F496907

General Info

Members Datasets Scaffolds Average Seq Length
2551 688 5102 390

Family's Representative Sequence

Representative Sequence 3300002987|JGI25159J45721_1004826|JGI25159J45721_10048263
Length 427
Sequence MSSIVANFDLVKGKLAKVKGRKIEAPEFKTPFVKRPTGRSLDSFMGWRRENGRVGVRNHVLLLPLDDLSNAACEAVANNIKGTLAIPHAYGRLQFGEDLEVHFRTLIGTGSNPNVAAVIVIGIEDGWTKRVVDGIAKTGKPVVGFGIEGHGDIATIAKASYVAKEFVQWATELQRVKCGIEELWVSTKCGESDTTTGLSSCPTVGNMYDKWIPRGVYGVFGETSEITGAEHLCKARAATPEVGERWYKMWKAYQDDVIEAHKTDDLSDSQPTKGNIAGGLTTIEEKALGNLEKIGRECKFIDILEPAQAPEKGPGLYYMDTSSAAAECVTLMAAGGYVVHTFPTGQGNVIGNPIVPVIKITGNPKTMRTMPEHIDVDVSGILRRDLTIPQAGDALIENIVRTANGRLTAAEALGHREFSMTKLYRSA

Samples

Sample ID Description Type Environment
1 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
8 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
9 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
10 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
11 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
12 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
13 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
14 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
15 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
16 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
17 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
18 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
19 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
20 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
21 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
22 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
23 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
24 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
25 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
26 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
27 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
28 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
29 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
30 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
31 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
32 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
33 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
34 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
35 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
36 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
37 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
38 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
39 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
40 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
41 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
42 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
43 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
44 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
45 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
46 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
47 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
48 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
49 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
50 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
51 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
52 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
53 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
54 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
55 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
56 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
57 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
58 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
59 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
60 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
61 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
62 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
63 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
64 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
65 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
66 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
67 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
68 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
69 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
70 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
71 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
72 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
73 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
74 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
75 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
76 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
77 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
78 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
79 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
80 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
81 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
82 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
83 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
84 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
85 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
86 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
87 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
88 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
89 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
90 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
91 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
92 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
93 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
94 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
95 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
96 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
97 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
98 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
99 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
100 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
101 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
102 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
103 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
104 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
105 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
106 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
107 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
108 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
109 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
110 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
111 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
112 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
113 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
114 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
115 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
116 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
117 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
118 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
119 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
120 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
121 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
122 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
123 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
124 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
125 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
126 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
127 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
128 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
129 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
130 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
131 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
132 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
133 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
134 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
135 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
136 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
137 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
138 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
139 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
140 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
141 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
142 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
143 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
144 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
145 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
146 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
147 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
148 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
149 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
150 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
151 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
152 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
153 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
154 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
155 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
156 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
157 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
158 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
159 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
160 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
161 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
162 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
163 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
164 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
165 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
166 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
167 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
168 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
169 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
170 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
171 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
172 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
173 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
174 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
175 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
176 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
177 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
178 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
179 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
180 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
181 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
182 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
183 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
184 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
185 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
186 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
187 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
188 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
189 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
190 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
191 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
192 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
193 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
194 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
195 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
196 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
197 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
198 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
267 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
268 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
269 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
270 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
271 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
272 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
273 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
274 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
275 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
276 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
277 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
278 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
279 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
280 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
281 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
282 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
284 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
285 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
286 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
287 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
288 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
289 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
290 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
291 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
292 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
293 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
294 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
295 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
296 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
297 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
298 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
299 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
300 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
301 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
302 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
303 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
304 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
305 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
306 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
307 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
308 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
309 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
310 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
311 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
312 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
313 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
314 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
315 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
316 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
317 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
318 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
319 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
320 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
321 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
322 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
323 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
324 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
325 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
326 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
327 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
328 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
329 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
330 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
331 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
332 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
333 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
334 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
335 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
336 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
337 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
338 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
339 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
340 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
341 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
342 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
343 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
344 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
345 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
346 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
347 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
348 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
349 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
350 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
351 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
352 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
353 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
354 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
355 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
356 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
357 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
358 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
359 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
360 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
361 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
362 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
363 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
364 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
365 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
366 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
367 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
368 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
369 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
370 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
371 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
372 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
373 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
374 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
375 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
376 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
377 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
378 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
379 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
380 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
381 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
382 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
383 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
384 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
385 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
386 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
387 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
388 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
389 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
390 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
391 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
392 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
393 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
394 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
395 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
396 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
397 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
398 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
399 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
400 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
401 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
402 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
403 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
404 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
405 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
406 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
407 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
408 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
409 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
410 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
411 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
412 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
413 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
414 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
415 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
416 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
417 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
418 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
419 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
420 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
421 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
422 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
423 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
424 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
425 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
426 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
427 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
428 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
429 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
430 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
431 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
432 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
433 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
434 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
435 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
436 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
437 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
438 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
439 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
440 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
441 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
442 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
443 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
444 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
445 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
446 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
447 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
448 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
449 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
450 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
451 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
452 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
453 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
454 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
455 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
456 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
457 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
458 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
459 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
460 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
461 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
462 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
463 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
464 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
465 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
466 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
467 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
468 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
469 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
470 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
471 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
472 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
473 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
474 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
475 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
476 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
477 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
478 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
479 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
480 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
481 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
482 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
483 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
484 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
485 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
486 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
487 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
488 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
489 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
490 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
491 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
492 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
493 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
494 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
495 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
496 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
497 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
498 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
499 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
500 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
501 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
502 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
503 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
504 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
505 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
506 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
507 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
508 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
509 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
510 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
511 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
512 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
513 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
514 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
515 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
516 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
517 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
518 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
519 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
520 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
521 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
522 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
523 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
524 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
525 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
526 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
527 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
528 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
529 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
530 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
531 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
532 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
533 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
534 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
535 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
536 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
537 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
538 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
539 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
540 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
541 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
542 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
543 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
544 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
545 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
546 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
547 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
548 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
549 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
550 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
551 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
552 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
553 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
554 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
555 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
556 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
557 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
558 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
559 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
560 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
561 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
562 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
563 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
564 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
565 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
566 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
567 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
568 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
569 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
570 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
571 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
572 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
573 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
574 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
575 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
576 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
577 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
578 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
579 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
580 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
581 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
582 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
583 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
584 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
585 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
586 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
587 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
588 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
589 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
590 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
591 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
592 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
593 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
594 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
595 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
596 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
597 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
598 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
599 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
600 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
601 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
602 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
603 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
604 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
605 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
606 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
607 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
608 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
609 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
610 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
611 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
612 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
613 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
614 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
615 2643221569 Achromobacter sp. Root565 Isolate Unclassified
616 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
617 2643221594 Achromobacter sp. Root170 Isolate Unclassified
618 2643221621 Achromobacter sp. Root83 Isolate Unclassified
619 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
620 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
621 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
622 2643221733 Bosea sp. Root381 Isolate Unclassified
623 2643221736 Bosea sp. Root483D1 Isolate Unclassified
624 2671180694 Paenibacillus sp. A3 Isolate Unclassified
625 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
626 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
627 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
628 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
629 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
630 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
631 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
632 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
633 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
634 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
635 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
636 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
637 2836160341 Unclassified Planctomycetes Bin 134 Isolate Unclassified
638 2841760612 Bosea sp. Tri-49 Isolate Nodule
639 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
640 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
641 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
642 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
643 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
644 2844104063 Bosea sp. Tri-39 Isolate Nodule
645 2851182111 Bosea sp. Tri-44 Isolate Nodule
646 2851246043 Bosea sp. Tri-54 Isolate Nodule
647 2855730933 Achromobacter sp. HZ28 Isolate Nodule
648 2855767633 Achromobacter sp. HZ34 Isolate Nodule
649 2857472729 Cohnella sp. R-74144 Isolate Unclassified
650 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
651 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
652 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
653 2858950400 Achromobacter sp. K91 Isolate Unclassified
654 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
655 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
656 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
657 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
658 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
659 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
660 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
661 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
662 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
663 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
664 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
665 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
666 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
667 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
668 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
669 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
670 2904456579 Variovorax sp. 2002 Isolate Unclassified
671 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
672 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
673 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
674 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
675 2929520902 Variovorax beijingensis 502 Isolate Unclassified
676 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
677 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
678 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
679 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
680 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
681 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
682 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
683 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
684 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
685 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
686 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified
687 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule
688 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.16
Metatranscriptomes 0.27
Isolates 3.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.15
Nodule 0.82
Rhizoplane 3.57
Rhizosphere 84.63
Stem 0
Stem Tuber 0.04
Unclassified 0.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1004826 3300002987 Bacteria 4357
2 LJNas_1001084 3300000546 Bacteria 4229
3 JGI24752J21851_1006045 3300001976 Bacteria 1580
4 JGI24743J22301_10002711 3300001991 Bacteria 2710
5 JGI24749J21850_1004600 3300002076 Bacteria 1930
6 JGI24744J21845_10015542 3300002077 Bacteria 1521
7 JGI24751J29686_10023872 3300002459 Bacteria 1268
8 JGI25155J39150_1000102 3300002704 Bacteria 45181
9 JGI25156J39149_1000010 3300002705 Bacteria 200080
10 JGI25156J39149_1003941 3300002705 Bacteria 4692
11 JGI25154J39366_1000027 3300002738 Bacteria 200075
12 JGI25157J39369_1000146 3300002741 Bacteria 59929
13 JGI25152J39213_1001500 3300002773 Bacteria 9945
14 JGI25151J46595_10000665 3300003187 Bacteria 29242
15 JGI25151J46595_10001147 3300003187 Bacteria 19200
16 JGI25151J46595_10001988 3300003187 Bacteria 12814
17 JGI25151J46595_10006454 3300003187 Bacteria 5899
18 JGI25151J46595_10037386 3300003187 Bacteria 1821
19 JGI25406J46586_10000085 3300003203 Bacteria 42549
20 JGI25406J46586_10000963 3300003203 Bacteria 13521
21 JGI25153J46596_10001926 3300003215 Bacteria 12324
22 JGI25153J46596_10003713 3300003215 Bacteria 8427
23 JGI25160J50197_1000129 3300003354 Bacteria 68068
24 JGI25161J50226_1000080 3300003374 Bacteria 79971
25 JGI25404J52841_10010033 3300003659 Bacteria 2033
26 Ga0055529_1000955 3300003763 Bacteria 15071
27 Ga0055526_1000392 3300003771 Bacteria 35369
28 Ga0055526_1010926 3300003771 Bacteria 4159
29 Ga0055524_1000120 3300003775 Bacteria 91299
30 Ga0055524_1000220 3300003775 Bacteria 60522
31 Ga0055524_1014910 3300003775 Bacteria 2859
32 Ga0055534_1004574 3300003784 Bacteria 3956
33 Ga0055528_1005152 3300003790 Bacteria 6148
34 Ga0055530_10001496 3300003791 Bacteria 16970
35 Ga0055540_1000067 3300003792 Bacteria 122108
36 Ga0055540_1000742 3300003792 Bacteria 22142
37 Ga0055531_10001465 3300003794 Bacteria 17364
38 Ga0055543_1000782 3300004625 Bacteria 15786
39 Ga0065165_1000089 3300005262 Bacteria 150859
40 Ga0065165_1003799 3300005262 Bacteria 10095
41 Ga0065165_1010089 3300005262 Bacteria 4140
42 Ga0065714_10096614 3300005288 Bacteria 1756
43 Ga0065715_10109379 3300005293 Bacteria 2671
44 Ga0065715_10109792 3300005293 Bacteria 2652
45 Ga0065715_10111824 3300005293 Bacteria 2557
46 Ga0065707_10005979 3300005295 Bacteria 3405
47 Ga0070658_10004615 3300005327 Bacteria 11195
48 Ga0070658_10031847 3300005327 Bacteria 4237
49 Ga0070658_10033925 3300005327 Bacteria 4107
50 Ga0070658_10131546 3300005327 Bacteria 2086
51 Ga0070658_10139561 3300005327 Bacteria 2024
52 Ga0070676_10030944 3300005328 Bacteria 3056
53 Ga0070676_10032265 3300005328 Bacteria 3000
54 Ga0070676_10035163 3300005328 Bacteria 2880
55 Ga0070676_10053655 3300005328 Bacteria 2375
56 Ga0070676_10063347 3300005328 Bacteria 2202
57 Ga0070676_10091806 3300005328 Bacteria 1861
58 Ga0070683_100003861 3300005329 Bacteria 12250
59 Ga0070683_100004329 3300005329 Bacteria 11672
60 Ga0070683_100024665 3300005329 Bacteria 5390
61 Ga0070683_100193150 3300005329 Bacteria 1933
62 Ga0070690_100000791 3300005330 Bacteria 16062
63 Ga0070690_100002610 3300005330 Bacteria 9708
64 Ga0070690_100038731 3300005330 Bacteria 3010
65 Ga0070690_100132853 3300005330 Bacteria 1682
66 Ga0070670_100003026 3300005331 Bacteria 13907
67 Ga0070670_100003111 3300005331 Bacteria 13732
68 Ga0070670_100003829 3300005331 Bacteria 12534
69 Ga0070670_100008102 3300005331 Bacteria 8938
70 Ga0070670_100012137 3300005331 Bacteria 7369
71 Ga0070670_100097346 3300005331 Bacteria 2531
72 Ga0070670_100108692 3300005331 Bacteria 2390
73 Ga0070670_100154343 3300005331 Bacteria 1988
74 Ga0070670_100166482 3300005331 Bacteria 1911
75 Ga0070670_100235863 3300005331 Bacteria 1592
76 Ga0070677_10007914 3300005333 Bacteria 3559
77 Ga0070677_10023224 3300005333 Bacteria 2294
78 Ga0070677_10096775 3300005333 Bacteria 1294
79 Ga0068869_100000765 3300005334 Bacteria 18276
80 Ga0068869_100001018 3300005334 Bacteria 16298
81 Ga0068869_100042720 3300005334 Bacteria 3252
82 Ga0068869_100055614 3300005334 Bacteria 2884
83 Ga0068869_100077594 3300005334 Bacteria 2472
84 Ga0068869_100345413 3300005334 Bacteria 1212
85 Ga0070666_10001146 3300005335 Bacteria 16113
86 Ga0070666_10002429 3300005335 Bacteria 11261
87 Ga0070666_10028081 3300005335 Bacteria 3691
88 Ga0070666_10036356 3300005335 Bacteria 3269
89 Ga0070666_10122534 3300005335 Bacteria 1804
90 Ga0070666_10152790 3300005335 Bacteria 1611
91 Ga0070680_100009247 3300005336 Bacteria 7559
92 Ga0070680_100009721 3300005336 Bacteria 7402
93 Ga0070680_100018087 3300005336 Bacteria 5567
94 Ga0070680_100047040 3300005336 Bacteria 3512
95 Ga0070680_100053041 3300005336 Bacteria 3309
96 Ga0070680_100061472 3300005336 Bacteria 3075
97 Ga0070680_100067178 3300005336 Bacteria 2940
98 Ga0070680_100081819 3300005336 Bacteria 2664
99 Ga0070680_100144337 3300005336 Bacteria 1997
100 Ga0070680_100213452 3300005336 Bacteria 1628
101 Ga0070680_100232628 3300005336 Bacteria 1557
102 Ga0070682_100013046 3300005337 Bacteria 4771
103 Ga0070682_100018870 3300005337 Bacteria 4038
104 Ga0068868_100001147 3300005338 Bacteria 18142
105 Ga0068868_100002556 3300005338 Bacteria 12651
106 Ga0068868_100021273 3300005338 Bacteria 4885
107 Ga0068868_100021806 3300005338 Bacteria 4828
108 Ga0068868_100022425 3300005338 Bacteria 4764
109 Ga0068868_100023378 3300005338 Bacteria 4677
110 Ga0068868_100059175 3300005338 Bacteria 3030
111 Ga0068868_100099979 3300005338 Bacteria 2346
112 Ga0068868_100130729 3300005338 Bacteria 2054
113 Ga0070660_100000414 3300005339 Bacteria 28402
114 Ga0070660_100007676 3300005339 Bacteria 7517
115 Ga0070660_100011856 3300005339 Bacteria 6213
116 Ga0070660_100281948 3300005339 Bacteria 1360
117 Ga0070689_100015635 3300005340 Bacteria 5538
118 Ga0070689_100028507 3300005340 Bacteria 4221
119 Ga0070689_100036959 3300005340 Bacteria 3736
120 Ga0070689_100055599 3300005340 Bacteria 3067
121 Ga0070691_10008601 3300005341 Bacteria 4672
122 Ga0070691_10011393 3300005341 Bacteria 4060
123 Ga0070691_10022802 3300005341 Bacteria 2906
124 Ga0070691_10068626 3300005341 Bacteria 1717
125 Ga0070687_100000304 3300005343 Bacteria 16643
126 Ga0070687_100056866 3300005343 Bacteria 2048
127 Ga0070661_100001393 3300005344 Bacteria 16882
128 Ga0070661_100002474 3300005344 Bacteria 12663
129 Ga0070661_100013149 3300005344 Bacteria 5809
130 Ga0070661_100013622 3300005344 Bacteria 5710
131 Ga0070661_100027259 3300005344 Bacteria 4112
132 Ga0070661_100208388 3300005344 Bacteria 1495
133 Ga0070692_10003468 3300005345 Bacteria 6398
134 Ga0070692_10003506 3300005345 Bacteria 6373
135 Ga0070668_100001125 3300005347 Bacteria 18781
136 Ga0070668_100002102 3300005347 Bacteria 14565
137 Ga0070668_100002366 3300005347 Bacteria 13865
138 Ga0070668_100004406 3300005347 Bacteria 10453
139 Ga0070668_100011384 3300005347 Bacteria 6626
140 Ga0070668_100016884 3300005347 Bacteria 5460
141 Ga0070668_100025270 3300005347 Bacteria 4502
142 Ga0070668_100026967 3300005347 Bacteria 4361
143 Ga0070668_100074994 3300005347 Bacteria 2640
144 Ga0070669_100047634 3300005353 Bacteria 3127
145 Ga0070669_100053873 3300005353 Bacteria 2945
146 Ga0070669_100111016 3300005353 Bacteria 2081
147 Ga0070675_100003449 3300005354 Bacteria 11977
148 Ga0070675_100005167 3300005354 Bacteria 9955
149 Ga0070675_100012529 3300005354 Bacteria 6647
150 Ga0070675_100022937 3300005354 Bacteria 4988
151 Ga0070675_100029663 3300005354 Bacteria 4413
152 Ga0070675_100042024 3300005354 Bacteria 3734
153 Ga0070675_100054875 3300005354 Bacteria 3279
154 Ga0070675_100058740 3300005354 Bacteria 3172
155 Ga0070675_100082426 3300005354 Bacteria 2683
156 Ga0070675_100197462 3300005354 Bacteria 1745
157 Ga0070671_100000338 3300005355 Bacteria 32240
158 Ga0070671_100006434 3300005355 Bacteria 9385
159 Ga0070671_100009895 3300005355 Bacteria 7657
160 Ga0070671_100025730 3300005355 Bacteria 4831
161 Ga0070671_100029700 3300005355 Bacteria 4508
162 Ga0070671_100043354 3300005355 Bacteria 3738
163 Ga0070671_100045096 3300005355 Bacteria 3665
164 Ga0070671_100071227 3300005355 Bacteria 2901
165 Ga0070674_100001258 3300005356 Bacteria 13315
166 Ga0070674_100001631 3300005356 Bacteria 12072
167 Ga0070674_100010861 3300005356 Bacteria 5522
168 Ga0070674_100012431 3300005356 Bacteria 5228
169 Ga0070674_100017576 3300005356 Bacteria 4504
170 Ga0070674_100022508 3300005356 Bacteria 4066
171 Ga0070674_100045874 3300005356 Bacteria 2987
172 Ga0070674_100049172 3300005356 Bacteria 2898
173 Ga0070674_100083748 3300005356 Bacteria 2285
174 Ga0070674_100096938 3300005356 Bacteria 2141
175 Ga0070674_100229580 3300005356 Bacteria 1448
176 Ga0070673_100000088 3300005364 Bacteria 39833
177 Ga0070673_100009518 3300005364 Bacteria 6524
178 Ga0070673_100038782 3300005364 Bacteria 3640
179 Ga0070673_100042543 3300005364 Bacteria 3503
180 Ga0070673_100055219 3300005364 Bacteria 3129
181 Ga0070673_100097997 3300005364 Bacteria 2409
182 Ga0070673_100123447 3300005364 Bacteria 2164
183 Ga0070673_100158345 3300005364 Bacteria 1924
184 Ga0070673_100194102 3300005364 Bacteria 1745
185 Ga0070688_100001429 3300005365 Bacteria 11887
186 Ga0070688_100002890 3300005365 Bacteria 8757
187 Ga0070659_100000526 3300005366 Bacteria 27993
188 Ga0070659_100018703 3300005366 Bacteria 5230
189 Ga0070659_100026219 3300005366 Bacteria 4482
190 Ga0070659_100095232 3300005366 Bacteria 2391
191 Ga0070659_100240271 3300005366 Bacteria 1499
192 Ga0070659_100284167 3300005366 Bacteria 1377
193 Ga0070667_100002119 3300005367 Bacteria 17493
194 Ga0070667_100004866 3300005367 Bacteria 11253
195 Ga0070667_100007593 3300005367 Bacteria 8992
196 Ga0070667_100010142 3300005367 Bacteria 7793
197 Ga0070667_100013844 3300005367 Bacteria 6668
198 Ga0070667_100013983 3300005367 Bacteria 6634
199 Ga0070667_100019067 3300005367 Bacteria 5688
200 Ga0070667_100024190 3300005367 Bacteria 5044
201 Ga0070667_100031393 3300005367 Bacteria 4430
202 Ga0070667_100037267 3300005367 Bacteria 4077
203 Ga0070667_100052433 3300005367 Bacteria 3442
204 Ga0070667_100077023 3300005367 Bacteria 2847
205 Ga0070667_100079962 3300005367 Bacteria 2795
206 Ga0070667_100097524 3300005367 Bacteria 2536
207 Ga0070667_100166561 3300005367 Bacteria 1944
208 Ga0070667_100185192 3300005367 Bacteria 1842
209 Ga0070709_10000166 3300005434 Bacteria 41674
210 Ga0070709_10017608 3300005434 Bacteria 4101
211 Ga0070709_10060445 3300005434 Bacteria 2409
212 Ga0070714_100000688 3300005435 Bacteria 23874
213 Ga0070714_100002535 3300005435 Bacteria 13462
214 Ga0070714_100005454 3300005435 Bacteria 9711
215 Ga0070714_100006050 3300005435 Bacteria 9289
216 Ga0070714_100007950 3300005435 Bacteria 8262
217 Ga0070714_100015514 3300005435 Bacteria 6128
218 Ga0070714_100030334 3300005435 Bacteria 4499
219 Ga0070714_100056448 3300005435 Bacteria 3359
220 Ga0070714_100066445 3300005435 Bacteria 3108
221 Ga0070714_100154862 3300005435 Bacteria 2068
222 Ga0070714_100308075 3300005435 Bacteria 1478
223 Ga0070713_100000050 3300005436 Bacteria 73746
224 Ga0070713_100000296 3300005436 Bacteria 32917
225 Ga0070713_100001145 3300005436 Bacteria 16990
226 Ga0070713_100003263 3300005436 Bacteria 10702
227 Ga0070713_100006994 3300005436 Bacteria 7877
228 Ga0070713_100041234 3300005436 Bacteria 3760
229 Ga0070713_100181970 3300005436 Bacteria 1889
230 Ga0070710_10000177 3300005437 Bacteria 29266
231 Ga0070710_10070659 3300005437 Bacteria 2011
232 Ga0070710_10088176 3300005437 Bacteria 1825
233 Ga0070701_10000171 3300005438 Bacteria 20076
234 Ga0070711_100003077 3300005439 Bacteria 9646
235 Ga0070711_100018275 3300005439 Bacteria 4473
236 Ga0070705_100000234 3300005440 Bacteria 32936
237 Ga0070705_100030916 3300005440 Bacteria 2960
238 Ga0070705_100179028 3300005440 Bacteria 1434
239 Ga0070700_100000396 3300005441 Bacteria 22554
240 Ga0070700_100003757 3300005441 Bacteria 7858
241 Ga0070700_100009762 3300005441 Bacteria 5276
242 Ga0070694_100000367 3300005444 Bacteria 24183
243 Ga0070694_100048846 3300005444 Bacteria 2847
244 Ga0070694_100141761 3300005444 Bacteria 1747
245 Ga0070708_100000482 3300005445 Bacteria 30278
246 Ga0070708_100005262 3300005445 Bacteria 10243
247 Ga0070708_100018279 3300005445 Bacteria 5866
248 Ga0070708_100028996 3300005445 Bacteria 4768
249 Ga0070708_100194359 3300005445 Bacteria 1898
250 Ga0070663_100003639 3300005455 Bacteria 8925
251 Ga0070663_100008039 3300005455 Bacteria 6467
252 Ga0070663_100014515 3300005455 Bacteria 5059
253 Ga0070663_100022478 3300005455 Bacteria 4218
254 Ga0070663_100023734 3300005455 Bacteria 4116
255 Ga0070663_100089090 3300005455 Bacteria 2283
256 Ga0070678_100000181 3300005456 Bacteria 27394
257 Ga0070678_100003020 3300005456 Bacteria 9322
258 Ga0070678_100003364 3300005456 Bacteria 8915
259 Ga0070678_100003576 3300005456 Bacteria 8673
260 Ga0070678_100004173 3300005456 Bacteria 8154
261 Ga0070678_100005633 3300005456 Bacteria 7269
262 Ga0070678_100019293 3300005456 Bacteria 4442
263 Ga0070678_100020420 3300005456 Bacteria 4346
264 Ga0070678_100073367 3300005456 Bacteria 2568
265 Ga0070662_100000260 3300005457 Bacteria 31271
266 Ga0070662_100014312 3300005457 Bacteria 5297
267 Ga0070662_100015884 3300005457 Bacteria 5049
268 Ga0070662_100018876 3300005457 Bacteria 4672
269 Ga0070662_100021232 3300005457 Bacteria 4432
270 Ga0070662_100033017 3300005457 Bacteria 3642
271 Ga0070662_100140000 3300005457 Bacteria 1874
272 Ga0070662_100151198 3300005457 Bacteria 1807
273 Ga0070681_10000270 3300005458 Bacteria 41405
274 Ga0070681_10004175 3300005458 Bacteria 13673
275 Ga0070681_10008106 3300005458 Bacteria 10278
276 Ga0070681_10015325 3300005458 Bacteria 7626
277 Ga0070681_10018680 3300005458 Bacteria 6933
278 Ga0070681_10084807 3300005458 Bacteria 3120
279 Ga0070681_10117545 3300005458 Bacteria 2595
280 Ga0068867_100001228 3300005459 Bacteria 17661
281 Ga0068867_100002868 3300005459 Bacteria 12133
282 Ga0068867_100006609 3300005459 Bacteria 8198
283 Ga0068867_100008399 3300005459 Bacteria 7282
284 Ga0068867_100014239 3300005459 Bacteria 5634
285 Ga0068867_100120473 3300005459 Bacteria 2027
286 Ga0068867_100218880 3300005459 Bacteria 1533
287 Ga0068867_100257386 3300005459 Bacteria 1422
288 Ga0070685_10001545 3300005466 Bacteria 12142
289 Ga0070706_100000916 3300005467 Bacteria 32335
290 Ga0070706_100010400 3300005467 Bacteria 8641
291 Ga0070706_100023387 3300005467 Bacteria 5691
292 Ga0070706_100041792 3300005467 Bacteria 4234
293 Ga0070706_100074346 3300005467 Bacteria 3145
294 Ga0070707_100006418 3300005468 Bacteria 10932
295 Ga0070707_100054091 3300005468 Bacteria 3848
296 Ga0070707_100088252 3300005468 Bacteria 3000
297 Ga0070707_100256846 3300005468 Unclassified 1700
298 Ga0070698_100020280 3300005471 Bacteria 6966
299 Ga0070698_100085575 3300005471 Bacteria 3140
300 Ga0070698_100356594 3300005471 Bacteria 1394
301 Ga0070699_100001364 3300005518 Bacteria 22452
302 Ga0070699_100007905 3300005518 Bacteria 9243
303 Ga0070699_100018493 3300005518 Bacteria 5984
304 Ga0070699_100027305 3300005518 Bacteria 4926
305 Ga0070699_100039229 3300005518 Bacteria 4101
306 Ga0070699_100040940 3300005518 Bacteria 4010
307 Ga0070699_100062738 3300005518 Bacteria 3221
308 Ga0070699_100154268 3300005518 Bacteria 2032
309 Ga0070699_100267397 3300005518 Bacteria 1530
310 Ga0070679_100003292 3300005530 Bacteria 14788
311 Ga0070679_100009100 3300005530 Bacteria 9372
312 Ga0070679_100009718 3300005530 Bacteria 9099
313 Ga0070679_100011541 3300005530 Bacteria 8422
314 Ga0070679_100015757 3300005530 Bacteria 7271
315 Ga0070679_100016703 3300005530 Bacteria 7090
316 Ga0070679_100019099 3300005530 Bacteria 6659
317 Ga0070679_100026131 3300005530 Bacteria 5732
318 Ga0070679_100029306 3300005530 Bacteria 5431
319 Ga0070679_100059424 3300005530 Bacteria 3811
320 Ga0070679_100073882 3300005530 Bacteria 3401
321 Ga0070679_100088141 3300005530 Bacteria 3090
322 Ga0070679_100169850 3300005530 Bacteria 2154
323 Ga0070679_100170041 3300005530 Bacteria 2152
324 Ga0070684_100000545 3300005535 Bacteria 25878
325 Ga0070684_100020182 3300005535 Bacteria 5528
326 Ga0070684_100061046 3300005535 Bacteria 3299
327 Ga0070684_100081786 3300005535 Bacteria 2858
328 Ga0070684_100102937 3300005535 Bacteria 2553
329 Ga0070684_100137869 3300005535 Bacteria 2205
330 Ga0070697_100010429 3300005536 Bacteria 7251
331 Ga0070697_100012160 3300005536 Bacteria 6741
332 Ga0070697_100074049 3300005536 Bacteria 2797
333 Ga0070697_100144999 3300005536 Bacteria 1998
334 Ga0070697_100341772 3300005536 Bacteria 1292
335 Ga0068853_100001405 3300005539 Bacteria 17386
336 Ga0068853_100001673 3300005539 Bacteria 16221
337 Ga0068853_100030506 3300005539 Bacteria 4554
338 Ga0068853_100111784 3300005539 Bacteria 2427
339 Ga0068853_100136664 3300005539 Bacteria 2198
340 Ga0068853_100174994 3300005539 Bacteria 1944
341 Ga0070672_100000162 3300005543 Bacteria 36932
342 Ga0070672_100002172 3300005543 Bacteria 12368
343 Ga0070672_100005135 3300005543 Bacteria 8641
344 Ga0070672_100010390 3300005543 Bacteria 6457
345 Ga0070672_100028301 3300005543 Bacteria 4191
346 Ga0070672_100033301 3300005543 Bacteria 3901
347 Ga0070672_100091418 3300005543 Bacteria 2455
348 Ga0070672_100111685 3300005543 Bacteria 2228
349 Ga0070672_100160907 3300005543 Bacteria 1862
350 Ga0070672_100194532 3300005543 Bacteria 1694
351 Ga0070672_100241519 3300005543 Bacteria 1519
352 Ga0070686_100000664 3300005544 Bacteria 20136
353 Ga0070686_100039547 3300005544 Bacteria 2939
354 Ga0070686_100096357 3300005544 Bacteria 1989
355 Ga0070686_100106129 3300005544 Bacteria 1906
356 Ga0070695_100000111 3300005545 Bacteria 36343
357 Ga0070695_100001361 3300005545 Bacteria 13561
358 Ga0070695_100011788 3300005545 Bacteria 5234
359 Ga0070695_100047364 3300005545 Bacteria 2745
360 Ga0070695_100065579 3300005545 Bacteria 2365
361 Ga0070695_100079680 3300005545 Bacteria 2163
362 Ga0070696_100000082 3300005546 Bacteria 47144
363 Ga0070696_100003444 3300005546 Bacteria 10532
364 Ga0070696_100021368 3300005546 Bacteria 4387
365 Ga0070696_100032551 3300005546 Bacteria 3577
366 Ga0070696_100045224 3300005546 Bacteria 3050
367 Ga0070693_100000114 3300005547 Bacteria 35958
368 Ga0070693_100000865 3300005547 Bacteria 13507
369 Ga0070693_100001728 3300005547 Bacteria 9939
370 Ga0070693_100005035 3300005547 Bacteria 6312
371 Ga0070693_100062816 3300005547 Bacteria 2162
372 Ga0070665_100002442 3300005548 Bacteria 20489
373 Ga0070665_100016639 3300005548 Bacteria 7370
374 Ga0070665_100029771 3300005548 Bacteria 5494
375 Ga0070665_100053727 3300005548 Bacteria 4040
376 Ga0070665_100099737 3300005548 Bacteria 2908
377 Ga0070665_100115672 3300005548 Bacteria 2685
378 Ga0070665_100128633 3300005548 Bacteria 2535
379 Ga0070665_100131950 3300005548 Bacteria 2500
380 Ga0070704_100000018 3300005549 Bacteria 54668
381 Ga0070704_100001228 3300005549 Bacteria 13503
382 Ga0070704_100033699 3300005549 Bacteria 3465
383 Ga0070704_100045554 3300005549 Bacteria 3053
384 Ga0070704_100047528 3300005549 Bacteria 3000
385 Ga0070704_100280801 3300005549 Bacteria 1379
386 Ga0068855_100000110 3300005563 Bacteria 102379
387 Ga0068855_100003278 3300005563 Bacteria 19819
388 Ga0068855_100005802 3300005563 Bacteria 15063
389 Ga0068855_100008462 3300005563 Bacteria 12442
390 Ga0068855_100012806 3300005563 Bacteria 10119
391 Ga0068855_100015031 3300005563 Bacteria 9322
392 Ga0068855_100026128 3300005563 Bacteria 6985
393 Ga0068855_100026300 3300005563 Bacteria 6961
394 Ga0068855_100055276 3300005563 Bacteria 4663
395 Ga0068855_100061401 3300005563 Bacteria 4391
396 Ga0068855_100071639 3300005563 Bacteria 4030
397 Ga0068855_100078243 3300005563 Bacteria 3836
398 Ga0068855_100102704 3300005563 Bacteria 3290
399 Ga0068855_100109076 3300005563 Bacteria 3179
400 Ga0068855_100213025 3300005563 Bacteria 2170
401 Ga0068855_100250382 3300005563 Bacteria 1976
402 Ga0068855_100257576 3300005563 Bacteria 1944
403 Ga0068855_100304165 3300005563 Bacteria 1765
404 Ga0068855_100313391 3300005563 Bacteria 1735
405 Ga0068855_100318261 3300005563 Bacteria 1720
406 Ga0070664_100000378 3300005564 Bacteria 33105
407 Ga0070664_100008665 3300005564 Bacteria 8231
408 Ga0070664_100025255 3300005564 Bacteria 4923
409 Ga0070664_100031992 3300005564 Bacteria 4400
410 Ga0070664_100131581 3300005564 Bacteria 2198
411 Ga0070664_100213331 3300005564 Bacteria 1726
412 Ga0070664_100229970 3300005564 Bacteria 1662
413 Ga0068857_100001558 3300005577 Bacteria 18383
414 Ga0068857_100023087 3300005577 Bacteria 5472
415 Ga0068857_100193717 3300005577 Bacteria 1852
416 Ga0068857_100204717 3300005577 Bacteria 1800
417 Ga0068854_100001530 3300005578 Bacteria 14031
418 Ga0068854_100006640 3300005578 Bacteria 7371
419 Ga0068854_100017510 3300005578 Bacteria 4794
420 Ga0068854_100024990 3300005578 Bacteria 4098
421 Ga0068854_100031933 3300005578 Bacteria 3661
422 Ga0068854_100113346 3300005578 Bacteria 2048
423 Ga0068854_100117862 3300005578 Bacteria 2011
424 Ga0068854_100173130 3300005578 Unclassified 1681
425 Ga0068854_100197974 3300005578 Bacteria 1578
426 Ga0068856_100000111 3300005614 Bacteria 81104
427 Ga0068856_100005394 3300005614 Bacteria 12607
428 Ga0068856_100007590 3300005614 Bacteria 10584
429 Ga0068856_100014426 3300005614 Bacteria 7633
430 Ga0068856_100028421 3300005614 Bacteria 5461
431 Ga0068856_100048125 3300005614 Bacteria 4201
432 Ga0068856_100174136 3300005614 Unclassified 2164
433 Ga0068856_100417654 3300005614 Bacteria 1361
434 Ga0070702_100000345 3300005615 Bacteria 16164
435 Ga0068852_100003212 3300005616 Bacteria 11414
436 Ga0068852_100004140 3300005616 Bacteria 10216
437 Ga0068852_100017789 3300005616 Bacteria 5586
438 Ga0068852_100019144 3300005616 Bacteria 5410
439 Ga0068852_100020157 3300005616 Bacteria 5297
440 Ga0068852_100025599 3300005616 Bacteria 4783
441 Ga0068852_100027955 3300005616 Bacteria 4607
442 Ga0068852_100031859 3300005616 Bacteria 4358
443 Ga0068852_100048828 3300005616 Unclassified 3618
444 Ga0068852_100101955 3300005616 Bacteria 2593
445 Ga0068852_100179663 3300005616 Bacteria 1989
446 Ga0068852_100282870 3300005616 Bacteria 1600
447 Ga0068859_100000050 3300005617 Bacteria 131351
448 Ga0068859_100001228 3300005617 Bacteria 26165
449 Ga0068859_100001261 3300005617 Bacteria 25857
450 Ga0068859_100005369 3300005617 Bacteria 13040
451 Ga0068859_100020233 3300005617 Bacteria 6681
452 Ga0068859_100039506 3300005617 Bacteria 4734
453 Ga0068859_100071664 3300005617 Bacteria 3501
454 Ga0068859_100122048 3300005617 Bacteria 2672
455 Ga0068859_100137103 3300005617 Bacteria 2520
456 Ga0068859_100137529 3300005617 Bacteria 2517
457 Ga0068859_100166988 3300005617 Bacteria 2281
458 Ga0068859_100242045 3300005617 Bacteria 1894
459 Ga0068864_100000460 3300005618 Bacteria 35285
460 Ga0068864_100002785 3300005618 Bacteria 14445
461 Ga0068864_100016703 3300005618 Bacteria 6115
462 Ga0068864_100027165 3300005618 Bacteria 4831
463 Ga0068864_100094192 3300005618 Bacteria 2646
464 Ga0068864_100102538 3300005618 Bacteria 2539
465 Ga0068864_100123793 3300005618 Bacteria 2315
466 Ga0068864_100140665 3300005618 Bacteria 2177
467 Ga0068864_100141225 3300005618 Bacteria 2172
468 Ga0068866_10000156 3300005718 Bacteria 31375
469 Ga0068866_10003100 3300005718 Bacteria 6850
470 Ga0068866_10006388 3300005718 Bacteria 4908
471 Ga0068861_100001057 3300005719 Bacteria 16951
472 Ga0068861_100009536 3300005719 Bacteria 6707
473 Ga0068861_100023788 3300005719 Bacteria 4423
474 Ga0068861_100057676 3300005719 Bacteria 2967
475 Ga0068861_100078478 3300005719 Bacteria 2578
476 Ga0068861_100160238 3300005719 Bacteria 1855
477 Ga0068861_100211799 3300005719 Bacteria 1633
478 Ga0068851_10000414 3300005834 Bacteria 19144
479 Ga0068851_10001349 3300005834 Bacteria 10720
480 Ga0068851_10087221 3300005834 Bacteria 1638
481 Ga0068870_10008908 3300005840 Bacteria 4534
482 Ga0068870_10016826 3300005840 Bacteria 3504
483 Ga0068870_10106359 3300005840 Bacteria 1594
484 Ga0068870_10117541 3300005840 Bacteria 1527
485 Ga0068863_100001068 3300005841 Bacteria 27364
486 Ga0068863_100025983 3300005841 Bacteria 5587
487 Ga0068863_100040897 3300005841 Bacteria 4407
488 Ga0068863_100051003 3300005841 Bacteria 3922
489 Ga0068863_100051490 3300005841 Bacteria 3903
490 Ga0068863_100057234 3300005841 Bacteria 3690
491 Ga0068863_100090628 3300005841 Bacteria 2899
492 Ga0068863_100096663 3300005841 Bacteria 2804
493 Ga0068863_100096791 3300005841 Bacteria 2802
494 Ga0068863_100143699 3300005841 Bacteria 2281
495 Ga0068858_100000509 3300005842 Bacteria 40798
496 Ga0068858_100000908 3300005842 Bacteria 30684
497 Ga0068858_100000936 3300005842 Bacteria 30216
498 Ga0068858_100001799 3300005842 Bacteria 21863
499 Ga0068858_100003300 3300005842 Bacteria 16062
500 Ga0068858_100004438 3300005842 Bacteria 13763
501 Ga0068858_100015891 3300005842 Bacteria 7073
502 Ga0068858_100073047 3300005842 Bacteria 3184
503 Ga0068858_100160385 3300005842 Bacteria 2117
504 Ga0068858_100202702 3300005842 Bacteria 1876
505 Ga0068860_100000654 3300005843 Bacteria 40345
506 Ga0068860_100002554 3300005843 Bacteria 19028
507 Ga0068860_100005079 3300005843 Bacteria 13385
508 Ga0068860_100013086 3300005843 Bacteria 8143
509 Ga0068860_100029150 3300005843 Bacteria 5309
510 Ga0068860_100055316 3300005843 Bacteria 3772
511 Ga0068860_100132929 3300005843 Bacteria 2389
512 Ga0068860_100253711 3300005843 Bacteria 1713
513 Ga0068860_100319516 3300005843 Bacteria 1524
514 Ga0068862_100002561 3300005844 Bacteria 16062
515 Ga0068862_100005682 3300005844 Bacteria 10408
516 Ga0068862_100013649 3300005844 Bacteria 6726
517 Ga0068862_100048752 3300005844 Bacteria 3616
518 Ga0068862_100090908 3300005844 Bacteria 2658
519 Ga0081538_10002434 3300005981 Bacteria 18220
520 Ga0081538_10038698 3300005981 Bacteria 3072
521 Ga0081540_1000034 3300005983 Bacteria 142197
522 Ga0081540_1000233 3300005983 Bacteria 58300
523 Ga0081540_1014864 3300005983 Bacteria 4956
524 Ga0081540_1044763 3300005983 Bacteria 2256
525 Ga0081539_10000003 3300005985 Bacteria 594833
526 Ga0081539_10000226 3300005985 Bacteria 132618
527 Ga0081539_10000350 3300005985 Bacteria 101255
528 Ga0081539_10002808 3300005985 Bacteria 23283
529 Ga0081539_10011647 3300005985 Bacteria 6921
530 Ga0081539_10046218 3300005985 Bacteria 2496
531 Ga0070717_10004190 3300006028 Bacteria 10395
532 Ga0070717_10005576 3300006028 Bacteria 9182
533 Ga0075365_10006017 3300006038 Bacteria 6626
534 Ga0075365_10021391 3300006038 Bacteria 4035
535 Ga0075365_10021774 3300006038 Bacteria 4005
536 Ga0075363_100003654 3300006048 Bacteria 6605
537 Ga0075363_100014909 3300006048 Bacteria 3811
538 Ga0075363_100047677 3300006048 Bacteria 2276
539 Ga0075364_10011203 3300006051 Bacteria 5444
540 Ga0075364_10073250 3300006051 Bacteria 2257
541 Ga0070715_10007390 3300006163 Bacteria 3782
542 Ga0070716_100024556 3300006173 Bacteria 3209
543 Ga0070712_100001526 3300006175 Bacteria 14126
544 Ga0070712_100068090 3300006175 Bacteria 2535
545 Ga0075362_10004553 3300006177 Bacteria 4994
546 Ga0075362_10006498 3300006177 Bacteria 4362
547 Ga0075362_10013784 3300006177 Bacteria 3245
548 Ga0075367_10002211 3300006178 Bacteria 8773
549 Ga0075367_10010754 3300006178 Bacteria 4819
550 Ga0075367_10020194 3300006178 Bacteria 3706
551 Ga0075367_10046150 3300006178 Bacteria 2559
552 Ga0075367_10155512 3300006178 Bacteria 1420
553 Ga0075369_10003214 3300006186 Bacteria 5930
554 Ga0075369_10005977 3300006186 Bacteria 4581
555 Ga0075369_10021320 3300006186 Bacteria 2661
556 Ga0075366_10000889 3300006195 Bacteria 14448
557 Ga0075366_10004299 3300006195 Bacteria 7642
558 Ga0075366_10005946 3300006195 Bacteria 6639
559 Ga0075366_10010089 3300006195 Bacteria 5293
560 Ga0075366_10017173 3300006195 Bacteria 4162
561 Ga0075366_10034969 3300006195 Bacteria 2962
562 Ga0075366_10067248 3300006195 Bacteria 2132
563 Ga0075366_10123704 3300006195 Bacteria 1559
564 Ga0097621_100005385 3300006237 Bacteria 9019
565 Ga0097621_100016314 3300006237 Bacteria 5611
566 Ga0097621_100021031 3300006237 Bacteria 5037
567 Ga0097621_100045565 3300006237 Bacteria 3543
568 Ga0097621_100105628 3300006237 Bacteria 2375
569 Ga0097621_100160476 3300006237 Bacteria 1932
570 Ga0097621_100165215 3300006237 Bacteria 1905
571 Ga0097621_100205692 3300006237 Bacteria 1710
572 Ga0075370_10000260 3300006353 Bacteria 18957
573 Ga0075370_10003339 3300006353 Bacteria 7622
574 Ga0075370_10004894 3300006353 Bacteria 6575
575 Ga0075370_10020321 3300006353 Bacteria 3627
576 Ga0075370_10043805 3300006353 Bacteria 2530
577 Ga0068871_100002592 3300006358 Bacteria 12334
578 Ga0068871_100003991 3300006358 Bacteria 10206
579 Ga0068871_100005158 3300006358 Bacteria 9134
580 Ga0068871_100014718 3300006358 Bacteria 5838
581 Ga0068871_100020821 3300006358 Bacteria 5031
582 Ga0068871_100044435 3300006358 Bacteria 3573
583 Ga0068871_100044872 3300006358 Bacteria 3556
584 Ga0068871_100121511 3300006358 Bacteria 2206
585 Ga0068871_100165706 3300006358 Bacteria 1892
586 Ga0068871_100203430 3300006358 Bacteria 1710
587 Ga0068871_100219035 3300006358 Bacteria 1648
588 Ga0068871_100254005 3300006358 Bacteria 1532
589 Ga0075428_100001234 3300006844 Bacteria 27338
590 Ga0075428_100004047 3300006844 Bacteria 16112
591 Ga0075428_100007549 3300006844 Bacteria 12051
592 Ga0075428_100022830 3300006844 Bacteria 6923
593 Ga0075428_100025082 3300006844 Bacteria 6596
594 Ga0075428_100036509 3300006844 Bacteria 5412
595 Ga0075428_100044680 3300006844 Bacteria 4867
596 Ga0075428_100073981 3300006844 Bacteria 3722
597 Ga0075428_100178975 3300006844 Bacteria 2296
598 Ga0075428_100208739 3300006844 Bacteria 2111
599 Ga0075430_100019910 3300006846 Bacteria 5709
600 Ga0075430_100103452 3300006846 Bacteria 2377
601 Ga0075430_100134215 3300006846 Bacteria 2063
602 Ga0075431_100004172 3300006847 Bacteria 14132
603 Ga0075431_100005968 3300006847 Bacteria 12063
604 Ga0075431_100028493 3300006847 Bacteria 5740
605 Ga0075431_100061865 3300006847 Bacteria 3863
606 Ga0075431_100083839 3300006847 Bacteria 3290
607 Ga0075431_100097021 3300006847 Bacteria 3043
608 Ga0075431_100115980 3300006847 Bacteria 2765
609 Ga0075433_10005257 3300006852 Bacteria 10150
610 Ga0075433_10010717 3300006852 Bacteria 7372
611 Ga0075433_10015526 3300006852 Bacteria 6251
612 Ga0075433_10053925 3300006852 Bacteria 3507
613 Ga0075433_10089679 3300006852 Bacteria 2717
614 Ga0075433_10302772 3300006852 Bacteria 1416
615 Ga0075434_100000358 3300006871 Bacteria 33110
616 Ga0075434_100001872 3300006871 Bacteria 18204
617 Ga0075434_100007534 3300006871 Bacteria 10080
618 Ga0075434_100008875 3300006871 Bacteria 9360
619 Ga0075434_100038634 3300006871 Bacteria 4728
620 Ga0075434_100107526 3300006871 Bacteria 2800
621 Ga0075434_100199420 3300006871 Bacteria 2021
622 Ga0075429_100004465 3300006880 Bacteria 12038
623 Ga0075429_100004891 3300006880 Bacteria 11543
624 Ga0075429_100005055 3300006880 Bacteria 11348
625 Ga0075429_100020573 3300006880 Bacteria 5726
626 Ga0075429_100071233 3300006880 Bacteria 3027
627 Ga0075429_100249503 3300006880 Bacteria 1554
628 Ga0068865_100000555 3300006881 Bacteria 20766
629 Ga0068865_100029629 3300006881 Bacteria 3634
630 Ga0075436_100000499 3300006914 Bacteria 25388
631 Ga0075436_100001270 3300006914 Bacteria 17140
632 Ga0075436_100001595 3300006914 Bacteria 15494
633 Ga0075436_100007515 3300006914 Bacteria 7446
634 Ga0075436_100012218 3300006914 Bacteria 5883
635 Ga0075436_100033467 3300006914 Bacteria 3543
636 Ga0075436_100040430 3300006914 Bacteria 3218
637 Ga0075436_100061715 3300006914 Bacteria 2590
638 Ga0075436_100067051 3300006914 Bacteria 2481
639 Ga0075436_100083387 3300006914 Bacteria 2218
640 Ga0097620_100000050 3300006931 Bacteria 131351
641 Ga0097620_100001228 3300006931 Bacteria 26165
642 Ga0097620_100001261 3300006931 Bacteria 25857
643 Ga0097620_100005369 3300006931 Bacteria 13040
644 Ga0097620_100020233 3300006931 Bacteria 6681
645 Ga0097620_100039503 3300006931 Bacteria 4734
646 Ga0097620_100071665 3300006931 Bacteria 3501
647 Ga0097620_100122046 3300006931 Bacteria 2672
648 Ga0097620_100137100 3300006931 Bacteria 2520
649 Ga0097620_100137522 3300006931 Bacteria 2517
650 Ga0097620_100166992 3300006931 Bacteria 2281
651 Ga0097620_100242050 3300006931 Bacteria 1894
652 Ga0099826_10101113 3300006948 Bacteria 1739
653 Ga0075435_100000518 3300007076 Bacteria 23614
654 Ga0075435_100000614 3300007076 Bacteria 21898
655 Ga0075435_100005567 3300007076 Bacteria 8816
656 Ga0075435_100005891 3300007076 Bacteria 8623
657 Ga0075435_100020348 3300007076 Bacteria 5082
658 Ga0075435_100116089 3300007076 Bacteria 2229
659 Ga0075435_100124014 3300007076 Bacteria 2157
660 Ga0099794_10045989 3300007265 Bacteria 2089
661 Ga0099794_10093076 3300007265 Bacteria 1498
662 Ga0099795_10011102 3300007788 Bacteria 2678
663 Ga0105251_10008986 3300009011 Bacteria 5961
664 Ga0105244_10002330 3300009036 Bacteria 14435
665 Ga0105250_10013698 3300009092 Bacteria 3341
666 Ga0105250_10033246 3300009092 Bacteria 2070
667 Ga0105240_10002253 3300009093 Bacteria 31317
668 Ga0105240_10002277 3300009093 Bacteria 31116
669 Ga0105240_10002317 3300009093 Bacteria 30815
670 Ga0105240_10004031 3300009093 Bacteria 22598
671 Ga0105240_10008860 3300009093 Bacteria 14325
672 Ga0105240_10014573 3300009093 Bacteria 10727
673 Ga0105240_10020031 3300009093 Bacteria 8930
674 Ga0105240_10056095 3300009093 Bacteria 4930
675 Ga0105240_10057621 3300009093 Bacteria 4852
676 Ga0105240_10108454 3300009093 Bacteria 3364
677 Ga0105240_10146957 3300009093 Bacteria 2812
678 Ga0105240_10173518 3300009093 Bacteria 2551
679 Ga0105240_10224480 3300009093 Bacteria 2186
680 Ga0111539_10000774 3300009094 Bacteria 41587
681 Ga0111539_10004948 3300009094 Bacteria 17333
682 Ga0111539_10009844 3300009094 Bacteria 12063
683 Ga0111539_10012218 3300009094 Bacteria 10770
684 Ga0111539_10019536 3300009094 Bacteria 8359
685 Ga0111539_10025598 3300009094 Bacteria 7232
686 Ga0111539_10027603 3300009094 Bacteria 6934
687 Ga0111539_10029884 3300009094 Bacteria 6629
688 Ga0111539_10035170 3300009094 Bacteria 6066
689 Ga0111539_10048101 3300009094 Bacteria 5094
690 Ga0111539_10077382 3300009094 Bacteria 3915
691 Ga0111539_10094104 3300009094 Bacteria 3520
692 Ga0111539_10276914 3300009094 Bacteria 1952
693 Ga0111539_10283886 3300009094 Bacteria 1927
694 Ga0105245_10006058 3300009098 Bacteria 10630
695 Ga0105245_10006192 3300009098 Bacteria 10530
696 Ga0105245_10012365 3300009098 Bacteria 7427
697 Ga0105245_10018143 3300009098 Bacteria 6152
698 Ga0105245_10018998 3300009098 Bacteria 6016
699 Ga0105245_10047958 3300009098 Bacteria 3820
700 Ga0105245_10078074 3300009098 Bacteria 3020
701 Ga0105245_10105489 3300009098 Bacteria 2614
702 Ga0105247_10000096 3300009101 Bacteria 95855
703 Ga0105247_10007792 3300009101 Bacteria 6552
704 Ga0105247_10026353 3300009101 Bacteria 3509
705 Ga0114129_10012508 3300009147 Bacteria 12083
706 Ga0114129_10057622 3300009147 Bacteria 5435
707 Ga0114129_10076783 3300009147 Bacteria 4649
708 Ga0114129_10244767 3300009147 Bacteria 2410
709 Ga0114129_10400193 3300009147 Bacteria 1810
710 Ga0114129_10631570 3300009147 Bacteria 1384
711 Ga0114129_10643173 3300009147 Bacteria 1370
712 Ga0105243_10002682 3300009148 Bacteria 14791
713 Ga0105243_10092325 3300009148 Bacteria 2496
714 Ga0105243_10150520 3300009148 Bacteria 1996
715 Ga0105241_10009644 3300009174 Bacteria 7093
716 Ga0105241_10009841 3300009174 Bacteria 7026
717 Ga0105241_10014428 3300009174 Bacteria 5785
718 Ga0105241_10046734 3300009174 Bacteria 3288
719 Ga0105241_10213921 3300009174 Bacteria 1616
720 Ga0105242_10000987 3300009176 Bacteria 22250
721 Ga0105242_10004690 3300009176 Bacteria 10583
722 Ga0105242_10005171 3300009176 Bacteria 10070
723 Ga0105242_10155246 3300009176 Bacteria 1999
724 Ga0105248_10005713 3300009177 Bacteria 13661
725 Ga0105248_10018063 3300009177 Bacteria 7785
726 Ga0105248_10019213 3300009177 Bacteria 7559
727 Ga0105248_10029722 3300009177 Bacteria 6098
728 Ga0105248_10046801 3300009177 Bacteria 4850
729 Ga0105248_10115806 3300009177 Bacteria 3023
730 Ga0105248_10280886 3300009177 Bacteria 1874
731 Ga0105248_10444987 3300009177 Bacteria 1460
732 Ga0105237_10013426 3300009545 Bacteria 8591
733 Ga0105237_10057451 3300009545 Bacteria 3894
734 Ga0105237_10078653 3300009545 Bacteria 3287
735 Ga0105237_10148920 3300009545 Bacteria 2336
736 Ga0105238_10035651 3300009551 Bacteria 5056
737 Ga0105238_10070957 3300009551 Bacteria 3481
738 Ga0105238_10101306 3300009551 Bacteria 2863
739 Ga0105238_10109205 3300009551 Bacteria 2747
740 Ga0105238_10137593 3300009551 Bacteria 2420
741 Ga0105249_10008399 3300009553 Bacteria 8996
742 Ga0105249_10031945 3300009553 Bacteria 4763
743 Ga0105249_10043097 3300009553 Bacteria 4105
744 Ga0105033_102584 3300009986 Bacteria 1501
745 Ga0105239_10037192 3300010375 Bacteria 5338
746 Ga0105239_10072852 3300010375 Bacteria 3777
747 Ga0105239_10106209 3300010375 Bacteria 3110
748 Ga0105239_10392130 3300010375 Bacteria 1571
749 Ga0105246_10021584 3300011119 Bacteria 4145
750 Ga0157373_10001619 3300013100 Bacteria 17169
751 Ga0157373_10002312 3300013100 Bacteria 14442
752 Ga0157373_10013368 3300013100 Bacteria 6020
753 Ga0157373_10027369 3300013100 Bacteria 4113
754 Ga0157373_10036627 3300013100 Bacteria 3520
755 Ga0157373_10057905 3300013100 Bacteria 2748
756 Ga0157371_10000248 3300013102 Bacteria 76451
757 Ga0157371_10059206 3300013102 Bacteria 2715
758 Ga0157371_10072086 3300013102 Bacteria 2446
759 Ga0157371_10113325 3300013102 Bacteria 1925
760 Ga0157370_10001476 3300013104 Bacteria 29099
761 Ga0157370_10002434 3300013104 Bacteria 22443
762 Ga0157370_10002793 3300013104 Bacteria 20861
763 Ga0157370_10017634 3300013104 Bacteria 7198
764 Ga0157370_10028618 3300013104 Bacteria 5479
765 Ga0157370_10046551 3300013104 Bacteria 4159
766 Ga0157370_10058497 3300013104 Bacteria 3663
767 Ga0157370_10090644 3300013104 Bacteria 2871
768 Ga0157370_10113977 3300013104 Bacteria 2526
769 Ga0157370_10251043 3300013104 Bacteria 1636
770 Ga0157370_10279892 3300013104 Bacteria 1541
771 Ga0157369_10002433 3300013105 Bacteria 22368
772 Ga0157369_10005169 3300013105 Bacteria 15270
773 Ga0157369_10009381 3300013105 Bacteria 11188
774 Ga0157369_10017645 3300013105 Bacteria 8020
775 Ga0157369_10028282 3300013105 Bacteria 6206
776 Ga0157369_10044702 3300013105 Unclassified 4819
777 Ga0157369_10068958 3300013105 Bacteria 3799
778 Ga0157369_10442469 3300013105 Bacteria 1346
779 Ga0157369_10475029 3300013105 Bacteria 1294
780 Ga0157374_10000383 3300013296 Bacteria 40730
781 Ga0157374_10140746 3300013296 Bacteria 2342
782 Ga0157374_10151670 3300013296 Bacteria 2253
783 Ga0157374_10197504 3300013296 Bacteria 1969
784 Ga0157374_10223434 3300013296 Bacteria 1849
785 Ga0157378_10001843 3300013297 Bacteria 19029
786 Ga0157378_10006389 3300013297 Bacteria 10304
787 Ga0157378_10013081 3300013297 Bacteria 7260
788 Ga0157378_10164146 3300013297 Bacteria 2079
789 Ga0163162_10009180 3300013306 Bacteria 9623
790 Ga0163162_10014658 3300013306 Bacteria 7660
791 Ga0163162_10022421 3300013306 Bacteria 6221
792 Ga0163162_10028063 3300013306 Bacteria 5568
793 Ga0163162_10066313 3300013306 Bacteria 3659
794 Ga0163162_10073237 3300013306 Bacteria 3481
795 Ga0163162_10092342 3300013306 Bacteria 3110
796 Ga0163162_10099059 3300013306 Bacteria 3005
797 Ga0163162_10286032 3300013306 Bacteria 1781
798 Ga0157372_10000853 3300013307 Bacteria 33072
799 Ga0157372_10002272 3300013307 Bacteria 20823
800 Ga0157372_10007773 3300013307 Bacteria 11387
801 Ga0157372_10010528 3300013307 Bacteria 9839
802 Ga0157372_10021026 3300013307 Bacteria 7046
803 Ga0157372_10025906 3300013307 Bacteria 6378
804 Ga0157372_10076391 3300013307 Bacteria 3782
805 Ga0157372_10077546 3300013307 Bacteria 3753
806 Ga0157372_10103094 3300013307 Bacteria 3260
807 Ga0157375_10002420 3300013308 Bacteria 16164
808 Ga0157375_10010965 3300013308 Bacteria 7994
809 Ga0157375_10015344 3300013308 Bacteria 6855
810 Ga0157375_10017406 3300013308 Bacteria 6485
811 Ga0157375_10061562 3300013308 Bacteria 3727
812 Ga0157375_10070871 3300013308 Bacteria 3497
813 Ga0157375_10082273 3300013308 Bacteria 3261
814 Ga0157375_10124072 3300013308 Bacteria 2696
815 Ga0157375_10250122 3300013308 Bacteria 1933
816 Ga0157375_10270500 3300013308 Bacteria 1861
817 Ga0157375_10352751 3300013308 Bacteria 1637
818 Ga0157375_10425083 3300013308 Bacteria 1494
819 Ga0163163_10002007 3300014325 Bacteria 17193
820 Ga0163163_10018281 3300014325 Bacteria 6557
821 Ga0163163_10018338 3300014325 Bacteria 6549
822 Ga0163163_10054333 3300014325 Bacteria 3957
823 Ga0163163_10054599 3300014325 Bacteria 3947
824 Ga0163163_10086471 3300014325 Bacteria 3144
825 Ga0163163_10146952 3300014325 Bacteria 2401
826 Ga0157380_10095999 3300014326 Bacteria 2457
827 Ga0157377_10007961 3300014745 Bacteria 5145
828 Ga0157377_10147190 3300014745 Bacteria 1453
829 Ga0157379_10000112 3300014968 Bacteria 56064
830 Ga0157379_10002542 3300014968 Bacteria 15302
831 Ga0157379_10003708 3300014968 Bacteria 13001
832 Ga0157379_10017141 3300014968 Bacteria 6379
833 Ga0157379_10064873 3300014968 Bacteria 3264
834 Ga0157379_10098574 3300014968 Bacteria 2624
835 Ga0157376_10002564 3300014969 Bacteria 12333
836 Ga0157376_10003872 3300014969 Bacteria 10345
837 Ga0157376_10006926 3300014969 Bacteria 8035
838 Ga0157376_10009458 3300014969 Bacteria 7078
839 Ga0157376_10018283 3300014969 Bacteria 5369
840 Ga0157376_10048694 3300014969 Bacteria 3507
841 Ga0157376_10058385 3300014969 Bacteria 3231
842 Ga0157376_10091163 3300014969 Bacteria 2640
843 Ga0157376_10168401 3300014969 Bacteria 1993
844 Ga0157376_10374289 3300014969 Bacteria 1370
845 Ga0183361_10020 3300016635 Bacteria 128627
846 Ga0163161_10039411 3300017792 Bacteria 3392
847 Ga0163161_10117754 3300017792 Bacteria 1993
848 Ga0163161_10231188 3300017792 Bacteria 1435
849 Ga0163161_10253178 3300017792 Bacteria 1373
850 Ga0163161_10276995 3300017792 Bacteria 1315
851 Ga0206356_10748952 3300020070 Bacteria 1838
852 Ga0206353_10626947 3300020082 Bacteria 1914
853 Ga0213873_10000922 3300021358 Bacteria 4757
854 Ga0213872_10021887 3300021361 Bacteria 2944
855 Ga0213874_10012479 3300021377 Bacteria 2180
856 Ga0213874_10032583 3300021377 Bacteria 1514
857 Ga0213876_10001148 3300021384 Bacteria 16814
858 Ga0213876_10001201 3300021384 Bacteria 16350
859 Ga0213875_10001830 3300021388 Bacteria 13220
860 Ga0213875_10007325 3300021388 Bacteria 5704
861 Ga0209435_100003 3300025206 Bacteria 669534
862 Ga0209436_103757 3300025208 Bacteria 3925
863 Ga0207425_1001795 3300025245 Bacteria 8312
864 Ga0209646_1000008 3300025246 Bacteria 669534
865 Ga0209026_1000007 3300025250 Bacteria 669534
866 Ga0209759_1000019 3300025256 Bacteria 357908
867 Ga0209759_1000150 3300025256 Bacteria 120839
868 Ga0209129_1000095 3300025258 Bacteria 171644
869 Ga0209129_1002122 3300025258 Bacteria 10086
870 Ga0209129_1002488 3300025258 Bacteria 8990
871 Ga0209565_1000077 3300025263 Bacteria 161163
872 Ga0209565_1000116 3300025263 Bacteria 114340
873 Ga0209565_1004239 3300025263 Bacteria 4433
874 Ga0209565_1005400 3300025263 Bacteria 3721
875 Ga0209455_1001612 3300025272 Bacteria 9889
876 Ga0209673_1001210 3300025273 Bacteria 27444
877 Ga0209673_1009392 3300025273 Bacteria 4243
878 Ga0209130_1000087 3300025284 Bacteria 155407
879 Ga0209130_1000095 3300025284 Bacteria 145126
880 Ga0209130_1000134 3300025284 Bacteria 119102
881 Ga0209675_1003004 3300025291 Bacteria 8298
882 Ga0209675_1007519 3300025291 Bacteria 4163
883 Ga0209675_1007884 3300025291 Bacteria 3999
884 Ga0209676_1000019 3300025292 Bacteria 620012
885 Ga0209676_1000145 3300025292 Bacteria 174391
886 Ga0209025_1000040 3300025294 Bacteria 376228
887 Ga0209025_1000231 3300025294 Bacteria 130671
888 Ga0209025_1000406 3300025294 Bacteria 87410
889 Ga0209025_1000762 3300025294 Bacteria 53705
890 Ga0209025_1001626 3300025294 Bacteria 28065
891 Ga0209025_1003068 3300025294 Bacteria 16402
892 Ga0209025_1005144 3300025294 Bacteria 10850
893 Ga0209025_1005742 3300025294 Bacteria 9968
894 Ga0209025_1011730 3300025294 Bacteria 5722
895 Ga0209025_1013094 3300025294 Bacteria 5243
896 Ga0209025_1039569 3300025294 Bacteria 2054
897 Ga0209564_1000062 3300025295 Bacteria 321275
898 Ga0209564_1000274 3300025295 Bacteria 107980
899 Ga0209564_1000728 3300025295 Bacteria 46991
900 Ga0209564_1007827 3300025295 Bacteria 5420
901 Ga0209564_1012801 3300025295 Bacteria 3623
902 Ga0209758_1000072 3300025297 Bacteria 277776
903 Ga0209758_1000122 3300025297 Bacteria 190970
904 Ga0209758_1000302 3300025297 Bacteria 96619
905 Ga0209758_1007283 3300025297 Bacteria 7592
906 Ga0209758_1008050 3300025297 Bacteria 6956
907 Ga0209050_1000023 3300025298 Bacteria 537172
908 Ga0209050_1000143 3300025298 Bacteria 171806
909 Ga0209050_1019316 3300025298 Bacteria 2594
910 Ga0209256_1000003 3300025299 Bacteria 1661127
911 Ga0209256_1000119 3300025299 Bacteria 168215
912 Ga0209256_1001038 3300025299 Bacteria 32584
913 Ga0209256_1028690 3300025299 Bacteria 1565
914 Ga0207426_1000397 3300025302 Bacteria 73966
915 Ga0207426_1013333 3300025302 Bacteria 3050
916 Ga0209051_1000017 3300025303 Bacteria 537172
917 Ga0209051_1000350 3300025303 Bacteria 68654
918 Ga0209051_1005009 3300025303 Bacteria 7894
919 Ga0209051_1013687 3300025303 Bacteria 3841
920 Ga0209051_1014556 3300025303 Bacteria 3663
921 Ga0209257_1000041 3300025304 Bacteria 537172
922 Ga0207697_10000878 3300025315 Bacteria 17003
923 Ga0207697_10020857 3300025315 Bacteria 2683
924 Ga0207697_10024842 3300025315 Bacteria 2451
925 Ga0207697_10077986 3300025315 Bacteria 1393
926 Ga0207656_10002354 3300025321 Bacteria 6344
927 Ga0207656_10005152 3300025321 Bacteria 4595
928 Ga0207656_10025355 3300025321 Bacteria 2406
929 Ga0207656_10043842 3300025321 Bacteria 1909
930 Ga0207655_1000081 3300025728 Bacteria 214272
931 Ga0207713_1005290 3300025735 Bacteria 8119
932 Ga0207682_10000322 3300025893 Bacteria 21806
933 Ga0207682_10000734 3300025893 Bacteria 15195
934 Ga0207682_10004201 3300025893 Bacteria 6082
935 Ga0207682_10027596 3300025893 Bacteria 2261
936 Ga0207682_10035024 3300025893 Bacteria 2026
937 Ga0207692_10042245 3300025898 Bacteria 2262
938 Ga0207642_10002655 3300025899 Bacteria 5574
939 Ga0207642_10002928 3300025899 Bacteria 5341
940 Ga0207710_10001100 3300025900 Bacteria 13851
941 Ga0207710_10031418 3300025900 Bacteria 2322
942 Ga0207688_10064844 3300025901 Bacteria 2063
943 Ga0207688_10129224 3300025901 Bacteria 1480
944 Ga0207680_10009052 3300025903 Bacteria 4921
945 Ga0207680_10014314 3300025903 Bacteria 4100
946 Ga0207680_10023983 3300025903 Bacteria 3340
947 Ga0207685_10015914 3300025905 Bacteria 2395
948 Ga0207699_10009538 3300025906 Bacteria 4838
949 Ga0207699_10039273 3300025906 Bacteria 2718
950 Ga0207699_10052903 3300025906 Bacteria 2406
951 Ga0207699_10130385 3300025906 Bacteria 1639
952 Ga0207645_10000566 3300025907 Bacteria 30620
953 Ga0207645_10001846 3300025907 Bacteria 17066
954 Ga0207645_10003269 3300025907 Bacteria 12375
955 Ga0207645_10005615 3300025907 Bacteria 9069
956 Ga0207645_10012049 3300025907 Bacteria 5879
957 Ga0207645_10039297 3300025907 Bacteria 3032
958 Ga0207645_10051024 3300025907 Bacteria 2643
959 Ga0207645_10117450 3300025907 Bacteria 1725
960 Ga0207645_10144351 3300025907 Bacteria 1551
961 Ga0207643_10000359 3300025908 Bacteria 30555
962 Ga0207643_10005706 3300025908 Bacteria 6656
963 Ga0207643_10025037 3300025908 Bacteria 3296
964 Ga0207643_10025602 3300025908 Bacteria 3262
965 Ga0207643_10100650 3300025908 Bacteria 1695
966 Ga0207705_10040333 3300025909 Unclassified 3348
967 Ga0207705_10088206 3300025909 Bacteria 2269
968 Ga0207684_10001435 3300025910 Bacteria 25772
969 Ga0207684_10015827 3300025910 Bacteria 6485
970 Ga0207684_10064256 3300025910 Bacteria 3116
971 Ga0207684_10096107 3300025910 Bacteria 2529
972 Ga0207654_10007099 3300025911 Bacteria 5644
973 Ga0207654_10013783 3300025911 Bacteria 4165
974 Ga0207654_10024105 3300025911 Bacteria 3267
975 Ga0207654_10032026 3300025911 Bacteria 2900
976 Ga0207654_10060487 3300025911 Bacteria 2213
977 Ga0207707_10004047 3300025912 Bacteria 12993
978 Ga0207707_10004182 3300025912 Bacteria 12784
979 Ga0207707_10014718 3300025912 Bacteria 6817
980 Ga0207707_10037315 3300025912 Bacteria 4247
981 Ga0207707_10102264 3300025912 Bacteria 2505
982 Ga0207707_10104201 3300025912 Bacteria 2479
983 Ga0207707_10267505 3300025912 Bacteria 1482
984 Ga0207707_10282263 3300025912 Bacteria 1438
985 Ga0207695_10010633 3300025913 Bacteria 11243
986 Ga0207695_10015435 3300025913 Bacteria 8993
987 Ga0207695_10018070 3300025913 Bacteria 8162
988 Ga0207695_10026095 3300025913 Bacteria 6526
989 Ga0207695_10029551 3300025913 Bacteria 6051
990 Ga0207695_10030199 3300025913 Bacteria 5970
991 Ga0207695_10033181 3300025913 Bacteria 5637
992 Ga0207695_10067247 3300025913 Bacteria 3676
993 Ga0207695_10068579 3300025913 Bacteria 3634
994 Ga0207695_10180178 3300025913 Bacteria 2034
995 Ga0207671_10042375 3300025914 Bacteria 3369
996 Ga0207671_10056265 3300025914 Bacteria 2914
997 Ga0207671_10195766 3300025914 Bacteria 1577
998 Ga0207693_10000254 3300025915 Bacteria 49362
999 Ga0207693_10005030 3300025915 Bacteria 11101
1000 Ga0207693_10045324 3300025915 Bacteria 3455
1001 Ga0207663_10000170 3300025916 Bacteria 29272
1002 Ga0207663_10009347 3300025916 Bacteria 5174
1003 Ga0207660_10004490 3300025917 Bacteria 9101
1004 Ga0207660_10013388 3300025917 Bacteria 5377
1005 Ga0207660_10060572 3300025917 Bacteria 2722
1006 Ga0207660_10087926 3300025917 Bacteria 2297
1007 Ga0207660_10145920 3300025917 Bacteria 1814
1008 Ga0207660_10186308 3300025917 Bacteria 1614
1009 Ga0207660_10197139 3300025917 Bacteria 1571
1010 Ga0207660_10216583 3300025917 Bacteria 1501
1011 Ga0207662_10000269 3300025918 Bacteria 23948
1012 Ga0207662_10005657 3300025918 Bacteria 6684
1013 Ga0207662_10010985 3300025918 Bacteria 5010
1014 Ga0207662_10040377 3300025918 Bacteria 2743
1015 Ga0207662_10077594 3300025918 Bacteria 2021
1016 Ga0207657_10000894 3300025919 Bacteria 31534
1017 Ga0207657_10000910 3300025919 Bacteria 31264
1018 Ga0207657_10002586 3300025919 Bacteria 19581
1019 Ga0207657_10009641 3300025919 Bacteria 9690
1020 Ga0207657_10010420 3300025919 Bacteria 9279
1021 Ga0207657_10011936 3300025919 Bacteria 8597
1022 Ga0207657_10054102 3300025919 Unclassified 3473
1023 Ga0207657_10100815 3300025919 Bacteria 2397
1024 Ga0207649_10007671 3300025920 Bacteria 5869
1025 Ga0207649_10008175 3300025920 Bacteria 5696
1026 Ga0207649_10009735 3300025920 Bacteria 5264
1027 Ga0207649_10240052 3300025920 Bacteria 1300
1028 Ga0207652_10002789 3300025921 Bacteria 14674
1029 Ga0207652_10014053 3300025921 Bacteria 6480
1030 Ga0207652_10020495 3300025921 Bacteria 5445
1031 Ga0207652_10032606 3300025921 Bacteria 4382
1032 Ga0207652_10038737 3300025921 Bacteria 4042
1033 Ga0207652_10064636 3300025921 Bacteria 3166
1034 Ga0207652_10074683 3300025921 Bacteria 2952
1035 Ga0207652_10083693 3300025921 Bacteria 2794
1036 Ga0207652_10128589 3300025921 Bacteria 2258
1037 Ga0207652_10232749 3300025921 Bacteria 1661
1038 Ga0207652_10238279 3300025921 Bacteria 1640
1039 Ga0207646_10007355 3300025922 Bacteria 11216
1040 Ga0207646_10072730 3300025922 Bacteria 3071
1041 Ga0207646_10088310 3300025922 Bacteria 2774
1042 Ga0207646_10183280 3300025922 Bacteria 1891
1043 Ga0207681_10004029 3300025923 Bacteria 9113
1044 Ga0207681_10016931 3300025923 Bacteria 4570
1045 Ga0207681_10026224 3300025923 Bacteria 3757
1046 Ga0207681_10048133 3300025923 Bacteria 2876
1047 Ga0207681_10137157 3300025923 Bacteria 1817
1048 Ga0207681_10182015 3300025923 Bacteria 1601
1049 Ga0207694_10084650 3300025924 Bacteria 2494
1050 Ga0207694_10278506 3300025924 Bacteria 1373
1051 Ga0207650_10006778 3300025925 Bacteria 7811
1052 Ga0207650_10006791 3300025925 Bacteria 7805
1053 Ga0207650_10007082 3300025925 Bacteria 7642
1054 Ga0207650_10019133 3300025925 Bacteria 4812
1055 Ga0207650_10038704 3300025925 Bacteria 3484
1056 Ga0207650_10048127 3300025925 Bacteria 3144
1057 Ga0207650_10052972 3300025925 Bacteria 3007
1058 Ga0207650_10058189 3300025925 Bacteria 2877
1059 Ga0207650_10060031 3300025925 Bacteria 2837
1060 Ga0207650_10063538 3300025925 Bacteria 2760
1061 Ga0207650_10090302 3300025925 Bacteria 2339
1062 Ga0207650_10144783 3300025925 Bacteria 1871
1063 Ga0207650_10295923 3300025925 Bacteria 1321
1064 Ga0207659_10002162 3300025926 Bacteria 11680
1065 Ga0207659_10008786 3300025926 Bacteria 6293
1066 Ga0207659_10009706 3300025926 Bacteria 6018
1067 Ga0207659_10014831 3300025926 Bacteria 5037
1068 Ga0207659_10021968 3300025926 Bacteria 4243
1069 Ga0207659_10056197 3300025926 Bacteria 2818
1070 Ga0207659_10087462 3300025926 Bacteria 2319
1071 Ga0207687_10002262 3300025927 Bacteria 13120
1072 Ga0207687_10002498 3300025927 Bacteria 12485
1073 Ga0207687_10003693 3300025927 Bacteria 10301
1074 Ga0207687_10048895 3300025927 Bacteria 2939
1075 Ga0207687_10093060 3300025927 Bacteria 2203
1076 Ga0207687_10107229 3300025927 Bacteria 2066
1077 Ga0207687_10279393 3300025927 Bacteria 1338
1078 Ga0207700_10000029 3300025928 Bacteria 132615
1079 Ga0207700_10001192 3300025928 Bacteria 14939
1080 Ga0207700_10001526 3300025928 Bacteria 13117
1081 Ga0207700_10002806 3300025928 Bacteria 10028
1082 Ga0207700_10004530 3300025928 Bacteria 8208
1083 Ga0207664_10000168 3300025929 Bacteria 52834
1084 Ga0207664_10001380 3300025929 Bacteria 15949
1085 Ga0207664_10049306 3300025929 Bacteria 3314
1086 Ga0207664_10076163 3300025929 Bacteria 2715
1087 Ga0207664_10081040 3300025929 Bacteria 2640
1088 Ga0207664_10154994 3300025929 Bacteria 1949
1089 Ga0207664_10281259 3300025929 Bacteria 1460
1090 Ga0207644_10002009 3300025931 Bacteria 13168
1091 Ga0207644_10002533 3300025931 Bacteria 11752
1092 Ga0207644_10002966 3300025931 Bacteria 10931
1093 Ga0207644_10011226 3300025931 Bacteria 5922
1094 Ga0207644_10012107 3300025931 Bacteria 5722
1095 Ga0207644_10015020 3300025931 Bacteria 5193
1096 Ga0207644_10019061 3300025931 Bacteria 4650
1097 Ga0207644_10039113 3300025931 Bacteria 3346
1098 Ga0207644_10039942 3300025931 Bacteria 3314
1099 Ga0207644_10056950 3300025931 Bacteria 2821
1100 Ga0207644_10062939 3300025931 Bacteria 2692
1101 Ga0207644_10142981 3300025931 Bacteria 1844
1102 Ga0207644_10207302 3300025931 Bacteria 1548
1103 Ga0207644_10286144 3300025931 Bacteria 1324
1104 Ga0207690_10021165 3300025932 Bacteria 4028
1105 Ga0207690_10060193 3300025932 Bacteria 2576
1106 Ga0207690_10162126 3300025932 Bacteria 1668
1107 Ga0207690_10274384 3300025932 Bacteria 1311
1108 Ga0207706_10000008 3300025933 Bacteria 201940
1109 Ga0207706_10000918 3300025933 Bacteria 30228
1110 Ga0207706_10015589 3300025933 Bacteria 6865
1111 Ga0207706_10017980 3300025933 Bacteria 6361
1112 Ga0207706_10025205 3300025933 Bacteria 5332
1113 Ga0207706_10034060 3300025933 Bacteria 4532
1114 Ga0207706_10085191 3300025933 Bacteria 2778
1115 Ga0207706_10094141 3300025933 Bacteria 2635
1116 Ga0207706_10112183 3300025933 Bacteria 2399
1117 Ga0207706_10136569 3300025933 Bacteria 2157
1118 Ga0207706_10175242 3300025933 Bacteria 1884
1119 Ga0207686_10000302 3300025934 Bacteria 35955
1120 Ga0207686_10003451 3300025934 Bacteria 8490
1121 Ga0207686_10004433 3300025934 Bacteria 7526
1122 Ga0207686_10013258 3300025934 Bacteria 4557
1123 Ga0207686_10014352 3300025934 Bacteria 4407
1124 Ga0207686_10153659 3300025934 Bacteria 1605
1125 Ga0207686_10193233 3300025934 Bacteria 1452
1126 Ga0207709_10000759 3300025935 Bacteria 25445
1127 Ga0207709_10005409 3300025935 Bacteria 7262
1128 Ga0207670_10001147 3300025936 Bacteria 13941
1129 Ga0207670_10013237 3300025936 Bacteria 4854
1130 Ga0207670_10021145 3300025936 Bacteria 4009
1131 Ga0207670_10039924 3300025936 Bacteria 3077
1132 Ga0207670_10058975 3300025936 Bacteria 2609
1133 Ga0207670_10113586 3300025936 Bacteria 1956
1134 Ga0207670_10118013 3300025936 Bacteria 1923
1135 Ga0207669_10005372 3300025937 Bacteria 5743
1136 Ga0207669_10017247 3300025937 Bacteria 3698
1137 Ga0207669_10030798 3300025937 Bacteria 2987
1138 Ga0207669_10034968 3300025937 Bacteria 2853
1139 Ga0207669_10102327 3300025937 Bacteria 1897
1140 Ga0207669_10110195 3300025937 Bacteria 1843
1141 Ga0207669_10113094 3300025937 Bacteria 1824
1142 Ga0207669_10134098 3300025937 Bacteria 1707
1143 Ga0207704_10000698 3300025938 Bacteria 14805
1144 Ga0207704_10026586 3300025938 Bacteria 3177
1145 Ga0207704_10073401 3300025938 Bacteria 2179
1146 Ga0207704_10113959 3300025938 Bacteria 1834
1147 Ga0207704_10144508 3300025938 Bacteria 1669
1148 Ga0207665_10000144 3300025939 Bacteria 48077
1149 Ga0207665_10003107 3300025939 Bacteria 11137
1150 Ga0207665_10109588 3300025939 Bacteria 1938
1151 Ga0207691_10000445 3300025940 Bacteria 40892
1152 Ga0207691_10001965 3300025940 Bacteria 20102
1153 Ga0207691_10003889 3300025940 Bacteria 14502
1154 Ga0207691_10005758 3300025940 Bacteria 11991
1155 Ga0207691_10006969 3300025940 Bacteria 10902
1156 Ga0207691_10017602 3300025940 Bacteria 6773
1157 Ga0207691_10017742 3300025940 Bacteria 6747
1158 Ga0207691_10027487 3300025940 Bacteria 5333
1159 Ga0207691_10045823 3300025940 Bacteria 4019
1160 Ga0207691_10192422 3300025940 Bacteria 1779
1161 Ga0207691_10197646 3300025940 Bacteria 1751
1162 Ga0207691_10201505 3300025940 Bacteria 1732
1163 Ga0207711_10002349 3300025941 Bacteria 16953
1164 Ga0207711_10032140 3300025941 Bacteria 4437
1165 Ga0207711_10053204 3300025941 Bacteria 3472
1166 Ga0207711_10059364 3300025941 Bacteria 3293
1167 Ga0207711_10061594 3300025941 Bacteria 3236
1168 Ga0207711_10065889 3300025941 Bacteria 3132
1169 Ga0207711_10071157 3300025941 Bacteria 3017
1170 Ga0207711_10170714 3300025941 Bacteria 1973
1171 Ga0207711_10203801 3300025941 Bacteria 1806
1172 Ga0207689_10000264 3300025942 Bacteria 47214
1173 Ga0207689_10001002 3300025942 Bacteria 27139
1174 Ga0207689_10001752 3300025942 Bacteria 20489
1175 Ga0207689_10018905 3300025942 Bacteria 5811
1176 Ga0207689_10025980 3300025942 Bacteria 4904
1177 Ga0207689_10028106 3300025942 Bacteria 4703
1178 Ga0207689_10102669 3300025942 Bacteria 2349
1179 Ga0207689_10240972 3300025942 Bacteria 1495
1180 Ga0207689_10285880 3300025942 Bacteria 1366
1181 Ga0207661_10002159 3300025944 Bacteria 13551
1182 Ga0207661_10010709 3300025944 Bacteria 6609
1183 Ga0207661_10026953 3300025944 Bacteria 4385
1184 Ga0207661_10052101 3300025944 Bacteria 3268
1185 Ga0207661_10084180 3300025944 Bacteria 2633
1186 Ga0207661_10271990 3300025944 Bacteria 1512
1187 Ga0207661_10359374 3300025944 Bacteria 1315
1188 Ga0207679_10000934 3300025945 Bacteria 18670
1189 Ga0207679_10008329 3300025945 Bacteria 6604
1190 Ga0207679_10026399 3300025945 Bacteria 4004
1191 Ga0207679_10097947 3300025945 Bacteria 2285
1192 Ga0207679_10105695 3300025945 Bacteria 2211
1193 Ga0207679_10125934 3300025945 Bacteria 2047
1194 Ga0207679_10248342 3300025945 Bacteria 1511
1195 Ga0207667_10001326 3300025949 Bacteria 31063
1196 Ga0207667_10002319 3300025949 Bacteria 23836
1197 Ga0207667_10005114 3300025949 Bacteria 16016
1198 Ga0207667_10007810 3300025949 Bacteria 12787
1199 Ga0207667_10011686 3300025949 Bacteria 10187
1200 Ga0207667_10013199 3300025949 Bacteria 9471
1201 Ga0207667_10025214 3300025949 Bacteria 6512
1202 Ga0207667_10047830 3300025949 Bacteria 4526
1203 Ga0207667_10065289 3300025949 Bacteria 3797
1204 Ga0207667_10107719 3300025949 Bacteria 2875
1205 Ga0207667_10179921 3300025949 Bacteria 2172
1206 Ga0207667_10254061 3300025949 Bacteria 1798
1207 Ga0207667_10258707 3300025949 Bacteria 1780
1208 Ga0207667_10359671 3300025949 Bacteria 1484
1209 Ga0207651_10001791 3300025960 Bacteria 9983
1210 Ga0207651_10008798 3300025960 Bacteria 5480
1211 Ga0207651_10089694 3300025960 Bacteria 2245
1212 Ga0207651_10134288 3300025960 Bacteria 1900
1213 Ga0207712_10000914 3300025961 Bacteria 21401
1214 Ga0207712_10050072 3300025961 Bacteria 2915
1215 Ga0207668_10002718 3300025972 Bacteria 10355
1216 Ga0207668_10002952 3300025972 Bacteria 9967
1217 Ga0207668_10006144 3300025972 Bacteria 7084
1218 Ga0207668_10006590 3300025972 Bacteria 6865
1219 Ga0207668_10014807 3300025972 Bacteria 4834
1220 Ga0207668_10025949 3300025972 Bacteria 3799
1221 Ga0207668_10191690 3300025972 Bacteria 1620
1222 Ga0207640_10007012 3300025981 Bacteria 6202
1223 Ga0207640_10012816 3300025981 Bacteria 4789
1224 Ga0207640_10014760 3300025981 Bacteria 4505
1225 Ga0207640_10025893 3300025981 Bacteria 3557
1226 Ga0207640_10027679 3300025981 Bacteria 3457
1227 Ga0207640_10275967 3300025981 Bacteria 1318
1228 Ga0207658_10005406 3300025986 Bacteria 8764
1229 Ga0207658_10010573 3300025986 Bacteria 6271
1230 Ga0207658_10015102 3300025986 Bacteria 5296
1231 Ga0207658_10027760 3300025986 Bacteria 3980
1232 Ga0207658_10034275 3300025986 Bacteria 3627
1233 Ga0207658_10054407 3300025986 Bacteria 2961
1234 Ga0207658_10072215 3300025986 Bacteria 2615
1235 Ga0207658_10171666 3300025986 Bacteria 1787
1236 Ga0207658_10197228 3300025986 Bacteria 1678
1237 Ga0207677_10001411 3300026023 Bacteria 12801
1238 Ga0207677_10001899 3300026023 Bacteria 11029
1239 Ga0207677_10005148 3300026023 Bacteria 7077
1240 Ga0207677_10006672 3300026023 Bacteria 6339
1241 Ga0207677_10011282 3300026023 Bacteria 5087
1242 Ga0207677_10012603 3300026023 Bacteria 4869
1243 Ga0207677_10014588 3300026023 Bacteria 4595
1244 Ga0207677_10022852 3300026023 Bacteria 3851
1245 Ga0207677_10055131 3300026023 Bacteria 2717
1246 Ga0207677_10063856 3300026023 Bacteria 2561
1247 Ga0207703_10000312 3300026035 Bacteria 52728
1248 Ga0207703_10000519 3300026035 Bacteria 39563
1249 Ga0207703_10001439 3300026035 Bacteria 21733
1250 Ga0207703_10001924 3300026035 Bacteria 18395
1251 Ga0207703_10004500 3300026035 Bacteria 11440
1252 Ga0207703_10010082 3300026035 Bacteria 7405
1253 Ga0207703_10056104 3300026035 Bacteria 3207
1254 Ga0207703_10234668 3300026035 Bacteria 1646
1255 Ga0207703_10272757 3300026035 Bacteria 1533
1256 Ga0207703_10356315 3300026035 Bacteria 1348
1257 Ga0207703_10364156 3300026035 Bacteria 1334
1258 Ga0207639_10003226 3300026041 Bacteria 10969
1259 Ga0207639_10019458 3300026041 Bacteria 4842
1260 Ga0207639_10133260 3300026041 Bacteria 2060
1261 Ga0207639_10140382 3300026041 Bacteria 2012
1262 Ga0207678_10008479 3300026067 Bacteria 9064
1263 Ga0207678_10013310 3300026067 Bacteria 7219
1264 Ga0207678_10013688 3300026067 Bacteria 7125
1265 Ga0207678_10026139 3300026067 Bacteria 5094
1266 Ga0207678_10055132 3300026067 Bacteria 3424
1267 Ga0207678_10101232 3300026067 Bacteria 2461
1268 Ga0207678_10118446 3300026067 Bacteria 2259
1269 Ga0207678_10232350 3300026067 Bacteria 1579
1270 Ga0207708_10000494 3300026075 Bacteria 30296
1271 Ga0207708_10000736 3300026075 Bacteria 24605
1272 Ga0207708_10014620 3300026075 Bacteria 5873
1273 Ga0207708_10081135 3300026075 Bacteria 2493
1274 Ga0207702_10000510 3300026078 Bacteria 43837
1275 Ga0207702_10001951 3300026078 Bacteria 20113
1276 Ga0207702_10009236 3300026078 Bacteria 8287
1277 Ga0207702_10011613 3300026078 Bacteria 7340
1278 Ga0207702_10034707 3300026078 Bacteria 4218
1279 Ga0207702_10052132 3300026078 Bacteria 3461
1280 Ga0207702_10279662 3300026078 Bacteria 1577
1281 Ga0207641_10002633 3300026088 Bacteria 16445
1282 Ga0207641_10003157 3300026088 Bacteria 14760
1283 Ga0207641_10003409 3300026088 Bacteria 14084
1284 Ga0207641_10005405 3300026088 Bacteria 10910
1285 Ga0207641_10017709 3300026088 Bacteria 5836
1286 Ga0207641_10023223 3300026088 Bacteria 5110
1287 Ga0207641_10034439 3300026088 Bacteria 4213
1288 Ga0207641_10044364 3300026088 Bacteria 3739
1289 Ga0207641_10045360 3300026088 Bacteria 3701
1290 Ga0207641_10121886 3300026088 Bacteria 2328
1291 Ga0207641_10146921 3300026088 Bacteria 2132
1292 Ga0207648_10001616 3300026089 Bacteria 24706
1293 Ga0207648_10001763 3300026089 Bacteria 23706
1294 Ga0207648_10006120 3300026089 Bacteria 11993
1295 Ga0207648_10008506 3300026089 Bacteria 9930
1296 Ga0207648_10016567 3300026089 Bacteria 6728
1297 Ga0207648_10022205 3300026089 Bacteria 5701
1298 Ga0207648_10026787 3300026089 Bacteria 5120
1299 Ga0207648_10031739 3300026089 Bacteria 4669
1300 Ga0207648_10074003 3300026089 Bacteria 2969
1301 Ga0207648_10081943 3300026089 Bacteria 2813
1302 Ga0207676_10000470 3300026095 Bacteria 33856
1303 Ga0207676_10002657 3300026095 Bacteria 12701
1304 Ga0207676_10004691 3300026095 Bacteria 9683
1305 Ga0207676_10012094 3300026095 Bacteria 6177
1306 Ga0207676_10024376 3300026095 Bacteria 4476
1307 Ga0207676_10034877 3300026095 Bacteria 3812
1308 Ga0207676_10038933 3300026095 Bacteria 3633
1309 Ga0207676_10043251 3300026095 Bacteria 3467
1310 Ga0207676_10046420 3300026095 Bacteria 3361
1311 Ga0207676_10073349 3300026095 Bacteria 2754
1312 Ga0207676_10350331 3300026095 Bacteria 1365
1313 Ga0207676_10370113 3300026095 Bacteria 1331
1314 Ga0207676_10385738 3300026095 Bacteria 1305
1315 Ga0207674_10000062 3300026116 Bacteria 111069
1316 Ga0207674_10000709 3300026116 Bacteria 43489
1317 Ga0207674_10002483 3300026116 Bacteria 23239
1318 Ga0207674_10045502 3300026116 Bacteria 4514
1319 Ga0207674_10132731 3300026116 Bacteria 2453
1320 Ga0207675_100000697 3300026118 Bacteria 33220
1321 Ga0207675_100001280 3300026118 Bacteria 25152
1322 Ga0207675_100001316 3300026118 Bacteria 24900
1323 Ga0207675_100002525 3300026118 Bacteria 18102
1324 Ga0207675_100013518 3300026118 Bacteria 7619
1325 Ga0207675_100015875 3300026118 Bacteria 7023
1326 Ga0207675_100035962 3300026118 Bacteria 4619
1327 Ga0207675_100103442 3300026118 Bacteria 2684
1328 Ga0207675_100113214 3300026118 Bacteria 2562
1329 Ga0207683_10000227 3300026121 Bacteria 49549
1330 Ga0207683_10000568 3300026121 Bacteria 34203
1331 Ga0207683_10001219 3300026121 Bacteria 23337
1332 Ga0207683_10001441 3300026121 Bacteria 21521
1333 Ga0207683_10003890 3300026121 Bacteria 12952
1334 Ga0207683_10006363 3300026121 Bacteria 10111
1335 Ga0207683_10010344 3300026121 Bacteria 7957
1336 Ga0207683_10016063 3300026121 Bacteria 6370
1337 Ga0207683_10020379 3300026121 Bacteria 5671
1338 Ga0207683_10039856 3300026121 Bacteria 4098
1339 Ga0207683_10040419 3300026121 Bacteria 4070
1340 Ga0207683_10066461 3300026121 Bacteria 3179
1341 Ga0207683_10172623 3300026121 Bacteria 1959
1342 Ga0207683_10173336 3300026121 Bacteria 1954
1343 Ga0207698_10001850 3300026142 Bacteria 12355
1344 Ga0207698_10002880 3300026142 Bacteria 10291
1345 Ga0207698_10014880 3300026142 Bacteria 5190
1346 Ga0207698_10018491 3300026142 Bacteria 4750
1347 Ga0207698_10020427 3300026142 Bacteria 4559
1348 Ga0207698_10024335 3300026142 Bacteria 4248
1349 Ga0207698_10031555 3300026142 Unclassified 3826
1350 Ga0207698_10059367 3300026142 Bacteria 2970
1351 Ga0207698_10093619 3300026142 Bacteria 2467
1352 Ga0207698_10126866 3300026142 Bacteria 2172
1353 Ga0207698_10171374 3300026142 Bacteria 1911
1354 Ga0207698_10193180 3300026142 Bacteria 1816
1355 Ga0207698_10228156 3300026142 Bacteria 1688
1356 Ga0209371_1007913 3300027312 Bacteria 3613
1357 Ga0209969_1000759 3300027360 Bacteria 4329
1358 Ga0209967_1000554 3300027364 Bacteria 4917
1359 Ga0209981_1000574 3300027378 Bacteria 4664
1360 Ga0209981_1006417 3300027378 Bacteria 1573
1361 Ga0209996_1000669 3300027395 Bacteria 4101
1362 Ga0210000_1000619 3300027462 Bacteria 4867
1363 Ga0210000_1001550 3300027462 Bacteria 3243
1364 Ga0209995_1005446 3300027471 Bacteria 2043
1365 Ga0209995_1012367 3300027471 Bacteria 1392
1366 Ga0209968_1001892 3300027526 Bacteria 3178
1367 Ga0209999_1000519 3300027543 Bacteria 6013
1368 Ga0209999_1005633 3300027543 Bacteria 2253
1369 Ga0209983_1011015 3300027665 Bacteria 1849
1370 Ga0209588_1028637 3300027671 Bacteria 1774
1371 Ga0209971_1001259 3300027682 Bacteria 6321
1372 Ga0209971_1006979 3300027682 Bacteria 2678
1373 Ga0209966_1012711 3300027695 Bacteria 1549
1374 Ga0209966_1012913 3300027695 Bacteria 1539
1375 Ga0209813_10000476 3300027866 Bacteria 9614
1376 Ga0209974_10000194 3300027876 Bacteria 19284
1377 Ga0209974_10001758 3300027876 Bacteria 7890
1378 Ga0209974_10012396 3300027876 Bacteria 2851
1379 Ga0207428_10003084 3300027907 Bacteria 16402
1380 Ga0207428_10003647 3300027907 Bacteria 14845
1381 Ga0207428_10006244 3300027907 Bacteria 11012
1382 Ga0207428_10008344 3300027907 Bacteria 9359
1383 Ga0207428_10024205 3300027907 Bacteria 5100
1384 Ga0207428_10058156 3300027907 Bacteria 3069
1385 Ga0207428_10079841 3300027907 Bacteria 2557
1386 Ga0207428_10182725 3300027907 Bacteria 1584
1387 Ga0268266_10007894 3300028379 Bacteria 9531
1388 Ga0268266_10008086 3300028379 Bacteria 9390
1389 Ga0268266_10009978 3300028379 Bacteria 8337
1390 Ga0268266_10019877 3300028379 Bacteria 5724
1391 Ga0268266_10041780 3300028379 Bacteria 3914
1392 Ga0268266_10045694 3300028379 Bacteria 3747
1393 Ga0268266_10048744 3300028379 Bacteria 3631
1394 Ga0268266_10054328 3300028379 Bacteria 3441
1395 Ga0268266_10069069 3300028379 Bacteria 3061
1396 Ga0268266_10102809 3300028379 Bacteria 2521
1397 Ga0268266_10112273 3300028379 Bacteria 2416
1398 Ga0268266_10157087 3300028379 Bacteria 2055
1399 Ga0268265_10004584 3300028380 Bacteria 9553
1400 Ga0268265_10004996 3300028380 Bacteria 9104
1401 Ga0268265_10005389 3300028380 Bacteria 8758
1402 Ga0268265_10012818 3300028380 Bacteria 5692
1403 Ga0268265_10110928 3300028380 Bacteria 2239
1404 Ga0268265_10149434 3300028380 Bacteria 1968
1405 Ga0268265_10205450 3300028380 Bacteria 1712
1406 Ga0268265_10217718 3300028380 Bacteria 1668
1407 Ga0268264_10000145 3300028381 Bacteria 167262
1408 Ga0268264_10000702 3300028381 Bacteria 38628
1409 Ga0268264_10001853 3300028381 Bacteria 19220
1410 Ga0268264_10014241 3300028381 Bacteria 6538
1411 Ga0268264_10020100 3300028381 Bacteria 5456
1412 Ga0268264_10029856 3300028381 Bacteria 4468
1413 Ga0268264_10063126 3300028381 Bacteria 3113
1414 Ga0268264_10128828 3300028381 Bacteria 2240
1415 Ga0268264_10258265 3300028381 Bacteria 1622
1416 Ga0268264_10328243 3300028381 Bacteria 1449
1417 Ga0265337_1013649 3300028556 Bacteria 2717
1418 Ga0265318_10006296 3300028577 Bacteria 5482
1419 Ga0307515_10000093 3300028794 Bacteria 212053
1420 Ga0307515_10017976 3300028794 Bacteria 12835
1421 Ga0307515_10155276 3300028794 Bacteria 2366
1422 Ga0265338_10000045 3300028800 Bacteria 223264
1423 Ga0265338_10000205 3300028800 Bacteria 111060
1424 Ga0265338_10009967 3300028800 Bacteria 11233
1425 Ga0265338_10066764 3300028800 Bacteria 3111
1426 Ga0307511_10000005 3300030521 Bacteria 175482
1427 Ga0307511_10002396 3300030521 Bacteria 19597
1428 Ga0307511_10029420 3300030521 Bacteria 4961
1429 Ga0265330_10014406 3300031235 Bacteria 3670
1430 Ga0265330_10028519 3300031235 Bacteria 2515
1431 Ga0265330_10037714 3300031235 Bacteria 2151
1432 Ga0265332_10000958 3300031238 Bacteria 17090
1433 Ga0265332_10001524 3300031238 Bacteria 12848
1434 Ga0265328_10007751 3300031239 Bacteria 4463
1435 Ga0265325_10000630 3300031241 Bacteria 25635
1436 Ga0265325_10018378 3300031241 Bacteria 3876
1437 Ga0265325_10074544 3300031241 Bacteria 1697
1438 Ga0265329_10003688 3300031242 Bacteria 6604
1439 Ga0265340_10016731 3300031247 Bacteria 3795
1440 Ga0265339_10038895 3300031249 Bacteria 2651
1441 Ga0265339_10082269 3300031249 Bacteria 1700
1442 Ga0265331_10002114 3300031250 Bacteria 13701
1443 Ga0265331_10003801 3300031250 Bacteria 9577
1444 Ga0265331_10015421 3300031250 Bacteria 4034
1445 Ga0265331_10039283 3300031250 Bacteria 2308
1446 Ga0265316_10025070 3300031344 Bacteria 4982
1447 Ga0265316_10026875 3300031344 Bacteria 4776
1448 Ga0265316_10049063 3300031344 Bacteria 3327
1449 Ga0265316_10143199 3300031344 Bacteria 1794
1450 Ga0307513_10000104 3300031456 Bacteria 119239
1451 Ga0307509_10000002 3300031507 Bacteria 607551
1452 Ga0307509_10023370 3300031507 Bacteria 6945
1453 Ga0307509_10040989 3300031507 Bacteria 5031
1454 Ga0307509_10049824 3300031507 Bacteria 4488
1455 Ga0307408_100040078 3300031548 Bacteria 3315
1456 Ga0307408_100097633 3300031548 Bacteria 2232
1457 Ga0307408_100127701 3300031548 Bacteria 1979
1458 Ga0265313_10074095 3300031595 Bacteria 1562
1459 Ga0307508_10112275 3300031616 Bacteria 2326
1460 Ga0316575_10006567 3300031665 Bacteria 4190
1461 Ga0316575_10016119 3300031665 Bacteria 2824
1462 Ga0316575_10016590 3300031665 Bacteria 2789
1463 Ga0316575_10035985 3300031665 Bacteria 1947
1464 Ga0316579_10007610 3300031691 Bacteria 4482
1465 Ga0316579_10009935 3300031691 Bacteria 4012
1466 Ga0316579_10027858 3300031691 Bacteria 2568
1467 Ga0316579_10032999 3300031691 Bacteria 2376
1468 Ga0316579_10064955 3300031691 Bacteria 1721
1469 Ga0265314_10000523 3300031711 Bacteria 49565
1470 Ga0265314_10001945 3300031711 Bacteria 22010
1471 Ga0265314_10015124 3300031711 Bacteria 6137
1472 Ga0265342_10003160 3300031712 Bacteria 13732
1473 Ga0316576_10019148 3300031727 Bacteria 4687
1474 Ga0316576_10199278 3300031727 Bacteria 1508
1475 Ga0316578_10004329 3300031728 Bacteria 6682
1476 Ga0316578_10009032 3300031728 Bacteria 5105
1477 Ga0316578_10012288 3300031728 Bacteria 4511
1478 Ga0316578_10039586 3300031728 Bacteria 2723
1479 Ga0307405_10052570 3300031731 Bacteria 2534
1480 Ga0307413_10046722 3300031824 Bacteria 2577
1481 Ga0307413_10058152 3300031824 Bacteria 2368
1482 Ga0307410_10005780 3300031852 Bacteria 6595
1483 Ga0307410_10138911 3300031852 Bacteria 1795
1484 Ga0307406_10002674 3300031901 Bacteria 9701
1485 Ga0307406_10033409 3300031901 Bacteria 3149
1486 Ga0307406_10141911 3300031901 Bacteria 1701
1487 Ga0307407_10004002 3300031903 Bacteria 6166
1488 Ga0307407_10006689 3300031903 Bacteria 5154
1489 Ga0307412_10014011 3300031911 Bacteria 4720
1490 Ga0307412_10019161 3300031911 Bacteria 4136
1491 Ga0307412_10095129 3300031911 Bacteria 2094
1492 Ga0307409_100000674 3300031995 Bacteria 15138
1493 Ga0307409_100018856 3300031995 Bacteria 4654
1494 Ga0307409_100153391 3300031995 Bacteria 2004
1495 Ga0307409_100274245 3300031995 Bacteria 1555
1496 Ga0307416_100012024 3300032002 Bacteria 5809
1497 Ga0307416_100015040 3300032002 Bacteria 5328
1498 Ga0307416_100018117 3300032002 Bacteria 4951
1499 Ga0307416_100029619 3300032002 Bacteria 4093
1500 Ga0307416_100438825 3300032002 Bacteria 1355
1501 Ga0307414_10177423 3300032004 Bacteria 1710
1502 Ga0307411_10060228 3300032005 Bacteria 2520
1503 Ga0307415_100001423 3300032126 Bacteria 11439
1504 Ga0307415_100094136 3300032126 Bacteria 2177
1505 Ga0307415_100197221 3300032126 Bacteria 1594
1506 Ga0307415_100235887 3300032126 Bacteria 1476
1507 Ga0316583_10002176 3300032133 Bacteria 6755
1508 Ga0316583_10005429 3300032133 Bacteria 4574
1509 Ga0316583_10026229 3300032133 Bacteria 2080
1510 Ga0316585_10006962 3300032137 Bacteria 3246
1511 Ga0316593_10023588 3300032168 Bacteria 1943
1512 Ga0316593_10057995 3300032168 Bacteria 1319
1513 Ga0307507_10014093 3300033179 Bacteria 9587
1514 Ga0307510_10000007 3300033180 Bacteria 558582
1515 Ga0307510_10039627 3300033180 Bacteria 5186
1516 Ga0316592_1005024 3300033524 Bacteria 2492
1517 Ga0316586_1003345 3300033527 Bacteria 2096
1518 Ga0316588_1002715 3300033528 Bacteria 3121
1519 Ga0373938_0001276 3300034957 Bacteria 4046
1520 Ga0373926_0004126 3300035083 Bacteria 4748
1521 Ga0373934_0000243 3300035086 Bacteria 19594
1522 Ga0373934_0003740 3300035086 Bacteria 5600
1523 Ga0373934_0011985 3300035086 Bacteria 3270
1524 Ga0373934_0022213 3300035086 Bacteria 2446
1525 Ga0373940_0005447 3300035088 Bacteria 2758
1526 Ga0373940_0016453 3300035088 Bacteria 1832
1527 Ga0373951_0012561 3300035091 Bacteria 1904
1528 Ga0373952_0004182 3300035092 Bacteria 2608
1529 Ga0373952_0020049 3300035092 Bacteria 1398
1530 Ga0373923_0001240 3300035111 Bacteria 7157
1531 Ga0373923_0046228 3300035111 Bacteria 1810
1532 Ga0373932_0000353 3300035112 Bacteria 14116
1533 Ga0373932_0009251 3300035112 Bacteria 2367
1534 Ga0373936_0045960 3300035113 Bacteria 1759
1535 Ga0373939_0001442 3300035114 Bacteria 5753
1536 Ga0373939_0002736 3300035114 Bacteria 4137
1537 Ga0373939_0003087 3300035114 Bacteria 3911
1538 Ga0373945_0056549 3300035116 Bacteria 1455
1539 Ga0373953_0004970 3300035117 Bacteria 4282
1540 Ga0373953_0005184 3300035117 Bacteria 4213
1541 Ga0373954_0000003 3300035118 Bacteria 137757
1542 Ga0373954_0003106 3300035118 Bacteria 7012
1543 Ga0373954_0009477 3300035118 Bacteria 4282
1544 Ga0373954_0009838 3300035118 Bacteria 4208
1545 Ga0373954_0018758 3300035118 Bacteria 3116
1546 Ga0373956_0002064 3300035119 Bacteria 8323
1547 Ga0373956_0005959 3300035119 Bacteria 4874
1548 Ga0373956_0047177 3300035119 Bacteria 1926
1549 Ga0373957_0008533 3300035120 Bacteria 3323
1550 Ga0373957_0091909 3300035120 Bacteria 1207
1551 Ga0373960_0007072 3300035121 Bacteria 2648
1552 Ga0373960_0019603 3300035121 Bacteria 1779
1553 Ga0373943_0001697 3300035170 Bacteria 9992
1554 Ga0373943_0011387 3300035170 Bacteria 4003
1555 Ga0373943_0027495 3300035170 Bacteria 2673
1556 Ga0373943_0065997 3300035170 Bacteria 1821
1557 Ga0373946_0008281 3300035171 Bacteria 3816
1558 Ga0373946_0026490 3300035171 Bacteria 2288
1559 Ga0373946_0041523 3300035171 Bacteria 1887
1560 Ga0373955_0000145 3300035172 Bacteria 28047
1561 Ga0373955_0001065 3300035172 Bacteria 11686
1562 Ga0373955_0001607 3300035172 Bacteria 9675
1563 Ga0373955_0015582 3300035172 Bacteria 3725
1564 Ga0373955_0018267 3300035172 Bacteria 3485
1565 Ga0373955_0042371 3300035172 Bacteria 2444
1566 Ga0373955_0042484 3300035172 Bacteria 2441
1567 Ga0373955_0046475 3300035172 Bacteria 2347
1568 Ga0373955_0094716 3300035172 Bacteria 1707
1569 Ga0373942_0002017 3300035207 Bacteria 5051
1570 Ga0373942_0047388 3300035207 Bacteria 1194
1571 Ga0373962_0001024 3300035242 Bacteria 6467
1572 Ga0316574_0009125 3300035398 Bacteria 5540
1573 Ga0316574_0011818 3300035398 Bacteria 4973
1574 Ga0316574_0020894 3300035398 Bacteria 3880
1575 Ga0316574_0099034 3300035398 Bacteria 1865
1576 Ga0316574_0124507 3300035398 Bacteria 1656
1577 Ga0316574_0144681 3300035398 Bacteria 1532
1578 Ga0316574_0168269 3300035398 Bacteria 1411
1579 Ga0373924_0000941 3300035410 Bacteria 9198
1580 Ga0373924_0004607 3300035410 Bacteria 4828
1581 Ga0373924_0006633 3300035410 Bacteria 4152
1582 Ga0373924_0034351 3300035410 Bacteria 2052
1583 Ga0373931_0000189 3300035691 Bacteria 26663
1584 Ga0373931_0002113 3300035691 Bacteria 8752
1585 Ga0373931_0005256 3300035691 Bacteria 5971
1586 Ga0373931_0033728 3300035691 Bacteria 2654
1587 Ga0373931_0096464 3300035691 Bacteria 1656
1588 Ga0373935_0000017 3300035692 Bacteria 70368
1589 Ga0373935_0005734 3300035692 Bacteria 7338
1590 Ga0373935_0009848 3300035692 Bacteria 5722
1591 Ga0373935_0016747 3300035692 Bacteria 4436
1592 Ga0373935_0033804 3300035692 Bacteria 3185
1593 Ga0373935_0050401 3300035692 Bacteria 2642
1594 Ga0373935_0073411 3300035692 Bacteria 2210
1595 Ga0373935_0147534 3300035692 Bacteria 1594
1596 Ga0373927_0016477 3300035695 Bacteria 4873
1597 Ga0373927_0018526 3300035695 Bacteria 4573
1598 Ga0373927_0036724 3300035695 Bacteria 3185
1599 Ga0373927_0079565 3300035695 Bacteria 2124
1600 Ga0373927_0081786 3300035695 Bacteria 2093
1601 Ga0373927_0084079 3300035695 Bacteria 2064
1602 Ga0373927_0109731 3300035695 Bacteria 1797
1603 Ga0373933_0000579 3300035724 Bacteria 22962
1604 Ga0373933_0001228 3300035724 Bacteria 15165
1605 Ga0373933_0004151 3300035724 Bacteria 7977
1606 Ga0373933_0008876 3300035724 Bacteria 5481
1607 Ga0373933_0035109 3300035724 Bacteria 2926
1608 Ga0373933_0057746 3300035724 Bacteria 2333
1609 Ga0373933_0115462 3300035724 Bacteria 1677
1610 Ga0373947_0009952 3300035725 Bacteria 5463
1611 Ga0373947_0018315 3300035725 Bacteria 4031
1612 Ga0373947_0061412 3300035725 Bacteria 2284
1613 Ga0373947_0135362 3300035725 Bacteria 1576
1614 Ga0373947_0193816 3300035725 Bacteria 1327
1615 Ga0373937_0000103 3300036401 Bacteria 80386
1616 Ga0373937_0000131 3300036401 Bacteria 72767
1617 Ga0373937_0001360 3300036401 Bacteria 20455
1618 Ga0373937_0007447 3300036401 Bacteria 9471
1619 Ga0373937_0012811 3300036401 Bacteria 7384
1620 Ga0373937_0021739 3300036401 Bacteria 5759
1621 Ga0373937_0027437 3300036401 Bacteria 5149
1622 Ga0373937_0036403 3300036401 Bacteria 4484
1623 Ga0373937_0037606 3300036401 Bacteria 4411
1624 Ga0373937_0045372 3300036401 Bacteria 4016
1625 Ga0373937_0046984 3300036401 Bacteria 3949
1626 Ga0373937_0157864 3300036401 Bacteria 2126
1627 Ga0373937_0223313 3300036401 Bacteria 1773
1628 Ga0316582_0018444 3300036647 Bacteria 4062
1629 Ga0316582_0076960 3300036647 Bacteria 2171
1630 Ga0316582_0095048 3300036647 Bacteria 1966
1631 Ga0316582_0135484 3300036647 Bacteria 1657
1632 Ga0316584_0000192 3300036712 Bacteria 29986
1633 Ga0316584_0042219 3300036712 Bacteria 3400
1634 Ga0316584_0051908 3300036712 Bacteria 3067
1635 Ga0316584_0061049 3300036712 Bacteria 2823
1636 Ga0316584_0070015 3300036712 Bacteria 2630
1637 Ga0316584_0079431 3300036712 Bacteria 2457
1638 Ga0316584_0089186 3300036712 Bacteria 2309
1639 Ga0316584_0153546 3300036712 Bacteria 1713
1640 Ga0373925_0000058 3300037068 Bacteria 122682
1641 Ga0373925_0040900 3300037068 Bacteria 3433
1642 Ga0373925_0043332 3300037068 Bacteria 3339
1643 Ga0373925_0044352 3300037068 Bacteria 3302
1644 Ga0373925_0054731 3300037068 Bacteria 2985
1645 Ga0373925_0112646 3300037068 Bacteria 2103
1646 Ga0395899_0028085 3300037312 Bacteria 4238
1647 Ga0395899_0061267 3300037312 Bacteria 2771
1648 Ga0395899_0065936 3300037312 Bacteria 2660
1649 Ga0395900_0019231 3300037418 Bacteria 6964
1650 Ga0395900_0036870 3300037418 Bacteria 5040
1651 Ga0395900_0046502 3300037418 Bacteria 4469
1652 Ga0395900_0059277 3300037418 Bacteria 3940
1653 Ga0395900_0201866 3300037418 Bacteria 2011
1654 Ga0395900_0204678 3300037418 Bacteria 1995
1655 Ga0395900_0283517 3300037418 Bacteria 1648
1656 Ga0395900_0295256 3300037418 Bacteria 1608
1657 Ga0395898_0015812 3300037466 Bacteria 7734
1658 Ga0395898_0023421 3300037466 Bacteria 6241
1659 Ga0395898_0029771 3300037466 Bacteria 5465
1660 Ga0395898_0047621 3300037466 Bacteria 4206
1661 Ga0395898_0060385 3300037466 Bacteria 3684
1662 Ga0395898_0077240 3300037466 Bacteria 3215
1663 Ga0395898_0127713 3300037466 Bacteria 2436
1664 Ga0395898_0153070 3300037466 Bacteria 2206
1665 Ga0395898_0154242 3300037466 Bacteria 2197
1666 Ga0395898_0184252 3300037466 Bacteria 1995
1667 Ga0395905_0000043 3300037471 Bacteria 247469
1668 Ga0395905_0014552 3300037471 Bacteria 7506
1669 Ga0395905_0049067 3300037471 Bacteria 3955
1670 Ga0395905_0067525 3300037471 Bacteria 3349
1671 Ga0395905_0115317 3300037471 Bacteria 2524
1672 Ga0395905_0120534 3300037471 Bacteria 2466
1673 Ga0395905_0158564 3300037471 Bacteria 2127
1674 Ga0395905_0180344 3300037471 Bacteria 1982
1675 Ga0316581_0001310 3300037588 Bacteria 5524
1676 Ga0436364_0207258 3300037853 Bacteria 22246
1677 Ga0436364_0314874 3300037853 Bacteria 1261
1678 Ga0436364_0351220 3300037853 Bacteria 2167
1679 Ga0436364_0764338 3300037853 Bacteria 31107
1680 Ga0436364_0988190 3300037853 Bacteria 2674
1681 Ga0436364_1220763 3300037853 Bacteria 6566
1682 Ga0436364_1270512 3300037853 Bacteria 5001
1683 Ga0436364_1468533 3300037853 Bacteria 1358
1684 Ga0395901_0011296 3300038443 Bacteria 9047
1685 Ga0395901_0017178 3300038443 Bacteria 7381
1686 Ga0395901_0017650 3300038443 Bacteria 7285
1687 Ga0395901_0034121 3300038443 Bacteria 5255
1688 Ga0395901_0090732 3300038443 Bacteria 3198
1689 Ga0395901_0233125 3300038443 Bacteria 1921
1690 Ga0400488_25049 3300038741 Bacteria 6520
1691 Ga0400483_010883 3300039062 Bacteria 2039
1692 Ga0400483_052876 3300039062 Bacteria 1405
1693 Ga0400483_192796 3300039062 Bacteria 5957
1694 Ga0400489_18675 3300039093 Bacteria 22223
1695 Ga0400489_49853 3300039093 Bacteria 14837
1696 Ga0400487_25275 3300039110 Bacteria 1161
1697 Ga0436365_0727164 3300039437 Bacteria 12956
1698 Ga0436365_1241251 3300039437 Bacteria 27325
1699 Ga0436365_1282334 3300039437 Bacteria 2414
1700 Ga0436365_1865855 3300039437 Bacteria 6531
1701 Ga0436360_1082140 3300039438 Bacteria 5044
1702 Ga0436361_0234825 3300039447 Bacteria 1897
1703 Ga0436361_0837620 3300039447 Bacteria 1401
1704 Ga0436363_0024737 3300039450 Bacteria 5925
1705 Ga0436363_1334135 3300039450 Bacteria 2120
1706 Ga0436363_1512283 3300039450 Bacteria 5634
1707 Ga0436362_0025995 3300039453 Bacteria 2084
1708 Ga0436362_1027627 3300039453 Bacteria 4387
1709 Ga0439436_0001332 3300041404 Bacteria 7098
1710 Ga0439453_0000481 3300041408 Bacteria 4376
1711 Ga0439466_0019516 3300041411 Bacteria 2426
1712 Ga0439465_0003831 3300041413 Bacteria 4907
1713 Ga0451853_3625268 3300041512 Bacteria 1655
1714 Ga0439433_0002646 3300041999 Bacteria 3805
1715 Ga0439441_012443 3300042001 Bacteria 1461
1716 Ga0439445_0000170 3300042004 Bacteria 11554
1717 Ga0439449_0004416 3300042007 Bacteria 5423
1718 Ga0439451_020065 3300042009 Bacteria 1347
1719 Ga0439462_0010265 3300042015 Bacteria 2371
1720 Ga0439446_0005653 3300042156 Bacteria 3222
1721 Ga0450909_001487 3300042185 Bacteria 3271
1722 Ga0439434_0004262 3300042435 Bacteria 4180
1723 Ga0439434_0005544 3300042435 Bacteria 3687
1724 Ga0439434_0011570 3300042435 Bacteria 2610
1725 Ga0439435_0000427 3300042436 Bacteria 6569
1726 Ga0439444_0000069 3300042437 Bacteria 7681
1727 Ga0451577_0008711 3300042876 Bacteria 9837
1728 Ga0451577_0009071 3300042876 Bacteria 9601
1729 Ga0451577_0033459 3300042876 Bacteria 4634
1730 Ga0451577_0130421 3300042876 Bacteria 2255
1731 Ga0451577_0286070 3300042876 Unclassified 1494
1732 Ga0466969_0001994 3300044656 Bacteria 10909
1733 Ga0466972_0003545 3300044658 Bacteria 7749
1734 Ga0466966_0026781 3300044684 Bacteria 3762
1735 Ga0466961_0012714 3300044693 Bacteria 5391
1736 Ga0466961_0028539 3300044693 Bacteria 3588
1737 Ga0466963_0038709 3300044694 Bacteria 3120
1738 Ga0466964_0006291 3300044706 Bacteria 4419
1739 Ga0453684_0275738 3300044712 Bacteria 1920
1740 Ga0466968_0000683 3300044735 Bacteria 11685
1741 Ga0466968_0004230 3300044735 Bacteria 5352
1742 Ga0466970_0082030 3300044765 Bacteria 1744
1743 Ga0466957_0000089 3300044842 Bacteria 36497
1744 Ga0466960_0011379 3300044901 Bacteria 3722
1745 Ga0466959_0001172 3300045049 Bacteria 15783
1746 Ga0466959_0008856 3300045049 Bacteria 7136
1747 Ga0466959_0009421 3300045049 Bacteria 6947
1748 Ga0466959_0015485 3300045049 Bacteria 5556
1749 Ga0451576_0001669 3300045051 Bacteria 36837
1750 Ga0451576_0001675 3300045051 Bacteria 36759
1751 Ga0451576_0005273 3300045051 Bacteria 16262
1752 Ga0451576_0086106 3300045051 Bacteria 3268
1753 Ga0451576_0369994 3300045051 Bacteria 1502
1754 Ga0466958_0034236 3300045836 Bacteria 3030
1755 Ga0466958_0067726 3300045836 Bacteria 2181
1756 Ga0466967_0133314 3300045976 Bacteria 2308
1757 Ga0495592_0000062 3300046454 Bacteria 99207
1758 Ga0495592_0049105 3300046454 Bacteria 3137
1759 Ga0495592_0072897 3300046454 Bacteria 2498
1760 Ga0495592_0076710 3300046454 Bacteria 2424
1761 Ga0495590_0017572 3300046457 Bacteria 2572
1762 Ga0495590_0056223 3300046457 Bacteria 1375
1763 Ga0495591_002493 3300046458 Bacteria 10195
1764 Ga0495591_005888 3300046458 Bacteria 5554
1765 Ga0495629_0000115 3300046459 Bacteria 72648
1766 Ga0495629_0001063 3300046459 Bacteria 21933
1767 Ga0495629_0001807 3300046459 Bacteria 16771
1768 Ga0495629_0005730 3300046459 Bacteria 9270
1769 Ga0495629_0039433 3300046459 Bacteria 3324
1770 Ga0495629_0044725 3300046459 Bacteria 3107
1771 Ga0495629_0048099 3300046459 Bacteria 2990
1772 Ga0495638_0003283 3300046460 Bacteria 12754
1773 Ga0495638_0014124 3300046460 Bacteria 5407
1774 Ga0495641_0003356 3300046461 Bacteria 12023
1775 Ga0495651_0001912 3300046462 Bacteria 16134
1776 Ga0495651_0003749 3300046462 Bacteria 11627
1777 Ga0495651_0005207 3300046462 Bacteria 9913
1778 Ga0495653_0000072 3300046463 Bacteria 85266
1779 Ga0495653_0003451 3300046463 Bacteria 12705
1780 Ga0495653_0004667 3300046463 Bacteria 11079
1781 Ga0495653_0015156 3300046463 Bacteria 6284
1782 Ga0495653_0089891 3300046463 Bacteria 2248
1783 Ga0495653_0100678 3300046463 Bacteria 2094
1784 Ga0495650_0005305 3300046471 Bacteria 8430
1785 Ga0495650_0017498 3300046471 Bacteria 3592
1786 Ga0495580_0006433 3300046472 Bacteria 9563
1787 Ga0495580_0015198 3300046472 Bacteria 5819
1788 Ga0495580_0025336 3300046472 Bacteria 4335
1789 Ga0495580_0038208 3300046472 Bacteria 3440
1790 Ga0495580_0038330 3300046472 Bacteria 3433
1791 Ga0495582_0014890 3300046473 Bacteria 4273
1792 Ga0495582_0022387 3300046473 Bacteria 3457
1793 Ga0495582_0049259 3300046473 Bacteria 2320
1794 Ga0495605_0012353 3300046474 Bacteria 4740
1795 Ga0495605_0069680 3300046474 Bacteria 1664
1796 Ga0495639_0003385 3300046475 Bacteria 6911
1797 Ga0495639_0007850 3300046475 Bacteria 4586
1798 Ga0495639_0008512 3300046475 Bacteria 4400
1799 Ga0495662_0036717 3300046476 Bacteria 2364
1800 Ga0495664_0000009 3300046477 Bacteria 289534
1801 Ga0495664_0042127 3300046477 Bacteria 2703
1802 Ga0495584_0008312 3300046491 Bacteria 5375
1803 Ga0495584_0012414 3300046491 Bacteria 4348
1804 Ga0495584_0043732 3300046491 Bacteria 2261
1805 Ga0495585_0080064 3300046492 Bacteria 1771
1806 Ga0495594_0027422 3300046499 Bacteria 3069
1807 Ga0495596_0000832 3300046500 Bacteria 18665
1808 Ga0495596_0001312 3300046500 Bacteria 14347
1809 Ga0495607_0060761 3300046501 Bacteria 2150
1810 Ga0495607_0087371 3300046501 Bacteria 1697
1811 Ga0495583_0002560 3300046506 Bacteria 15337
1812 Ga0495583_0019920 3300046506 Bacteria 3490
1813 Ga0495583_0056047 3300046506 Bacteria 1779
1814 Ga0495606_0007905 3300046507 Bacteria 9378
1815 Ga0495606_0010540 3300046507 Bacteria 7653
1816 Ga0495606_0018588 3300046507 Bacteria 5203
1817 Ga0495608_0000061 3300046511 Bacteria 86891
1818 Ga0495608_0003916 3300046511 Bacteria 10705
1819 Ga0495616_0009920 3300046513 Bacteria 5536
1820 Ga0495618_0000061 3300046514 Bacteria 78337
1821 Ga0495618_0005652 3300046514 Bacteria 7602
1822 Ga0495620_0005528 3300046515 Bacteria 7046
1823 Ga0495620_0036318 3300046515 Bacteria 2206
1824 Ga0495620_0036549 3300046515 Bacteria 2196
1825 Ga0495628_0000012 3300046516 Bacteria 224162
1826 Ga0495628_0004166 3300046516 Bacteria 12869
1827 Ga0495628_0005756 3300046516 Bacteria 10859
1828 Ga0495628_0023537 3300046516 Bacteria 5054
1829 Ga0495628_0034390 3300046516 Bacteria 4076
1830 Ga0495628_0063792 3300046516 Bacteria 2886
1831 Ga0495628_0192958 3300046516 Bacteria 1537
1832 Ga0495630_0010670 3300046517 Bacteria 6632
1833 Ga0495630_0015707 3300046517 Bacteria 5532
1834 Ga0495630_0026145 3300046517 Bacteria 4320
1835 Ga0495630_0056182 3300046517 Bacteria 2949
1836 Ga0495630_0063049 3300046517 Bacteria 2785
1837 Ga0495630_0081720 3300046517 Bacteria 2438
1838 Ga0495630_0090327 3300046517 Bacteria 2314
1839 Ga0495631_0003805 3300046518 Bacteria 8201
1840 Ga0495631_0005592 3300046518 Bacteria 6568
1841 Ga0495631_0013284 3300046518 Bacteria 3999
1842 Ga0495631_0028611 3300046518 Bacteria 2541
1843 Ga0495632_0017133 3300046519 Bacteria 4007
1844 Ga0495632_0062788 3300046519 Bacteria 1800
1845 Ga0495637_0007448 3300046520 Bacteria 5421
1846 Ga0495643_0006316 3300046522 Bacteria 7834
1847 Ga0495643_0011455 3300046522 Bacteria 5401
1848 Ga0495643_0037999 3300046522 Bacteria 2638
1849 Ga0495643_0086339 3300046522 Bacteria 1625
1850 Ga0495644_0032333 3300046523 Bacteria 1976
1851 Ga0495648_0011365 3300046524 Bacteria 6709
1852 Ga0495648_0020006 3300046524 Bacteria 4682
1853 Ga0495648_0045460 3300046524 Bacteria 2731
1854 Ga0495666_0005421 3300046526 Bacteria 6423
1855 Ga0495666_0009188 3300046526 Bacteria 4944
1856 Ga0495642_0007602 3300046528 Bacteria 4152
1857 Ga0495642_0010765 3300046528 Bacteria 3504
1858 Ga0495652_0000021 3300046529 Bacteria 181454
1859 Ga0495652_0004306 3300046529 Bacteria 13640
1860 Ga0495652_0032040 3300046529 Bacteria 4599
1861 Ga0495652_0072337 3300046529 Bacteria 2874
1862 Ga0495654_0009184 3300046530 Bacteria 5421
1863 Ga0495654_0027893 3300046530 Bacteria 2890
1864 Ga0495654_0037383 3300046530 Bacteria 2435
1865 Ga0495665_0004644 3300046531 Bacteria 7409
1866 Ga0495665_0015272 3300046531 Bacteria 4137
1867 Ga0495665_0026132 3300046531 Bacteria 3136
1868 Ga0495665_0037280 3300046531 Bacteria 2595
1869 Ga0495665_0066116 3300046531 Bacteria 1908
1870 Ga0495665_0072069 3300046531 Bacteria 1819
1871 Ga0495640_0000028 3300046533 Bacteria 79904
1872 Ga0495640_0006679 3300046533 Bacteria 9101
1873 Ga0495640_0013131 3300046533 Bacteria 6304
1874 Ga0495640_0031348 3300046533 Bacteria 3794
1875 Ga0495586_0007082 3300046535 Bacteria 5977
1876 Ga0495586_0008178 3300046535 Bacteria 5574
1877 Ga0495586_0009251 3300046535 Bacteria 5238
1878 Ga0495586_0012052 3300046535 Bacteria 4593
1879 Ga0495586_0013720 3300046535 Bacteria 4300
1880 Ga0495586_0198461 3300046535 Bacteria 1137
1881 Ga0495587_0000033 3300046536 Bacteria 123885
1882 Ga0495587_0004825 3300046536 Bacteria 8855
1883 Ga0495587_0009004 3300046536 Bacteria 6408
1884 Ga0495587_0029072 3300046536 Bacteria 3357
1885 Ga0495587_0110371 3300046536 Bacteria 1580
1886 Ga0495609_0016445 3300046538 Bacteria 3447
1887 Ga0495609_0018956 3300046538 Bacteria 3187
1888 Ga0495621_0001657 3300046539 Bacteria 5837
1889 Ga0495597_0000019 3300046542 Bacteria 164636
1890 Ga0495597_0000058 3300046542 Bacteria 92755
1891 Ga0495597_0002251 3300046542 Bacteria 12572
1892 Ga0495597_0006725 3300046542 Bacteria 5919
1893 Ga0495645_0000017 3300046543 Bacteria 156865
1894 Ga0495645_0000609 3300046543 Bacteria 24694
1895 Ga0495645_0000843 3300046543 Bacteria 20844
1896 Ga0495645_0001841 3300046543 Bacteria 14405
1897 Ga0495645_0016307 3300046543 Bacteria 5302
1898 Ga0495645_0060228 3300046543 Bacteria 2752
1899 Ga0495645_0119832 3300046543 Bacteria 1854
1900 Ga0495622_0000196 3300046557 Bacteria 47964
1901 Ga0495622_0002089 3300046557 Bacteria 9766
1902 Ga0495622_0013911 3300046557 Bacteria 3734
1903 Ga0495633_0006886 3300046558 Bacteria 6653
1904 Ga0495633_0009809 3300046558 Bacteria 5263
1905 Ga0495633_0023642 3300046558 Bacteria 3042
1906 Ga0495667_0000011 3300046559 Bacteria 222545
1907 Ga0495667_0000672 3300046559 Bacteria 21886
1908 Ga0495667_0001460 3300046559 Bacteria 15551
1909 Ga0495667_0078757 3300046559 Bacteria 2143
1910 Ga0495667_0098363 3300046559 Bacteria 1894
1911 Ga0495667_0098876 3300046559 Bacteria 1889
1912 Ga0495656_0007411 3300046615 Bacteria 3875
1913 Ga0495668_0003141 3300046616 Bacteria 12745
1914 Ga0495668_0026664 3300046616 Bacteria 3278
1915 Ga0495668_0030630 3300046616 Bacteria 3036
1916 Ga0495668_0048473 3300046616 Bacteria 2356
1917 Ga0495668_0100806 3300046616 Bacteria 1580
1918 Ga0495634_0000220 3300046642 Bacteria 53609
1919 Ga0495634_0001130 3300046642 Bacteria 24672
1920 Ga0495634_0026629 3300046642 Bacteria 4033
1921 Ga0495634_0046247 3300046642 Bacteria 2939
1922 Ga0495634_0077175 3300046642 Bacteria 2185
1923 Ga0495634_0124527 3300046642 Bacteria 1648
1924 Ga0495611_0003515 3300046648 Bacteria 6897
1925 Ga0495611_0036614 3300046648 Bacteria 2178
1926 Ga0495611_0078038 3300046648 Bacteria 1519
1927 Ga0495625_0024548 3300046660 Bacteria 4587
1928 Ga0495635_0000019 3300046663 Bacteria 193402
1929 Ga0495635_0007180 3300046663 Bacteria 7780
1930 Ga0495635_0016849 3300046663 Bacteria 5104
1931 Ga0495635_0048647 3300046663 Bacteria 2923
1932 Ga0495661_0001133 3300046665 Bacteria 23317
1933 Ga0495661_0005288 3300046665 Bacteria 9176
1934 Ga0495661_0075586 3300046665 Bacteria 1957
1935 Ga0495661_0079148 3300046665 Bacteria 1899
1936 Ga0495661_0086112 3300046665 Bacteria 1799
1937 Ga0495588_0018753 3300046674 Bacteria 3378
1938 Ga0495657_0000378 3300046675 Bacteria 41496
1939 Ga0495657_0009256 3300046675 Bacteria 7477
1940 Ga0495657_0032069 3300046675 Bacteria 3669
1941 Ga0495599_0000024 3300046678 Bacteria 121388
1942 Ga0495599_0015770 3300046678 Bacteria 4690
1943 Ga0495599_0153466 3300046678 Bacteria 1425
1944 Ga0495623_0000022 3300046679 Bacteria 98899
1945 Ga0495623_0003295 3300046679 Bacteria 10663
1946 Ga0495623_0009483 3300046679 Bacteria 6321
1947 Ga0495623_0026360 3300046679 Bacteria 3742
1948 Ga0495646_0000033 3300046680 Bacteria 83930
1949 Ga0495646_0001525 3300046680 Bacteria 13804
1950 Ga0495646_0025972 3300046680 Bacteria 3679
1951 Ga0495646_0034625 3300046680 Bacteria 3136
1952 Ga0495646_0054051 3300046680 Bacteria 2417
1953 Ga0495646_0064318 3300046680 Bacteria 2175
1954 Ga0495647_0002023 3300046681 Bacteria 6335
1955 Ga0495647_0008562 3300046681 Bacteria 3440
1956 Ga0495658_0003278 3300046683 Bacteria 8044
1957 Ga0495658_0055595 3300046683 Bacteria 2255
1958 Ga0495658_0076122 3300046683 Bacteria 1960
1959 Ga0495658_0126589 3300046683 Bacteria 1551
1960 Ga0495669_0049879 3300046684 Bacteria 1876
1961 Ga0495613_0009781 3300046689 Bacteria 7128
1962 Ga0495613_0021121 3300046689 Bacteria 4854
1963 Ga0495613_0035495 3300046689 Bacteria 3700
1964 Ga0495613_0038298 3300046689 Bacteria 3554
1965 Ga0495624_0000768 3300046690 Bacteria 25268
1966 Ga0495624_0001964 3300046690 Bacteria 15647
1967 Ga0495624_0005770 3300046690 Bacteria 8869
1968 Ga0495624_0008963 3300046690 Bacteria 6951
1969 Ga0495624_0035255 3300046690 Bacteria 3231
1970 Ga0495670_0005274 3300046691 Bacteria 6359
1971 Ga0495670_0026270 3300046691 Bacteria 2881
1972 Ga0495670_0056278 3300046691 Bacteria 1973
1973 Ga0495671_0026726 3300046692 Bacteria 2988
1974 Ga0495671_0027130 3300046692 Bacteria 2960
1975 Ga0495671_0030347 3300046692 Bacteria 2769
1976 Ga0495671_0035825 3300046692 Bacteria 2518
1977 Ga0495649_0001475 3300046694 Bacteria 17679
1978 Ga0495649_0025625 3300046694 Bacteria 3284
1979 Ga0495649_0084480 3300046694 Bacteria 1695
1980 Ga0495589_0000861 3300046794 Bacteria 18936
1981 Ga0495589_0003845 3300046794 Bacteria 8070
1982 Ga0495600_0000028 3300046809 Bacteria 90661
1983 Ga0495600_0000657 3300046809 Bacteria 17939
1984 Ga0495600_0009629 3300046809 Bacteria 5972
1985 Ga0495600_0017922 3300046809 Bacteria 4507
1986 Ga0495600_0018548 3300046809 Bacteria 4434
1987 Ga0495600_0046862 3300046809 Bacteria 2820
1988 Ga0495600_0051933 3300046809 Bacteria 2676
1989 Ga0495600_0122751 3300046809 Bacteria 1689
1990 Ga0495600_0194322 3300046809 Bacteria 1304
1991 Ga0495660_0012857 3300046810 Bacteria 4854
1992 Ga0495660_0051548 3300046810 Bacteria 2239
1993 Ga0495660_0129958 3300046810 Bacteria 1264
1994 Ga0495581_0001914 3300047315 Bacteria 11661
1995 Ga0495581_0005793 3300047315 Bacteria 7163
1996 Ga0495581_0009339 3300047315 Bacteria 5676
1997 Ga0495581_0044986 3300047315 Bacteria 2552
1998 Ga0495581_0064417 3300047315 Bacteria 2117
1999 Ga0495604_0000011 3300047317 Bacteria 292024
2000 Ga0495604_0013594 3300047317 Bacteria 6492
2001 Ga0495604_0015332 3300047317 Bacteria 6116
2002 Ga0495604_0029226 3300047317 Bacteria 4384
2003 Ga0495604_0097564 3300047317 Bacteria 2167
2004 Ga0495674_0000015 3300047319 Bacteria 224071
2005 Ga0495674_0016124 3300047319 Bacteria 6973
2006 Ga0495674_0031893 3300047319 Bacteria 4781
2007 Ga0495674_0052325 3300047319 Bacteria 3594
2008 Ga0495674_0094033 3300047319 Bacteria 2557
2009 Ga0495674_0113720 3300047319 Bacteria 2292
2010 Ga0495674_0165371 3300047319 Bacteria 1849
2011 Ga0495674_0299994 3300047319 Bacteria 1312
2012 Ga0495672_0033356 3300047320 Bacteria 3190
2013 Ga0495672_0050320 3300047320 Bacteria 2460
2014 Ga0495676_0012310 3300047321 Bacteria 7708
2015 Ga0495676_0017794 3300047321 Bacteria 6275
2016 Ga0495676_0021777 3300047321 Bacteria 5590
2017 Ga0495676_0026748 3300047321 Bacteria 4960
2018 Ga0495676_0074109 3300047321 Bacteria 2608
2019 Ga0495676_0152020 3300047321 Bacteria 1646
2020 Ga0495680_0000812 3300047322 Bacteria 34880
2021 Ga0495680_0009066 3300047322 Bacteria 8982
2022 Ga0495680_0012341 3300047322 Bacteria 7521
2023 Ga0495680_0019802 3300047322 Bacteria 5673
2024 Ga0495680_0070190 3300047322 Bacteria 2671
2025 Ga0495687_000060 3300047443 Bacteria 179124
2026 Ga0495687_000350 3300047443 Bacteria 59063
2027 Ga0495687_015375 3300047443 Bacteria 3896
2028 Ga0495687_022160 3300047443 Bacteria 3057
2029 Ga0495675_0000295 3300047444 Bacteria 35782
2030 Ga0495675_0003515 3300047444 Bacteria 9442
2031 Ga0495675_0003662 3300047444 Bacteria 9287
2032 Ga0495675_0032366 3300047444 Bacteria 3337
2033 Ga0495677_0003018 3300047445 Bacteria 6544
2034 Ga0495677_0012062 3300047445 Bacteria 3154
2035 Ga0495679_000026 3300047446 Bacteria 196639
2036 Ga0495679_000245 3300047446 Bacteria 45040
2037 Ga0495679_002264 3300047446 Bacteria 9936
2038 Ga0495679_025669 3300047446 Bacteria 1967
2039 Ga0495673_0000335 3300047469 Bacteria 60281
2040 Ga0495673_0007801 3300047469 Bacteria 6096
2041 Ga0495673_0062981 3300047469 Bacteria 1582
2042 Ga0495681_0000005 3300047470 Bacteria 225279
2043 Ga0495681_0007520 3300047470 Bacteria 6941
2044 Ga0495681_0008222 3300047470 Bacteria 6557
2045 Ga0495681_0015730 3300047470 Bacteria 4271
2046 Ga0495681_0054108 3300047470 Bacteria 1877
2047 Ga0495684_0000036 3300047471 Bacteria 107181
2048 Ga0495684_0020175 3300047471 Bacteria 5133
2049 Ga0495684_0046440 3300047471 Bacteria 3322
2050 Ga0495684_0082407 3300047471 Bacteria 2440
2051 Ga0495686_0014653 3300047472 Bacteria 5391
2052 Ga0495593_0001674 3300047673 Bacteria 13131
2053 Ga0495593_0007037 3300047673 Bacteria 6597
2054 Ga0495593_0088071 3300047673 Bacteria 1600
2055 Ga0495593_0095932 3300047673 Bacteria 1524
2056 Ga0495602_0000018 3300048088 Bacteria 183837
2057 Ga0495602_0031584 3300048088 Bacteria 5004
2058 Ga0495602_0033350 3300048088 Bacteria 4831
2059 Ga0495602_0058452 3300048088 Bacteria 3374
2060 Ga0495614_0046053 3300048089 Bacteria 1870
2061 Ga0495614_0063828 3300048089 Bacteria 1583
2062 Ga0495614_0083312 3300048089 Bacteria 1387
2063 Ga0495626_0008241 3300048091 Bacteria 5733
2064 Ga0495626_0008439 3300048091 Bacteria 5645
2065 Ga0495626_0010810 3300048091 Bacteria 4850
2066 Ga0495626_0014377 3300048091 Bacteria 4087
2067 Ga0496100_0035629 3300048903 Bacteria 3132
2068 Ga0496101_0174015 3300048904 Bacteria 1655
2069 Ga0496101_0242092 3300048904 Bacteria 1404
2070 Ga0496102_0039979 3300048905 Bacteria 4241
2071 Ga0496102_0169234 3300048905 Bacteria 2057
2072 Ga0496102_0214595 3300048905 Bacteria 1814
2073 Ga0496102_0264863 3300048905 Bacteria 1620
2074 Ga0496102_0365754 3300048905 Bacteria 1358
2075 Ga0496103_0142093 3300048906 Bacteria 1536
2076 Ga0496104_0000175 3300048907 Bacteria 56916
2077 Ga0496104_0002357 3300048907 Bacteria 16326
2078 Ga0496104_0003379 3300048907 Bacteria 13784
2079 Ga0496104_0009058 3300048907 Bacteria 8852
2080 Ga0496104_0026761 3300048907 Bacteria 5330
2081 Ga0496104_0028770 3300048907 Bacteria 5150
2082 Ga0496104_0061783 3300048907 Bacteria 3552
2083 Ga0496104_0068986 3300048907 Bacteria 3360
2084 Ga0496105_0007248 3300048908 Bacteria 8565
2085 Ga0496105_0014273 3300048908 Bacteria 6322
2086 Ga0496105_0019067 3300048908 Bacteria 5529
2087 Ga0496105_0035302 3300048908 Bacteria 4115
2088 Ga0496105_0059288 3300048908 Bacteria 3159
2089 Ga0496105_0076042 3300048908 Bacteria 2773
2090 Ga0496105_0119224 3300048908 Bacteria 2177
2091 Ga0496106_0000334 3300048909 Bacteria 33088
2092 Ga0496106_0001067 3300048909 Bacteria 20209
2093 Ga0496106_0104347 3300048909 Bacteria 2201
2094 Ga0496106_0124796 3300048909 Bacteria 2015
2095 Ga0496107_0009614 3300048910 Bacteria 6705
2096 Ga0496107_0088487 3300048910 Bacteria 2261
2097 Ga0496107_0131986 3300048910 Bacteria 1844
2098 Ga0496108_0001410 3300048911 Bacteria 18935
2099 Ga0496108_0001485 3300048911 Bacteria 18526
2100 Ga0496108_0001994 3300048911 Bacteria 16347
2101 Ga0496108_0012643 3300048911 Bacteria 6878
2102 Ga0496108_0054756 3300048911 Bacteria 3348
2103 Ga0496108_0097929 3300048911 Bacteria 2499
2104 Ga0496108_0106011 3300048911 Bacteria 2400
2105 Ga0496108_0106174 3300048911 Bacteria 2398
2106 Ga0496109_0001151 3300048912 Bacteria 22020
2107 Ga0496109_0004099 3300048912 Bacteria 12178
2108 Ga0496109_0004300 3300048912 Bacteria 11896
2109 Ga0496109_0005509 3300048912 Bacteria 10599
2110 Ga0496109_0025515 3300048912 Bacteria 5267
2111 Ga0496109_0032109 3300048912 Bacteria 4717
2112 Ga0496109_0032518 3300048912 Bacteria 4689
2113 Ga0496109_0337966 3300048912 Bacteria 1422
2114 Ga0496109_0385585 3300048912 Bacteria 1324
2115 Ga0496110_0003529 3300048913 Bacteria 12009
2116 Ga0496110_0004061 3300048913 Bacteria 11295
2117 Ga0496110_0004114 3300048913 Bacteria 11239
2118 Ga0496110_0015658 3300048913 Bacteria 6317
2119 Ga0496110_0024070 3300048913 Bacteria 5188
2120 Ga0496110_0033235 3300048913 Bacteria 4460
2121 Ga0496110_0073883 3300048913 Bacteria 3026
2122 Ga0496110_0103988 3300048913 Bacteria 2548
2123 Ga0496110_0179084 3300048913 Bacteria 1924
2124 Ga0496110_0259005 3300048913 Bacteria 1583
2125 Ga0496110_0276879 3300048913 Bacteria 1528
2126 Ga0496111_0000362 3300048914 Bacteria 22540
2127 Ga0496111_0002041 3300048914 Bacteria 12016
2128 Ga0496111_0003573 3300048914 Bacteria 9635
2129 Ga0496111_0103935 3300048914 Bacteria 2090
2130 Ga0496111_0175879 3300048914 Bacteria 1591
2131 Ga0496111_0177154 3300048914 Bacteria 1585
2132 Ga0496112_0000056 3300048915 Bacteria 77708
2133 Ga0496112_0000755 3300048915 Bacteria 22673
2134 Ga0496112_0001355 3300048915 Bacteria 18635
2135 Ga0496112_0003671 3300048915 Bacteria 12793
2136 Ga0496112_0004153 3300048915 Bacteria 12193
2137 Ga0496112_0020129 3300048915 Bacteria 6317
2138 Ga0496112_0025394 3300048915 Bacteria 5689
2139 Ga0496112_0066539 3300048915 Bacteria 3556
2140 Ga0496112_0153912 3300048915 Bacteria 2267
2141 Ga0496112_0179019 3300048915 Bacteria 2084
2142 Ga0496113_0004878 3300048916 Bacteria 8308
2143 Ga0496113_0007156 3300048916 Bacteria 7147
2144 Ga0496113_0013283 3300048916 Bacteria 5572
2145 Ga0496113_0021063 3300048916 Bacteria 4595
2146 Ga0496113_0068623 3300048916 Bacteria 2691
2147 Ga0496113_0068976 3300048916 Bacteria 2684
2148 Ga0496114_0004949 3300048917 Bacteria 10387
2149 Ga0496114_0007967 3300048917 Bacteria 8385
2150 Ga0496114_0050781 3300048917 Bacteria 3452
2151 Ga0496114_0076831 3300048917 Bacteria 2814
2152 Ga0496114_0100758 3300048917 Bacteria 2465
2153 Ga0496114_0342448 3300048917 Bacteria 1322
2154 Ga0496115_0069540 3300048918 Bacteria 2852
2155 Ga0496115_0097378 3300048918 Bacteria 2409
2156 Ga0496115_0151226 3300048918 Bacteria 1917
2157 Ga0496116_0023537 3300048919 Bacteria 4585
2158 Ga0496116_0120025 3300048919 Bacteria 1524
2159 Ga0496117_0006817 3300048920 Bacteria 11373
2160 Ga0496117_0009447 3300048920 Bacteria 9074
2161 Ga0496117_0082879 3300048920 Bacteria 2099
2162 Ga0496118_0000401 3300048921 Bacteria 73186
2163 Ga0496118_0006350 3300048921 Bacteria 13041
2164 Ga0496121_0001952 3300048924 Bacteria 32880
2165 Ga0496121_0003905 3300048924 Bacteria 20690
2166 Ga0496121_0004910 3300048924 Bacteria 17550
2167 Ga0496121_0016298 3300048924 Bacteria 7683
2168 Ga0496121_0030946 3300048924 Bacteria 4904
2169 Ga0496121_0068518 3300048924 Bacteria 2870
2170 Ga0496122_0003399 3300048925 Bacteria 20950
2171 Ga0496122_0006573 3300048925 Bacteria 13282
2172 Ga0496123_0000136 3300048926 Bacteria 152399
2173 Ga0496124_0000103 3300048927 Bacteria 179162
2174 Ga0496124_0004093 3300048927 Bacteria 17250
2175 Ga0496124_0064437 3300048927 Bacteria 3059
2176 Ga0496124_0186448 3300048927 Bacteria 1592
2177 Ga0496125_0000482 3300048928 Bacteria 70413
2178 Ga0496125_0003169 3300048928 Bacteria 20390
2179 Ga0496125_0009441 3300048928 Bacteria 10017
2180 Ga0496125_0027805 3300048928 Bacteria 5119
2181 Ga0496126_0000389 3300048929 Bacteria 90452
2182 Ga0496126_0004363 3300048929 Bacteria 16963
2183 Ga0496126_0258225 3300048929 Bacteria 1450
2184 Ga0501032_0046476 3300049569 Bacteria 2934
2185 Ga0501033_0021452 3300049570 Bacteria 4873
2186 Ga0501033_0057231 3300049570 Bacteria 2882
2187 Ga0501033_0060320 3300049570 Bacteria 2799
2188 Ga0501034_0001791 3300049571 Bacteria 27438
2189 Ga0501034_0019580 3300049571 Bacteria 6920
2190 Ga0501034_0054616 3300049571 Bacteria 4021
2191 Ga0501034_0059944 3300049571 Bacteria 3822
2192 Ga0501034_0116771 3300049571 Bacteria 2656
2193 Ga0501034_0129683 3300049571 Bacteria 2505
2194 Ga0501036_0005876 3300049572 Bacteria 9940
2195 Ga0501036_0035339 3300049572 Bacteria 4229
2196 Ga0501036_0046105 3300049572 Bacteria 3691
2197 Ga0501037_0116821 3300049573 Bacteria 1920
2198 Ga0501038_0001150 3300049574 Bacteria 23992
2199 Ga0501038_0011563 3300049574 Bacteria 8051
2200 Ga0501038_0026277 3300049574 Bacteria 5186
2201 Ga0501038_0035650 3300049574 Bacteria 4367
2202 Ga0501038_0046808 3300049574 Bacteria 3749
2203 Ga0501038_0073346 3300049574 Bacteria 2899
2204 Ga0501038_0076393 3300049574 Bacteria 2829
2205 Ga0501039_0005097 3300049575 Bacteria 9952
2206 Ga0501039_0018526 3300049575 Bacteria 5345
2207 Ga0501039_0063229 3300049575 Bacteria 2868
2208 Ga0501039_0137830 3300049575 Bacteria 1916
2209 Ga0501039_0149638 3300049575 Bacteria 1834
2210 Ga0501040_0000302 3300049576 Bacteria 28825
2211 Ga0501040_0069994 3300049576 Bacteria 2420
2212 Ga0501041_0000776 3300049577 Bacteria 17119
2213 Ga0501041_0036218 3300049577 Bacteria 2991
2214 Ga0501041_0050856 3300049577 Bacteria 2525
2215 Ga0501042_0032113 3300049578 Bacteria 3716
2216 Ga0501042_0168987 3300049578 Bacteria 1578
2217 Ga0501043_0017849 3300049579 Bacteria 5564
2218 Ga0501043_0133179 3300049579 Bacteria 1948
2219 Ga0501043_0192910 3300049579 Bacteria 1584
2220 Ga0501046_0000992 3300049580 Bacteria 27750
2221 Ga0501046_0012729 3300049580 Bacteria 7155
2222 Ga0501046_0032554 3300049580 Bacteria 4222
2223 Ga0501046_0082316 3300049580 Bacteria 2486
2224 Ga0501046_0090716 3300049580 Bacteria 2351
2225 Ga0501047_0006878 3300049581 Bacteria 10687
2226 Ga0501047_0055369 3300049581 Bacteria 3836
2227 Ga0501047_0066749 3300049581 Bacteria 3468
2228 Ga0501047_0068994 3300049581 Bacteria 3405
2229 Ga0501047_0072955 3300049581 Bacteria 3304
2230 Ga0501047_0074314 3300049581 Bacteria 3272
2231 Ga0501047_0091627 3300049581 Bacteria 2918
2232 Ga0501048_0002096 3300049582 Bacteria 15203
2233 Ga0501048_0025493 3300049582 Bacteria 4309
2234 Ga0501048_0062367 3300049582 Bacteria 2638
2235 Ga0501067_0015302 3300049583 Bacteria 4245
2236 Ga0501067_0049784 3300049583 Bacteria 2322
2237 Ga0501068_0057009 3300049584 Bacteria 2368
2238 Ga0501068_0059842 3300049584 Bacteria 2313
2239 Ga0501068_0063195 3300049584 Bacteria 2252
2240 Ga0501068_0106085 3300049584 Bacteria 1744
2241 Ga0501069_0000753 3300049585 Bacteria 15120
2242 Ga0501069_0002492 3300049585 Bacteria 9395
2243 Ga0501069_0020064 3300049585 Bacteria 3618
2244 Ga0501069_0023857 3300049585 Bacteria 3335
2245 Ga0501069_0087230 3300049585 Bacteria 1763
2246 Ga0501070_0001170 3300049586 Bacteria 23464
2247 Ga0501070_0004788 3300049586 Bacteria 11576
2248 Ga0501070_0007363 3300049586 Bacteria 9344
2249 Ga0501070_0027379 3300049586 Bacteria 4782
2250 Ga0501070_0037102 3300049586 Bacteria 4068
2251 Ga0501070_0063680 3300049586 Bacteria 3054
2252 Ga0501070_0171365 3300049586 Bacteria 1788
2253 Ga0501071_0005763 3300049587 Bacteria 7996
2254 Ga0501072_0002409 3300049588 Bacteria 14027
2255 Ga0501072_0021818 3300049588 Bacteria 4966
2256 Ga0501072_0030616 3300049588 Bacteria 4210
2257 Ga0501072_0213969 3300049588 Bacteria 1536
2258 Ga0501073_0005923 3300049589 Bacteria 9125
2259 Ga0501073_0007998 3300049589 Bacteria 7851
2260 Ga0501073_0009999 3300049589 Bacteria 6976
2261 Ga0501073_0167617 3300049589 Bacteria 1521
2262 Ga0501074_0000574 3300049590 Bacteria 22747
2263 Ga0501074_0005553 3300049590 Bacteria 9069
2264 Ga0501074_0032692 3300049590 Bacteria 3768
2265 Ga0501074_0034148 3300049590 Bacteria 3687
2266 Ga0501074_0088725 3300049590 Bacteria 2215
2267 Ga0501074_0130966 3300049590 Bacteria 1794
2268 Ga0501075_0000045 3300049591 Bacteria 50874
2269 Ga0501075_0006755 3300049591 Bacteria 7918
2270 Ga0501075_0010485 3300049591 Bacteria 6513
2271 Ga0501075_0043416 3300049591 Bacteria 3372
2272 Ga0501075_0067208 3300049591 Bacteria 2706
2273 Ga0501076_0000394 3300049592 Bacteria 27363
2274 Ga0501076_0001383 3300049592 Bacteria 16245
2275 Ga0501076_0003698 3300049592 Bacteria 10760
2276 Ga0501077_0000629 3300049593 Bacteria 21374
2277 Ga0501077_0037063 3300049593 Bacteria 3107
2278 Ga0501217_018736 3300049661 Bacteria 1610
2279 Ga0501079_0000771 3300049741 Bacteria 21925
2280 Ga0501079_0003366 3300049741 Bacteria 11728
2281 Ga0501079_0020434 3300049741 Bacteria 5061
2282 Ga0501079_0023207 3300049741 Bacteria 4763
2283 Ga0501079_0026665 3300049741 Bacteria 4430
2284 Ga0501079_0110325 3300049741 Bacteria 2138
2285 Ga0501080_0009055 3300049742 Bacteria 9060
2286 Ga0501080_0009317 3300049742 Bacteria 8951
2287 Ga0501080_0011191 3300049742 Bacteria 8211
2288 Ga0501080_0021145 3300049742 Bacteria 6022
2289 Ga0501080_0038140 3300049742 Bacteria 4487
2290 Ga0501080_0045623 3300049742 Bacteria 4080
2291 Ga0501080_0059134 3300049742 Bacteria 3567
2292 Ga0501080_0073094 3300049742 Bacteria 3190
2293 Ga0501080_0121069 3300049742 Bacteria 2425
2294 Ga0501080_0129611 3300049742 Bacteria 2335
2295 Ga0501081_0001457 3300049743 Bacteria 14500
2296 Ga0501081_0002316 3300049743 Bacteria 11989
2297 Ga0501081_0002657 3300049743 Bacteria 11303
2298 Ga0501081_0022931 3300049743 Bacteria 4180
2299 Ga0501081_0147533 3300049743 Bacteria 1688
2300 Ga0501083_0005518 3300049744 Bacteria 8962
2301 Ga0501083_0072056 3300049744 Bacteria 2297
2302 Ga0501035_0001502 3300049822 Bacteria 23865
2303 Ga0501035_0003296 3300049822 Bacteria 15478
2304 Ga0501035_0013856 3300049822 Bacteria 7442
2305 Ga0501035_0055851 3300049822 Bacteria 3525
2306 Ga0501035_0103110 3300049822 Bacteria 2502
2307 Ga0501035_0161886 3300049822 Bacteria 1936
2308 Ga0501035_0165034 3300049822 Bacteria 1915
2309 Ga0501044_0005438 3300049823 Bacteria 14152
2310 Ga0501044_0005924 3300049823 Bacteria 13543
2311 Ga0501044_0009435 3300049823 Bacteria 10628
2312 Ga0501044_0032581 3300049823 Bacteria 5477
2313 Ga0501044_0041563 3300049823 Bacteria 4787
2314 Ga0501044_0043991 3300049823 Bacteria 4637
2315 Ga0501044_0044170 3300049823 Bacteria 4627
2316 Ga0501044_0047523 3300049823 Bacteria 4438
2317 Ga0501044_0057579 3300049823 Bacteria 3988
2318 Ga0501044_0063388 3300049823 Bacteria 3776
2319 Ga0501044_0064532 3300049823 Bacteria 3738
2320 Ga0501044_0080009 3300049823 Bacteria 3310
2321 Ga0501044_0101395 3300049823 Bacteria 2896
2322 Ga0501044_0129701 3300049823 Bacteria 2516
2323 Ga0501044_0138081 3300049823 Bacteria 2427
2324 Ga0501044_0170287 3300049823 Bacteria 2150
2325 Ga0501045_0001370 3300049824 Bacteria 16220
2326 Ga0501045_0013789 3300049824 Bacteria 5714
2327 Ga0501045_0040278 3300049824 Bacteria 3400
2328 Ga0501045_0064785 3300049824 Bacteria 2683
2329 Ga0501045_0170995 3300049824 Bacteria 1618
2330 nmdc:mga03683_44495_c1 3300050489 Bacteria 1835
2331 nmdc:mga03n38_41650_c1 3300050490 Bacteria 2003
2332 nmdc:mga00v17_14534_c1 3300050491 Bacteria 4397
2333 nmdc:mga00v17_50376_c1 3300050491 Bacteria 2530
2334 nmdc:mga0yw44_23947_c1 3300050492 Bacteria 3447
2335 nmdc:mga0yw44_98522_c1 3300050492 Bacteria 1859
2336 nmdc:mga0k408_11361_c1 3300050493 Bacteria 4848
2337 nmdc:mga0k408_4350_c1 3300050493 Bacteria 7521
2338 nmdc:mga0k408_47203_c1 3300050493 Bacteria 2489
2339 nmdc:mga0k408_51080_c1 3300050493 Bacteria 2395
2340 nmdc:mga0k408_5246_c1 3300050493 Bacteria 6881
2341 nmdc:mga0k408_55909_c1 3300050493 Bacteria 2289
2342 nmdc:mga06z11_26354_c1 3300050494 Bacteria 2766
2343 nmdc:mga06z11_3297_c1 3300050494 Bacteria 6246
2344 nmdc:mga06z11_7489_c1 3300050494 Bacteria 4495
2345 nmdc:mga04h51_615_c1 3300050495 Bacteria 8450
2346 nmdc:mga07m45_20783_c1 3300050496 Bacteria 3568
2347 nmdc:mga07m45_3394_c1 3300050496 Bacteria 7673
2348 nmdc:mga07m45_66050_c1 3300050496 Bacteria 2055
2349 nmdc:mga07m45_6981_c2 3300050496 Bacteria 5319
2350 nmdc:mga07m45_9756_c1 3300050496 Bacteria 4993
2351 nmdc:mga05p37_11294_c1 3300050507 Bacteria 10623
2352 nmdc:mga05p37_181569_c1 3300050507 Bacteria 2560
2353 nmdc:mga05p37_223699_c1 3300050507 Bacteria 2270
2354 nmdc:mga05p37_228563_c1 3300050507 Bacteria 2242
2355 nmdc:mga05p37_3076_c1 3300050507 Bacteria 19372
2356 nmdc:mga05p37_48136_c2 3300050507 Bacteria 4920
2357 nmdc:mga05p37_5061_c2 3300050507 Bacteria 9847
2358 nmdc:mga05p37_61459_c1 3300050507 Bacteria 4624
2359 nmdc:mga09592_1195_c1 3300050508 Bacteria 20776
2360 nmdc:mga09592_128738_c1 3300050508 Bacteria 2177
2361 nmdc:mga09592_158136_c1 3300050508 Bacteria 1957
2362 nmdc:mga09592_315_c1 3300050508 Bacteria 35276
2363 nmdc:mga0qj67_173074_c1 3300050509 Bacteria 1753
2364 nmdc:mga0qj67_24464_c1 3300050509 Bacteria 4655
2365 nmdc:mga0qj67_29101_c1 3300050509 Bacteria 4290
2366 nmdc:mga0qj67_30531_c1 3300050509 Bacteria 4197
2367 nmdc:mga0qj67_38505_c1 3300050509 Bacteria 3751
2368 nmdc:mga0qj67_47246_c1 3300050509 Bacteria 3400
2369 nmdc:mga0qj67_52587_c1 3300050509 Bacteria 3224
2370 nmdc:mga0qj67_64958_c1 3300050509 Bacteria 2905
2371 nmdc:mga0qj67_8966_c1 3300050509 Bacteria 7420
2372 nmdc:mga06r32_315564_c1 3300050510 Bacteria 1549
2373 nmdc:mga06r32_4869_c1 3300050510 Bacteria 12090
2374 nmdc:mga06r32_74946_c1 3300050510 Bacteria 3282
2375 nmdc:mga06r32_8310_c1 3300050510 Bacteria 9341
2376 nmdc:mga06r32_93662_c1 3300050510 Bacteria 2938
2377 nmdc:mga08y16_147_c1 3300050511 Bacteria 61021
2378 nmdc:mga08y16_148913_c1 3300050511 Bacteria 2433
2379 nmdc:mga08y16_19131_c1 3300050511 Bacteria 7216
2380 nmdc:mga08y16_221015_c1 3300050511 Bacteria 1961
2381 nmdc:mga08y16_23263_c1 3300050511 Bacteria 6543
2382 nmdc:mga08y16_262278_c1 3300050511 Bacteria 1784
2383 nmdc:mga08y16_29925_c1 3300050511 Bacteria 5734
2384 nmdc:mga08y16_303975_c1 3300050511 Bacteria 1644
2385 nmdc:mga08y16_317431_c1 3300050511 Bacteria 1604
2386 nmdc:mga08y16_334982_c1 3300050511 Bacteria 1556
2387 nmdc:mga08y16_59193_c1 3300050511 Bacteria 4002
2388 nmdc:mga0n895_1137_c1 3300050512 Bacteria 19479
2389 nmdc:mga0n895_114457_c1 3300050512 Bacteria 2715
2390 nmdc:mga0n895_1601_c1 3300050512 Bacteria 5085
2391 nmdc:mga0n895_19648_c1 3300050512 Bacteria 6282
2392 nmdc:mga0n895_219621_c1 3300050512 Bacteria 1930
2393 nmdc:mga0n895_281803_c1 3300050512 Bacteria 1685
2394 nmdc:mga0n895_283645_c1 3300050512 Bacteria 1679
2395 nmdc:mga0n895_79545_c1 3300050512 Bacteria 3265
2396 nmdc:mga0rr50_1387_c1 3300050513 Bacteria 13256
2397 nmdc:mga0rr50_15574_c1 3300050513 Bacteria 5022
2398 nmdc:mga0rr50_9578_c1 3300050513 Bacteria 6100
2399 nmdc:mga08x19_101351_c1 3300050514 Bacteria 1911
2400 nmdc:mga08x19_111334_c1 3300050514 Bacteria 1826
2401 nmdc:mga08x19_15247_c1 3300050514 Bacteria 4674
2402 nmdc:mga08x19_20153_c1 3300050514 Bacteria 4104
2403 nmdc:mga08x19_38857_c1 3300050514 Bacteria 3023
2404 nmdc:mga08x19_52035_c1 3300050514 Bacteria 2632
2405 nmdc:mga08x19_60938_c1 3300050514 Bacteria 2445
2406 nmdc:mga08x19_9079_c1 3300050514 Bacteria 5936
2407 nmdc:mga0a205_4178_c1 3300050515 Bacteria 12940
2408 nmdc:mga0a205_44270_c1 3300050515 Bacteria 4290
2409 nmdc:mga0a205_56652_c1 3300050515 Bacteria 3784
2410 nmdc:mga0a205_71885_c1 3300050515 Bacteria 3341
2411 nmdc:mga0a205_91052_c1 3300050515 Bacteria 2947
2412 nmdc:mga0sz30_6728_c1 3300050516 Bacteria 4284
2413 Ga0495601_0000024 3300053077 Bacteria 133160
2414 Ga0495601_0011833 3300053077 Bacteria 5232
2415 Ga0495601_0052433 3300053077 Bacteria 2576
2416 Ga0495601_0103852 3300053077 Bacteria 1837
2417 Ga0495612_0000079 3300053078 Bacteria 44236
2418 Ga0495612_0009187 3300053078 Bacteria 4010
2419 Ga0500610_0000484 3300053079 Bacteria 12265
2420 Ga0500610_0000504 3300053079 Bacteria 12015
2421 Ga0495595_0000036 3300053084 Bacteria 79035
2422 Ga0495595_0004673 3300053084 Bacteria 5510
2423 Ga0495619_0000034 3300053085 Bacteria 129851
2424 Ga0495619_0007830 3300053085 Bacteria 6762
2425 Ga0495619_0091938 3300053085 Bacteria 2055
2426 Ga0495619_0235971 3300053085 Bacteria 1267
2427 Ga0500578_0000085 3300053086 Bacteria 103911
2428 Ga0500644_0000705 3300053088 Bacteria 11835
2429 Ga0500651_0002090 3300053093 Bacteria 10377
2430 Ga0500566_0027781 3300053094 Bacteria 3312
2431 Ga0500641_0015280 3300053096 Bacteria 2846
2432 Ga0500562_010957 3300053108 Bacteria 2301
2433 Ga0500642_0034477 3300053130 Bacteria 2142
2434 Ga0500652_000572 3300053131 Bacteria 12879
2435 Ga0500616_0067300 3300053153 Bacteria 1837
2436 Ga0500616_0109324 3300053153 Bacteria 1338
2437 Ga0500622_0000080 3300053156 Bacteria 102519
2438 Ga0500622_0012388 3300053156 Bacteria 4617
2439 Ga0500627_0001388 3300053158 Bacteria 6734
2440 Ga0500636_0166844 3300053177 Bacteria 1195
2441 Ga0500637_0034605 3300053178 Bacteria 2827
2442 Ga0500637_0047688 3300053178 Bacteria 2434
2443 Ga0501084_0002016 3300054114 Bacteria 16220
2444 Ga0501084_0006846 3300054114 Bacteria 9384
2445 Ga0501084_0053845 3300054114 Bacteria 3366
2446 Ga0501084_0057188 3300054114 Bacteria 3264
2447 Ga0501084_0114557 3300054114 Bacteria 2267
2448 Ga0501084_0118613 3300054114 Bacteria 2224
2449 Ga0501084_0201797 3300054114 Bacteria 1678
2450 Ga0500661_000179 3300055283 Bacteria 11055
2451 Ga0590075_006645 3300059424 Bacteria 2739
2452 Ga0590077_003920 3300059426 Bacteria 3072
2453 Ga0501082_0021180 3300060353 Bacteria 5608
2454 Ga0501082_0040245 3300060353 Bacteria 4032
2455 Ga0501082_0058469 3300060353 Bacteria 3322
2456 Ga0501082_0104768 3300060353 Bacteria 2447
2457 Ga0501082_0116984 3300060353 Bacteria 2309
2458 Ga0501082_0247636 3300060353 Bacteria 1551
2459 Ga0530510_0000797 3300061734 Bacteria 20554
2460 Ga0530510_0004236 3300061734 Bacteria 9915
2461 2511242759 2511231002 Bacteria 5042903
2462 2512345957 2512047030 Bacteria 9031815
2463 2512730932 2512564039 Bacteria 8739048
2464 2513952496 2513237150 Bacteria 6553639
2465 2514041626 2513237165 Bacteria 6771773
2466 2515684053 2515154122 Bacteria 8609520
2467 2515689306 2515154123 Bacteria 6387382
2468 2516018685 2515154189 Bacteria 9629850
2469 2524187173 2524023129 Bacteria 6762600
2470 2558906548 2558860112 Bacteria 9931328
2471 2587726639 2585428057 Bacteria 6737412
2472 2587733302 2585428058 Bacteria 6853932
2473 2587737476 2585428059 Bacteria 8696589
2474 2588290900 2588253510 Bacteria 6901809
2475 2595317840 2593339198 Bacteria 7267884
2476 2599904766 2599185292 Bacteria 6290804
2477 2643861309 2643221569 Bacteria 6064337
2478 2643968574 2643221592 Bacteria 6608788
2479 2643983092 2643221594 Bacteria 5811388
2480 2644120576 2643221621 Bacteria 6212786
2481 2644142897 2643221625 Bacteria 6512927
2482 2644275052 2643221648 Bacteria 6521465
2483 2644301462 2643221654 Bacteria 5273570
2484 2644728641 2643221733 Bacteria 5690728
2485 2644747271 2643221736 Bacteria 6608466
2486 2673821512 2671180694 Bacteria 7506943
2487 2712469910 2711768156 Bacteria 4471618
2488 2723876951 2721755763 Bacteria 4464185
2489 2738745014 2738541281 Bacteria 5112672
2490 2739354244 2738543032 Bacteria 5115625
2491 2746091203 2744054900 Bacteria 8399525
2492 2746097636 2744054901 Bacteria 8397047
2493 2792839419 2791355137 Bacteria 9654227
2494 2809032861 2808606395 Bacteria 6020352
2495 2816507483 2816332139 Bacteria 9138787
2496 2828305918 2828305725 Bacteria 4916900
2497 2828306077 2828305725 Bacteria 4916900
2498 2829749646 2829745981 Bacteria 5406054
2499 2834644249 2834641062 Bacteria 5559922
2500 2836164194 2836160341 Unclassified 5867367
2501 2841761990 2841760612 Bacteria 6454112
2502 2841911893 2841911363 Bacteria 6173697
2503 2841921346 2841917233 Bacteria 6173500
2504 2842332292 2842324504 Bacteria 9364110
2505 2842356537 2842348783 Bacteria 9002918
2506 2842460871 2842454564 Bacteria 8730687
2507 2844105015 2844104063 Bacteria 6440972
2508 2851183500 2851182111 Bacteria 6047226
2509 2851248003 2851246043 Bacteria 6439203
2510 2855736562 2855730933 Bacteria 7047938
2511 2855773499 2855767633 Bacteria 7049357
2512 2857478449 2857472729 Bacteria 6568124
2513 2857540671 2857537821 Bacteria 5248181
2514 2857543454 2857542790 Bacteria 5326616
2515 2858692510 2858688981 Bacteria 8184122
2516 2858956312 2858950400 Bacteria 6783797
2517 2863073249 2863067949 Bacteria 8541735
2518 2881418506 2881412998 Bacteria 6492157
2519 2881930680 2881927736 Bacteria 3993927
2520 2883090215 2883087390 Bacteria 9532701
2521 2883579285 2883577096 Bacteria 4709178
2522 2885198050 2885192300 Bacteria 5882526
2523 2885277959 2885270888 Bacteria 9831543
2524 2888580759 2888578766 Bacteria 6743310
2525 2889050568 2889049205 Bacteria 7524325
2526 2889307427 2889306138 Bacteria 6358934
2527 2889791972 2889790730 Bacteria 5689708
2528 2894776130 2894772417 Bacteria 5305674
2529 2899278936 2899275550 Bacteria 3958688
2530 2899370595 2899370129 Bacteria 6781179
2531 2902688414 2902682994 Bacteria 8951596
2532 2904452146 2904449895 Bacteria 6927402
2533 2904458708 2904456579 Bacteria 6819253
2534 2904621609 2904615490 Bacteria 10047340
2535 2908673454 2908669403 Bacteria 5740494
2536 2919429094 2919425241 Bacteria 8055701
2537 2925331838 2925326138 Bacteria 9652120
2538 2929523317 2929520902 Bacteria 6765052
2539 2945976041 2945972063 Bacteria 6086495
2540 2945987415 2945984333 Bacteria 7358892
2541 2954771231 2954767861 Bacteria 5535784
2542 3001272272 3001272096 Bacteria 4729684
2543 3007808846 3007803356 Bacteria 5931491
2544 643601374 643348564 Bacteria 8839022
2545 644750889 644736347 Bacteria 6476522
2546 8003401958 8003400568 Bacteria 5535898
2547 8045867027 8045864390 Bacteria 5043873
2548 8054804009 8054795415 Bacteria 9785225
2549 8055637477 8055632911 Bacteria 5283357
2550 8057529846 8057529695 Bacteria 6306553
2551 8057733644 8057733483 Bacteria 6578323
2552 JGI25159J45721_1004826
2553 LJNas_1001084
2554 JGI24752J21851_1006045
2555 JGI24743J22301_10002711
2556 JGI24749J21850_1004600
2557 JGI24744J21845_10015542
2558 JGI24751J29686_10023872
2559 JGI25155J39150_1000102
2560 JGI25156J39149_1000010
2561 JGI25156J39149_1003941
2562 JGI25154J39366_1000027
2563 JGI25157J39369_1000146
2564 JGI25152J39213_1001500
2565 JGI25151J46595_10000665
2566 JGI25151J46595_10001147
2567 JGI25151J46595_10001988
2568 JGI25151J46595_10006454
2569 JGI25151J46595_10037386
2570 JGI25406J46586_10000085
2571 JGI25406J46586_10000963
2572 JGI25153J46596_10001926
2573 JGI25153J46596_10003713
2574 JGI25160J50197_1000129
2575 JGI25161J50226_1000080
2576 JGI25404J52841_10010033
2577 Ga0055529_1000955
2578 Ga0055526_1000392
2579 Ga0055526_1010926
2580 Ga0055524_1000120
2581 Ga0055524_1000220
2582 Ga0055524_1014910
2583 Ga0055534_1004574
2584 Ga0055528_1005152
2585 Ga0055530_10001496
2586 Ga0055540_1000067
2587 Ga0055540_1000742
2588 Ga0055531_10001465
2589 Ga0055543_1000782
2590 Ga0065165_1000089
2591 Ga0065165_1003799
2592 Ga0065165_1010089
2593 Ga0065714_10096614
2594 Ga0065715_10109379
2595 Ga0065715_10109792
2596 Ga0065715_10111824
2597 Ga0065707_10005979
2598 Ga0070658_10004615
2599 Ga0070658_10031847
2600 Ga0070658_10033925
2601 Ga0070658_10131546
2602 Ga0070658_10139561
2603 Ga0070676_10030944
2604 Ga0070676_10032265
2605 Ga0070676_10035163
2606 Ga0070676_10053655
2607 Ga0070676_10063347
2608 Ga0070676_10091806
2609 Ga0070683_100003861
2610 Ga0070683_100004329
2611 Ga0070683_100024665
2612 Ga0070683_100193150
2613 Ga0070690_100000791
2614 Ga0070690_100002610
2615 Ga0070690_100038731
2616 Ga0070690_100132853
2617 Ga0070670_100003026
2618 Ga0070670_100003111
2619 Ga0070670_100003829
2620 Ga0070670_100008102
2621 Ga0070670_100012137
2622 Ga0070670_100097346
2623 Ga0070670_100108692
2624 Ga0070670_100154343
2625 Ga0070670_100166482
2626 Ga0070670_100235863
2627 Ga0070677_10007914
2628 Ga0070677_10023224
2629 Ga0070677_10096775
2630 Ga0068869_100000765
2631 Ga0068869_100001018
2632 Ga0068869_100042720
2633 Ga0068869_100055614
2634 Ga0068869_100077594
2635 Ga0068869_100345413
2636 Ga0070666_10001146
2637 Ga0070666_10002429
2638 Ga0070666_10028081
2639 Ga0070666_10036356
2640 Ga0070666_10122534
2641 Ga0070666_10152790
2642 Ga0070680_100009247
2643 Ga0070680_100009721
2644 Ga0070680_100018087
2645 Ga0070680_100047040
2646 Ga0070680_100053041
2647 Ga0070680_100061472
2648 Ga0070680_100067178
2649 Ga0070680_100081819
2650 Ga0070680_100144337
2651 Ga0070680_100213452
2652 Ga0070680_100232628
2653 Ga0070682_100013046
2654 Ga0070682_100018870
2655 Ga0068868_100001147
2656 Ga0068868_100002556
2657 Ga0068868_100021273
2658 Ga0068868_100021806
2659 Ga0068868_100022425
2660 Ga0068868_100023378
2661 Ga0068868_100059175
2662 Ga0068868_100099979
2663 Ga0068868_100130729
2664 Ga0070660_100000414
2665 Ga0070660_100007676
2666 Ga0070660_100011856
2667 Ga0070660_100281948
2668 Ga0070689_100015635
2669 Ga0070689_100028507
2670 Ga0070689_100036959
2671 Ga0070689_100055599
2672 Ga0070691_10008601
2673 Ga0070691_10011393
2674 Ga0070691_10022802
2675 Ga0070691_10068626
2676 Ga0070687_100000304
2677 Ga0070687_100056866
2678 Ga0070661_100001393
2679 Ga0070661_100002474
2680 Ga0070661_100013149
2681 Ga0070661_100013622
2682 Ga0070661_100027259
2683 Ga0070661_100208388
2684 Ga0070692_10003468
2685 Ga0070692_10003506
2686 Ga0070668_100001125
2687 Ga0070668_100002102
2688 Ga0070668_100002366
2689 Ga0070668_100004406
2690 Ga0070668_100011384
2691 Ga0070668_100016884
2692 Ga0070668_100025270
2693 Ga0070668_100026967
2694 Ga0070668_100074994
2695 Ga0070669_100047634
2696 Ga0070669_100053873
2697 Ga0070669_100111016
2698 Ga0070675_100003449
2699 Ga0070675_100005167
2700 Ga0070675_100012529
2701 Ga0070675_100022937
2702 Ga0070675_100029663
2703 Ga0070675_100042024
2704 Ga0070675_100054875
2705 Ga0070675_100058740
2706 Ga0070675_100082426
2707 Ga0070675_100197462
2708 Ga0070671_100000338
2709 Ga0070671_100006434
2710 Ga0070671_100009895
2711 Ga0070671_100025730
2712 Ga0070671_100029700
2713 Ga0070671_100043354
2714 Ga0070671_100045096
2715 Ga0070671_100071227
2716 Ga0070674_100001258
2717 Ga0070674_100001631
2718 Ga0070674_100010861
2719 Ga0070674_100012431
2720 Ga0070674_100017576
2721 Ga0070674_100022508
2722 Ga0070674_100045874
2723 Ga0070674_100049172
2724 Ga0070674_100083748
2725 Ga0070674_100096938
2726 Ga0070674_100229580
2727 Ga0070673_100000088
2728 Ga0070673_100009518
2729 Ga0070673_100038782
2730 Ga0070673_100042543
2731 Ga0070673_100055219
2732 Ga0070673_100097997
2733 Ga0070673_100123447
2734 Ga0070673_100158345
2735 Ga0070673_100194102
2736 Ga0070688_100001429
2737 Ga0070688_100002890
2738 Ga0070659_100000526
2739 Ga0070659_100018703
2740 Ga0070659_100026219
2741 Ga0070659_100095232
2742 Ga0070659_100240271
2743 Ga0070659_100284167
2744 Ga0070667_100002119
2745 Ga0070667_100004866
2746 Ga0070667_100007593
2747 Ga0070667_100010142
2748 Ga0070667_100013844
2749 Ga0070667_100013983
2750 Ga0070667_100019067
2751 Ga0070667_100024190
2752 Ga0070667_100031393
2753 Ga0070667_100037267
2754 Ga0070667_100052433
2755 Ga0070667_100077023
2756 Ga0070667_100079962
2757 Ga0070667_100097524
2758 Ga0070667_100166561
2759 Ga0070667_100185192
2760 Ga0070709_10000166
2761 Ga0070709_10017608
2762 Ga0070709_10060445
2763 Ga0070714_100000688
2764 Ga0070714_100002535
2765 Ga0070714_100005454
2766 Ga0070714_100006050
2767 Ga0070714_100007950
2768 Ga0070714_100015514
2769 Ga0070714_100030334
2770 Ga0070714_100056448
2771 Ga0070714_100066445
2772 Ga0070714_100154862
2773 Ga0070714_100308075
2774 Ga0070713_100000050
2775 Ga0070713_100000296
2776 Ga0070713_100001145
2777 Ga0070713_100003263
2778 Ga0070713_100006994
2779 Ga0070713_100041234
2780 Ga0070713_100181970
2781 Ga0070710_10000177
2782 Ga0070710_10070659
2783 Ga0070710_10088176
2784 Ga0070701_10000171
2785 Ga0070711_100003077
2786 Ga0070711_100018275
2787 Ga0070705_100000234
2788 Ga0070705_100030916
2789 Ga0070705_100179028
2790 Ga0070700_100000396
2791 Ga0070700_100003757
2792 Ga0070700_100009762
2793 Ga0070694_100000367
2794 Ga0070694_100048846
2795 Ga0070694_100141761
2796 Ga0070708_100000482
2797 Ga0070708_100005262
2798 Ga0070708_100018279
2799 Ga0070708_100028996
2800 Ga0070708_100194359
2801 Ga0070663_100003639
2802 Ga0070663_100008039
2803 Ga0070663_100014515
2804 Ga0070663_100022478
2805 Ga0070663_100023734
2806 Ga0070663_100089090
2807 Ga0070678_100000181
2808 Ga0070678_100003020
2809 Ga0070678_100003364
2810 Ga0070678_100003576
2811 Ga0070678_100004173
2812 Ga0070678_100005633
2813 Ga0070678_100019293
2814 Ga0070678_100020420
2815 Ga0070678_100073367
2816 Ga0070662_100000260
2817 Ga0070662_100014312
2818 Ga0070662_100015884
2819 Ga0070662_100018876
2820 Ga0070662_100021232
2821 Ga0070662_100033017
2822 Ga0070662_100140000
2823 Ga0070662_100151198
2824 Ga0070681_10000270
2825 Ga0070681_10004175
2826 Ga0070681_10008106
2827 Ga0070681_10015325
2828 Ga0070681_10018680
2829 Ga0070681_10084807
2830 Ga0070681_10117545
2831 Ga0068867_100001228
2832 Ga0068867_100002868
2833 Ga0068867_100006609
2834 Ga0068867_100008399
2835 Ga0068867_100014239
2836 Ga0068867_100120473
2837 Ga0068867_100218880
2838 Ga0068867_100257386
2839 Ga0070685_10001545
2840 Ga0070706_100000916
2841 Ga0070706_100010400
2842 Ga0070706_100023387
2843 Ga0070706_100041792
2844 Ga0070706_100074346
2845 Ga0070707_100006418
2846 Ga0070707_100054091
2847 Ga0070707_100088252
2848 Ga0070707_100256846
2849 Ga0070698_100020280
2850 Ga0070698_100085575
2851 Ga0070698_100356594
2852 Ga0070699_100001364
2853 Ga0070699_100007905
2854 Ga0070699_100018493
2855 Ga0070699_100027305
2856 Ga0070699_100039229
2857 Ga0070699_100040940
2858 Ga0070699_100062738
2859 Ga0070699_100154268
2860 Ga0070699_100267397
2861 Ga0070679_100003292
2862 Ga0070679_100009100
2863 Ga0070679_100009718
2864 Ga0070679_100011541
2865 Ga0070679_100015757
2866 Ga0070679_100016703
2867 Ga0070679_100019099
2868 Ga0070679_100026131
2869 Ga0070679_100029306
2870 Ga0070679_100059424
2871 Ga0070679_100073882
2872 Ga0070679_100088141
2873 Ga0070679_100169850
2874 Ga0070679_100170041
2875 Ga0070684_100000545
2876 Ga0070684_100020182
2877 Ga0070684_100061046
2878 Ga0070684_100081786
2879 Ga0070684_100102937
2880 Ga0070684_100137869
2881 Ga0070697_100010429
2882 Ga0070697_100012160
2883 Ga0070697_100074049
2884 Ga0070697_100144999
2885 Ga0070697_100341772
2886 Ga0068853_100001405
2887 Ga0068853_100001673
2888 Ga0068853_100030506
2889 Ga0068853_100111784
2890 Ga0068853_100136664
2891 Ga0068853_100174994
2892 Ga0070672_100000162
2893 Ga0070672_100002172
2894 Ga0070672_100005135
2895 Ga0070672_100010390
2896 Ga0070672_100028301
2897 Ga0070672_100033301
2898 Ga0070672_100091418
2899 Ga0070672_100111685
2900 Ga0070672_100160907
2901 Ga0070672_100194532
2902 Ga0070672_100241519
2903 Ga0070686_100000664
2904 Ga0070686_100039547
2905 Ga0070686_100096357
2906 Ga0070686_100106129
2907 Ga0070695_100000111
2908 Ga0070695_100001361
2909 Ga0070695_100011788
2910 Ga0070695_100047364
2911 Ga0070695_100065579
2912 Ga0070695_100079680
2913 Ga0070696_100000082
2914 Ga0070696_100003444
2915 Ga0070696_100021368
2916 Ga0070696_100032551
2917 Ga0070696_100045224
2918 Ga0070693_100000114
2919 Ga0070693_100000865
2920 Ga0070693_100001728
2921 Ga0070693_100005035
2922 Ga0070693_100062816
2923 Ga0070665_100002442
2924 Ga0070665_100016639
2925 Ga0070665_100029771
2926 Ga0070665_100053727
2927 Ga0070665_100099737
2928 Ga0070665_100115672
2929 Ga0070665_100128633
2930 Ga0070665_100131950
2931 Ga0070704_100000018
2932 Ga0070704_100001228
2933 Ga0070704_100033699
2934 Ga0070704_100045554
2935 Ga0070704_100047528
2936 Ga0070704_100280801
2937 Ga0068855_100000110
2938 Ga0068855_100003278
2939 Ga0068855_100005802
2940 Ga0068855_100008462
2941 Ga0068855_100012806
2942 Ga0068855_100015031
2943 Ga0068855_100026128
2944 Ga0068855_100026300
2945 Ga0068855_100055276
2946 Ga0068855_100061401
2947 Ga0068855_100071639
2948 Ga0068855_100078243
2949 Ga0068855_100102704
2950 Ga0068855_100109076
2951 Ga0068855_100213025
2952 Ga0068855_100250382
2953 Ga0068855_100257576
2954 Ga0068855_100304165
2955 Ga0068855_100313391
2956 Ga0068855_100318261
2957 Ga0070664_100000378
2958 Ga0070664_100008665
2959 Ga0070664_100025255
2960 Ga0070664_100031992
2961 Ga0070664_100131581
2962 Ga0070664_100213331
2963 Ga0070664_100229970
2964 Ga0068857_100001558
2965 Ga0068857_100023087
2966 Ga0068857_100193717
2967 Ga0068857_100204717
2968 Ga0068854_100001530
2969 Ga0068854_100006640
2970 Ga0068854_100017510
2971 Ga0068854_100024990
2972 Ga0068854_100031933
2973 Ga0068854_100113346
2974 Ga0068854_100117862
2975 Ga0068854_100173130
2976 Ga0068854_100197974
2977 Ga0068856_100000111
2978 Ga0068856_100005394
2979 Ga0068856_100007590
2980 Ga0068856_100014426
2981 Ga0068856_100028421
2982 Ga0068856_100048125
2983 Ga0068856_100174136
2984 Ga0068856_100417654
2985 Ga0070702_100000345
2986 Ga0068852_100003212
2987 Ga0068852_100004140
2988 Ga0068852_100017789
2989 Ga0068852_100019144
2990 Ga0068852_100020157
2991 Ga0068852_100025599
2992 Ga0068852_100027955
2993 Ga0068852_100031859
2994 Ga0068852_100048828
2995 Ga0068852_100101955
2996 Ga0068852_100179663
2997 Ga0068852_100282870
2998 Ga0068859_100000050
2999 Ga0068859_100001228
3000 Ga0068859_100001261
3001 Ga0068859_100005369
3002 Ga0068859_100020233
3003 Ga0068859_100039506
3004 Ga0068859_100071664
3005 Ga0068859_100122048
3006 Ga0068859_100137103
3007 Ga0068859_100137529
3008 Ga0068859_100166988
3009 Ga0068859_100242045
3010 Ga0068864_100000460
3011 Ga0068864_100002785
3012 Ga0068864_100016703
3013 Ga0068864_100027165
3014 Ga0068864_100094192
3015 Ga0068864_100102538
3016 Ga0068864_100123793
3017 Ga0068864_100140665
3018 Ga0068864_100141225
3019 Ga0068866_10000156
3020 Ga0068866_10003100
3021 Ga0068866_10006388
3022 Ga0068861_100001057
3023 Ga0068861_100009536
3024 Ga0068861_100023788
3025 Ga0068861_100057676
3026 Ga0068861_100078478
3027 Ga0068861_100160238
3028 Ga0068861_100211799
3029 Ga0068851_10000414
3030 Ga0068851_10001349
3031 Ga0068851_10087221
3032 Ga0068870_10008908
3033 Ga0068870_10016826
3034 Ga0068870_10106359
3035 Ga0068870_10117541
3036 Ga0068863_100001068
3037 Ga0068863_100025983
3038 Ga0068863_100040897
3039 Ga0068863_100051003
3040 Ga0068863_100051490
3041 Ga0068863_100057234
3042 Ga0068863_100090628
3043 Ga0068863_100096663
3044 Ga0068863_100096791
3045 Ga0068863_100143699
3046 Ga0068858_100000509
3047 Ga0068858_100000908
3048 Ga0068858_100000936
3049 Ga0068858_100001799
3050 Ga0068858_100003300
3051 Ga0068858_100004438
3052 Ga0068858_100015891
3053 Ga0068858_100073047
3054 Ga0068858_100160385
3055 Ga0068858_100202702
3056 Ga0068860_100000654
3057 Ga0068860_100002554
3058 Ga0068860_100005079
3059 Ga0068860_100013086
3060 Ga0068860_100029150
3061 Ga0068860_100055316
3062 Ga0068860_100132929
3063 Ga0068860_100253711
3064 Ga0068860_100319516
3065 Ga0068862_100002561
3066 Ga0068862_100005682
3067 Ga0068862_100013649
3068 Ga0068862_100048752
3069 Ga0068862_100090908
3070 Ga0081538_10002434
3071 Ga0081538_10038698
3072 Ga0081540_1000034
3073 Ga0081540_1000233
3074 Ga0081540_1014864
3075 Ga0081540_1044763
3076 Ga0081539_10000003
3077 Ga0081539_10000226
3078 Ga0081539_10000350
3079 Ga0081539_10002808
3080 Ga0081539_10011647
3081 Ga0081539_10046218
3082 Ga0070717_10004190
3083 Ga0070717_10005576
3084 Ga0075365_10006017
3085 Ga0075365_10021391
3086 Ga0075365_10021774
3087 Ga0075363_100003654
3088 Ga0075363_100014909
3089 Ga0075363_100047677
3090 Ga0075364_10011203
3091 Ga0075364_10073250
3092 Ga0070715_10007390
3093 Ga0070716_100024556
3094 Ga0070712_100001526
3095 Ga0070712_100068090
3096 Ga0075362_10004553
3097 Ga0075362_10006498
3098 Ga0075362_10013784
3099 Ga0075367_10002211
3100 Ga0075367_10010754
3101 Ga0075367_10020194
3102 Ga0075367_10046150
3103 Ga0075367_10155512
3104 Ga0075369_10003214
3105 Ga0075369_10005977
3106 Ga0075369_10021320
3107 Ga0075366_10000889
3108 Ga0075366_10004299
3109 Ga0075366_10005946
3110 Ga0075366_10010089
3111 Ga0075366_10017173
3112 Ga0075366_10034969
3113 Ga0075366_10067248
3114 Ga0075366_10123704
3115 Ga0097621_100005385
3116 Ga0097621_100016314
3117 Ga0097621_100021031
3118 Ga0097621_100045565
3119 Ga0097621_100105628
3120 Ga0097621_100160476
3121 Ga0097621_100165215
3122 Ga0097621_100205692
3123 Ga0075370_10000260
3124 Ga0075370_10003339
3125 Ga0075370_10004894
3126 Ga0075370_10020321
3127 Ga0075370_10043805
3128 Ga0068871_100002592
3129 Ga0068871_100003991
3130 Ga0068871_100005158
3131 Ga0068871_100014718
3132 Ga0068871_100020821
3133 Ga0068871_100044435
3134 Ga0068871_100044872
3135 Ga0068871_100121511
3136 Ga0068871_100165706
3137 Ga0068871_100203430
3138 Ga0068871_100219035
3139 Ga0068871_100254005
3140 Ga0075428_100001234
3141 Ga0075428_100004047
3142 Ga0075428_100007549
3143 Ga0075428_100022830
3144 Ga0075428_100025082
3145 Ga0075428_100036509
3146 Ga0075428_100044680
3147 Ga0075428_100073981
3148 Ga0075428_100178975
3149 Ga0075428_100208739
3150 Ga0075430_100019910
3151 Ga0075430_100103452
3152 Ga0075430_100134215
3153 Ga0075431_100004172
3154 Ga0075431_100005968
3155 Ga0075431_100028493
3156 Ga0075431_100061865
3157 Ga0075431_100083839
3158 Ga0075431_100097021
3159 Ga0075431_100115980
3160 Ga0075433_10005257
3161 Ga0075433_10010717
3162 Ga0075433_10015526
3163 Ga0075433_10053925
3164 Ga0075433_10089679
3165 Ga0075433_10302772
3166 Ga0075434_100000358
3167 Ga0075434_100001872
3168 Ga0075434_100007534
3169 Ga0075434_100008875
3170 Ga0075434_100038634
3171 Ga0075434_100107526
3172 Ga0075434_100199420
3173 Ga0075429_100004465
3174 Ga0075429_100004891
3175 Ga0075429_100005055
3176 Ga0075429_100020573
3177 Ga0075429_100071233
3178 Ga0075429_100249503
3179 Ga0068865_100000555
3180 Ga0068865_100029629
3181 Ga0075436_100000499
3182 Ga0075436_100001270
3183 Ga0075436_100001595
3184 Ga0075436_100007515
3185 Ga0075436_100012218
3186 Ga0075436_100033467
3187 Ga0075436_100040430
3188 Ga0075436_100061715
3189 Ga0075436_100067051
3190 Ga0075436_100083387
3191 Ga0097620_100000050
3192 Ga0097620_100001228
3193 Ga0097620_100001261
3194 Ga0097620_100005369
3195 Ga0097620_100020233
3196 Ga0097620_100039503
3197 Ga0097620_100071665
3198 Ga0097620_100122046
3199 Ga0097620_100137100
3200 Ga0097620_100137522
3201 Ga0097620_100166992
3202 Ga0097620_100242050
3203 Ga0099826_10101113
3204 Ga0075435_100000518
3205 Ga0075435_100000614
3206 Ga0075435_100005567
3207 Ga0075435_100005891
3208 Ga0075435_100020348
3209 Ga0075435_100116089
3210 Ga0075435_100124014
3211 Ga0099794_10045989
3212 Ga0099794_10093076
3213 Ga0099795_10011102
3214 Ga0105251_10008986
3215 Ga0105244_10002330
3216 Ga0105250_10013698
3217 Ga0105250_10033246
3218 Ga0105240_10002253
3219 Ga0105240_10002277
3220 Ga0105240_10002317
3221 Ga0105240_10004031
3222 Ga0105240_10008860
3223 Ga0105240_10014573
3224 Ga0105240_10020031
3225 Ga0105240_10056095
3226 Ga0105240_10057621
3227 Ga0105240_10108454
3228 Ga0105240_10146957
3229 Ga0105240_10173518
3230 Ga0105240_10224480
3231 Ga0111539_10000774
3232 Ga0111539_10004948
3233 Ga0111539_10009844
3234 Ga0111539_10012218
3235 Ga0111539_10019536
3236 Ga0111539_10025598
3237 Ga0111539_10027603
3238 Ga0111539_10029884
3239 Ga0111539_10035170
3240 Ga0111539_10048101
3241 Ga0111539_10077382
3242 Ga0111539_10094104
3243 Ga0111539_10276914
3244 Ga0111539_10283886
3245 Ga0105245_10006058
3246 Ga0105245_10006192
3247 Ga0105245_10012365
3248 Ga0105245_10018143
3249 Ga0105245_10018998
3250 Ga0105245_10047958
3251 Ga0105245_10078074
3252 Ga0105245_10105489
3253 Ga0105247_10000096
3254 Ga0105247_10007792
3255 Ga0105247_10026353
3256 Ga0114129_10012508
3257 Ga0114129_10057622
3258 Ga0114129_10076783
3259 Ga0114129_10244767
3260 Ga0114129_10400193
3261 Ga0114129_10631570
3262 Ga0114129_10643173
3263 Ga0105243_10002682
3264 Ga0105243_10092325
3265 Ga0105243_10150520
3266 Ga0105241_10009644
3267 Ga0105241_10009841
3268 Ga0105241_10014428
3269 Ga0105241_10046734
3270 Ga0105241_10213921
3271 Ga0105242_10000987
3272 Ga0105242_10004690
3273 Ga0105242_10005171
3274 Ga0105242_10155246
3275 Ga0105248_10005713
3276 Ga0105248_10018063
3277 Ga0105248_10019213
3278 Ga0105248_10029722
3279 Ga0105248_10046801
3280 Ga0105248_10115806
3281 Ga0105248_10280886
3282 Ga0105248_10444987
3283 Ga0105237_10013426
3284 Ga0105237_10057451
3285 Ga0105237_10078653
3286 Ga0105237_10148920
3287 Ga0105238_10035651
3288 Ga0105238_10070957
3289 Ga0105238_10101306
3290 Ga0105238_10109205
3291 Ga0105238_10137593
3292 Ga0105249_10008399
3293 Ga0105249_10031945
3294 Ga0105249_10043097
3295 Ga0105033_102584
3296 Ga0105239_10037192
3297 Ga0105239_10072852
3298 Ga0105239_10106209
3299 Ga0105239_10392130
3300 Ga0105246_10021584
3301 Ga0157373_10001619
3302 Ga0157373_10002312
3303 Ga0157373_10013368
3304 Ga0157373_10027369
3305 Ga0157373_10036627
3306 Ga0157373_10057905
3307 Ga0157371_10000248
3308 Ga0157371_10059206
3309 Ga0157371_10072086
3310 Ga0157371_10113325
3311 Ga0157370_10001476
3312 Ga0157370_10002434
3313 Ga0157370_10002793
3314 Ga0157370_10017634
3315 Ga0157370_10028618
3316 Ga0157370_10046551
3317 Ga0157370_10058497
3318 Ga0157370_10090644
3319 Ga0157370_10113977
3320 Ga0157370_10251043
3321 Ga0157370_10279892
3322 Ga0157369_10002433
3323 Ga0157369_10005169
3324 Ga0157369_10009381
3325 Ga0157369_10017645
3326 Ga0157369_10028282
3327 Ga0157369_10044702
3328 Ga0157369_10068958
3329 Ga0157369_10442469
3330 Ga0157369_10475029
3331 Ga0157374_10000383
3332 Ga0157374_10140746
3333 Ga0157374_10151670
3334 Ga0157374_10197504
3335 Ga0157374_10223434
3336 Ga0157378_10001843
3337 Ga0157378_10006389
3338 Ga0157378_10013081
3339 Ga0157378_10164146
3340 Ga0163162_10009180
3341 Ga0163162_10014658
3342 Ga0163162_10022421
3343 Ga0163162_10028063
3344 Ga0163162_10066313
3345 Ga0163162_10073237
3346 Ga0163162_10092342
3347 Ga0163162_10099059
3348 Ga0163162_10286032
3349 Ga0157372_10000853
3350 Ga0157372_10002272
3351 Ga0157372_10007773
3352 Ga0157372_10010528
3353 Ga0157372_10021026
3354 Ga0157372_10025906
3355 Ga0157372_10076391
3356 Ga0157372_10077546
3357 Ga0157372_10103094
3358 Ga0157375_10002420
3359 Ga0157375_10010965
3360 Ga0157375_10015344
3361 Ga0157375_10017406
3362 Ga0157375_10061562
3363 Ga0157375_10070871
3364 Ga0157375_10082273
3365 Ga0157375_10124072
3366 Ga0157375_10250122
3367 Ga0157375_10270500
3368 Ga0157375_10352751
3369 Ga0157375_10425083
3370 Ga0163163_10002007
3371 Ga0163163_10018281
3372 Ga0163163_10018338
3373 Ga0163163_10054333
3374 Ga0163163_10054599
3375 Ga0163163_10086471
3376 Ga0163163_10146952
3377 Ga0157380_10095999
3378 Ga0157377_10007961
3379 Ga0157377_10147190
3380 Ga0157379_10000112
3381 Ga0157379_10002542
3382 Ga0157379_10003708
3383 Ga0157379_10017141
3384 Ga0157379_10064873
3385 Ga0157379_10098574
3386 Ga0157376_10002564
3387 Ga0157376_10003872
3388 Ga0157376_10006926
3389 Ga0157376_10009458
3390 Ga0157376_10018283
3391 Ga0157376_10048694
3392 Ga0157376_10058385
3393 Ga0157376_10091163
3394 Ga0157376_10168401
3395 Ga0157376_10374289
3396 Ga0183361_10020
3397 Ga0163161_10039411
3398 Ga0163161_10117754
3399 Ga0163161_10231188
3400 Ga0163161_10253178
3401 Ga0163161_10276995
3402 Ga0206356_10748952
3403 Ga0206353_10626947
3404 Ga0213873_10000922
3405 Ga0213872_10021887
3406 Ga0213874_10012479
3407 Ga0213874_10032583
3408 Ga0213876_10001148
3409 Ga0213876_10001201
3410 Ga0213875_10001830
3411 Ga0213875_10007325
3412 Ga0209435_100003
3413 Ga0209436_103757
3414 Ga0207425_1001795
3415 Ga0209646_1000008
3416 Ga0209026_1000007
3417 Ga0209759_1000019
3418 Ga0209759_1000150
3419 Ga0209129_1000095
3420 Ga0209129_1002122
3421 Ga0209129_1002488
3422 Ga0209565_1000077
3423 Ga0209565_1000116
3424 Ga0209565_1004239
3425 Ga0209565_1005400
3426 Ga0209455_1001612
3427 Ga0209673_1001210
3428 Ga0209673_1009392
3429 Ga0209130_1000087
3430 Ga0209130_1000095
3431 Ga0209130_1000134
3432 Ga0209675_1003004
3433 Ga0209675_1007519
3434 Ga0209675_1007884
3435 Ga0209676_1000019
3436 Ga0209676_1000145
3437 Ga0209025_1000040
3438 Ga0209025_1000231
3439 Ga0209025_1000406
3440 Ga0209025_1000762
3441 Ga0209025_1001626
3442 Ga0209025_1003068
3443 Ga0209025_1005144
3444 Ga0209025_1005742
3445 Ga0209025_1011730
3446 Ga0209025_1013094
3447 Ga0209025_1039569
3448 Ga0209564_1000062
3449 Ga0209564_1000274
3450 Ga0209564_1000728
3451 Ga0209564_1007827
3452 Ga0209564_1012801
3453 Ga0209758_1000072
3454 Ga0209758_1000122
3455 Ga0209758_1000302
3456 Ga0209758_1007283
3457 Ga0209758_1008050
3458 Ga0209050_1000023
3459 Ga0209050_1000143
3460 Ga0209050_1019316
3461 Ga0209256_1000003
3462 Ga0209256_1000119
3463 Ga0209256_1001038
3464 Ga0209256_1028690
3465 Ga0207426_1000397
3466 Ga0207426_1013333
3467 Ga0209051_1000017
3468 Ga0209051_1000350
3469 Ga0209051_1005009
3470 Ga0209051_1013687
3471 Ga0209051_1014556
3472 Ga0209257_1000041
3473 Ga0207697_10000878
3474 Ga0207697_10020857
3475 Ga0207697_10024842
3476 Ga0207697_10077986
3477 Ga0207656_10002354
3478 Ga0207656_10005152
3479 Ga0207656_10025355
3480 Ga0207656_10043842
3481 Ga0207655_1000081
3482 Ga0207713_1005290
3483 Ga0207682_10000322
3484 Ga0207682_10000734
3485 Ga0207682_10004201
3486 Ga0207682_10027596
3487 Ga0207682_10035024
3488 Ga0207692_10042245
3489 Ga0207642_10002655
3490 Ga0207642_10002928
3491 Ga0207710_10001100
3492 Ga0207710_10031418
3493 Ga0207688_10064844
3494 Ga0207688_10129224
3495 Ga0207680_10009052
3496 Ga0207680_10014314
3497 Ga0207680_10023983
3498 Ga0207685_10015914
3499 Ga0207699_10009538
3500 Ga0207699_10039273
3501 Ga0207699_10052903
3502 Ga0207699_10130385
3503 Ga0207645_10000566
3504 Ga0207645_10001846
3505 Ga0207645_10003269
3506 Ga0207645_10005615
3507 Ga0207645_10012049
3508 Ga0207645_10039297
3509 Ga0207645_10051024
3510 Ga0207645_10117450
3511 Ga0207645_10144351
3512 Ga0207643_10000359
3513 Ga0207643_10005706
3514 Ga0207643_10025037
3515 Ga0207643_10025602
3516 Ga0207643_10100650
3517 Ga0207705_10040333
3518 Ga0207705_10088206
3519 Ga0207684_10001435
3520 Ga0207684_10015827
3521 Ga0207684_10064256
3522 Ga0207684_10096107
3523 Ga0207654_10007099
3524 Ga0207654_10013783
3525 Ga0207654_10024105
3526 Ga0207654_10032026
3527 Ga0207654_10060487
3528 Ga0207707_10004047
3529 Ga0207707_10004182
3530 Ga0207707_10014718
3531 Ga0207707_10037315
3532 Ga0207707_10102264
3533 Ga0207707_10104201
3534 Ga0207707_10267505
3535 Ga0207707_10282263
3536 Ga0207695_10010633
3537 Ga0207695_10015435
3538 Ga0207695_10018070
3539 Ga0207695_10026095
3540 Ga0207695_10029551
3541 Ga0207695_10030199
3542 Ga0207695_10033181
3543 Ga0207695_10067247
3544 Ga0207695_10068579
3545 Ga0207695_10180178
3546 Ga0207671_10042375
3547 Ga0207671_10056265
3548 Ga0207671_10195766
3549 Ga0207693_10000254
3550 Ga0207693_10005030
3551 Ga0207693_10045324
3552 Ga0207663_10000170
3553 Ga0207663_10009347
3554 Ga0207660_10004490
3555 Ga0207660_10013388
3556 Ga0207660_10060572
3557 Ga0207660_10087926
3558 Ga0207660_10145920
3559 Ga0207660_10186308
3560 Ga0207660_10197139
3561 Ga0207660_10216583
3562 Ga0207662_10000269
3563 Ga0207662_10005657
3564 Ga0207662_10010985
3565 Ga0207662_10040377
3566 Ga0207662_10077594
3567 Ga0207657_10000894
3568 Ga0207657_10000910
3569 Ga0207657_10002586
3570 Ga0207657_10009641
3571 Ga0207657_10010420
3572 Ga0207657_10011936
3573 Ga0207657_10054102
3574 Ga0207657_10100815
3575 Ga0207649_10007671
3576 Ga0207649_10008175
3577 Ga0207649_10009735
3578 Ga0207649_10240052
3579 Ga0207652_10002789
3580 Ga0207652_10014053
3581 Ga0207652_10020495
3582 Ga0207652_10032606
3583 Ga0207652_10038737
3584 Ga0207652_10064636
3585 Ga0207652_10074683
3586 Ga0207652_10083693
3587 Ga0207652_10128589
3588 Ga0207652_10232749
3589 Ga0207652_10238279
3590 Ga0207646_10007355
3591 Ga0207646_10072730
3592 Ga0207646_10088310
3593 Ga0207646_10183280
3594 Ga0207681_10004029
3595 Ga0207681_10016931
3596 Ga0207681_10026224
3597 Ga0207681_10048133
3598 Ga0207681_10137157
3599 Ga0207681_10182015
3600 Ga0207694_10084650
3601 Ga0207694_10278506
3602 Ga0207650_10006778
3603 Ga0207650_10006791
3604 Ga0207650_10007082
3605 Ga0207650_10019133
3606 Ga0207650_10038704
3607 Ga0207650_10048127
3608 Ga0207650_10052972
3609 Ga0207650_10058189
3610 Ga0207650_10060031
3611 Ga0207650_10063538
3612 Ga0207650_10090302
3613 Ga0207650_10144783
3614 Ga0207650_10295923
3615 Ga0207659_10002162
3616 Ga0207659_10008786
3617 Ga0207659_10009706
3618 Ga0207659_10014831
3619 Ga0207659_10021968
3620 Ga0207659_10056197
3621 Ga0207659_10087462
3622 Ga0207687_10002262
3623 Ga0207687_10002498
3624 Ga0207687_10003693
3625 Ga0207687_10048895
3626 Ga0207687_10093060
3627 Ga0207687_10107229
3628 Ga0207687_10279393
3629 Ga0207700_10000029
3630 Ga0207700_10001192
3631 Ga0207700_10001526
3632 Ga0207700_10002806
3633 Ga0207700_10004530
3634 Ga0207664_10000168
3635 Ga0207664_10001380
3636 Ga0207664_10049306
3637 Ga0207664_10076163
3638 Ga0207664_10081040
3639 Ga0207664_10154994
3640 Ga0207664_10281259
3641 Ga0207644_10002009
3642 Ga0207644_10002533
3643 Ga0207644_10002966
3644 Ga0207644_10011226
3645 Ga0207644_10012107
3646 Ga0207644_10015020
3647 Ga0207644_10019061
3648 Ga0207644_10039113
3649 Ga0207644_10039942
3650 Ga0207644_10056950
3651 Ga0207644_10062939
3652 Ga0207644_10142981
3653 Ga0207644_10207302
3654 Ga0207644_10286144
3655 Ga0207690_10021165
3656 Ga0207690_10060193
3657 Ga0207690_10162126
3658 Ga0207690_10274384
3659 Ga0207706_10000008
3660 Ga0207706_10000918
3661 Ga0207706_10015589
3662 Ga0207706_10017980
3663 Ga0207706_10025205
3664 Ga0207706_10034060
3665 Ga0207706_10085191
3666 Ga0207706_10094141
3667 Ga0207706_10112183
3668 Ga0207706_10136569
3669 Ga0207706_10175242
3670 Ga0207686_10000302
3671 Ga0207686_10003451
3672 Ga0207686_10004433
3673 Ga0207686_10013258
3674 Ga0207686_10014352
3675 Ga0207686_10153659
3676 Ga0207686_10193233
3677 Ga0207709_10000759
3678 Ga0207709_10005409
3679 Ga0207670_10001147
3680 Ga0207670_10013237
3681 Ga0207670_10021145
3682 Ga0207670_10039924
3683 Ga0207670_10058975
3684 Ga0207670_10113586
3685 Ga0207670_10118013
3686 Ga0207669_10005372
3687 Ga0207669_10017247
3688 Ga0207669_10030798
3689 Ga0207669_10034968
3690 Ga0207669_10102327
3691 Ga0207669_10110195
3692 Ga0207669_10113094
3693 Ga0207669_10134098
3694 Ga0207704_10000698
3695 Ga0207704_10026586
3696 Ga0207704_10073401
3697 Ga0207704_10113959
3698 Ga0207704_10144508
3699 Ga0207665_10000144
3700 Ga0207665_10003107
3701 Ga0207665_10109588
3702 Ga0207691_10000445
3703 Ga0207691_10001965
3704 Ga0207691_10003889
3705 Ga0207691_10005758
3706 Ga0207691_10006969
3707 Ga0207691_10017602
3708 Ga0207691_10017742
3709 Ga0207691_10027487
3710 Ga0207691_10045823
3711 Ga0207691_10192422
3712 Ga0207691_10197646
3713 Ga0207691_10201505
3714 Ga0207711_10002349
3715 Ga0207711_10032140
3716 Ga0207711_10053204
3717 Ga0207711_10059364
3718 Ga0207711_10061594
3719 Ga0207711_10065889
3720 Ga0207711_10071157
3721 Ga0207711_10170714
3722 Ga0207711_10203801
3723 Ga0207689_10000264
3724 Ga0207689_10001002
3725 Ga0207689_10001752
3726 Ga0207689_10018905
3727 Ga0207689_10025980
3728 Ga0207689_10028106
3729 Ga0207689_10102669
3730 Ga0207689_10240972
3731 Ga0207689_10285880
3732 Ga0207661_10002159
3733 Ga0207661_10010709
3734 Ga0207661_10026953
3735 Ga0207661_10052101
3736 Ga0207661_10084180
3737 Ga0207661_10271990
3738 Ga0207661_10359374
3739 Ga0207679_10000934
3740 Ga0207679_10008329
3741 Ga0207679_10026399
3742 Ga0207679_10097947
3743 Ga0207679_10105695
3744 Ga0207679_10125934
3745 Ga0207679_10248342
3746 Ga0207667_10001326
3747 Ga0207667_10002319
3748 Ga0207667_10005114
3749 Ga0207667_10007810
3750 Ga0207667_10011686
3751 Ga0207667_10013199
3752 Ga0207667_10025214
3753 Ga0207667_10047830
3754 Ga0207667_10065289
3755 Ga0207667_10107719
3756 Ga0207667_10179921
3757 Ga0207667_10254061
3758 Ga0207667_10258707
3759 Ga0207667_10359671
3760 Ga0207651_10001791
3761 Ga0207651_10008798
3762 Ga0207651_10089694
3763 Ga0207651_10134288
3764 Ga0207712_10000914
3765 Ga0207712_10050072
3766 Ga0207668_10002718
3767 Ga0207668_10002952
3768 Ga0207668_10006144
3769 Ga0207668_10006590
3770 Ga0207668_10014807
3771 Ga0207668_10025949
3772 Ga0207668_10191690
3773 Ga0207640_10007012
3774 Ga0207640_10012816
3775 Ga0207640_10014760
3776 Ga0207640_10025893
3777 Ga0207640_10027679
3778 Ga0207640_10275967
3779 Ga0207658_10005406
3780 Ga0207658_10010573
3781 Ga0207658_10015102
3782 Ga0207658_10027760
3783 Ga0207658_10034275
3784 Ga0207658_10054407
3785 Ga0207658_10072215
3786 Ga0207658_10171666
3787 Ga0207658_10197228
3788 Ga0207677_10001411
3789 Ga0207677_10001899
3790 Ga0207677_10005148
3791 Ga0207677_10006672
3792 Ga0207677_10011282
3793 Ga0207677_10012603
3794 Ga0207677_10014588
3795 Ga0207677_10022852
3796 Ga0207677_10055131
3797 Ga0207677_10063856
3798 Ga0207703_10000312
3799 Ga0207703_10000519
3800 Ga0207703_10001439
3801 Ga0207703_10001924
3802 Ga0207703_10004500
3803 Ga0207703_10010082
3804 Ga0207703_10056104
3805 Ga0207703_10234668
3806 Ga0207703_10272757
3807 Ga0207703_10356315
3808 Ga0207703_10364156
3809 Ga0207639_10003226
3810 Ga0207639_10019458
3811 Ga0207639_10133260
3812 Ga0207639_10140382
3813 Ga0207678_10008479
3814 Ga0207678_10013310
3815 Ga0207678_10013688
3816 Ga0207678_10026139
3817 Ga0207678_10055132
3818 Ga0207678_10101232
3819 Ga0207678_10118446
3820 Ga0207678_10232350
3821 Ga0207708_10000494
3822 Ga0207708_10000736
3823 Ga0207708_10014620
3824 Ga0207708_10081135
3825 Ga0207702_10000510
3826 Ga0207702_10001951
3827 Ga0207702_10009236
3828 Ga0207702_10011613
3829 Ga0207702_10034707
3830 Ga0207702_10052132
3831 Ga0207702_10279662
3832 Ga0207641_10002633
3833 Ga0207641_10003157
3834 Ga0207641_10003409
3835 Ga0207641_10005405
3836 Ga0207641_10017709
3837 Ga0207641_10023223
3838 Ga0207641_10034439
3839 Ga0207641_10044364
3840 Ga0207641_10045360
3841 Ga0207641_10121886
3842 Ga0207641_10146921
3843 Ga0207648_10001616
3844 Ga0207648_10001763
3845 Ga0207648_10006120
3846 Ga0207648_10008506
3847 Ga0207648_10016567
3848 Ga0207648_10022205
3849 Ga0207648_10026787
3850 Ga0207648_10031739
3851 Ga0207648_10074003
3852 Ga0207648_10081943
3853 Ga0207676_10000470
3854 Ga0207676_10002657
3855 Ga0207676_10004691
3856 Ga0207676_10012094
3857 Ga0207676_10024376
3858 Ga0207676_10034877
3859 Ga0207676_10038933
3860 Ga0207676_10043251
3861 Ga0207676_10046420
3862 Ga0207676_10073349
3863 Ga0207676_10350331
3864 Ga0207676_10370113
3865 Ga0207676_10385738
3866 Ga0207674_10000062
3867 Ga0207674_10000709
3868 Ga0207674_10002483
3869 Ga0207674_10045502
3870 Ga0207674_10132731
3871 Ga0207675_100000697
3872 Ga0207675_100001280
3873 Ga0207675_100001316
3874 Ga0207675_100002525
3875 Ga0207675_100013518
3876 Ga0207675_100015875
3877 Ga0207675_100035962
3878 Ga0207675_100103442
3879 Ga0207675_100113214
3880 Ga0207683_10000227
3881 Ga0207683_10000568
3882 Ga0207683_10001219
3883 Ga0207683_10001441
3884 Ga0207683_10003890
3885 Ga0207683_10006363
3886 Ga0207683_10010344
3887 Ga0207683_10016063
3888 Ga0207683_10020379
3889 Ga0207683_10039856
3890 Ga0207683_10040419
3891 Ga0207683_10066461
3892 Ga0207683_10172623
3893 Ga0207683_10173336
3894 Ga0207698_10001850
3895 Ga0207698_10002880
3896 Ga0207698_10014880
3897 Ga0207698_10018491
3898 Ga0207698_10020427
3899 Ga0207698_10024335
3900 Ga0207698_10031555
3901 Ga0207698_10059367
3902 Ga0207698_10093619
3903 Ga0207698_10126866
3904 Ga0207698_10171374
3905 Ga0207698_10193180
3906 Ga0207698_10228156
3907 Ga0209371_1007913
3908 Ga0209969_1000759
3909 Ga0209967_1000554
3910 Ga0209981_1000574
3911 Ga0209981_1006417
3912 Ga0209996_1000669
3913 Ga0210000_1000619
3914 Ga0210000_1001550
3915 Ga0209995_1005446
3916 Ga0209995_1012367
3917 Ga0209968_1001892
3918 Ga0209999_1000519
3919 Ga0209999_1005633
3920 Ga0209983_1011015
3921 Ga0209588_1028637
3922 Ga0209971_1001259
3923 Ga0209971_1006979
3924 Ga0209966_1012711
3925 Ga0209966_1012913
3926 Ga0209813_10000476
3927 Ga0209974_10000194
3928 Ga0209974_10001758
3929 Ga0209974_10012396
3930 Ga0207428_10003084
3931 Ga0207428_10003647
3932 Ga0207428_10006244
3933 Ga0207428_10008344
3934 Ga0207428_10024205
3935 Ga0207428_10058156
3936 Ga0207428_10079841
3937 Ga0207428_10182725
3938 Ga0268266_10007894
3939 Ga0268266_10008086
3940 Ga0268266_10009978
3941 Ga0268266_10019877
3942 Ga0268266_10041780
3943 Ga0268266_10045694
3944 Ga0268266_10048744
3945 Ga0268266_10054328
3946 Ga0268266_10069069
3947 Ga0268266_10102809
3948 Ga0268266_10112273
3949 Ga0268266_10157087
3950 Ga0268265_10004584
3951 Ga0268265_10004996
3952 Ga0268265_10005389
3953 Ga0268265_10012818
3954 Ga0268265_10110928
3955 Ga0268265_10149434
3956 Ga0268265_10205450
3957 Ga0268265_10217718
3958 Ga0268264_10000145
3959 Ga0268264_10000702
3960 Ga0268264_10001853
3961 Ga0268264_10014241
3962 Ga0268264_10020100
3963 Ga0268264_10029856
3964 Ga0268264_10063126
3965 Ga0268264_10128828
3966 Ga0268264_10258265
3967 Ga0268264_10328243
3968 Ga0265337_1013649
3969 Ga0265318_10006296
3970 Ga0307515_10000093
3971 Ga0307515_10017976
3972 Ga0307515_10155276
3973 Ga0265338_10000045
3974 Ga0265338_10000205
3975 Ga0265338_10009967
3976 Ga0265338_10066764
3977 Ga0307511_10000005
3978 Ga0307511_10002396
3979 Ga0307511_10029420
3980 Ga0265330_10014406
3981 Ga0265330_10028519
3982 Ga0265330_10037714
3983 Ga0265332_10000958
3984 Ga0265332_10001524
3985 Ga0265328_10007751
3986 Ga0265325_10000630
3987 Ga0265325_10018378
3988 Ga0265325_10074544
3989 Ga0265329_10003688
3990 Ga0265340_10016731
3991 Ga0265339_10038895
3992 Ga0265339_10082269
3993 Ga0265331_10002114
3994 Ga0265331_10003801
3995 Ga0265331_10015421
3996 Ga0265331_10039283
3997 Ga0265316_10025070
3998 Ga0265316_10026875
3999 Ga0265316_10049063
4000 Ga0265316_10143199
4001 Ga0307513_10000104
4002 Ga0307509_10000002
4003 Ga0307509_10023370
4004 Ga0307509_10040989
4005 Ga0307509_10049824
4006 Ga0307408_100040078
4007 Ga0307408_100097633
4008 Ga0307408_100127701
4009 Ga0265313_10074095
4010 Ga0307508_10112275
4011 Ga0316575_10006567
4012 Ga0316575_10016119
4013 Ga0316575_10016590
4014 Ga0316575_10035985
4015 Ga0316579_10007610
4016 Ga0316579_10009935
4017 Ga0316579_10027858
4018 Ga0316579_10032999
4019 Ga0316579_10064955
4020 Ga0265314_10000523
4021 Ga0265314_10001945
4022 Ga0265314_10015124
4023 Ga0265342_10003160
4024 Ga0316576_10019148
4025 Ga0316576_10199278
4026 Ga0316578_10004329
4027 Ga0316578_10009032
4028 Ga0316578_10012288
4029 Ga0316578_10039586
4030 Ga0307405_10052570
4031 Ga0307413_10046722
4032 Ga0307413_10058152
4033 Ga0307410_10005780
4034 Ga0307410_10138911
4035 Ga0307406_10002674
4036 Ga0307406_10033409
4037 Ga0307406_10141911
4038 Ga0307407_10004002
4039 Ga0307407_10006689
4040 Ga0307412_10014011
4041 Ga0307412_10019161
4042 Ga0307412_10095129
4043 Ga0307409_100000674
4044 Ga0307409_100018856
4045 Ga0307409_100153391
4046 Ga0307409_100274245
4047 Ga0307416_100012024
4048 Ga0307416_100015040
4049 Ga0307416_100018117
4050 Ga0307416_100029619
4051 Ga0307416_100438825
4052 Ga0307414_10177423
4053 Ga0307411_10060228
4054 Ga0307415_100001423
4055 Ga0307415_100094136
4056 Ga0307415_100197221
4057 Ga0307415_100235887
4058 Ga0316583_10002176
4059 Ga0316583_10005429
4060 Ga0316583_10026229
4061 Ga0316585_10006962
4062 Ga0316593_10023588
4063 Ga0316593_10057995
4064 Ga0307507_10014093
4065 Ga0307510_10000007
4066 Ga0307510_10039627
4067 Ga0316592_1005024
4068 Ga0316586_1003345
4069 Ga0316588_1002715
4070 Ga0373938_0001276
4071 Ga0373926_0004126
4072 Ga0373934_0000243
4073 Ga0373934_0003740
4074 Ga0373934_0011985
4075 Ga0373934_0022213
4076 Ga0373940_0005447
4077 Ga0373940_0016453
4078 Ga0373951_0012561
4079 Ga0373952_0004182
4080 Ga0373952_0020049
4081 Ga0373923_0001240
4082 Ga0373923_0046228
4083 Ga0373932_0000353
4084 Ga0373932_0009251
4085 Ga0373936_0045960
4086 Ga0373939_0001442
4087 Ga0373939_0002736
4088 Ga0373939_0003087
4089 Ga0373945_0056549
4090 Ga0373953_0004970
4091 Ga0373953_0005184
4092 Ga0373954_0000003
4093 Ga0373954_0003106
4094 Ga0373954_0009477
4095 Ga0373954_0009838
4096 Ga0373954_0018758
4097 Ga0373956_0002064
4098 Ga0373956_0005959
4099 Ga0373956_0047177
4100 Ga0373957_0008533
4101 Ga0373957_0091909
4102 Ga0373960_0007072
4103 Ga0373960_0019603
4104 Ga0373943_0001697
4105 Ga0373943_0011387
4106 Ga0373943_0027495
4107 Ga0373943_0065997
4108 Ga0373946_0008281
4109 Ga0373946_0026490
4110 Ga0373946_0041523
4111 Ga0373955_0000145
4112 Ga0373955_0001065
4113 Ga0373955_0001607
4114 Ga0373955_0015582
4115 Ga0373955_0018267
4116 Ga0373955_0042371
4117 Ga0373955_0042484
4118 Ga0373955_0046475
4119 Ga0373955_0094716
4120 Ga0373942_0002017
4121 Ga0373942_0047388
4122 Ga0373962_0001024
4123 Ga0316574_0009125
4124 Ga0316574_0011818
4125 Ga0316574_0020894
4126 Ga0316574_0099034
4127 Ga0316574_0124507
4128 Ga0316574_0144681
4129 Ga0316574_0168269
4130 Ga0373924_0000941
4131 Ga0373924_0004607
4132 Ga0373924_0006633
4133 Ga0373924_0034351
4134 Ga0373931_0000189
4135 Ga0373931_0002113
4136 Ga0373931_0005256
4137 Ga0373931_0033728
4138 Ga0373931_0096464
4139 Ga0373935_0000017
4140 Ga0373935_0005734
4141 Ga0373935_0009848
4142 Ga0373935_0016747
4143 Ga0373935_0033804
4144 Ga0373935_0050401
4145 Ga0373935_0073411
4146 Ga0373935_0147534
4147 Ga0373927_0016477
4148 Ga0373927_0018526
4149 Ga0373927_0036724
4150 Ga0373927_0079565
4151 Ga0373927_0081786
4152 Ga0373927_0084079
4153 Ga0373927_0109731
4154 Ga0373933_0000579
4155 Ga0373933_0001228
4156 Ga0373933_0004151
4157 Ga0373933_0008876
4158 Ga0373933_0035109
4159 Ga0373933_0057746
4160 Ga0373933_0115462
4161 Ga0373947_0009952
4162 Ga0373947_0018315
4163 Ga0373947_0061412
4164 Ga0373947_0135362
4165 Ga0373947_0193816
4166 Ga0373937_0000103
4167 Ga0373937_0000131
4168 Ga0373937_0001360
4169 Ga0373937_0007447
4170 Ga0373937_0012811
4171 Ga0373937_0021739
4172 Ga0373937_0027437
4173 Ga0373937_0036403
4174 Ga0373937_0037606
4175 Ga0373937_0045372
4176 Ga0373937_0046984
4177 Ga0373937_0157864
4178 Ga0373937_0223313
4179 Ga0316582_0018444
4180 Ga0316582_0076960
4181 Ga0316582_0095048
4182 Ga0316582_0135484
4183 Ga0316584_0000192
4184 Ga0316584_0042219
4185 Ga0316584_0051908
4186 Ga0316584_0061049
4187 Ga0316584_0070015
4188 Ga0316584_0079431
4189 Ga0316584_0089186
4190 Ga0316584_0153546
4191 Ga0373925_0000058
4192 Ga0373925_0040900
4193 Ga0373925_0043332
4194 Ga0373925_0044352
4195 Ga0373925_0054731
4196 Ga0373925_0112646
4197 Ga0395899_0028085
4198 Ga0395899_0061267
4199 Ga0395899_0065936
4200 Ga0395900_0019231
4201 Ga0395900_0036870
4202 Ga0395900_0046502
4203 Ga0395900_0059277
4204 Ga0395900_0201866
4205 Ga0395900_0204678
4206 Ga0395900_0283517
4207 Ga0395900_0295256
4208 Ga0395898_0015812
4209 Ga0395898_0023421
4210 Ga0395898_0029771
4211 Ga0395898_0047621
4212 Ga0395898_0060385
4213 Ga0395898_0077240
4214 Ga0395898_0127713
4215 Ga0395898_0153070
4216 Ga0395898_0154242
4217 Ga0395898_0184252
4218 Ga0395905_0000043
4219 Ga0395905_0014552
4220 Ga0395905_0049067
4221 Ga0395905_0067525
4222 Ga0395905_0115317
4223 Ga0395905_0120534
4224 Ga0395905_0158564
4225 Ga0395905_0180344
4226 Ga0316581_0001310
4227 Ga0436364_0207258
4228 Ga0436364_0314874
4229 Ga0436364_0351220
4230 Ga0436364_0764338
4231 Ga0436364_0988190
4232 Ga0436364_1220763
4233 Ga0436364_1270512
4234 Ga0436364_1468533
4235 Ga0395901_0011296
4236 Ga0395901_0017178
4237 Ga0395901_0017650
4238 Ga0395901_0034121
4239 Ga0395901_0090732
4240 Ga0395901_0233125
4241 Ga0400488_25049
4242 Ga0400483_010883
4243 Ga0400483_052876
4244 Ga0400483_192796
4245 Ga0400489_18675
4246 Ga0400489_49853
4247 Ga0400487_25275
4248 Ga0436365_0727164
4249 Ga0436365_1241251
4250 Ga0436365_1282334
4251 Ga0436365_1865855
4252 Ga0436360_1082140
4253 Ga0436361_0234825
4254 Ga0436361_0837620
4255 Ga0436363_0024737
4256 Ga0436363_1334135
4257 Ga0436363_1512283
4258 Ga0436362_0025995
4259 Ga0436362_1027627
4260 Ga0439436_0001332
4261 Ga0439453_0000481
4262 Ga0439466_0019516
4263 Ga0439465_0003831
4264 Ga0451853_3625268
4265 Ga0439433_0002646
4266 Ga0439441_012443
4267 Ga0439445_0000170
4268 Ga0439449_0004416
4269 Ga0439451_020065
4270 Ga0439462_0010265
4271 Ga0439446_0005653
4272 Ga0450909_001487
4273 Ga0439434_0004262
4274 Ga0439434_0005544
4275 Ga0439434_0011570
4276 Ga0439435_0000427
4277 Ga0439444_0000069
4278 Ga0451577_0008711
4279 Ga0451577_0009071
4280 Ga0451577_0033459
4281 Ga0451577_0130421
4282 Ga0451577_0286070
4283 Ga0466969_0001994
4284 Ga0466972_0003545
4285 Ga0466966_0026781
4286 Ga0466961_0012714
4287 Ga0466961_0028539
4288 Ga0466963_0038709
4289 Ga0466964_0006291
4290 Ga0453684_0275738
4291 Ga0466968_0000683
4292 Ga0466968_0004230
4293 Ga0466970_0082030
4294 Ga0466957_0000089
4295 Ga0466960_0011379
4296 Ga0466959_0001172
4297 Ga0466959_0008856
4298 Ga0466959_0009421
4299 Ga0466959_0015485
4300 Ga0451576_0001669
4301 Ga0451576_0001675
4302 Ga0451576_0005273
4303 Ga0451576_0086106
4304 Ga0451576_0369994
4305 Ga0466958_0034236
4306 Ga0466958_0067726
4307 Ga0466967_0133314
4308 Ga0495592_0000062
4309 Ga0495592_0049105
4310 Ga0495592_0072897
4311 Ga0495592_0076710
4312 Ga0495590_0017572
4313 Ga0495590_0056223
4314 Ga0495591_002493
4315 Ga0495591_005888
4316 Ga0495629_0000115
4317 Ga0495629_0001063
4318 Ga0495629_0001807
4319 Ga0495629_0005730
4320 Ga0495629_0039433
4321 Ga0495629_0044725
4322 Ga0495629_0048099
4323 Ga0495638_0003283
4324 Ga0495638_0014124
4325 Ga0495641_0003356
4326 Ga0495651_0001912
4327 Ga0495651_0003749
4328 Ga0495651_0005207
4329 Ga0495653_0000072
4330 Ga0495653_0003451
4331 Ga0495653_0004667
4332 Ga0495653_0015156
4333 Ga0495653_0089891
4334 Ga0495653_0100678
4335 Ga0495650_0005305
4336 Ga0495650_0017498
4337 Ga0495580_0006433
4338 Ga0495580_0015198
4339 Ga0495580_0025336
4340 Ga0495580_0038208
4341 Ga0495580_0038330
4342 Ga0495582_0014890
4343 Ga0495582_0022387
4344 Ga0495582_0049259
4345 Ga0495605_0012353
4346 Ga0495605_0069680
4347 Ga0495639_0003385
4348 Ga0495639_0007850
4349 Ga0495639_0008512
4350 Ga0495662_0036717
4351 Ga0495664_0000009
4352 Ga0495664_0042127
4353 Ga0495584_0008312
4354 Ga0495584_0012414
4355 Ga0495584_0043732
4356 Ga0495585_0080064
4357 Ga0495594_0027422
4358 Ga0495596_0000832
4359 Ga0495596_0001312
4360 Ga0495607_0060761
4361 Ga0495607_0087371
4362 Ga0495583_0002560
4363 Ga0495583_0019920
4364 Ga0495583_0056047
4365 Ga0495606_0007905
4366 Ga0495606_0010540
4367 Ga0495606_0018588
4368 Ga0495608_0000061
4369 Ga0495608_0003916
4370 Ga0495616_0009920
4371 Ga0495618_0000061
4372 Ga0495618_0005652
4373 Ga0495620_0005528
4374 Ga0495620_0036318
4375 Ga0495620_0036549
4376 Ga0495628_0000012
4377 Ga0495628_0004166
4378 Ga0495628_0005756
4379 Ga0495628_0023537
4380 Ga0495628_0034390
4381 Ga0495628_0063792
4382 Ga0495628_0192958
4383 Ga0495630_0010670
4384 Ga0495630_0015707
4385 Ga0495630_0026145
4386 Ga0495630_0056182
4387 Ga0495630_0063049
4388 Ga0495630_0081720
4389 Ga0495630_0090327
4390 Ga0495631_0003805
4391 Ga0495631_0005592
4392 Ga0495631_0013284
4393 Ga0495631_0028611
4394 Ga0495632_0017133
4395 Ga0495632_0062788
4396 Ga0495637_0007448
4397 Ga0495643_0006316
4398 Ga0495643_0011455
4399 Ga0495643_0037999
4400 Ga0495643_0086339
4401 Ga0495644_0032333
4402 Ga0495648_0011365
4403 Ga0495648_0020006
4404 Ga0495648_0045460
4405 Ga0495666_0005421
4406 Ga0495666_0009188
4407 Ga0495642_0007602
4408 Ga0495642_0010765
4409 Ga0495652_0000021
4410 Ga0495652_0004306
4411 Ga0495652_0032040
4412 Ga0495652_0072337
4413 Ga0495654_0009184
4414 Ga0495654_0027893
4415 Ga0495654_0037383
4416 Ga0495665_0004644
4417 Ga0495665_0015272
4418 Ga0495665_0026132
4419 Ga0495665_0037280
4420 Ga0495665_0066116
4421 Ga0495665_0072069
4422 Ga0495640_0000028
4423 Ga0495640_0006679
4424 Ga0495640_0013131
4425 Ga0495640_0031348
4426 Ga0495586_0007082
4427 Ga0495586_0008178
4428 Ga0495586_0009251
4429 Ga0495586_0012052
4430 Ga0495586_0013720
4431 Ga0495586_0198461
4432 Ga0495587_0000033
4433 Ga0495587_0004825
4434 Ga0495587_0009004
4435 Ga0495587_0029072
4436 Ga0495587_0110371
4437 Ga0495609_0016445
4438 Ga0495609_0018956
4439 Ga0495621_0001657
4440 Ga0495597_0000019
4441 Ga0495597_0000058
4442 Ga0495597_0002251
4443 Ga0495597_0006725
4444 Ga0495645_0000017
4445 Ga0495645_0000609
4446 Ga0495645_0000843
4447 Ga0495645_0001841
4448 Ga0495645_0016307
4449 Ga0495645_0060228
4450 Ga0495645_0119832
4451 Ga0495622_0000196
4452 Ga0495622_0002089
4453 Ga0495622_0013911
4454 Ga0495633_0006886
4455 Ga0495633_0009809
4456 Ga0495633_0023642
4457 Ga0495667_0000011
4458 Ga0495667_0000672
4459 Ga0495667_0001460
4460 Ga0495667_0078757
4461 Ga0495667_0098363
4462 Ga0495667_0098876
4463 Ga0495656_0007411
4464 Ga0495668_0003141
4465 Ga0495668_0026664
4466 Ga0495668_0030630
4467 Ga0495668_0048473
4468 Ga0495668_0100806
4469 Ga0495634_0000220
4470 Ga0495634_0001130
4471 Ga0495634_0026629
4472 Ga0495634_0046247
4473 Ga0495634_0077175
4474 Ga0495634_0124527
4475 Ga0495611_0003515
4476 Ga0495611_0036614
4477 Ga0495611_0078038
4478 Ga0495625_0024548
4479 Ga0495635_0000019
4480 Ga0495635_0007180
4481 Ga0495635_0016849
4482 Ga0495635_0048647
4483 Ga0495661_0001133
4484 Ga0495661_0005288
4485 Ga0495661_0075586
4486 Ga0495661_0079148
4487 Ga0495661_0086112
4488 Ga0495588_0018753
4489 Ga0495657_0000378
4490 Ga0495657_0009256
4491 Ga0495657_0032069
4492 Ga0495599_0000024
4493 Ga0495599_0015770
4494 Ga0495599_0153466
4495 Ga0495623_0000022
4496 Ga0495623_0003295
4497 Ga0495623_0009483
4498 Ga0495623_0026360
4499 Ga0495646_0000033
4500 Ga0495646_0001525
4501 Ga0495646_0025972
4502 Ga0495646_0034625
4503 Ga0495646_0054051
4504 Ga0495646_0064318
4505 Ga0495647_0002023
4506 Ga0495647_0008562
4507 Ga0495658_0003278
4508 Ga0495658_0055595
4509 Ga0495658_0076122
4510 Ga0495658_0126589
4511 Ga0495669_0049879
4512 Ga0495613_0009781
4513 Ga0495613_0021121
4514 Ga0495613_0035495
4515 Ga0495613_0038298
4516 Ga0495624_0000768
4517 Ga0495624_0001964
4518 Ga0495624_0005770
4519 Ga0495624_0008963
4520 Ga0495624_0035255
4521 Ga0495670_0005274
4522 Ga0495670_0026270
4523 Ga0495670_0056278
4524 Ga0495671_0026726
4525 Ga0495671_0027130
4526 Ga0495671_0030347
4527 Ga0495671_0035825
4528 Ga0495649_0001475
4529 Ga0495649_0025625
4530 Ga0495649_0084480
4531 Ga0495589_0000861
4532 Ga0495589_0003845
4533 Ga0495600_0000028
4534 Ga0495600_0000657
4535 Ga0495600_0009629
4536 Ga0495600_0017922
4537 Ga0495600_0018548
4538 Ga0495600_0046862
4539 Ga0495600_0051933
4540 Ga0495600_0122751
4541 Ga0495600_0194322
4542 Ga0495660_0012857
4543 Ga0495660_0051548
4544 Ga0495660_0129958
4545 Ga0495581_0001914
4546 Ga0495581_0005793
4547 Ga0495581_0009339
4548 Ga0495581_0044986
4549 Ga0495581_0064417
4550 Ga0495604_0000011
4551 Ga0495604_0013594
4552 Ga0495604_0015332
4553 Ga0495604_0029226
4554 Ga0495604_0097564
4555 Ga0495674_0000015
4556 Ga0495674_0016124
4557 Ga0495674_0031893
4558 Ga0495674_0052325
4559 Ga0495674_0094033
4560 Ga0495674_0113720
4561 Ga0495674_0165371
4562 Ga0495674_0299994
4563 Ga0495672_0033356
4564 Ga0495672_0050320
4565 Ga0495676_0012310
4566 Ga0495676_0017794
4567 Ga0495676_0021777
4568 Ga0495676_0026748
4569 Ga0495676_0074109
4570 Ga0495676_0152020
4571 Ga0495680_0000812
4572 Ga0495680_0009066
4573 Ga0495680_0012341
4574 Ga0495680_0019802
4575 Ga0495680_0070190
4576 Ga0495687_000060
4577 Ga0495687_000350
4578 Ga0495687_015375
4579 Ga0495687_022160
4580 Ga0495675_0000295
4581 Ga0495675_0003515
4582 Ga0495675_0003662
4583 Ga0495675_0032366
4584 Ga0495677_0003018
4585 Ga0495677_0012062
4586 Ga0495679_000026
4587 Ga0495679_000245
4588 Ga0495679_002264
4589 Ga0495679_025669
4590 Ga0495673_0000335
4591 Ga0495673_0007801
4592 Ga0495673_0062981
4593 Ga0495681_0000005
4594 Ga0495681_0007520
4595 Ga0495681_0008222
4596 Ga0495681_0015730
4597 Ga0495681_0054108
4598 Ga0495684_0000036
4599 Ga0495684_0020175
4600 Ga0495684_0046440
4601 Ga0495684_0082407
4602 Ga0495686_0014653
4603 Ga0495593_0001674
4604 Ga0495593_0007037
4605 Ga0495593_0088071
4606 Ga0495593_0095932
4607 Ga0495602_0000018
4608 Ga0495602_0031584
4609 Ga0495602_0033350
4610 Ga0495602_0058452
4611 Ga0495614_0046053
4612 Ga0495614_0063828
4613 Ga0495614_0083312
4614 Ga0495626_0008241
4615 Ga0495626_0008439
4616 Ga0495626_0010810
4617 Ga0495626_0014377
4618 Ga0496100_0035629
4619 Ga0496101_0174015
4620 Ga0496101_0242092
4621 Ga0496102_0039979
4622 Ga0496102_0169234
4623 Ga0496102_0214595
4624 Ga0496102_0264863
4625 Ga0496102_0365754
4626 Ga0496103_0142093
4627 Ga0496104_0000175
4628 Ga0496104_0002357
4629 Ga0496104_0003379
4630 Ga0496104_0009058
4631 Ga0496104_0026761
4632 Ga0496104_0028770
4633 Ga0496104_0061783
4634 Ga0496104_0068986
4635 Ga0496105_0007248
4636 Ga0496105_0014273
4637 Ga0496105_0019067
4638 Ga0496105_0035302
4639 Ga0496105_0059288
4640 Ga0496105_0076042
4641 Ga0496105_0119224
4642 Ga0496106_0000334
4643 Ga0496106_0001067
4644 Ga0496106_0104347
4645 Ga0496106_0124796
4646 Ga0496107_0009614
4647 Ga0496107_0088487
4648 Ga0496107_0131986
4649 Ga0496108_0001410
4650 Ga0496108_0001485
4651 Ga0496108_0001994
4652 Ga0496108_0012643
4653 Ga0496108_0054756
4654 Ga0496108_0097929
4655 Ga0496108_0106011
4656 Ga0496108_0106174
4657 Ga0496109_0001151
4658 Ga0496109_0004099
4659 Ga0496109_0004300
4660 Ga0496109_0005509
4661 Ga0496109_0025515
4662 Ga0496109_0032109
4663 Ga0496109_0032518
4664 Ga0496109_0337966
4665 Ga0496109_0385585
4666 Ga0496110_0003529
4667 Ga0496110_0004061
4668 Ga0496110_0004114
4669 Ga0496110_0015658
4670 Ga0496110_0024070
4671 Ga0496110_0033235
4672 Ga0496110_0073883
4673 Ga0496110_0103988
4674 Ga0496110_0179084
4675 Ga0496110_0259005
4676 Ga0496110_0276879
4677 Ga0496111_0000362
4678 Ga0496111_0002041
4679 Ga0496111_0003573
4680 Ga0496111_0103935
4681 Ga0496111_0175879
4682 Ga0496111_0177154
4683 Ga0496112_0000056
4684 Ga0496112_0000755
4685 Ga0496112_0001355
4686 Ga0496112_0003671
4687 Ga0496112_0004153
4688 Ga0496112_0020129
4689 Ga0496112_0025394
4690 Ga0496112_0066539
4691 Ga0496112_0153912
4692 Ga0496112_0179019
4693 Ga0496113_0004878
4694 Ga0496113_0007156
4695 Ga0496113_0013283
4696 Ga0496113_0021063
4697 Ga0496113_0068623
4698 Ga0496113_0068976
4699 Ga0496114_0004949
4700 Ga0496114_0007967
4701 Ga0496114_0050781
4702 Ga0496114_0076831
4703 Ga0496114_0100758
4704 Ga0496114_0342448
4705 Ga0496115_0069540
4706 Ga0496115_0097378
4707 Ga0496115_0151226
4708 Ga0496116_0023537
4709 Ga0496116_0120025
4710 Ga0496117_0006817
4711 Ga0496117_0009447
4712 Ga0496117_0082879
4713 Ga0496118_0000401
4714 Ga0496118_0006350
4715 Ga0496121_0001952
4716 Ga0496121_0003905
4717 Ga0496121_0004910
4718 Ga0496121_0016298
4719 Ga0496121_0030946
4720 Ga0496121_0068518
4721 Ga0496122_0003399
4722 Ga0496122_0006573
4723 Ga0496123_0000136
4724 Ga0496124_0000103
4725 Ga0496124_0004093
4726 Ga0496124_0064437
4727 Ga0496124_0186448
4728 Ga0496125_0000482
4729 Ga0496125_0003169
4730 Ga0496125_0009441
4731 Ga0496125_0027805
4732 Ga0496126_0000389
4733 Ga0496126_0004363
4734 Ga0496126_0258225
4735 Ga0501032_0046476
4736 Ga0501033_0021452
4737 Ga0501033_0057231
4738 Ga0501033_0060320
4739 Ga0501034_0001791
4740 Ga0501034_0019580
4741 Ga0501034_0054616
4742 Ga0501034_0059944
4743 Ga0501034_0116771
4744 Ga0501034_0129683
4745 Ga0501036_0005876
4746 Ga0501036_0035339
4747 Ga0501036_0046105
4748 Ga0501037_0116821
4749 Ga0501038_0001150
4750 Ga0501038_0011563
4751 Ga0501038_0026277
4752 Ga0501038_0035650
4753 Ga0501038_0046808
4754 Ga0501038_0073346
4755 Ga0501038_0076393
4756 Ga0501039_0005097
4757 Ga0501039_0018526
4758 Ga0501039_0063229
4759 Ga0501039_0137830
4760 Ga0501039_0149638
4761 Ga0501040_0000302
4762 Ga0501040_0069994
4763 Ga0501041_0000776
4764 Ga0501041_0036218
4765 Ga0501041_0050856
4766 Ga0501042_0032113
4767 Ga0501042_0168987
4768 Ga0501043_0017849
4769 Ga0501043_0133179
4770 Ga0501043_0192910
4771 Ga0501046_0000992
4772 Ga0501046_0012729
4773 Ga0501046_0032554
4774 Ga0501046_0082316
4775 Ga0501046_0090716
4776 Ga0501047_0006878
4777 Ga0501047_0055369
4778 Ga0501047_0066749
4779 Ga0501047_0068994
4780 Ga0501047_0072955
4781 Ga0501047_0074314
4782 Ga0501047_0091627
4783 Ga0501048_0002096
4784 Ga0501048_0025493
4785 Ga0501048_0062367
4786 Ga0501067_0015302
4787 Ga0501067_0049784
4788 Ga0501068_0057009
4789 Ga0501068_0059842
4790 Ga0501068_0063195
4791 Ga0501068_0106085
4792 Ga0501069_0000753
4793 Ga0501069_0002492
4794 Ga0501069_0020064
4795 Ga0501069_0023857
4796 Ga0501069_0087230
4797 Ga0501070_0001170
4798 Ga0501070_0004788
4799 Ga0501070_0007363
4800 Ga0501070_0027379
4801 Ga0501070_0037102
4802 Ga0501070_0063680
4803 Ga0501070_0171365
4804 Ga0501071_0005763
4805 Ga0501072_0002409
4806 Ga0501072_0021818
4807 Ga0501072_0030616
4808 Ga0501072_0213969
4809 Ga0501073_0005923
4810 Ga0501073_0007998
4811 Ga0501073_0009999
4812 Ga0501073_0167617
4813 Ga0501074_0000574
4814 Ga0501074_0005553
4815 Ga0501074_0032692
4816 Ga0501074_0034148
4817 Ga0501074_0088725
4818 Ga0501074_0130966
4819 Ga0501075_0000045
4820 Ga0501075_0006755
4821 Ga0501075_0010485
4822 Ga0501075_0043416
4823 Ga0501075_0067208
4824 Ga0501076_0000394
4825 Ga0501076_0001383
4826 Ga0501076_0003698
4827 Ga0501077_0000629
4828 Ga0501077_0037063
4829 Ga0501217_018736
4830 Ga0501079_0000771
4831 Ga0501079_0003366
4832 Ga0501079_0020434
4833 Ga0501079_0023207
4834 Ga0501079_0026665
4835 Ga0501079_0110325
4836 Ga0501080_0009055
4837 Ga0501080_0009317
4838 Ga0501080_0011191
4839 Ga0501080_0021145
4840 Ga0501080_0038140
4841 Ga0501080_0045623
4842 Ga0501080_0059134
4843 Ga0501080_0073094
4844 Ga0501080_0121069
4845 Ga0501080_0129611
4846 Ga0501081_0001457
4847 Ga0501081_0002316
4848 Ga0501081_0002657
4849 Ga0501081_0022931
4850 Ga0501081_0147533
4851 Ga0501083_0005518
4852 Ga0501083_0072056
4853 Ga0501035_0001502
4854 Ga0501035_0003296
4855 Ga0501035_0013856
4856 Ga0501035_0055851
4857 Ga0501035_0103110
4858 Ga0501035_0161886
4859 Ga0501035_0165034
4860 Ga0501044_0005438
4861 Ga0501044_0005924
4862 Ga0501044_0009435
4863 Ga0501044_0032581
4864 Ga0501044_0041563
4865 Ga0501044_0043991
4866 Ga0501044_0044170
4867 Ga0501044_0047523
4868 Ga0501044_0057579
4869 Ga0501044_0063388
4870 Ga0501044_0064532
4871 Ga0501044_0080009
4872 Ga0501044_0101395
4873 Ga0501044_0129701
4874 Ga0501044_0138081
4875 Ga0501044_0170287
4876 Ga0501045_0001370
4877 Ga0501045_0013789
4878 Ga0501045_0040278
4879 Ga0501045_0064785
4880 Ga0501045_0170995
4881 nmdc:mga03683_44495_c1
4882 nmdc:mga03n38_41650_c1
4883 nmdc:mga00v17_14534_c1
4884 nmdc:mga00v17_50376_c1
4885 nmdc:mga0yw44_23947_c1
4886 nmdc:mga0yw44_98522_c1
4887 nmdc:mga0k408_11361_c1
4888 nmdc:mga0k408_4350_c1
4889 nmdc:mga0k408_47203_c1
4890 nmdc:mga0k408_51080_c1
4891 nmdc:mga0k408_5246_c1
4892 nmdc:mga0k408_55909_c1
4893 nmdc:mga06z11_26354_c1
4894 nmdc:mga06z11_3297_c1
4895 nmdc:mga06z11_7489_c1
4896 nmdc:mga04h51_615_c1
4897 nmdc:mga07m45_20783_c1
4898 nmdc:mga07m45_3394_c1
4899 nmdc:mga07m45_66050_c1
4900 nmdc:mga07m45_6981_c2
4901 nmdc:mga07m45_9756_c1
4902 nmdc:mga05p37_11294_c1
4903 nmdc:mga05p37_181569_c1
4904 nmdc:mga05p37_223699_c1
4905 nmdc:mga05p37_228563_c1
4906 nmdc:mga05p37_3076_c1
4907 nmdc:mga05p37_48136_c2
4908 nmdc:mga05p37_5061_c2
4909 nmdc:mga05p37_61459_c1
4910 nmdc:mga09592_1195_c1
4911 nmdc:mga09592_128738_c1
4912 nmdc:mga09592_158136_c1
4913 nmdc:mga09592_315_c1
4914 nmdc:mga0qj67_173074_c1
4915 nmdc:mga0qj67_24464_c1
4916 nmdc:mga0qj67_29101_c1
4917 nmdc:mga0qj67_30531_c1
4918 nmdc:mga0qj67_38505_c1
4919 nmdc:mga0qj67_47246_c1
4920 nmdc:mga0qj67_52587_c1
4921 nmdc:mga0qj67_64958_c1
4922 nmdc:mga0qj67_8966_c1
4923 nmdc:mga06r32_315564_c1
4924 nmdc:mga06r32_4869_c1
4925 nmdc:mga06r32_74946_c1
4926 nmdc:mga06r32_8310_c1
4927 nmdc:mga06r32_93662_c1
4928 nmdc:mga08y16_147_c1
4929 nmdc:mga08y16_148913_c1
4930 nmdc:mga08y16_19131_c1
4931 nmdc:mga08y16_221015_c1
4932 nmdc:mga08y16_23263_c1
4933 nmdc:mga08y16_262278_c1
4934 nmdc:mga08y16_29925_c1
4935 nmdc:mga08y16_303975_c1
4936 nmdc:mga08y16_317431_c1
4937 nmdc:mga08y16_334982_c1
4938 nmdc:mga08y16_59193_c1
4939 nmdc:mga0n895_1137_c1
4940 nmdc:mga0n895_114457_c1
4941 nmdc:mga0n895_1601_c1
4942 nmdc:mga0n895_19648_c1
4943 nmdc:mga0n895_219621_c1
4944 nmdc:mga0n895_281803_c1
4945 nmdc:mga0n895_283645_c1
4946 nmdc:mga0n895_79545_c1
4947 nmdc:mga0rr50_1387_c1
4948 nmdc:mga0rr50_15574_c1
4949 nmdc:mga0rr50_9578_c1
4950 nmdc:mga08x19_101351_c1
4951 nmdc:mga08x19_111334_c1
4952 nmdc:mga08x19_15247_c1
4953 nmdc:mga08x19_20153_c1
4954 nmdc:mga08x19_38857_c1
4955 nmdc:mga08x19_52035_c1
4956 nmdc:mga08x19_60938_c1
4957 nmdc:mga08x19_9079_c1
4958 nmdc:mga0a205_4178_c1
4959 nmdc:mga0a205_44270_c1
4960 nmdc:mga0a205_56652_c1
4961 nmdc:mga0a205_71885_c1
4962 nmdc:mga0a205_91052_c1
4963 nmdc:mga0sz30_6728_c1
4964 Ga0495601_0000024
4965 Ga0495601_0011833
4966 Ga0495601_0052433
4967 Ga0495601_0103852
4968 Ga0495612_0000079
4969 Ga0495612_0009187
4970 Ga0500610_0000484
4971 Ga0500610_0000504
4972 Ga0495595_0000036
4973 Ga0495595_0004673
4974 Ga0495619_0000034
4975 Ga0495619_0007830
4976 Ga0495619_0091938
4977 Ga0495619_0235971
4978 Ga0500578_0000085
4979 Ga0500644_0000705
4980 Ga0500651_0002090
4981 Ga0500566_0027781
4982 Ga0500641_0015280
4983 Ga0500562_010957
4984 Ga0500642_0034477
4985 Ga0500652_000572
4986 Ga0500616_0067300
4987 Ga0500616_0109324
4988 Ga0500622_0000080
4989 Ga0500622_0012388
4990 Ga0500627_0001388
4991 Ga0500636_0166844
4992 Ga0500637_0034605
4993 Ga0500637_0047688
4994 Ga0501084_0002016
4995 Ga0501084_0006846
4996 Ga0501084_0053845
4997 Ga0501084_0057188
4998 Ga0501084_0114557
4999 Ga0501084_0118613
5000 Ga0501084_0201797
5001 Ga0500661_000179
5002 Ga0590075_006645
5003 Ga0590077_003920
5004 Ga0501082_0021180
5005 Ga0501082_0040245
5006 Ga0501082_0058469
5007 Ga0501082_0104768
5008 Ga0501082_0116984
5009 Ga0501082_0247636
5010 Ga0530510_0000797
5011 Ga0530510_0004236
5012 2511242759
5013 2512345957
5014 2512730932
5015 2513952496
5016 2514041626
5017 2515684053
5018 2515689306
5019 2516018685
5020 2524187173
5021 2558906548
5022 2587726639
5023 2587733302
5024 2587737476
5025 2588290900
5026 2595317840
5027 2599904766
5028 2643861309
5029 2643968574
5030 2643983092
5031 2644120576
5032 2644142897
5033 2644275052
5034 2644301462
5035 2644728641
5036 2644747271
5037 2673821512
5038 2712469910
5039 2723876951
5040 2738745014
5041 2739354244
5042 2746091203
5043 2746097636
5044 2792839419
5045 2809032861
5046 2816507483
5047 2828305918
5048 2828306077
5049 2829749646
5050 2834644249
5051 2836164194
5052 2841761990
5053 2841911893
5054 2841921346
5055 2842332292
5056 2842356537
5057 2842460871
5058 2844105015
5059 2851183500
5060 2851248003
5061 2855736562
5062 2855773499
5063 2857478449
5064 2857540671
5065 2857543454
5066 2858692510
5067 2858956312
5068 2863073249
5069 2881418506
5070 2881930680
5071 2883090215
5072 2883579285
5073 2885198050
5074 2885277959
5075 2888580759
5076 2889050568
5077 2889307427
5078 2889791972
5079 2894776130
5080 2899278936
5081 2899370595
5082 2902688414
5083 2904452146
5084 2904458708
5085 2904621609
5086 2908673454
5087 2919429094
5088 2925331838
5089 2929523317
5090 2945976041
5091 2945987415
5092 2954771231
5093 3001272272
5094 3007808846
5095 643601374
5096 644750889
5097 8003401958
5098 8045867027
5099 8054804009
5100 8055637477
5101 8057529846
5102 8057733644

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04295

GD_AH_second

D-galactarate dehydratase/Altronate hydrolase, second domain

46

171

0.98

PF20629

GD_AH_C

D-galactarate/Altronate dehydratase, C-terminal

180

426

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6u7l-assembly2.cif.gz_D 2.75 angstrom crystal structure of galactarate dehydratase from escherichia coli. 0.8662 1 382
6u7l-assembly1.cif.gz_A 2.75 angstrom crystal structure of galactarate dehydratase from escherichia coli. 0.8578 5 382
6u7l-assembly2.cif.gz_C 2.75 angstrom crystal structure of galactarate dehydratase from escherichia coli. 0.8577 1 382
6u7l-assembly1.cif.gz_B 2.75 angstrom crystal structure of galactarate dehydratase from escherichia coli. 0.8519 5 382
6u7l-assembly2.cif.gz_D 2.75 angstrom crystal structure of galactarate dehydratase from escherichia coli. 0.7718 1 382
ID Description Score Start End Superfamily
af_Q9VIG6_88_328_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.765 66 110 3.40.50.720
1yb1B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.6733 21 110 3.40.50.720
3o8qB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.6517 18 110 3.40.50.720
2ewmB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.6517 18 126 3.40.50.720
af_Q59RC4_2_267_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.6492 17 110 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2W5F9U5-F1-model_v4 deleted 0.998 8 135
AF-A0A6B1GNR9-F1-model_v4 UxaA family hydrolase 0.9968 8 126 GO:0016787
GO:0016829
GO:0019698
AF-A0A0F2SGY8-F1-model_v4 D-galactarate dehydratase 0.9968 6 122 GO:0016829
GO:0019698
AF-A0A836QDN6-F1-model_v4 D-galactarate dehydratase 0.9962 8 95 GO:0016829
GO:0019698
AF-A0A259D836-F1-model_v4 D-galactarate dehydratase 0.9947 5 145 GO:0016829
GO:0019698

Map