100043255
2662 Ga0068853_100062551
2663 Ga0068853_100123466
2664 Ga0070672_100055148
2665 Ga0070672_100240481
2666 Ga0070696_100138420
2667 Ga0070693_100086592
2668 Ga0070665_100033305
2669 Ga0070665_100052425
2670 Ga0070665_100064957
2671 Ga0070665_100077795
2672 Ga0070665_100133383
2673 Ga0070665_100178559
2674 Ga0070665_100232028
2675 Ga0070665_100290544
2676 Ga0070665_100363408
2677 Ga0070704_100012912
2678 Ga0070704_100040512
2679 Ga0070704_100088145
2680 Ga0068855_100007720
2681 Ga0068855_100012186
2682 Ga0068855_100015651
2683 Ga0068855_100025903
2684 Ga0068855_100027404
2685 Ga0068855_100033743
2686 Ga0068855_100055016
2687 Ga0068855_100076921
2688 Ga0068855_100120242
2689 Ga0068855_100152792
2690 Ga0068855_100274524
2691 Ga0070664_100003967
2692 Ga0070664_100118752
2693 Ga0070664_100285662
2694 Ga0068857_100022565
2695 Ga0068857_100031478
2696 Ga0068857_100065118
2697 Ga0068857_100088899
2698 Ga0068857_100106543
2699 Ga0068857_100234053
2700 Ga0068854_100031940
2701 Ga0068854_100044708
2702 Ga0068854_100159820
2703 Ga0068856_100000197
2704 Ga0068856_100000535
2705 Ga0068856_100001185
2706 Ga0068856_100006599
2707 Ga0068856_100020287
2708 Ga0068856_100281841
2709 Ga0068856_100430281
2710 Ga0068852_100009344
2711 Ga0068852_100015291
2712 Ga0068852_100025264
2713 Ga0068852_100043131
2714 Ga0068852_100049908
2715 Ga0068852_100109115
2716 Ga0068852_100217465
2717 Ga0068852_100220431
2718 Ga0068852_100234016
2719 Ga0068859_100052906
2720 Ga0068859_100160203
2721 Ga0068859_100244868
2722 Ga0068859_100272312
2723 Ga0068864_100035170
2724 Ga0068864_100200244
2725 Ga0068864_100217014
2726 Ga0068864_100236581
2727 Ga0068866_10006508
2728 Ga0068866_10028243
2729 Ga0068861_100015012
2730 Ga0068861_100129684
2731 Ga0068851_10003594
2732 Ga0068851_10003991
2733 Ga0068851_10011381
2734 Ga0068863_100306665
2735 Ga0068858_100044329
2736 Ga0068858_100077486
2737 Ga0068858_100122486
2738 Ga0068858_100333229
2739 Ga0068860_100002461
2740 Ga0068860_100010373
2741 Ga0068860_100079139
2742 Ga0068862_100051983
2743 Ga0068862_100121209
2744 Ga0068862_100185231
2745 Ga0068862_100222708
2746 Ga0068862_100293704
2747 Ga0081455_10001796
2748 Ga0081455_10006892
2749 Ga0081455_10006941
2750 Ga0081455_10007694
2751 Ga0081455_10010171
2752 Ga0081455_10023773
2753 Ga0081455_10034950
2754 Ga0081455_10056843
2755 Ga0081455_10063680
2756 Ga0081455_10095415
2757 Ga0081455_10166935
2758 Ga0081455_10218283
2759 Ga0081538_10021648
2760 Ga0081538_10051228
2761 Ga0081540_1000430
2762 Ga0081540_1000979
2763 Ga0081540_1002120
2764 Ga0081540_1004076
2765 Ga0081540_1004971
2766 Ga0081540_1009134
2767 Ga0081540_1009393
2768 Ga0081540_1011445
2769 Ga0081540_1012053
2770 Ga0081540_1012218
2771 Ga0081540_1012797
2772 Ga0081540_1016805
2773 Ga0081540_1018169
2774 Ga0081540_1018760
2775 Ga0081540_1022988
2776 Ga0081540_1030591
2777 Ga0081540_1034249
2778 Ga0081540_1034270
2779 Ga0081540_1035864
2780 Ga0081540_1059102
2781 Ga0081540_1065898
2782 Ga0081539_10000003
2783 Ga0081539_10000140
2784 Ga0081539_10000273
2785 Ga0081539_10000423
2786 Ga0081539_10001457
2787 Ga0081539_10016652
2788 Ga0081539_10037373
2789 Ga0081539_10044785
2790 Ga0070717_10002238
2791 Ga0070717_10004040
2792 Ga0070717_10006817
2793 Ga0070717_10107879
2794 Ga0070717_10149515
2795 Ga0075365_10021616
2796 Ga0075365_10027419
2797 Ga0075365_10030380
2798 Ga0075365_10033601
2799 Ga0075365_10064340
2800 Ga0075365_10066431
2801 Ga0075365_10075469
2802 Ga0075365_10076083
2803 Ga0075365_10101918
2804 Ga0075365_10131483
2805 Ga0075365_10142797
2806 Ga0075365_10180367
2807 Ga0075365_10212801
2808 Ga0075368_10000258
2809 Ga0075368_10015526
2810 Ga0075368_10017178
2811 Ga0075368_10038842
2812 Ga0075368_10041672
2813 Ga0075368_10056194
2814 Ga0075363_100002988
2815 Ga0075363_100056792
2816 Ga0075363_100082840
2817 Ga0075364_10010235
2818 Ga0075364_10031243
2819 Ga0075364_10068592
2820 Ga0070715_10000273
2821 Ga0070715_10000384
2822 Ga0070716_100022330
2823 Ga0070716_100030811
2824 Ga0070712_100000721
2825 Ga0070712_100006564
2826 Ga0070712_100013148
2827 Ga0070712_100016629
2828 Ga0070712_100022457
2829 Ga0070712_100036232
2830 Ga0070712_100070119
2831 Ga0075367_10001631
2832 Ga0075367_10004888
2833 Ga0075367_10004919
2834 Ga0075367_10013998
2835 Ga0075367_10041096
2836 Ga0075367_10122777
2837 Ga0075369_10022486
2838 Ga0075369_10037855
2839 Ga0075369_10042989
2840 Ga0075369_10050537
2841 Ga0075369_10057775
2842 Ga0075366_10029384
2843 Ga0075366_10046116
2844 Ga0075366_10080724
2845 Ga0075366_10087436
2846 Ga0097621_100110600
2847 Ga0097621_100269548
2848 Ga0075370_10018963
2849 Ga0075370_10019487
2850 Ga0075370_10075597
2851 Ga0075370_10098650
2852 Ga0075428_100000643
2853 Ga0075428_100006057
2854 Ga0075428_100056741
2855 Ga0075428_100323286
2856 Ga0075430_100000052
2857 Ga0075430_100010397
2858 Ga0075430_100025544
2859 Ga0075430_100177411
2860 Ga0075431_100000441
2861 Ga0075431_100000802
2862 Ga0075431_100003541
2863 Ga0075431_100063661
2864 Ga0075431_100114539
2865 Ga0075431_100199693
2866 Ga0075431_100364748
2867 Ga0075433_10000633
2868 Ga0075433_10014960
2869 Ga0075433_10084163
2870 Ga0075433_10085821
2871 Ga0075433_10193242
2872 Ga0075433_10241491
2873 Ga0075434_100029033
2874 Ga0075434_100097215
2875 Ga0075434_100109276
2876 Ga0075434_100280969
2877 Ga0075429_100001562
2878 Ga0075429_100021707
2879 Ga0075429_100059216
2880 Ga0075429_100232329
2881 Ga0068865_100025011
2882 Ga0068865_100080168
2883 Ga0075436_100023912
2884 Ga0097620_100052905
2885 Ga0097620_100160199
2886 Ga0097620_100244881
2887 Ga0097620_100272308
2888 Ga0099824_1004403
2889 Ga0099824_1006748
2890 Ga0099824_1027442
2891 Ga0099822_1004857
2892 Ga0099822_1018335
2893 Ga0099823_1031333
2894 Ga0099823_1052075
2895 Ga0075435_100012560
2896 Ga0075435_100036737
2897 Ga0075435_100056799
2898 Ga0099794_10014454
2899 Ga0099794_10016781
2900 Ga0099794_10018817
2901 Ga0099795_10005356
2902 Ga0105240_10002078
2903 Ga0105240_10027569
2904 Ga0105240_10029263
2905 Ga0105240_10032127
2906 Ga0105240_10038351
2907 Ga0105240_10041521
2908 Ga0105240_10073858
2909 Ga0105240_10114272
2910 Ga0105240_10118520
2911 Ga0105240_10180331
2912 Ga0105240_10249402
2913 Ga0111539_10006916
2914 Ga0111539_10013178
2915 Ga0111539_10032630
2916 Ga0111539_10074229
2917 Ga0105245_10037871
2918 Ga0105245_10143359
2919 Ga0105245_10174669
2920 Ga0105245_10271600
2921 Ga0105247_10025745
2922 Ga0105247_10033351
2923 Ga0105247_10050897
2924 Ga0105247_10110734
2925 Ga0114129_10002725
2926 Ga0114129_10038145
2927 Ga0114129_10040031
2928 Ga0114129_10040610
2929 Ga0114129_10103836
2930 Ga0114129_10180769
2931 Ga0114129_10308898
2932 Ga0105243_10098942
2933 Ga0105243_10362515
2934 Ga0105241_10011171
2935 Ga0105241_10042448
2936 Ga0105241_10076695
2937 Ga0105248_10043613
2938 Ga0105248_10132194
2939 Ga0105248_10212164
2940 Ga0105237_10007647
2941 Ga0105237_10023507
2942 Ga0105237_10027425
2943 Ga0105237_10047336
2944 Ga0105237_10053351
2945 Ga0105237_10070520
2946 Ga0105237_10086279
2947 Ga0105237_10128445
2948 Ga0105237_10227803
2949 Ga0105238_10020769
2950 Ga0105238_10029110
2951 Ga0105238_10040037
2952 Ga0105238_10055590
2953 Ga0105238_10056096
2954 Ga0105238_10164509
2955 Ga0105238_10195133
2956 Ga0105238_10233232
2957 Ga0105249_10026667
2958 Ga0099796_10060610
2959 Ga0105239_10005426
2960 Ga0105239_10009271
2961 Ga0105239_10044848
2962 Ga0105239_10049782
2963 Ga0105239_10060186
2964 Ga0105239_10063610
2965 Ga0105239_10071911
2966 Ga0105239_10117803
2967 Ga0105239_10165128
2968 Ga0105239_10188796
2969 Ga0105239_10208529
2970 Ga0105239_10289133
2971 Ga0105239_10319652
2972 Ga0105246_10003677
2973 Ga0105246_10194990
2974 Ga0157373_10014696
2975 Ga0157371_10001965
2976 Ga0157371_10032595
2977 Ga0157370_10012436
2978 Ga0157369_10003343
2979 Ga0157369_10006140
2980 Ga0157369_10028862
2981 Ga0157369_10042205
2982 Ga0157369_10047137
2983 Ga0157369_10134876
2984 Ga0157369_10135833
2985 Ga0157374_10020915
2986 Ga0157378_10010352
2987 Ga0157378_10027154
2988 Ga0157378_10044937
2989 Ga0157378_10203353
2990 Ga0163162_10229895
2991 Ga0163162_10298978
2992 Ga0163162_10344586
2993 Ga0157372_10001631
2994 Ga0157372_10133750
2995 Ga0157372_10157824
2996 Ga0157372_10305280
2997 Ga0157372_10337132
2998 Ga0157375_10055282
2999 Ga0157375_10204944
3000 Ga0157375_10543501
3001 Ga0163163_10005862
3002 Ga0163163_10023786
3003 Ga0163163_10067632
3004 Ga0163163_10112333
3005 Ga0163163_10194274
3006 Ga0163163_10232078
3007 Ga0163163_10236479
3008 Ga0163163_10467499
3009 Ga0182008_10109937
3010 Ga0157379_10014180
3011 Ga0157376_10008383
3012 Ga0157376_10266738
3013 Ga0163161_10004994
3014 Ga0163161_10089270
3015 Ga0214544_1000002
3016 Ga0214542_1000001
3017 Ga0214545_1000001
3018 Ga0214543_1000001
3019 Ga0213873_10004466
3020 Ga0213876_10001690
3021 Ga0213876_10091430
3022 Ga0213871_10001515
3023 Ga0209563_100864
3024 Ga0207425_1006454
3025 Ga0209677_100537
3026 Ga0209677_103297
3027 Ga0209677_104828
3028 Ga0209148_1000613
3029 Ga0209148_1000841
3030 Ga0209148_1005138
3031 Ga0209233_1001871
3032 Ga0209233_1004495
3033 Ga0209233_1008594
3034 Ga0209455_1001277
3035 Ga0209455_1003926
3036 Ga0209455_1004047
3037 Ga0209564_1003012
3038 Ga0209564_1003264
3039 Ga0209564_1008506
3040 Ga0209564_1012867
3041 Ga0209564_1014212
3042 Ga0209758_1000140
3043 Ga0209758_1000164
3044 Ga0209758_1001346
3045 Ga0209758_1001601
3046 Ga0209758_1002251
3047 Ga0209758_1002397
3048 Ga0209758_1002853
3049 Ga0209758_1003241
3050 Ga0209758_1003800
3051 Ga0209758_1006517
3052 Ga0209758_1007245
3053 Ga0209758_1007676
3054 Ga0209758_1017749
3055 Ga0209758_1038310
3056 Ga0209256_1006146
3057 Ga0209256_1009403
3058 Ga0209256_1018544
3059 Ga0207426_1000626
3060 Ga0207426_1000822
3061 Ga0207426_1001216
3062 Ga0207426_1001803
3063 Ga0207426_1002280
3064 Ga0207426_1002722
3065 Ga0207426_1009840
3066 Ga0207426_1011102
3067 Ga0207426_1013581
3068 Ga0207426_1027750
3069 Ga0209257_1002059
3070 Ga0209257_1002227
3071 Ga0209257_1026420
3072 Ga0209257_1033673
3073 Ga0207697_10004888
3074 Ga0207697_10016374
3075 Ga0207697_10073450
3076 Ga0207656_10007922
3077 Ga0207656_10027596
3078 Ga0207682_10000233
3079 Ga0207692_10000214
3080 Ga0207692_10009204
3081 Ga0207692_10060872
3082 Ga0207642_10013332
3083 Ga0207710_10048973
3084 Ga0207710_10117111
3085 Ga0207688_10050156
3086 Ga0207688_10085575
3087 Ga0207688_10096000
3088 Ga0207688_10149583
3089 Ga0207680_10022163
3090 Ga0207680_10140666
3091 Ga0207647_10000712
3092 Ga0207647_10025278
3093 Ga0207647_10033656
3094 Ga0207647_10063221
3095 Ga0207685_10005804
3096 Ga0207699_10000379
3097 Ga0207699_10001095
3098 Ga0207699_10027860
3099 Ga0207699_10045190
3100 Ga0207645_10019420
3101 Ga0207645_10032640
3102 Ga0207643_10028396
3103 Ga0207705_10035725
3104 Ga0207684_10002538
3105 Ga0207684_10002971
3106 Ga0207684_10027469
3107 Ga0207684_10045020
3108 Ga0207684_10212938
3109 Ga0207654_10002421
3110 Ga0207654_10006353
3111 Ga0207654_10012132
3112 Ga0207654_10012820
3113 Ga0207654_10023984
3114 Ga0207707_10000359
3115 Ga0207707_10002327
3116 Ga0207707_10004014
3117 Ga0207707_10007742
3118 Ga0207707_10008741
3119 Ga0207707_10013921
3120 Ga0207707_10035480
3121 Ga0207707_10043631
3122 Ga0207707_10093928
3123 Ga0207707_10119750
3124 Ga0207707_10215459
3125 Ga0207707_10227195
3126 Ga0207695_10000910
3127 Ga0207695_10001998
3128 Ga0207695_10035157
3129 Ga0207695_10068321
3130 Ga0207695_10069051
3131 Ga0207695_10073106
3132 Ga0207695_10293540
3133 Ga0207695_10308493
3134 Ga0207695_10356756
3135 Ga0207671_10002587
3136 Ga0207671_10006943
3137 Ga0207671_10014047
3138 Ga0207671_10020564
3139 Ga0207671_10025479
3140 Ga0207671_10052004
3141 Ga0207671_10107404
3142 Ga0207671_10216729
3143 Ga0207693_10001226
3144 Ga0207693_10003562
3145 Ga0207693_10009473
3146 Ga0207693_10010251
3147 Ga0207693_10017377
3148 Ga0207693_10024965
3149 Ga0207693_10026683
3150 Ga0207693_10057257
3151 Ga0207693_10073149
3152 Ga0207663_10000628
3153 Ga0207663_10002632
3154 Ga0207663_10009673
3155 Ga0207663_10027788
3156 Ga0207663_10097600
3157 Ga0207663_10220692
3158 Ga0207660_10008313
3159 Ga0207660_10045952
3160 Ga0207660_10054672
3161 Ga0207662_10101648
3162 Ga0207657_10000371
3163 Ga0207657_10002789
3164 Ga0207657_10008747
3165 Ga0207657_10016670
3166 Ga0207657_10019432
3167 Ga0207649_10044696
3168 Ga0207652_10010009
3169 Ga0207652_10018726
3170 Ga0207652_10030769
3171 Ga0207652_10032026
3172 Ga0207652_10034932
3173 Ga0207652_10037570
3174 Ga0207652_10058518
3175 Ga0207652_10092077
3176 Ga0207646_10001054
3177 Ga0207646_10005295
3178 Ga0207646_10007223
3179 Ga0207646_10059976
3180 Ga0207646_10144919
3181 Ga0207694_10000157
3182 Ga0207694_10053295
3183 Ga0207694_10055889
3184 Ga0207694_10109193
3185 Ga0207694_10280143
3186 Ga0207650_10005860
3187 Ga0207650_10036096
3188 Ga0207650_10090519
3189 Ga0207659_10003917
3190 Ga0207659_10017546
3191 Ga0207659_10173002
3192 Ga0207687_10072339
3193 Ga0207687_10118367
3194 Ga0207687_10138239
3195 Ga0207700_10006989
3196 Ga0207700_10010013
3197 Ga0207700_10017812
3198 Ga0207700_10023291
3199 Ga0207700_10043564
3200 Ga0207700_10139046
3201 Ga0207700_10163270
3202 Ga0207700_10241838
3203 Ga0207664_10008537
3204 Ga0207664_10027649
3205 Ga0207664_10040218
3206 Ga0207664_10042081
3207 Ga0207664_10100541
3208 Ga0207664_10186531
3209 Ga0207664_10195437
3210 Ga0207664_10227587
3211 Ga0207644_10014609
3212 Ga0207644_10065259
3213 Ga0207644_10077073
3214 Ga0207644_10153702
3215 Ga0207690_10001921
3216 Ga0207690_10050336
3217 Ga0207706_10000179
3218 Ga0207706_10008198
3219 Ga0207706_10011412
3220 Ga0207706_10032041
3221 Ga0207706_10146897
3222 Ga0207706_10277773
3223 Ga0207709_10117562
3224 Ga0207709_10191009
3225 Ga0207670_10061736
3226 Ga0207669_10026912
3227 Ga0207669_10065085
3228 Ga0207704_10053582
3229 Ga0207665_10001305
3230 Ga0207665_10055356
3231 Ga0207665_10109693
3232 Ga0207691_10005440
3233 Ga0207691_10071690
3234 Ga0207691_10110729
3235 Ga0207711_10035548
3236 Ga0207711_10132179
3237 Ga0207689_10011579
3238 Ga0207689_10135761
3239 Ga0207661_10006014
3240 Ga0207661_10006099
3241 Ga0207661_10009972
3242 Ga0207661_10018653
3243 Ga0207661_10100386
3244 Ga0207661_10148136
3245 Ga0207679_10211546
3246 Ga0207667_10011520
3247 Ga0207667_10016633
3248 Ga0207667_10026324
3249 Ga0207667_10047244
3250 Ga0207667_10060098
3251 Ga0207667_10085227
3252 Ga0207667_10106279
3253 Ga0207667_10111037
3254 Ga0207667_10147724
3255 Ga0207651_10151632
3256 Ga0207668_10009212
3257 Ga0207668_10016413
3258 Ga0207668_10030484
3259 Ga0207640_10042167
3260 Ga0207677_10044918
3261 Ga0207677_10062741
3262 Ga0207703_10067369
3263 Ga0207703_10168578
3264 Ga0207703_10282785
3265 Ga0207639_10030650
3266 Ga0207639_10034004
3267 Ga0207639_10044374
3268 Ga0207639_10073521
3269 Ga0207639_10098703
3270 Ga0207639_10106443
3271 Ga0207639_10220099
3272 Ga0207639_10249787
3273 Ga0207678_10006632
3274 Ga0207678_10007352
3275 Ga0207678_10044979
3276 Ga0207678_10054731
3277 Ga0207678_10061977
3278 Ga0207678_10079940
3279 Ga0207678_10113616
3280 Ga0207678_10122698
3281 Ga0207678_10131781
3282 Ga0207678_10150261
3283 Ga0207678_10232846
3284 Ga0207708_10027461
3285 Ga0207702_10000002
3286 Ga0207702_10000044
3287 Ga0207702_10000081
3288 Ga0207702_10000997
3289 Ga0207702_10032981
3290 Ga0207702_10104157
3291 Ga0207702_10148419
3292 Ga0207702_10253604
3293 Ga0207702_10319707
3294 Ga0207641_10114037
3295 Ga0207641_10398181
3296 Ga0207648_10003625
3297 Ga0207648_10044202
3298 Ga0207648_10109161
3299 Ga0207648_10139548
3300 Ga0207676_10013792
3301 Ga0207676_10090780
3302 Ga0207676_10173041
3303 Ga0207676_10215008
3304 Ga0207676_10326140
3305 Ga0207674_10009531
3306 Ga0207674_10018412
3307 Ga0207674_10023874
3308 Ga0207674_10041515
3309 Ga0207674_10153455
3310 Ga0207674_10322592
3311 Ga0207675_100002865
3312 Ga0207675_100021301
3313 Ga0207675_100031537
3314 Ga0207675_100120126
3315 Ga0207675_100133127
3316 Ga0207675_100168586
3317 Ga0207675_100292939
3318 Ga0207683_10019414
3319 Ga0207683_10019699
3320 Ga0207683_10030000
3321 Ga0207683_10037080
3322 Ga0207683_10110859
3323 Ga0207683_10277308
3324 Ga0207698_10015437
3325 Ga0207698_10027206
3326 Ga0207698_10037047
3327 Ga0207698_10098849
3328 Ga0207698_10102070
3329 Ga0209389_1000061
3330 Ga0209389_1000201
3331 Ga0209389_1000233
3332 Ga0209589_1000001
3333 Ga0209589_1000465
3334 Ga0209969_1002972
3335 Ga0209489_100001
3336 Ga0209489_100006
3337 Ga0209489_100035
3338 Ga0209489_102560
3339 Ga0209700_100001
3340 Ga0209700_100005
3341 Ga0209700_100062
3342 Ga0209967_1003797
3343 Ga0209179_1007355
3344 Ga0209983_1002077
3345 Ga0209588_1004305
3346 Ga0209971_1006564
3347 Ga0209813_10000241
3348 Ga0209974_10000323
3349 Ga0207428_10000018
3350 Ga0207428_10064578
3351 Ga0268266_10002410
3352 Ga0268266_10003390
3353 Ga0268266_10005649
3354 Ga0268266_10025598
3355 Ga0268266_10030373
3356 Ga0268266_10034718
3357 Ga0268266_10094186
3358 Ga0268266_10124114
3359 Ga0268266_10143239
3360 Ga0268266_10165099
3361 Ga0268265_10036239
3362 Ga0268265_10038885
3363 Ga0268265_10085253
3364 Ga0268264_10000149
3365 Ga0268264_10016783
3366 Ga0268264_10141726
3367 Ga0265337_1016243
3368 Ga0265326_10002417
3369 Ga0265319_1003112
3370 Ga0265319_1019665
3371 Ga0265334_10004574
3372 Ga0265334_10006531
3373 Ga0265318_10002252
3374 Ga0265323_10000280
3375 Ga0265323_10004599
3376 Ga0265322_10017668
3377 Ga0265336_10000434
3378 Ga0265336_10001016
3379 Ga0307517_10000008
3380 Ga0307517_10000772
3381 Ga0307517_10011552
3382 Ga0307517_10042025
3383 Ga0307515_10038891
3384 Ga0307515_10243880
3385 Ga0265338_10000776
3386 Ga0265338_10001205
3387 Ga0265324_10004764
3388 Ga0265324_10006841
3389 Ga0307511_10107907
3390 Ga0265330_10024452
3391 Ga0265332_10023610
3392 Ga0265325_10003329
3393 Ga0265340_10000903
3394 Ga0265339_10028260
3395 Ga0307513_10005868
3396 Ga0307513_10220710
3397 Ga0307509_10037791
3398 Ga0307509_10093588
3399 Ga0307508_10000009
3400 Ga0307508_10000213
3401 Ga0307508_10008975
3402 Ga0307508_10009580
3403 Ga0307508_10036557
3404 Ga0307508_10044235
3405 Ga0307508_10076621
3406 Ga0307508_10093534
3407 Ga0265314_10002371
3408 Ga0265314_10005412
3409 Ga0265314_10009299
3410 Ga0265314_10025825
3411 Ga0265314_10027041
3412 Ga0265314_10085675
3413 Ga0265342_10067315
3414 Ga0307516_10002828
3415 Ga0307516_10005403
3416 Ga0307516_10008211
3417 Ga0307516_10013909
3418 Ga0307516_10044284
3419 Ga0307516_10052133
3420 Ga0307516_10078013
3421 Ga0307516_10147974
3422 Ga0307410_10081736
3423 Ga0307412_10160792
3424 Ga0307416_100048634
3425 Ga0307416_100067979
3426 Ga0307416_100072477
3427 Ga0307414_10196208
3428 Ga0307411_10055799
3429 Ga0307411_10081443
3430 Ga0307411_10318101
3431 Ga0307507_10059932
3432 Ga0307510_10005184
3433 Ga0307510_10024366
3434 Ga0307510_10030365
3435 Ga0307510_10052336
3436 Ga0307510_10063180
3437 Ga0307510_10064293
3438 Ga0307510_10148559
3439 Ga0307510_10159470
3440 Ga0315911_1000001
3441 Ga0315911_1000006
3442 Ga0316215_1003151
3443 Ga0373926_0006210
3444 Ga0373951_0021202
3445 Ga0373923_0047531
3446 Ga0373936_0000012
3447 Ga0373936_0012550
3448 Ga0373939_0015998
3449 Ga0373941_0055204
3450 Ga0373945_0005196
3451 Ga0373953_0060402
3452 Ga0373954_0005241
3453 Ga0373954_0011301
3454 Ga0373954_0023809
3455 Ga0373956_0023481
3456 Ga0373956_0026692
3457 Ga0373957_0010573
3458 Ga0373957_0017756
3459 Ga0373957_0039787
3460 Ga0373957_0070331
3461 Ga0373943_0059921
3462 Ga0373943_0087722
3463 Ga0373955_0000210
3464 Ga0373955_0021420
3465 Ga0373955_0028931
3466 Ga0373955_0035358
3467 Ga0373955_0174155
3468 Ga0373961_0010213
3469 Ga0373961_0019772
3470 Ga0373931_0001664
3471 Ga0373931_0001805
3472 Ga0373935_0000146
3473 Ga0373935_0000382
3474 Ga0373935_0000602
3475 Ga0373935_0017006
3476 Ga0373935_0051822
3477 Ga0373927_0000069
3478 Ga0373927_0007415
3479 Ga0373927_0008315
3480 Ga0373927_0009820
3481 Ga0373927_0025913
3482 Ga0373927_0051893
3483 Ga0373927_0052766
3484 Ga0373927_0057746
3485 Ga0373927_0062734
3486 Ga0373927_0108626
3487 Ga0373927_0120305
3488 Ga0373933_0000445
3489 Ga0373933_0001755
3490 Ga0373933_0009054
3491 Ga0373933_0012105
3492 Ga0373933_0080933
3493 Ga0373947_0000385
3494 Ga0373947_0002022
3495 Ga0373947_0010182
3496 Ga0373947_0024081
3497 Ga0373947_0042886
3498 Ga0373947_0042950
3499 Ga0373947_0109264
3500 Ga0373947_0133007
3501 Ga0373947_0137542
3502 Ga0373947_0198619
3503 Ga0373937_0011760
3504 Ga0373937_0038193
3505 Ga0373937_0044445
3506 Ga0373937_0047885
3507 Ga0373937_0049800
3508 Ga0373937_0049980
3509 Ga0373937_0076440
3510 Ga0373937_0086387
3511 Ga0373937_0128498
3512 Ga0373925_0022731
3513 Ga0373925_0023950
3514 Ga0373925_0031253
3515 Ga0373925_0093009
3516 Ga0373925_0096352
3517 Ga0373925_0209660
3518 Ga0395899_0012313
3519 Ga0395899_0051385
3520 Ga0395900_0001120
3521 Ga0395900_0008437
3522 Ga0395900_0019170
3523 Ga0395900_0057396
3524 Ga0395900_0125874
3525 Ga0395900_0203299
3526 Ga0395898_0012798
3527 Ga0395898_0017966
3528 Ga0395898_0136444
3529 Ga0395898_0141457
3530 Ga0395898_0142442
3531 Ga0395898_0291364
3532 Ga0395905_0038754
3533 Ga0395905_0045219
3534 Ga0395905_0191275
3535 Ga0436364_0154921
3536 Ga0436364_0794198
3537 Ga0436364_1394003
3538 Ga0395901_0002127
3539 Ga0395901_0029033
3540 Ga0395901_0077651
3541 Ga0395901_0131762
3542 Ga0395901_0239417
3543 Ga0395901_0240634
3544 Ga0395901_0407197
3545 Ga0395901_0489680
3546 Ga0436365_0613407
3547 Ga0436365_0655688
3548 Ga0436365_1233295
3549 Ga0436365_1440273
3550 Ga0436365_1540038
3551 Ga0436360_1071774
3552 Ga0436360_1105678
3553 Ga0436361_0209695
3554 Ga0436361_0549184
3555 Ga0436361_0848594
3556 Ga0436361_0904316
3557 Ga0436363_0361238
3558 Ga0436363_0814578
3559 Ga0436363_0918081
3560 Ga0436363_1092037
3561 Ga0436362_0554704
3562 Ga0436362_0680219
3563 Ga0439441_002408
3564 Ga0439435_0007906
3565 Ga0439460_0018470
3566 Ga0451577_0001635
3567 Ga0451577_0013589
3568 Ga0466969_0049680
3569 Ga0466972_0000189
3570 Ga0466972_0007356
3571 Ga0466972_0021981
3572 Ga0453683_0005342
3573 Ga0453683_0005758
3574 Ga0453683_0006980
3575 Ga0453683_0020767
3576 Ga0466965_0003215
3577 Ga0466966_0000196
3578 Ga0466966_0000655
3579 Ga0466966_0016313
3580 Ga0466961_0000239
3581 Ga0466961_0001465
3582 Ga0466963_0035708
3583 Ga0466963_0054556
3584 Ga0466963_0116741
3585 Ga0466964_0039299
3586 Ga0453684_0026520
3587 Ga0453684_0049587
3588 Ga0466968_0003867
3589 Ga0466960_0037541
3590 Ga0466959_0021923
3591 Ga0466959_0043086
3592 Ga0466959_0095878
3593 Ga0451576_0021367
3594 Ga0466967_0024787
3595 Ga0466967_0115555
3596 Ga0466967_0135163
3597 Ga0466967_0135494
3598 Ga0495617_027881
3599 Ga0495592_0004668
3600 Ga0495592_0036870
3601 Ga0495592_0047310
3602 Ga0495592_0057851
3603 Ga0495592_0066030
3604 Ga0495592_0087144
3605 Ga0495592_0089703
3606 Ga0495603_0000191
3607 Ga0495603_0000429
3608 Ga0495603_0000499
3609 Ga0495603_0004726
3610 Ga0495603_0009824
3611 Ga0495603_0010882
3612 Ga0495603_0017980
3613 Ga0495603_0031657
3614 Ga0495603_0041717
3615 Ga0495603_0058221
3616 Ga0495629_0000083
3617 Ga0495629_0000500
3618 Ga0495629_0000721
3619 Ga0495638_0004605
3620 Ga0495638_0015687
3621 Ga0495638_0019634
3622 Ga0495638_0052980
3623 Ga0495638_0098190
3624 Ga0495638_0103032
3625 Ga0495638_0110496
3626 Ga0495641_0001436
3627 Ga0495641_0062784
3628 Ga0495651_0000395
3629 Ga0495651_0013879
3630 Ga0495651_0019048
3631 Ga0495651_0040157
3632 Ga0495651_0064755
3633 Ga0495653_0004234
3634 Ga0495653_0034425
3635 Ga0495580_0000143
3636 Ga0495580_0000716
3637 Ga0495580_0001842
3638 Ga0495580_0010080
3639 Ga0495582_0000094
3640 Ga0495582_0000251
3641 Ga0495582_0036966
3642 Ga0495639_0000077
3643 Ga0495639_0000150
3644 Ga0495639_0000926
3645 Ga0495639_0039079
3646 Ga0495662_0000080
3647 Ga0495662_0000826
3648 Ga0495662_0031332
3649 Ga0495664_0005360
3650 Ga0495664_0014962
3651 Ga0495664_0028264
3652 Ga0495664_0045999
3653 Ga0495664_0065612
3654 Ga0495584_0042407
3655 Ga0495584_0061875
3656 Ga0495584_0092153
3657 Ga0495585_0061664
3658 Ga0495594_0000433
3659 Ga0495594_0000648
3660 Ga0495594_0001874
3661 Ga0495594_0039280
3662 Ga0495606_0001450
3663 Ga0495606_0002520
3664 Ga0495606_0002700
3665 Ga0495606_0032276
3666 Ga0495606_0049185
3667 Ga0495606_0056101
3668 Ga0495606_0058297
3669 Ga0495606_0085077
3670 Ga0495606_0106427
3671 Ga0495608_0020761
3672 Ga0495608_0037629
3673 Ga0495608_0055907
3674 Ga0495610_0084470
3675 Ga0495618_0026652
3676 Ga0495618_0092429
3677 Ga0495620_0052979
3678 Ga0495628_0003637
3679 Ga0495628_0026802
3680 Ga0495628_0026806
3681 Ga0495628_0064553
3682 Ga0495628_0068444
3683 Ga0495628_0228721
3684 Ga0495630_0003796
3685 Ga0495630_0111703
3686 Ga0495630_0128620
3687 Ga0495631_0060901
3688 Ga0495632_0105296
3689 Ga0495637_0045179
3690 Ga0495643_0006299
3691 Ga0495643_0015625
3692 Ga0495643_0052418
3693 Ga0495644_0046239
3694 Ga0495648_0013070
3695 Ga0495648_0017835
3696 Ga0495648_0039534
3697 Ga0495648_0066948
3698 Ga0495663_0042220
3699 Ga0495666_0099252
3700 Ga0495642_0020776
3701 Ga0495652_0006074
3702 Ga0495652_0019988
3703 Ga0495652_0028621
3704 Ga0495652_0030569
3705 Ga0495652_0031471
3706 Ga0495652_0080952
3707 Ga0495652_0102748
3708 Ga0495652_0110898
3709 Ga0495652_0143984
3710 Ga0495652_0195722
3711 Ga0495654_0044567
3712 Ga0495665_0000784
3713 Ga0495665_0003088
3714 Ga0495665_0016458
3715 Ga0495665_0021744
3716 Ga0495640_0003320
3717 Ga0495640_0011232
3718 Ga0495640_0013662
3719 Ga0495640_0018041
3720 Ga0495640_0025555
3721 Ga0495640_0031230
3722 Ga0495586_0044679
3723 Ga0495587_0008275
3724 Ga0495587_0017472
3725 Ga0495587_0080594
3726 Ga0495621_0031684
3727 Ga0495597_0004537
3728 Ga0495645_0000805
3729 Ga0495645_0020048
3730 Ga0495645_0021210
3731 Ga0495645_0058920
3732 Ga0495645_0082855
3733 Ga0495622_0001916
3734 Ga0495622_0008222
3735 Ga0495622_0028444
3736 Ga0495622_0037832
3737 Ga0495622_0050528
3738 Ga0495622_0068828
3739 Ga0495633_0059289
3740 Ga0495667_0005217
3741 Ga0495667_0007037
3742 Ga0495667_0008195
3743 Ga0495667_0010501
3744 Ga0495667_0041370
3745 Ga0495667_0059642
3746 Ga0495667_0139449
3747 Ga0495656_0006988
3748 Ga0495656_0053353
3749 Ga0495668_0103416
3750 Ga0495668_0107575
3751 Ga0495668_0138146
3752 Ga0495634_0001187
3753 Ga0495634_0002836
3754 Ga0495634_0017869
3755 Ga0495634_0020590
3756 Ga0495634_0026647
3757 Ga0495634_0104942
3758 Ga0495625_0104872
3759 Ga0495635_0000229
3760 Ga0495635_0000425
3761 Ga0495635_0001333
3762 Ga0495635_0009501
3763 Ga0495635_0026189
3764 Ga0495635_0048856
3765 Ga0495635_0063005
3766 Ga0495659_0061544
3767 Ga0495661_0050951
3768 Ga0495588_0007431
3769 Ga0495588_0029437
3770 Ga0495588_0034106
3771 Ga0495657_0005171
3772 Ga0495657_0010875
3773 Ga0495657_0020820
3774 Ga0495657_0036819
3775 Ga0495657_0150771
3776 Ga0495599_0000421
3777 Ga0495599_0001555
3778 Ga0495599_0016576
3779 Ga0495599_0044339
3780 Ga0495599_0050075
3781 Ga0495599_0077243
3782 Ga0495599_0078053
3783 Ga0495599_0082341
3784 Ga0495599_0126498
3785 Ga0495599_0156362
3786 Ga0495623_0007010
3787 Ga0495623_0009021
3788 Ga0495623_0026676
3789 Ga0495623_0052619
3790 Ga0495646_0019582
3791 Ga0495646_0031778
3792 Ga0495646_0037047
3793 Ga0495646_0070124
3794 Ga0495647_0002127
3795 Ga0495647_0008621
3796 Ga0495658_0000334
3797 Ga0495658_0001408
3798 Ga0495658_0002435
3799 Ga0495658_0031544
3800 Ga0495669_0027773
3801 Ga0495669_0028233
3802 Ga0495613_0010577
3803 Ga0495613_0028367
3804 Ga0495613_0048297
3805 Ga0495613_0056346
3806 Ga0495624_0000096
3807 Ga0495624_0000786
3808 Ga0495624_0000818
3809 Ga0495624_0042731
3810 Ga0495624_0094070
3811 Ga0495670_0034442
3812 Ga0495670_0104087
3813 Ga0495649_0010278
3814 Ga0495649_0069484
3815 Ga0495600_0000440
3816 Ga0495600_0003908
3817 Ga0495600_0011116
3818 Ga0495600_0012843
3819 Ga0495600_0083511
3820 Ga0495600_0159146
3821 Ga0495581_0000095
3822 Ga0495581_0009576
3823 Ga0495581_0024060
3824 Ga0495604_0000797
3825 Ga0495604_0017963
3826 Ga0495604_0024509
3827 Ga0495604_0024712
3828 Ga0495604_0066064
3829 Ga0495604_0138526
3830 Ga0495674_0001326
3831 Ga0495674_0001342
3832 Ga0495674_0002711
3833 Ga0495674_0017800
3834 Ga0495674_0048096
3835 Ga0495674_0048881
3836 Ga0495674_0098531
3837 Ga0495674_0099667
3838 Ga0495674_0188994
3839 Ga0495672_0010757
3840 Ga0495672_0029155
3841 Ga0495672_0031567
3842 Ga0495672_0079353
3843 Ga0495676_0035190
3844 Ga0495676_0051777
3845 Ga0495676_0053391
3846 Ga0495676_0061193
3847 Ga0495676_0185413
3848 Ga0495680_0002991
3849 Ga0495680_0004264
3850 Ga0495680_0008649
3851 Ga0495683_0063682
3852 Ga0495687_009315
3853 Ga0495675_0042433
3854 Ga0495675_0091167
3855 Ga0495677_0031930
3856 Ga0495673_0055053
3857 Ga0495684_0001579
3858 Ga0495684_0019491
3859 Ga0495684_0045177
3860 Ga0495684_0066747
3861 Ga0495684_0089076
3862 Ga0495684_0145377
3863 Ga0495686_0104291
3864 Ga0495686_0158388
3865 Ga0495593_0000071
3866 Ga0495593_0000192
3867 Ga0495593_0000531
3868 Ga0495593_0004346
3869 Ga0495593_0004557
3870 Ga0495602_0002266
3871 Ga0495602_0032999
3872 Ga0495602_0046834
3873 Ga0495602_0058117
3874 Ga0495602_0061680
3875 Ga0495614_0008512
3876 Ga0495614_0014224
3877 Ga0495626_0079765
3878 Ga0496100_0017746
3879 Ga0496100_0048864
3880 Ga0496101_0002722
3881 Ga0496101_0050241
3882 Ga0496101_0070462
3883 Ga0496101_0081798
3884 Ga0496101_0112214
3885 Ga0496101_0181810
3886 Ga0496101_0199879
3887 Ga0496101_0221803
3888 Ga0496102_0006460
3889 Ga0496102_0013510
3890 Ga0496102_0014728
3891 Ga0496102_0023779
3892 Ga0496102_0035750
3893 Ga0496102_0047263
3894 Ga0496102_0056044
3895 Ga0496102_0069039
3896 Ga0496102_0130421
3897 Ga0496102_0216315
3898 Ga0496102_0289006
3899 Ga0496103_0006318
3900 Ga0496103_0034796
3901 Ga0496103_0063663
3902 Ga0496103_0092632
3903 Ga0496103_0125495
3904 Ga0496103_0186500
3905 Ga0496104_0003416
3906 Ga0496104_0006365
3907 Ga0496104_0007294
3908 Ga0496104_0007469
3909 Ga0496104_0013863
3910 Ga0496104_0020552
3911 Ga0496104_0028484
3912 Ga0496104_0050018
3913 Ga0496104_0082079
3914 Ga0496104_0305797
3915 Ga0496105_0000885
3916 Ga0496105_0002584
3917 Ga0496105_0003408
3918 Ga0496105_0020255
3919 Ga0496105_0033690
3920 Ga0496105_0035975
3921 Ga0496105_0083660
3922 Ga0496105_0114640
3923 Ga0496106_0001915
3924 Ga0496106_0007345
3925 Ga0496106_0022766
3926 Ga0496106_0030731
3927 Ga0496106_0037921
3928 Ga0496106_0088810
3929 Ga0496106_0118644
3930 Ga0496106_0127378
3931 Ga0496106_0145099
3932 Ga0496106_0150552
3933 Ga0496107_0012151
3934 Ga0496107_0016613
3935 Ga0496107_0027783
3936 Ga0496107_0038938
3937 Ga0496107_0053387
3938 Ga0496107_0055102
3939 Ga0496107_0098347
3940 Ga0496107_0188217
3941 Ga0496108_0003824
3942 Ga0496108_0017452
3943 Ga0496108_0030364
3944 Ga0496108_0036356
3945 Ga0496108_0040146
3946 Ga0496108_0160188
3947 Ga0496108_0178103
3948 Ga0496108_0253998
3949 Ga0496108_0327267
3950 Ga0496109_0004518
3951 Ga0496109_0032449
3952 Ga0496109_0035989
3953 Ga0496109_0041003
3954 Ga0496109_0154347
3955 Ga0496109_0201653
3956 Ga0496109_0288186
3957 Ga0496110_0014347
3958 Ga0496110_0049494
3959 Ga0496110_0233224
3960 Ga0496110_0238793
3961 Ga0496111_0002213
3962 Ga0496111_0025164
3963 Ga0496111_0030899
3964 Ga0496111_0036997
3965 Ga0496111_0066009
3966 Ga0496111_0072734
3967 Ga0496111_0219523
3968 Ga0496112_0000004
3969 Ga0496112_0000021
3970 Ga0496112_0009718
3971 Ga0496112_0011381
3972 Ga0496112_0012673
3973 Ga0496112_0014868
3974 Ga0496112_0024366
3975 Ga0496112_0034410
3976 Ga0496112_0035695
3977 Ga0496112_0039660
3978 Ga0496112_0069176
3979 Ga0496112_0079666
3980 Ga0496112_0101340
3981 Ga0496112_0104503
3982 Ga0496112_0132785
3983 Ga0496112_0207383
3984 Ga0496113_0001858
3985 Ga0496113_0004219
3986 Ga0496113_0043607
3987 Ga0496113_0045592
3988 Ga0496113_0053851
3989 Ga0496113_0101787
3990 Ga0496113_0106471
3991 Ga0496113_0142693
3992 Ga0496113_0145583
3993 Ga0496114_0002125
3994 Ga0496114_0010449
3995 Ga0496114_0011440
3996 Ga0496114_0043187
3997 Ga0496114_0085349
3998 Ga0496115_0012349
3999 Ga0496115_0054052
4000 Ga0496115_0062305
4001 Ga0496115_0063546
4002 Ga0496115_0088782
4003 Ga0496115_0096715
4004 Ga0496115_0111608
4005 Ga0496115_0134043
4006 Ga0496116_0027209
4007 Ga0496116_0045503
4008 Ga0496116_0123106
4009 Ga0496117_0165819
4010 Ga0496118_0008788
4011 Ga0496118_0011620
4012 Ga0496118_0016895
4013 Ga0496118_0017343
4014 Ga0496118_0018968
4015 Ga0496118_0044117
4016 Ga0496118_0048374
4017 Ga0496118_0100933
4018 Ga0496118_0131137
4019 Ga0496119_0020237
4020 Ga0496119_0070625
4021 Ga0496119_0074171
4022 Ga0496119_0079911
4023 Ga0496119_0090397
4024 Ga0496119_0104706
4025 Ga0496120_0040496
4026 Ga0496121_0000937
4027 Ga0496121_0001335
4028 Ga0496121_0001474
4029 Ga0496121_0005471
4030 Ga0496121_0007499
4031 Ga0496121_0007715
4032 Ga0496121_0014083
4033 Ga0496121_0026412
4034 Ga0496121_0041760
4035 Ga0496121_0073661
4036 Ga0496121_0081235
4037 Ga0496121_0093945
4038 Ga0496121_0137266
4039 Ga0496121_0156348
4040 Ga0496122_0040041
4041 Ga0496122_0068684
4042 Ga0496122_0096640
4043 Ga0496122_0107191
4044 Ga0496123_0051156
4045 Ga0496123_0059734
4046 Ga0496123_0144221
4047 Ga0496124_0000837
4048 Ga0496124_0043395
4049 Ga0496124_0060408
4050 Ga0496124_0139227
4051 Ga0496125_0000272
4052 Ga0496125_0002607
4053 Ga0496125_0003504
4054 Ga0496125_0005748
4055 Ga0496125_0007108
4056 Ga0496125_0018180
4057 Ga0496125_0048277
4058 Ga0496125_0054870
4059 Ga0496125_0076497
4060 Ga0496125_0101821
4061 Ga0496125_0133241
4062 Ga0496126_0003412
4063 Ga0496126_0004659
4064 Ga0496126_0009003
4065 Ga0496126_0012203
4066 Ga0496126_0012755
4067 Ga0496126_0013528
4068 Ga0496126_0018680
4069 Ga0496126_0019511
4070 Ga0496126_0023543
4071 Ga0496126_0023619
4072 Ga0496126_0025545
4073 Ga0496126_0028347
4074 Ga0496126_0030336
4075 Ga0496126_0032620
4076 Ga0496126_0034632
4077 Ga0496126_0044721
4078 Ga0496126_0055970
4079 Ga0496126_0082690
4080 Ga0496126_0092699
4081 Ga0496126_0131750
4082 Ga0496126_0142588
4083 Ga0496126_0151118
4084 Ga0496126_0170032
4085 Ga0496126_0173685
4086 Ga0496126_0251839
4087 Ga0496126_0279475
4088 Ga0501031_0000910
4089 Ga0501031_0001421
4090 Ga0501031_0002962
4091 Ga0501031_0010568
4092 Ga0501031_0016428
4093 Ga0501032_0000129
4094 Ga0501032_0000421
4095 Ga0501032_0000537
4096 Ga0501032_0006576
4097 Ga0501032_0145628
4098 Ga0501033_0000124
4099 Ga0501033_0000864
4100 Ga0501033_0001179
4101 Ga0501033_0002170
4102 Ga0501033_0025694
4103 Ga0501034_0000503
4104 Ga0501034_0012060
4105 Ga0501034_0014541
4106 Ga0501034_0089178
4107 Ga0501036_0000232
4108 Ga0501036_0001453
4109 Ga0501036_0002128
4110 Ga0501036_0018030
4111 Ga0501036_0023998
4112 Ga0501036_0081321
4113 Ga0501036_0294028
4114 Ga0501037_0000106
4115 Ga0501037_0000469
4116 Ga0501037_0002855
4117 Ga0501037_0005891
4118 Ga0501037_0158054
4119 Ga0501038_0000041
4120 Ga0501038_0000108
4121 Ga0501038_0000274
4122 Ga0501038_0001655
4123 Ga0501038_0003879
4124 Ga0501038_0008504
4125 Ga0501038_0053911
4126 Ga0501038_0143838
4127 Ga0501039_0000097
4128 Ga0501039_0000416
4129 Ga0501039_0000472
4130 Ga0501039_0003027
4131 Ga0501040_0155305
4132 Ga0501040_0189619
4133 Ga0501042_0016537
4134 Ga0501042_0017067
4135 Ga0501042_0022677
4136 Ga0501042_0039520
4137 Ga0501043_0000035
4138 Ga0501043_0000498
4139 Ga0501043_0004728
4140 Ga0501043_0019247
4141 Ga0501043_0130370
4142 Ga0501043_0176288
4143 Ga0501046_0000235
4144 Ga0501046_0000461
4145 Ga0501046_0003612
4146 Ga0501046_0128024
4147 Ga0501047_0000579
4148 Ga0501047_0000844
4149 Ga0501047_0001740
4150 Ga0501047_0015400
4151 Ga0501047_0076446
4152 Ga0501047_0084470
4153 Ga0501047_0108258
4154 Ga0501047_0236068
4155 Ga0501047_0236159
4156 Ga0501048_0000116
4157 Ga0501048_0001444
4158 Ga0501048_0002032
4159 Ga0501048_0013490
4160 Ga0501048_0080046
4161 Ga0501067_0000160
4162 Ga0501067_0001562
4163 Ga0501067_0012440
4164 Ga0501067_0048969
4165 Ga0501067_0077355
4166 Ga0501068_0000014
4167 Ga0501068_0001689
4168 Ga0501068_0002139
4169 Ga0501068_0004794
4170 Ga0501068_0045654
4171 Ga0501069_0003571
4172 Ga0501069_0004593
4173 Ga0501070_0000175
4174 Ga0501070_0000451
4175 Ga0501070_0003132
4176 Ga0501070_0010549
4177 Ga0501070_0012185
4178 Ga0501070_0034852
4179 Ga0501070_0133927
4180 Ga0501070_0171048
4181 Ga0501070_0222193
4182 Ga0501071_0033623
4183 Ga0501072_0001159
4184 Ga0501072_0013749
4185 Ga0501072_0041392
4186 Ga0501072_0047145
4187 Ga0501073_0000417
4188 Ga0501073_0002573
4189 Ga0501073_0012416
4190 Ga0501073_0015408
4191 Ga0501073_0020039
4192 Ga0501073_0020288
4193 Ga0501073_0036142
4194 Ga0501073_0062358
4195 Ga0501074_0000596
4196 Ga0501074_0002156
4197 Ga0501074_0014111
4198 Ga0501074_0018698
4199 Ga0501074_0020304
4200 Ga0501074_0027193
4201 Ga0501074_0036536
4202 Ga0501075_0025051
4203 Ga0501077_0061693
4204 Ga0501079_0000261
4205 Ga0501079_0026383
4206 Ga0501079_0120547
4207 Ga0501080_0000638
4208 Ga0501080_0000917
4209 Ga0501080_0002860
4210 Ga0501080_0016248
4211 Ga0501080_0024764
4212 Ga0501080_0024865
4213 Ga0501080_0034324
4214 Ga0501080_0052344
4215 Ga0501083_0000301
4216 Ga0501035_0000155
4217 Ga0501035_0000250
4218 Ga0501035_0000324
4219 Ga0501035_0005480
4220 Ga0501035_0056563
4221 Ga0501035_0113570
4222 Ga0501035_0195280
4223 Ga0501044_0000051
4224 Ga0501044_0000393
4225 Ga0501044_0006565
4226 Ga0501044_0037167
4227 Ga0501044_0042768
4228 Ga0501044_0061028
4229 Ga0501044_0061265
4230 Ga0501044_0099578
4231 Ga0501044_0130487
4232 Ga0501044_0141531
4233 Ga0501044_0277526
4234 Ga0501044_0325052
4235 Ga0501044_0343767
4236 Ga0501045_0016881
4237 Ga0501045_0122313
4238 Ga0501045_0193984
4239 nmdc:mga03n38_11031_c1
4240 nmdc:mga03n38_1152_c1
4241 nmdc:mga03n38_6491_c1
4242 nmdc:mga03n38_70748_c1
4243 nmdc:mga00v17_5870_c1
4244 nmdc:mga00v17_65415_c1
4245 nmdc:mga00v17_71047_c1
4246 nmdc:mga0yw44_126840_c1
4247 nmdc:mga0yw44_132499_c1
4248 nmdc:mga0yw44_26596_c1
4249 nmdc:mga0yw44_56770_c1
4250 nmdc:mga0yw44_58545_c1
4251 nmdc:mga0yw44_65387_c1
4252 nmdc:mga0yw44_92434_c1
4253 nmdc:mga0k408_16450_c2
4254 nmdc:mga0k408_48401_c1
4255 nmdc:mga0k408_50969_c2
4256 nmdc:mga06z11_18028_c1
4257 nmdc:mga06z11_265_c1
4258 nmdc:mga06z11_29777_c1
4259 nmdc:mga06z11_7714_c1
4260 nmdc:mga06z11_96712_c1
4261 nmdc:mga04h51_277_c1
4262 nmdc:mga07m45_13400_c1
4263 nmdc:mga07m45_20941_c1
4264 nmdc:mga07m45_24289_c1
4265 nmdc:mga07m45_25821_c1
4266 nmdc:mga07m45_49310_c1
4267 nmdc:mga07m45_54286_c1
4268 nmdc:mga05p37_133238_c1
4269 nmdc:mga05p37_14166_c1
4270 nmdc:mga05p37_168429_c1
4271 nmdc:mga05p37_19161_c1
4272 nmdc:mga05p37_21718_c1
4273 nmdc:mga05p37_38812_c1
4274 nmdc:mga05p37_56222_c1
4275 nmdc:mga05p37_99586_c1
4276 nmdc:mga09592_139305_c1
4277 nmdc:mga09592_43756_c1
4278 nmdc:mga09592_47189_c1
4279 nmdc:mga0qj67_1874_c1
4280 nmdc:mga0qj67_3798_c1
4281 nmdc:mga0qj67_676_c1
4282 nmdc:mga0qj67_77360_c1
4283 nmdc:mga06r32_109119_c1
4284 nmdc:mga06r32_1475_c1
4285 nmdc:mga06r32_1637_c1
4286 nmdc:mga06r32_33334_c1
4287 nmdc:mga06r32_338775_c1
4288 nmdc:mga06r32_543_c1
4289 nmdc:mga08y16_111404_c1
4290 nmdc:mga08y16_1251_c1
4291 nmdc:mga08y16_3110_c1
4292 nmdc:mga08y16_6269_c1
4293 nmdc:mga0n895_127644_c1
4294 nmdc:mga0n895_158611_c1
4295 nmdc:mga0n895_62290_c1
4296 nmdc:mga0n895_6506_c1
4297 nmdc:mga0n895_67363_c1
4298 nmdc:mga0n895_70689_c1
4299 nmdc:mga0n895_71097_c1
4300 nmdc:mga0n895_87513_c1
4301 nmdc:mga0rr50_14270_c1
4302 nmdc:mga0rr50_57318_c1
4303 nmdc:mga08x19_211757_c1
4304 nmdc:mga08x19_6146_c1
4305 nmdc:mga08x19_69282_c1
4306 nmdc:mga0a205_11259_c1
4307 nmdc:mga0a205_12648_c1
4308 nmdc:mga0a205_16908_c1
4309 nmdc:mga0a205_32349_c1
4310 nmdc:mga0a205_38197_c1
4311 nmdc:mga0a205_53745_c1
4312 nmdc:mga0a205_68159_c1
4313 nmdc:mga0a205_7303_c1
4314 nmdc:mga0sz30_4529_c2
4315 nmdc:mga0sz30_48151_c1
4316 nmdc:mga0sz30_50417_c1
4317 nmdc:mga0sz30_5857_c1
4318 nmdc:mga0sz30_72610_c1
4319 Ga0495601_0021200
4320 Ga0495601_0028822
4321 Ga0495601_0131066
4322 Ga0495612_0004165
4323 Ga0495612_0008179
4324 Ga0495612_0036583
4325 Ga0500635_0002738
4326 Ga0500635_0017508
4327 Ga0495619_0000176
4328 Ga0495619_0007164
4329 Ga0495619_0021997
4330 Ga0495619_0030263
4331 Ga0495619_0054846
4332 Ga0495619_0064738
4333 Ga0495619_0093482
4334 Ga0500643_000032
4335 Ga0500643_015047
4336 Ga0500647_0031804
4337 Ga0500647_0041985
4338 Ga0500566_0000009
4339 Ga0500566_0002219
4340 Ga0500566_0003778
4341 Ga0500566_0005587
4342 Ga0500566_0006693
4343 Ga0500566_0015610
4344 Ga0500566_0019346
4345 Ga0500566_0019862
4346 Ga0500566_0039944
4347 Ga0500640_000068
4348 Ga0500640_049776
4349 Ga0500641_0003846
4350 Ga0500641_0006701
4351 Ga0500641_0025396
4352 Ga0500641_0060461
4353 Ga0500650_0002825
4354 Ga0500554_003367
4355 Ga0500554_015669
4356 Ga0500556_0000004
4357 Ga0500556_0001973
4358 Ga0500556_0016734
4359 Ga0500557_000004
4360 Ga0500562_007827
4361 Ga0500569_010111
4362 Ga0500572_000070
4363 Ga0500572_000148
4364 Ga0500572_000326
4365 Ga0500572_000505
4366 Ga0500595_000152
4367 Ga0500595_000480
4368 Ga0500595_000735
4369 Ga0500595_000759
4370 Ga0500595_001524
4371 Ga0500595_001714
4372 Ga0500595_004779
4373 Ga0500595_006746
4374 Ga0500608_001229
4375 Ga0500614_000329
4376 Ga0500614_003149
4377 Ga0500614_003281
4378 Ga0500642_0000173
4379 Ga0500642_0000186
4380 Ga0500642_0018753
4381 Ga0500642_0044404
4382 Ga0500652_011396
4383 Ga0500559_0000081
4384 Ga0500559_0002268
4385 Ga0500559_0008102
4386 Ga0500564_032900
4387 Ga0500564_065104
4388 Ga0500568_0001430
4389 Ga0500568_0036451
4390 Ga0500577_0000153
4391 Ga0500577_0038254
4392 Ga0500589_011534
4393 Ga0500590_077293
4394 Ga0500603_000175
4395 Ga0500603_000352
4396 Ga0500603_000754
4397 Ga0500603_000885
4398 Ga0500603_023189
4399 Ga0500604_0002499
4400 Ga0500604_0010784
4401 Ga0500616_0000014
4402 Ga0500616_0000372
4403 Ga0500619_021446
4404 Ga0500619_031021
4405 Ga0500620_003626
4406 Ga0500620_004101
4407 Ga0500622_0000513
4408 Ga0500622_0080217
4409 Ga0500627_0057982
4410 Ga0500630_000849
4411 Ga0500633_0009242
4412 Ga0500634_0075667
4413 Ga0500638_000086
4414 Ga0500638_000252
4415 Ga0500638_051842
4416 Ga0500639_000199
4417 Ga0500639_000545
4418 Ga0500639_007542
4419 Ga0500636_0000122
4420 Ga0500636_0001016
4421 Ga0500636_0071295
4422 Ga0500636_0074876
4423 Ga0500636_0127047
4424 Ga0500637_0000142
4425 Ga0500637_0001163
4426 Ga0500637_0005306
4427 Ga0500637_0009759
4428 Ga0500637_0057366
4429 Ga0500637_0078172
4430 Ga0500625_007714
4431 Ga0500625_014344
4432 Ga0500645_008570
4433 Ga0500645_021765
4434 Ga0500596_000198
4435 Ga0500596_003453
4436 Ga0500601_000050
4437 Ga0500601_000509
4438 Ga0501084_0014689
4439 Ga0501084_0045232
4440 Ga0501084_0109964
4441 Ga0501084_0325820
4442 Ga0500661_000398
4443 Ga0500661_001246
4444 Ga0500661_007104
4445 Ga0587070_010389
4446 Ga0501082_0000965
4447 Ga0501082_0018584
4448 8016591556
4449 2507508416
4450 2507508430
4451 2508542483
4452 2508542498
4453 2508691729
4454 2508691743
4455 2509150525
4456 2509150550
4457 2511394186
4458 2511400721
4459 2513625537
4460 2513625552
4461 2513644464
4462 2513644478
4463 2513645670
4464 2513645687
4465 2513655082
4466 2513657100
4467 2513658003
4468 2513658023
4469 2513676090
4470 2513676108
4471 2513692719
4472 2513692737
4473 2513701113
4474 2513701127
4475 2513717135
4476 2513717148
4477 2513855542
4478 2513855705
4479 2513855727
4480 2513861105
4481 2513872928
4482 2513872942
4483 2513893981
4484 2513915895
4485 2513918840
4486 2513919883
4487 2513919903
4488 2513920424
4489 2514013687
4490 2514013702
4491 2515627075
4492 2515627091
4493 2517107766
4494 2517107781
4495 2517892087
4496 2517892244
4497 2517892264
4498 2517894800
4499 2524437506
4500 2524437522
4501 2524465664
4502 2524465682
4503 2524534171
4504 2524534554
4505 2524540300
4506 2524540321
4507 2528852385
4508 2528852400
4509 2603859618
4510 2603859619
4511 2617347342
4512 2617347356
4513 2617375575
4514 2617375590
4515 2644288819
4516 2671120488
4517 2671120508
4518 2671121875
4519 2723844884
4520 2723844901
4521 2728747401
4522 2728753301
4523 2745076486
4524 2745076502
4525 2793065422
4526 2793065436
4527 2793068828
4528 2793072395
4529 2793072415
4530 2793082228
4531 2793082245
4532 2805915160
4533 2805915174
4534 2818238713
4535 2818238732
4536 2824604043
4537 2824608164
4538 2824610297
4539 2824610312
4540 2824617890
4541 2824617905
4542 2824626573
4543 2824634355
4544 2824638590
4545 2824643472
4546 2824646058
4547 2824649706
4548 2824658047
4549 2824661154
4550 2824668332
4551 2824669299
4552 2824676871
4553 2824678704
4554 2824684508
4555 2824685182
4556 2824693178
4557 2824695164
4558 2824701479
4559 2824701810
4560 2824708999
4561 2824709046
4562 2824716244
4563 2824722334
4564 2824726543
4565 2824731957
4566 2824735269
4567 2824735284
4568 2824746616
4569 2824752346
4570 2824759581
4571 2824761808
4572 2824770001
4573 2824770016
4574 2824775467
4575 2824780895
4576 2838123566
4577 2838123581
4578 2841946775
4579 2841946789
4580 2841949666
4581 2841949681
4582 2841958817
4583 2841958833
4584 2841971812
4585 2841971827
4586 2841974827
4587 2841974843
4588 2841983596
4589 2841983611
4590 2842038885
4591 2842038901
4592 2842048153
4593 2842048169
4594 2842340784
4595 2844319225
4596 2844319239
4597 2847936377
4598 2847936392
4599 2847946727
4600 2847946741
4601 2849079141
4602 2849079156
4603 2857514127
4604 2857514143
4605 2857528974
4606 2857528975
4607 2874598205
4608 2874598220
4609 2874605378
4610 2874605396
4611 2874615081
4612 2874615098
4613 2874627666
4614 2874627682
4615 2874632016
4616 2874632030
4617 2874652723
4618 2874652738
4619 2876764674
4620 2876764691
4621 2876778302
4622 2876778317
4623 2876809905
4624 2876825814
4625 2876825829
4626 2879082096
4627 2879082111
4628 2879090175
4629 2879090548
4630 2879105730
4631 2879105745
4632 2879110199
4633 2879110218
4634 2879135258
4635 2879150467
4636 2881368667
4637 2881368681
4638 2881673506
4639 2881673522
4640 2885372988
4641 2885373003
4642 2885379555
4643 2885381721
4644 2885381927
4645 2885389913
4646 2885389999
4647 2885411340
4648 2885411447
4649 2888384222
4650 2888384239
4651 2888393634
4652 2888393648
4653 2888424698
4654 2888424713
4655 2889039650
4656 2889039670
4657 2893070431
4658 2893070432
4659 2903731067
4660 2903731081
4661 2903749168
4662 2903753399
4663 2903755251
4664 2903772426
4665 2903776948
4666 2904672998
4667 2904673014
4668 2904694604
4669 2904694621
4670 2904694847
4671 2904697785
4672 2904702207
4673 2904702402
4674 2904702431
4675 2904705945
4676 2904714826
4677 2904714841
4678 2906607412
4679 2906607426
4680 2906617217
4681 2906618759
4682 2906618775
4683 2906626961
4684 2906629729
4685 2906638088
4686 2906642437
4687 2906643124
4688 2906643393
4689 2906649011
4690 2906649025
4691 2906660744
4692 2906662476
4693 2906666216
4694 2906666238
4695 2908742367
4696 2908742524
4697 2908742548
4698 2908757119
4699 2908760011
4700 2908760159
4701 2908760176
4702 2908780343
4703 2908780359
4704 2919076373
4705 2919076374
4706 2922365521
4707 2922365541
4708 2922365655
4709 2922374571
4710 2922374586
4711 2922391147
4712 2922391164
4713 2922400628
4714 2922400643
4715 2922430429
4716 2922430454
4717 2922430611
4718 2929618236
4719 2929618251
4720 2929632424
4721 2929632439
4722 2932790530
4723 2932790545
4724 2932799777
4725 2932799791
4726 2932801095
4727 2932806958
4728 2932806972
4729 2932810951
4730 2932810966
4731 2932823704
4732 2932823719
4733 2932830161
4734 2932830176
4735 2933580164
4736 2933580179
4737 2935609030
4738 2935609044
4739 2935622598
4740 2935622613
4741 2935631224
4742 2935631514
4743 2935631536
4744 2935642587
4745 2935642602
4746 2935653247
4747 2935653262
4748 2935660267
4749 2935660434
4750 2935668094
4751 2935668109
4752 2935676127
4753 2935676142
4754 2935686111
4755 2935686126
4756 2935701248
4757 2935701263
4758 2935705954
4759 2935705969
4760 2935714663
4761 2935714678
4762 2935725282
4763 2935725297
4764 2935732343
4765 2935732358
4766 2935741722
4767 2935741737
4768 2935752076
4769 2935752091
4770 2935766424
4771 2935766439
4772 2935771867
4773 2935771887
4774 2935778681
4775 2935778696
4776 2935788918
4777 2935788933
4778 2935795267
4779 2935795282
4780 2935802953
4781 2935802968
4782 2935814270
4783 2935814285
4784 2935822190
4785 2935822204
4786 2935831407
4787 2935831422
4788 2935838267
4789 2935838282
4790 2935847772
4791 2935847786
4792 2935860847
4793 2935860862
4794 2935869801
4795 2935869816
4796 2935878765
4797 2935878780
4798 2935886904
4799 2935886918
4800 2935908941
4801 2935908956
4802 2935919659
4803 2935919674
4804 2935926470
4805 2935926485
4806 2935934920
4807 2935934935
4808 2935943370
4809 2935943385
4810 2935951808
4811 2935951823
4812 2935960569
4813 2935960584
4814 2935967933
4815 2935967948
4816 2935978558
4817 2935978573
4818 2935987573
4819 2935991274
4820 2935994824
4821 2935994839
4822 2936003466
4823 2936003481
4824 2936016117
4825 2936016132
4826 2936024750
4827 2936024765
4828 2936031846
4829 2936032013
4830 2936039826
4831 2936039841
4832 2936049707
4833 2936049874
4834 2936060811
4835 2936060826
4836 2940557106
4837 2940557121
4838 2941509965
4839 2941511308
4840 2941511330
4841 2941518948
4842 2941519009
4843 2941519031
4844 2941525364
4845 2941526389
4846 2941526411
4847 2941532980
4848 2941532995
4849 2941539050
4850 2941539065
4851 3005480343
4852 3005480365
4853 3005480522
4854 3005484474
4855 3005484489
4856 3005510488
4857 3005510504
4858 3005587870
4859 3005587886
4860 3005599395
4861 3005599409
4862 3005715057
4863 3005715067
4864 3005722470
4865 3005722484
4866 8006929122
4867 8006931876
4868 8006933688
4869 8006940254
4870 8006940509
4871 8006940533
4872 8006967134
4873 8006967153
4874 8006980032
4875 8006980197
4876 8006980222
4877 8006983360
4878 8006986567
4879 8006986585
4880 8006995830
4881 8006995849
4882 8016522134
4883 8016529459
4884 8016534670
4885 8016547873
4886 8016547888
4887 8016554245
4888 8016554261
4889 8016562618
4890 8016562635
4891 8016577151
4892 8016577166
4893 8016600404
4894 8016600419
4895 8016610319
4896 8016610334
4897 8016614596
4898 8016614612
4899 8016626386
4900 8016626403
4901 8016640145
4902 8016640162
4903 8017063519
4904 8017063535
4905 8019534419
4906 8019534435
4907 8019537115
4908 8019545034
4909 8019545050
4910 8019553477
4911 8019556581
4912 8019556599
4913 8019568709
4914 8019568725
4915 8019569072
4916 8019582839
4917 8019582854
4918 8019590633
4919 8019590648
4920 8019600705
4921 8019600721
4922 8019617829
4923 8019617845
4924 8019628358
4925 8019645447
4926 8019645463
4927 8019658562
4928 8019662147
4929 8019662162
4930 8019671662
4931 8019671679
4932 8019684419
4933 8019684437
4934 8019690231
4935 8019690247
4936 8054566151
4937 8055746160
4938 8055746175
4939 8056673668
4940 8056673687
4941 8056686773
4942 8056686796
4943 8056691352
4944 8056691370
4945 8056694260
4946 8056695216
4947 8056968185
4948 8056968200

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13458

Peripla_BP_6

Periplasmic binding protein

25

373

0.96

PF13433

Peripla_BP_5

Periplasmic binding protein domain

26

373

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3i09-assembly2.cif.gz_B crystal structure of a periplasmic binding protein (bma2936) from burkholderia mallei at 1.80 a resolution 0.9783 28 405
3i09-assembly2.cif.gz_B crystal structure of a periplasmic binding protein (bma2936) from burkholderia mallei at 1.80 a resolution 0.9681 28 405
4f06-assembly1.cif.gz_A crystal structure of solute binding protein of abc transporter from rhodopseudomonas palustris haa2 rpb_2270 in complex with p-hydroxybenzoic acid 0.898 29 390
4evr-assembly1.cif.gz_A crystal structure of abc transporter from r. palustris - solute binding protein (rpa0668) in complex with benzoate 0.8975 29 403
3ipc-assembly1.cif.gz_A structure of atu2422-gaba f77a mutant receptor in complex with leucine 0.8921 30 385
ID Description Score Start End Superfamily
3i09B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9844 151 280 3.40.50.2300
3i09B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9693 151 280 3.40.50.2300
3n0wB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.946 30 362 3.40.50.2300
af_A0A0R0JFH4_66_156_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9363 69 133 3.40.50.2300
3i09A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9248 28 362 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A0E4FT91-F1-model_v4 Substrate-binding protein 0.9628 20 366 GO:0006865
AF-A0A6G8TYN6-F1-model_v4 ABC transporter substrate-binding protein 0.9624 21 407 GO:0006865
AF-A0A6G8TYN6-F1-model_v4 ABC transporter substrate-binding protein 0.9575 21 407 GO:0006865
AF-A0A2G8MMU4-F1-model_v4 deleted 0.9547 19 284
AF-A0A4Q3YPE8-F1-model_v4 ABC transporter permease 0.9537 235 407 GO:0006865

Map