metagRoot

F496928

General Info

Members	Datasets	Scaffolds	Average Seq Length
2583	845	2418	199

Family's Representative Sequence

Representative Sequence	3300028381\|Ga0268264_10339836\|Ga0268264_103398362
Length	226
Sequence	MAKACRRTPGRPSCGCENDAPTPVTEPVMTQPRIAQIQRNTKETQIRVRVNLDGQGDAKLATGIGFFDHMLDQIARHGLIDLDIQAQGDLHIDGHHTVEDVGITLGQAFAAAVGDKKGIRRYGHAYVPLDEALSRVVIDFSGRPGLHMDVDFKAGAIGAFDTQLAFEFFQGFANHALVTLHIDNLKGDNAHHQCETIFKAFARALRFALEVDPRAADVIPSTKGSL

Samples

	Sample ID	Description	Type	Environment
1	2162886007	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1	Metagenome	Rhizosphere
2	2162886012	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1	Metagenome	Rhizosphere
3	2510065053	Pseudomonas sp. MOIL14HWK12:I1	Isolate	Rhizosphere
4	2510065055	Pseudomonas sp. MOIL14HWK12:I2	Isolate	Rhizosphere
5	2510065058	Pseudomonas oleovorans MOIL14HWK12	Isolate	Rhizosphere
6	2511231002	Polaromonas sp. CF318	Isolate	Rhizosphere
7	2511231006	Pseudomonas sp. GM17	Isolate	Nodule
8	2511231011	Pseudomonas sp. GM30	Isolate	Nodule
9	2511231023	Pseudomonas sp. GM80	Isolate	Nodule
10	2511231026	Herbaspirillum sp. YR522	Isolate	Rhizosphere
11	2511231031	Pseudomonas sp. GM16	Isolate	Nodule
12	2512047018	Pseudomonas chlororaphis chlororaphis GP72	Isolate	Rhizosphere
13	2513020051	Variovorax sp. CF313	Isolate	Rhizosphere
14	2554235341	Pseudomonas protegens CHA0	Isolate	Rhizosphere
15	2582580891	Pseudomonas chlororaphis YL-1	Isolate	Unclassified
16	2585428057	Methylibium sp. YR605	Isolate	Rhizosphere
17	2585428058	Methylibium sp. CF468	Isolate	Rhizosphere
18	2585428062	Methylibium sp. CF059	Isolate	Rhizosphere
19	2588253510	Rhizobacter sp. OV335	Isolate	Rhizosphere
20	2593339131	Bacillus sp. UNCCL81	Isolate	Unclassified
21	2597489887	Pseudomonas chlororaphis aureofaciens 30-84	Isolate	Rhizosphere
22	2599185155	Pseudomonas sp. NFACC10-1	Isolate	Rhizoplane
23	2599185160	Pseudomonas sp. NFPP25	Isolate	Rhizoplane
24	2599185161	Pseudomonas sp. NFPP09	Isolate	Rhizoplane
25	2599185162	Pseudomonas sp. NFPP10	Isolate	Rhizoplane
26	2599185163	Pseudomonas sp. NFPP12	Isolate	Rhizoplane
27	2599185164	Pseudomonas sp. NFPP13	Isolate	Rhizoplane
28	2599185165	Pseudomonas sp. NFPP18	Isolate	Rhizoplane
29	2599185166	Pseudomonas sp. NFPP08	Isolate	Rhizoplane
30	2599185168	Pseudomonas sp. NFPP05	Isolate	Rhizoplane
31	2599185181	Pseudomonas sp. NFPP17	Isolate	Rhizoplane
32	2599185182	Pseudomonas sp. NFPP19	Isolate	Rhizoplane
33	2599185185	Pseudomonas sp. NFPP07	Isolate	Rhizoplane
34	2599185186	Pseudomonas sp. NFPP15	Isolate	Rhizoplane
35	2599185214	Variovorax sp. NFACC26	Isolate	Rhizoplane
36	2599185226	Variovorax sp. NFACC27	Isolate	Rhizoplane
37	2599185227	Variovorax sp. NFACC28	Isolate	Rhizoplane
38	2599185229	Variovorax sp. NFACC29	Isolate	Endosphere
39	2599185257	Pseudomonas sp. NFACC41-3	Isolate	Rhizoplane
40	2599185307	Pseudomonas sp. NFACC02	Isolate	Rhizoplane
41	2599185356	Pseudomonas sp. NFPP14	Isolate	Rhizoplane
42	2600254931	Pseudomonas sp. NFIX28	Isolate	Rhizoplane
43	2600255283	Pseudomonas sp. NFR16	Isolate	Rhizoplane
44	2600255313	Pseudomonas sp. NFPP16	Isolate	Rhizoplane
45	2643221544	Pelomonas sp. Root1444	Isolate	Unclassified
46	2643221554	Duganella sp. Root1480D1	Isolate	Unclassified
47	2643221570	Acidovorax sp. Root568	Isolate	Unclassified
48	2643221585	Pelomonas sp. Root662	Isolate	Unclassified
49	2643221592	Rhizobacter sp. Root16D2	Isolate	Unclassified
50	2643221596	Acidovorax sp. Root70	Isolate	Unclassified
51	2643221603	Noviherbaspirillum sp. Root189	Isolate	Unclassified
52	2643221609	Acidovorax sp. Root217	Isolate	Unclassified
53	2643221611	Acidovorax sp. Root219	Isolate	Unclassified
54	2643221625	Rhizobacter sp. Root29	Isolate	Unclassified
55	2643221628	Variovorax sp. Root318D1	Isolate	Unclassified
56	2643221638	Duganella sp. Root336D2	Isolate	Unclassified
57	2643221639	Pelomonas sp. Root1217	Isolate	Unclassified
58	2643221644	Rhizobacter sp. Root1221	Isolate	Unclassified
59	2643221646	Pelomonas sp. Root1237	Isolate	Unclassified
60	2643221648	Rhizobacter sp. Root1238	Isolate	Unclassified
61	2643221652	Acidovorax sp. Root402	Isolate	Unclassified
62	2643221654	Rhizobacter sp. Root404	Isolate	Unclassified
63	2643221656	Pelomonas sp. Root405	Isolate	Unclassified
64	2643221658	Variovorax sp. Root411	Isolate	Unclassified
65	2643221660	Methylibium sp. Root1272	Isolate	Unclassified
66	2643221672	Variovorax sp. Root434	Isolate	Unclassified
67	2643221683	Variovorax sp. Root473	Isolate	Unclassified
68	2643221717	Acidovorax sp. Root267	Isolate	Unclassified
69	2667528171	Pseudomonas sp. NFPP22	Isolate	Rhizoplane
70	2671180172	Pseudomonas sp. NFIX51	Isolate	Rhizoplane
71	2687453129	Halotalea alkalilenta IHB B 13600	Isolate	Unclassified
72	2718217725	Pseudomonas fluorescens CREA-C16	Isolate	Rhizosphere
73	2721755523	Delftia sp. HK171	Isolate	Unclassified
74	2738541271	Pseudomonas sp. GV021	Isolate	Unclassified
75	2738541277	Variovorax sp. GV051	Isolate	Unclassified
76	2738541307	Variovorax sp. GV008	Isolate	Unclassified
77	2738541337	Pelomonas sp. BT06	Isolate	Unclassified
78	2738543012	Acidovorax sp. CF301	Isolate	Unclassified
79	2738543013	Variovorax sp. BT01	Isolate	Unclassified
80	2738543016	Pseudomonas sp. GV012	Isolate	Unclassified
81	2738543017	Bacillus sp. OV186	Isolate	Unclassified
82	2738543019	Variovorax sp. GV040	Isolate	Unclassified
83	2738543025	Pseudomonas sp. GV091	Isolate	Unclassified
84	2740892503	Pseudomonas chlororaphis piscium PCL1391	Isolate	Unclassified
85	2757320391	Bacillus sp. NFR08	Isolate	Rhizoplane
86	2773857672	Pseudomonas sp. 1766	Isolate	Unclassified
87	2773857673	Pseudomonas sp. 443	Isolate	Unclassified
88	2775507177	Bacillus sp. AFS055030	Isolate	Unclassified
89	2775507192	Bacillus sp. AFS041924	Isolate	Unclassified
90	2784132063	Pseudomonas sp. 424	Isolate	Unclassified
91	2808606386	Herbaspirillum sp. SJZ099	Isolate	Rhizosphere
92	2808606415	Herbaspirillum sp. SJZ130	Isolate	Rhizosphere
93	2808606419	Herbaspirillum sp. SJZ106	Isolate	Rhizosphere
94	2816332133	Acidovorax radicis 2721A	Isolate	Unclassified
95	2818991436	Collimonas arenae 515	Isolate	Unclassified
96	2818991446	Variovorax sp. 1180	Isolate	Unclassified
97	2818991456	Pseudomonas koreensis 3286	Isolate	Rhizosphere
98	2818991464	Pseudomonas protegens 3295	Isolate	Rhizosphere
99	2831265667	Variovorax guangxiensis DSM 27352	Isolate	Rhizosphere
100	2831864461	Roseateles noduli HZ7	Isolate	Nodule
101	2838054893	Variovorax guangxiensis 34/80	Isolate	Nodule
102	2839138175	Delftia acidovorans B15	Isolate	Rhizosphere
103	2842677519	Variovorax sp. R-72495	Isolate	Unclassified
104	2842733646	Variovorax sp. R-72446	Isolate	Unclassified
105	2844665904	Pseudomonas protegens H1F10C	Isolate	Unclassified
106	2852618963	Herbaspirillum sp. SJZ102	Isolate	Rhizosphere
107	2852657418	Pseudomonas sp. JAI115	Isolate	Rhizosphere
108	2857586860	Bacillus sp. R-71935	Isolate	Unclassified
109	2880230671	Pseudomonas fluorescens LBUM677	Isolate	Unclassified
110	2881101125	Ramlibacter rhizophilus CCTCC AB2015357	Isolate	Rhizosphere
111	2881412998	Achromobacter aloeverae AVA-1	Isolate	Unclassified
112	2885192300	Variovorax sp. MHTC-1	Isolate	Rhizosphere
113	2885198086	Variovorax sp. 679	Isolate	Unclassified
114	2885211737	Variovorax sp. 553	Isolate	Unclassified
115	2886848708	Mitsuaria sp. TWR114	Isolate	Rhizosphere
116	2894023352	Diaphorobacter ruginosibacter DSM 27467	Isolate	Nodule
117	2899924645	Variovorax sp. 369	Isolate	Unclassified
118	2904449895	Variovorax sp. 1763	Isolate	Rhizosphere
119	2904456579	Variovorax sp. 2002	Isolate	Unclassified
120	2904479285	Comamonas sediminis 4487	Isolate	Rhizosphere
121	2904518522	Pseudomonas fluorescens 4488	Isolate	Rhizosphere
122	2904541872	Variovorax sp. 1615	Isolate	Rhizosphere
123	2912963787	Pseudomonas sp. R32	Isolate	Rhizosphere
124	2917070673	Pseudomonas protegens CHA0	Isolate	Rhizosphere
125	2917832318	Pseudomonas rhizoryzae RY24	Isolate	Unclassified
126	2919125081	Pseudomonas psychrotolerans 1545	Isolate	Rhizosphere
127	2919462493	Variovorax sp. 3319	Isolate	Rhizosphere
128	2919704043	Hydrogenophaga palleronii 4249	Isolate	Unclassified
129	2923153595	Pseudomonas chlororaphis piscium PCL1391	Isolate	Unclassified
130	2928037797	Variovorax sp. 1126	Isolate	Unclassified
131	2928044640	Variovorax sp. 1128	Isolate	Unclassified
132	2928051484	Variovorax sp. 1133	Isolate	Unclassified
133	2928064002	Variovorax sp. 1140	Isolate	Rhizosphere
134	2928070936	Variovorax gossypii 1167	Isolate	Unclassified
135	2928084124	Variovorax paradoxus 1218	Isolate	Unclassified
136	2929160207	Variovorax sp. R-72349 Hybrid assembly	Isolate	Unclassified
137	2929520902	Variovorax beijingensis 502	Isolate	Unclassified
138	2935353572	Pseudomonas protegens TECH19	Isolate	Unclassified
139	2936340661	Gottfriedia acidiceleris 1-17	Isolate	Rhizosphere
140	2939631187	Ottowia thiooxydans 2709	Isolate	Rhizosphere
141	2945909444	Variovorax sp. CRF3-Va-1 W1I1	Isolate	Rhizosphere
142	2945945610	Variovorax paradoxus W1I18	Isolate	Rhizosphere
143	2945972063	Variovorax paradoxus W2I8	Isolate	Rhizosphere
144	2945984333	Variovorax sp. W2I14	Isolate	Rhizosphere
145	2954767861	Variovorax sp. TBS-050B	Isolate	Rhizosphere
146	2969304461	Pseudomonas sp. R84	Isolate	Rhizosphere
147	2974298342	Pseudomonas sp. SORGH_AS 211	Isolate	Unclassified
148	2984286254	Pseudomonas chlororaphis aurantiaca JD37	Isolate	Rhizosphere
149	2984499530	Pseudomonas sp. SORGH_AS199	Isolate	Aerial Root
150	2984504281	Pseudomonas psychrotolerans SORGH_AS201	Isolate	Aerial Root
151	2990710928	Acidovorax delafieldii SLBN-75	Isolate	Rhizosphere
152	3007395558	Pseudomonas chlororaphis PCL1601	Isolate	Rhizosphere
153	3007419365	Pseudomonas vanderleydeniana RW8P3	Isolate	Unclassified
154	3007614139	Pseudomonas sp. PB106	Isolate	Unclassified
155	3007861166	Pseudomonas hamedanensis SWRI65	Isolate	Rhizosphere
156	3007872151	Pseudomonas sp. SWRI51	Isolate	Rhizosphere
157	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
158	3300002077	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3	Metagenome	Rhizosphere
159	3300002704	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB	Metagenome	Unclassified
160	3300002705	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS	Metagenome	Unclassified
161	3300002737	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA	Metagenome	Endosphere
162	3300002738	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA	Metagenome	Unclassified
163	3300002739	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA	Metagenome	Endosphere
164	3300002741	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL	Metagenome	Unclassified
165	3300002772	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS	Metagenome	Endosphere
166	3300002773	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS	Metagenome	Endosphere
167	3300002774	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA	Metagenome	Endosphere
168	3300002987	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB	Metagenome	Endosphere
169	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
170	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
171	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
172	3300003316	Sugarcane root Sample L1	Metagenome	Unclassified
173	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
174	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
175	3300003374	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF	Metagenome	Endosphere
176	3300003544	Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
177	3300003574	Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
178	3300003575	Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
179	3300003577	Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
180	3300003578	Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Unclassified
181	3300003611	Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_27 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
182	3300003693	Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
183	3300003751	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2	Metagenome	Endosphere
184	3300003752	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2	Metagenome	Endosphere
185	3300003756	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2	Metagenome	Endosphere
186	3300003758	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2	Metagenome	Endosphere
187	3300003759	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2	Metagenome	Endosphere
188	3300003761	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2	Metagenome	Endosphere
189	3300003762	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2	Metagenome	Endosphere
190	3300003763	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2	Metagenome	Endosphere
191	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
192	3300003773	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2	Metagenome	Endosphere
193	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
194	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
195	3300003784	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2	Metagenome	Endosphere
196	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
197	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
198	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
199	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
200	3300003841	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2	Metagenome	Endosphere
201	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
202	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
203	3300005288	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
204	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
205	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
206	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
207	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
208	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
209	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
210	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
211	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
212	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
213	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
214	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
215	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
216	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
217	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
218	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
219	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
220	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
221	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
222	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
223	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
224	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
225	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
226	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
227	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
228	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
229	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
230	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
231	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
232	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
233	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
234	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
235	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
236	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
237	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
238	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
239	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
240	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
241	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
242	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
243	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
244	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
245	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
246	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
247	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
248	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
249	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
250	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
251	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
252	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
253	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
254	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
255	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
256	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
257	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
258	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
259	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
260	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
261	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
262	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
263	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
264	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
265	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
266	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
267	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
268	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
269	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
270	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
271	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
272	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
273	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
274	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
275	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
276	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
277	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
278	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
279	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
280	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
281	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
282	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
283	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
284	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
285	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
286	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
287	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
288	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
289	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
290	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
291	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
292	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
293	3300006944	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW	Metagenome	Nodule
294	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
295	3300006948	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15	Metagenome	Nodule
296	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
297	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
298	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
299	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
300	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
301	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
302	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
303	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
304	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
305	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
306	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
307	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
308	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
309	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
310	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
311	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
312	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
313	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
314	3300012497	Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510	Metagenome	Rhizosphere
315	3300012502	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610	Metagenome	Rhizosphere
316	3300012505	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610	Metagenome	Rhizosphere
317	3300012506	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610	Metagenome	Rhizosphere
318	3300012512	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510	Metagenome	Rhizosphere
319	3300012513	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510	Metagenome	Rhizosphere
320	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
321	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
322	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
323	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
324	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
325	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
326	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
327	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
328	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
329	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
330	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
331	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
332	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
333	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
334	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
335	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
336	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
337	3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Metagenome	Rhizosphere
338	3300015683	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04	Metagenome	Rhizosphere
339	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
340	3300020077	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
341	3300021358	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3	Metagenome	Rhizosphere
342	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
343	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
344	3300025206	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2)	Metagenome	Unclassified
345	3300025207	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
346	3300025208	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
347	3300025224	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
348	3300025225	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
349	3300025226	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
350	3300025228	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
351	3300025229	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
352	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
353	3300025231	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
354	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
355	3300025242	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
356	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
357	3300025246	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2)	Metagenome	Unclassified
358	3300025250	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2)	Metagenome	Unclassified
359	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
360	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
361	3300025256	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2)	Metagenome	Unclassified
362	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
363	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
364	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
365	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
366	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
367	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
368	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
369	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
370	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
371	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
372	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
373	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
374	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
375	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
376	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
377	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
378	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
379	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
380	3300025711	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
381	3300025728	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
382	3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
383	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
384	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
385	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
386	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
387	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
388	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
389	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
390	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
391	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
392	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
393	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
394	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
395	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
396	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
397	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
398	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
399	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
400	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
401	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
402	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
403	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
404	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
405	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
406	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
407	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
408	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
409	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
410	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
411	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
412	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
413	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
414	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
415	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
416	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
417	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
418	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
419	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
420	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
421	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
422	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
423	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
424	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
425	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
426	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
427	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
428	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
429	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
430	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
431	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
432	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
433	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
434	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
435	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
436	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
437	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
438	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
439	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
440	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
441	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
442	3300027312	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2)	Metagenome	Rhizosphere
443	3300027378	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2)	Metagenome	Rhizosphere
444	3300027614	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
445	3300027617	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
446	3300027665	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
447	3300027666	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2)	Metagenome	Nodule
448	3300027682	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
449	3300027695	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2)	Metagenome	Rhizosphere
450	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
451	3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
452	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
453	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
454	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
455	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
456	3300028563	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG	Metagenome	Rhizosphere
457	3300028666	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG	Metagenome	Rhizosphere
458	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
459	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
460	3300029957	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG	Metagenome	Rhizosphere
461	3300030500	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3)	Metagenome	Rhizosphere
462	3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Metagenome	Unclassified
463	3300030522	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM	Metagenome	Unclassified
464	3300030731	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3	Metagenome	Rhizosphere
465	3300030733	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2	Metagenome	Rhizosphere
466	3300030736	Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6	Metagenome	Rhizosphere
467	3300030744	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7	Metagenome	Rhizosphere
468	3300030745	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8	Metagenome	Rhizosphere
469	3300031242	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG	Metagenome	Rhizosphere
470	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
471	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
472	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
473	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
474	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
475	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
476	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
477	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
478	3300031649	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM	Metagenome	Unclassified
479	3300031665	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3	Metagenome	Rhizosphere
480	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
481	3300031728	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC	Metagenome	Rhizosphere
482	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
483	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
484	3300031733	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1	Metagenome	Rhizosphere
485	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
486	3300031838	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM	Metagenome	Unclassified
487	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
488	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
489	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
490	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
491	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
492	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
493	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
494	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
495	3300032168	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
496	3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Metagenome	Unclassified
497	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
498	3300033541	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
499	3300034816	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3	Metagenome	Rhizosphere
500	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
501	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
502	3300035088	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4	Metagenome	Rhizosphere
503	3300035089	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2	Metagenome	Rhizosphere
504	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
505	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
506	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
507	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
508	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
509	3300035120	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5	Metagenome	Rhizosphere
510	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
511	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
512	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
513	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
514	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
515	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
516	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
517	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
518	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
519	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
520	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
521	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
522	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
523	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
524	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
525	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
526	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
527	3300038725	Seagrass microbial communities from Seahorse Key, FL, USA - HV0818	Metagenome	Unclassified
528	3300038726	Seagrass microbial communities from Seahorse Key, FL, USA - TH0319	Metagenome	Unclassified
529	3300038727	Seagrass microbial communities from Seahorse Key, FL, USA - TV0818	Metagenome	Unclassified
530	3300038735	Seagrass microbial communities from Seahorse Key, FL, USA - SH0319	Metagenome	Unclassified
531	3300038742	Seagrass microbial communities from Seahorse Key, FL, USA - SH0818	Metagenome	Unclassified
532	3300039062	Seagrass microbial communities from Seahorse Key, FL, USA - HH0818	Metagenome	Unclassified
533	3300039110	Seagrass microbial communities from Seahorse Key, FL, USA - SV0319	Metagenome	Unclassified
534	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
535	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
536	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
537	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
538	3300041404	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272	Metagenome	Rhizosphere
539	3300041406	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284	Metagenome	Rhizosphere
540	3300041407	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416	Metagenome	Rhizosphere
541	3300041410	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596	Metagenome	Rhizosphere
542	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
543	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
544	3300041452	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG	Metagenome	Rhizoplane
545	3300041456	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG	Metagenome	Rhizoplane
546	3300041459	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG	Metagenome	Rhizoplane
547	3300041460	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG	Metagenome	Rhizoplane
548	3300041486	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG	Metagenome	Rhizoplane
549	3300041491	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG	Metagenome	Unclassified
550	3300041496	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG	Metagenome	Unclassified
551	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
552	3300041997	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607	Metagenome	Rhizosphere
553	3300041999	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297	Metagenome	Rhizosphere
554	3300042000	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539	Metagenome	Rhizosphere
555	3300042002	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616	Metagenome	Rhizosphere
556	3300042004	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619	Metagenome	Rhizosphere
557	3300042005	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216	Metagenome	Rhizosphere
558	3300042006	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437	Metagenome	Rhizosphere
559	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
560	3300042010	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431	Metagenome	Rhizosphere
561	3300042011	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204	Metagenome	Rhizosphere
562	3300042012	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213	Metagenome	Rhizosphere
563	3300042014	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275	Metagenome	Rhizosphere
564	3300042015	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287	Metagenome	Rhizosphere
565	3300042115	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642	Metagenome	Rhizosphere
566	3300042117	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937	Metagenome	Rhizosphere
567	3300042120	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192	Metagenome	Rhizosphere
568	3300042121	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398	Metagenome	Rhizosphere
569	3300042125	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472	Metagenome	Rhizosphere
570	3300042126	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87	Metagenome	Rhizosphere
571	3300042127	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91	Metagenome	Rhizosphere
572	3300042131	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130	Metagenome	Rhizosphere
573	3300042133	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134	Metagenome	Rhizosphere
574	3300042137	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519	Metagenome	Rhizosphere
575	3300042139	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442	Metagenome	Rhizosphere
576	3300042142	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610	Metagenome	Rhizosphere
577	3300042144	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89	Metagenome	Rhizosphere
578	3300042145	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581	Metagenome	Rhizosphere
579	3300042147	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618	Metagenome	Rhizosphere
580	3300042156	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593	Metagenome	Rhizosphere
581	3300042157	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210	Metagenome	Rhizosphere
582	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
583	3300042438	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533	Metagenome	Rhizosphere
584	3300042439	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363	Metagenome	Rhizosphere
585	3300042461	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366	Metagenome	Rhizosphere
586	3300042531	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253	Metagenome	Rhizosphere
587	3300042532	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92	Metagenome	Rhizosphere
588	3300042533	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472	Metagenome	Rhizosphere
589	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
590	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
591	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
592	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
593	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
594	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
595	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
596	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
597	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
598	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
599	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
600	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
601	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
602	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
603	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
604	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
605	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
606	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
607	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
608	3300046452	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere	Metagenome	Rhizosphere
609	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
610	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
611	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
612	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
613	3300046458	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere	Metagenome	Rhizosphere
614	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
615	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
616	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
617	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
618	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
619	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
620	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
621	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
622	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
623	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
624	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
625	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
626	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
627	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
628	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
629	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
630	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
631	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
632	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
633	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
634	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
635	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
636	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
637	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
638	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
639	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
640	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
641	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
642	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
643	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
644	3300046525	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere	Metagenome	Rhizosphere
645	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
646	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
647	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
648	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
649	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
650	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
651	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
652	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
653	3300046537	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere	Metagenome	Rhizosphere
654	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
655	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
656	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
657	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
658	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
659	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
660	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
661	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
662	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
663	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
664	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
665	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
666	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
667	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
668	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
669	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
670	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
671	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
672	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
673	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
674	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
675	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
676	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
677	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
678	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
679	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
680	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
681	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
682	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
683	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
684	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
685	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
686	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
687	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
688	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
689	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
690	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
691	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
692	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
693	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
694	3300047446	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere	Metagenome	Rhizosphere
695	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
696	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
697	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
698	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
699	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
700	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
701	3300048090	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere	Metagenome	Rhizosphere
702	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
703	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
704	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
705	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
706	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
707	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
708	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
709	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
710	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
711	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
712	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
713	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
714	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
715	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
716	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
717	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
718	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
719	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
720	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
721	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
722	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
723	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
724	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
725	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
726	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
727	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
728	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
729	3300049128	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
730	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
731	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
732	3300049515	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought	Metagenome	Rhizosphere
733	3300049521	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought	Metagenome	Rhizosphere
734	3300049523	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control	Metagenome	Rhizosphere
735	3300049527	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
736	3300049534	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
737	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
738	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
739	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
740	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
741	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
742	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
743	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
744	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
745	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
746	3300049649	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought	Metagenome	Rhizosphere
747	3300049653	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control	Metagenome	Rhizosphere
748	3300049654	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control	Metagenome	Rhizosphere
749	3300049655	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought	Metagenome	Rhizosphere
750	3300049658	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought	Metagenome	Rhizosphere
751	3300049661	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control	Metagenome	Rhizosphere
752	3300049662	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control	Metagenome	Rhizosphere
753	3300049663	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought	Metagenome	Rhizosphere
754	3300049665	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought	Metagenome	Rhizosphere
755	3300049679	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought	Metagenome	Rhizosphere
756	3300049686	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control	Metagenome	Rhizosphere
757	3300049705	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought	Metagenome	Rhizosphere
758	3300049706	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control	Metagenome	Rhizosphere
759	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
760	3300049757	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control	Metagenome	Rhizosphere
761	3300049762	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control	Metagenome	Rhizosphere
762	3300049766	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought	Metagenome	Rhizosphere
763	3300049777	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control	Metagenome	Rhizosphere
764	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
765	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
766	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
767	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
768	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
769	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
770	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
771	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
772	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
773	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
774	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
775	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
776	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
777	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
778	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
779	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
780	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
781	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
782	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
783	3300053079	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere	Metagenome	Endosphere
784	3300053080	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere	Metagenome	Endosphere
785	3300053083	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere	Metagenome	Rhizosphere
786	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
787	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
788	3300053086	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere	Metagenome	Endosphere
789	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
790	3300053088	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere	Metagenome	Endosphere
791	3300053092	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere	Metagenome	Endosphere
792	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
793	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
794	3300053098	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere	Metagenome	Endosphere
795	3300053108	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere	Metagenome	Endosphere
796	3300053110	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere	Metagenome	Endosphere
797	3300053117	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere	Metagenome	Endosphere
798	3300053121	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere	Metagenome	Endosphere
799	3300053122	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere	Metagenome	Endosphere
800	3300053125	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere	Metagenome	Endosphere
801	3300053131	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere	Metagenome	Endosphere
802	3300053133	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere	Metagenome	Endosphere
803	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
804	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
805	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
806	3300053141	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere	Metagenome	Endosphere
807	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
808	3300053154	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere	Metagenome	Endosphere
809	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
810	3300053158	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere	Metagenome	Endosphere
811	3300053161	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere	Metagenome	Endosphere
812	3300053724	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere	Metagenome	Endosphere
813	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
814	3300059421	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
815	3300059424	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
816	3300059492	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
817	3300059493	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
818	3300059503	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
819	3300059508	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
820	3300059510	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
821	3300059511	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
822	3300059513	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
823	3300059604	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
824	3300059608	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
825	3300059623	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
826	3300059639	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
827	3300059640	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
828	3300059641	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
829	3300059645	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
830	3300059647	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
831	3300059651	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
832	3300060346	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
833	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
834	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
835	637000220	Pseudomonas protegens Pf-5	Isolate	Rhizoplane
836	8011350971	Pseudomonas sp. 30_B	Isolate	Rhizosphere
837	8015687852	Pseudomonas chlororaphis aurantiaca RP4	Isolate	Rhizosphere
838	8016728285	Pseudomonas psychrotolerans SORGH_AS 227	Isolate	Unclassified
839	8019769354	Pseudomonas sp. MSSRFD41	Isolate	Rhizosphere
840	8047673197	Telluria mixta LMG 11547	Isolate	Rhizosphere
841	8055770955	Pseudomonas chlororaphis qlu-1	Isolate	Rhizosphere
842	8056172158	Pseudomonas ekonensis COR58	Isolate	Rhizosphere
843	8056569372	Pseudomonas serboccidentalis IT-P374	Isolate	Rhizosphere
844	8057160832	Larsenimonas rhizosphaerae GH2-1	Isolate	Rhizosphere
845	8057798959	Pseudomonas piscis BW16M1	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	92.26
Metatranscriptomes	1.36
Isolates	6.39

Biome Distribution

Category	Percentage (%)
Aerial Root	0.08
Bulb	0
Endosphere	18.47
Nodule	0.74
Rhizoplane	3.95
Rhizosphere	67.67
Stem	0
Stem Tuber	0
Unclassified	9.1

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	SwRhRL2b_contig_3690358	2162886007	Bacteria	1441
2	MBSR1b_contig_5927048	2162886012	Bacteria	1005
3	JGI24740J21852_10003858	3300001979	Bacteria	6506
4	JGI24740J21852_10018769	3300001979	Bacteria	2446
5	JGI24744J21845_10018634	3300002077	Bacteria	1375
6	JGI25155J39150_1000022	3300002704	Bacteria	142950
7	JGI25156J39149_1000005	3300002705	Bacteria	263980
8	JGI25156J39149_1000403	3300002705	Bacteria	27092
9	JGI25156J39149_1017222	3300002705	Bacteria	1376
10	JGI25156J39149_1025159	3300002705	Bacteria	961
11	JGI25162J39368_1000040	3300002737	Bacteria	175938
12	JGI25162J39368_1000098	3300002737	Bacteria	95821
13	JGI25162J39368_1000129	3300002737	Bacteria	83712
14	JGI25154J39366_1000017	3300002738	Bacteria	252448
15	JGI25154J39366_1001215	3300002738	Bacteria	9751
16	JGI25158J39367_1001690	3300002739	Bacteria	3788
17	JGI25158J39367_1002842	3300002739	Bacteria	2746
18	JGI25158J39367_1005105	3300002739	Bacteria	1939
19	JGI25157J39369_1000003	3300002741	Bacteria	274935
20	JGI25157J39369_1000008	3300002741	Bacteria	211083
21	JGI25164J39214_1000076	3300002772	Bacteria	95821
22	JGI25164J39214_1000101	3300002772	Bacteria	83715
23	JGI25164J39214_1004161	3300002772	Bacteria	1701
24	JGI25152J39213_1000516	3300002773	Bacteria	21501
25	JGI25152J39213_1004641	3300002773	Bacteria	4263
26	JGI25152J39213_1022434	3300002773	Bacteria	1091
27	JGI25150J39212_1005216	3300002774	Bacteria	2799
28	JGI25150J39212_1007128	3300002774	Bacteria	2264
29	JGI25150J39212_1009905	3300002774	Bacteria	1794
30	JGI25159J45721_1000561	3300002987	Bacteria	16704
31	JGI25159J45721_1001840	3300002987	Bacteria	8476
32	JGI25159J45721_1005446	3300002987	Bacteria	3995
33	JGI25159J45721_1009878	3300002987	Bacteria	2481
34	JGI25159J45721_1019835	3300002987	Bacteria	1312
35	JGI25151J46595_10001029	3300003187	Bacteria	20870
36	JGI25151J46595_10002886	3300003187	Bacteria	9872
37	JGI25151J46595_10003276	3300003187	Bacteria	9005
38	JGI25151J46595_10004893	3300003187	Bacteria	6996
39	JGI25151J46595_10004998	3300003187	Bacteria	6911
40	JGI25151J46595_10007286	3300003187	Bacteria	5442
41	JGI25165J46597_1000051	3300003214	Bacteria	241012
42	JGI25165J46597_1000150	3300003214	Bacteria	115430
43	JGI25165J46597_1000180	3300003214	Bacteria	95821
44	JGI25153J46596_10002374	3300003215	Bacteria	10904
45	JGI25153J46596_10003174	3300003215	Bacteria	9261
46	JGI25153J46596_10010237	3300003215	Bacteria	4260
47	JGI25153J46596_10024815	3300003215	Bacteria	2154
48	JGI25153J46596_10034417	3300003215	Bacteria	1656
49	JGI25153J46596_10066806	3300003215	Bacteria	949
50	rootH1_10011053	3300003316	Bacteria	7971
51	rootL2_10003476	3300003322	Bacteria	2370
52	rootL2_10003477	3300003322	Bacteria	7548
53	JGI25160J50197_1000691	3300003354	Bacteria	18646
54	JGI25160J50197_1008221	3300003354	Bacteria	3995
55	JGI25160J50197_1009957	3300003354	Bacteria	3479
56	JGI25160J50197_1013514	3300003354	Bacteria	2778
57	JGI25161J50226_1000095	3300003374	Bacteria	72343
58	JGI25161J50226_1002715	3300003374	Bacteria	4382
59	JGI25161J50226_1003084	3300003374	Bacteria	3978
60	Ga0007417J51691_1039383	3300003544	Bacteria	3583
61	Ga0007410J51695_1038032	3300003574	Bacteria	731
62	Ga0007410J51695_1046628	3300003574	Bacteria	2658
63	Ga0007409J51694_1014336	3300003575	Bacteria	2576
64	Ga0007409J51694_1026410	3300003575	Bacteria	6980
65	Ga0007416J51690_1028051	3300003577	Bacteria	4895
66	Ga0007416J51690_1049488	3300003577	Bacteria	840
67	Ga0006562J51391_1040310	3300003578	Bacteria	2860
68	Ga0006562J51391_1040314	3300003578	Bacteria	1260
69	Ga0007411J51799_120039	3300003611	Bacteria	800
70	Ga0032354_1041297	3300003693	Bacteria	5433
71	Ga0055538_1000025	3300003751	Bacteria	241012
72	Ga0055539_1000032	3300003752	Bacteria	241012
73	Ga0055539_1000255	3300003752	Bacteria	34096
74	Ga0055539_1002085	3300003752	Bacteria	3261
75	Ga0055533_1000040	3300003756	Bacteria	242927
76	Ga0055533_1000042	3300003756	Bacteria	241012
77	Ga0055532_1000004	3300003758	Bacteria	471824
78	Ga0055525_1000028	3300003759	Bacteria	331683
79	Ga0055525_1000031	3300003759	Bacteria	314909
80	Ga0055525_1000050	3300003759	Bacteria	241012
81	Ga0055525_1000815	3300003759	Bacteria	9593
82	Ga0055535_1000052	3300003761	Bacteria	132513
83	Ga0055535_1000966	3300003761	Bacteria	18756
84	Ga0055535_1013209	3300003761	Bacteria	1227
85	Ga0055542_1000080	3300003762	Bacteria	129634
86	Ga0055542_1008087	3300003762	Bacteria	2080
87	Ga0055529_1000053	3300003763	Bacteria	198996
88	Ga0055526_1002127	3300003771	Bacteria	13599
89	Ga0055526_1004387	3300003771	Bacteria	8507
90	Ga0055526_1008377	3300003771	Bacteria	5173
91	Ga0055526_1016604	3300003771	Bacteria	2866
92	Ga0055526_1020873	3300003771	Bacteria	2306
93	Ga0055526_1023266	3300003771	Bacteria	2074
94	Ga0055526_1024718	3300003771	Bacteria	1953
95	Ga0055537_1000150	3300003773	Bacteria	52097
96	Ga0055537_1000205	3300003773	Bacteria	44266
97	Ga0055537_1001935	3300003773	Bacteria	7404
98	Ga0055537_1005406	3300003773	Bacteria	3432
99	Ga0055537_1008735	3300003773	Bacteria	2306
100	Ga0055524_1000073	3300003775	Bacteria	123033
101	Ga0055524_1000247	3300003775	Bacteria	56379
102	Ga0055524_1000274	3300003775	Bacteria	51286
103	Ga0055524_1005814	3300003775	Bacteria	5447
104	Ga0055524_1005838	3300003775	Bacteria	5433
105	Ga0055524_1018272	3300003775	Bacteria	2441
106	Ga0055536_1000232	3300003781	Bacteria	44724
107	Ga0055536_1001456	3300003781	Bacteria	14231
108	Ga0055536_1005910	3300003781	Bacteria	5858
109	Ga0055536_1010264	3300003781	Bacteria	3742
110	Ga0055536_1019004	3300003781	Bacteria	2177
111	Ga0055534_1000016	3300003784	Bacteria	144444
112	Ga0055534_1003549	3300003784	Bacteria	4858
113	Ga0055534_1004167	3300003784	Bacteria	4276
114	Ga0055534_1005062	3300003784	Bacteria	3637
115	Ga0055534_1008144	3300003784	Bacteria	2408
116	Ga0055534_1013820	3300003784	Bacteria	1536
117	Ga0055528_1000894	3300003790	Bacteria	20125
118	Ga0055528_1002836	3300003790	Bacteria	9062
119	Ga0055528_1018968	3300003790	Bacteria	2306
120	Ga0055528_1045368	3300003790	Bacteria	937
121	Ga0055530_10000390	3300003791	Bacteria	39310
122	Ga0055530_10000848	3300003791	Bacteria	25191
123	Ga0055530_10005116	3300003791	Bacteria	6409
124	Ga0055530_10012347	3300003791	Bacteria	2988
125	Ga0055530_10017806	3300003791	Bacteria	2211
126	Ga0055530_10059012	3300003791	Bacteria	862
127	Ga0055540_1000037	3300003792	Bacteria	162957
128	Ga0055540_1000260	3300003792	Bacteria	47714
129	Ga0055540_1001014	3300003792	Bacteria	17999
130	Ga0055540_1004443	3300003792	Bacteria	6315
131	Ga0055540_1005600	3300003792	Bacteria	5227
132	Ga0055540_1005810	3300003792	Bacteria	5070
133	Ga0055540_1010345	3300003792	Bacteria	3115
134	Ga0055540_1011326	3300003792	Bacteria	2884
135	Ga0055540_1015724	3300003792	Bacteria	2186
136	Ga0055531_10000105	3300003794	Bacteria	91871
137	Ga0055531_10002177	3300003794	Bacteria	13374
138	Ga0055531_10006920	3300003794	Bacteria	6315
139	Ga0055531_10008464	3300003794	Bacteria	5415
140	Ga0055531_10010770	3300003794	Bacteria	4502
141	Ga0055531_10011977	3300003794	Bacteria	4122
142	Ga0055541_1000023	3300003841	Bacteria	241012
143	Ga0055543_1001829	3300004625	Bacteria	7793
144	Ga0055543_1009482	3300004625	Bacteria	2088
145	Ga0065165_1000170	3300005262	Bacteria	115389
146	Ga0065165_1000273	3300005262	Bacteria	87879
147	Ga0065165_1006524	3300005262	Bacteria	6083
148	Ga0065165_1032908	3300005262	Bacteria	1620
149	Ga0065165_1037216	3300005262	Bacteria	1476
150	Ga0065714_10006621	3300005288	Bacteria	4948
151	Ga0065714_10031694	3300005288	Bacteria	1103
152	Ga0065714_10187054	3300005288	Bacteria	941
153	Ga0065704_10097382	3300005289	Bacteria	2397
154	Ga0065704_10153173	3300005289	Bacteria	1412
155	Ga0065704_10158801	3300005289	Bacteria	1365
156	Ga0065704_10172773	3300005289	Bacteria	1281
157	Ga0065715_10133781	3300005293	Bacteria	1967
158	Ga0065715_10264815	3300005293	Bacteria	1127
159	Ga0065707_10317575	3300005295	Bacteria	972
160	Ga0070658_10024403	3300005327	Bacteria	4850
161	Ga0070658_10025395	3300005327	Bacteria	4750
162	Ga0070658_10049682	3300005327	Bacteria	3398
163	Ga0070658_10070483	3300005327	Bacteria	2862
164	Ga0070658_10076377	3300005327	Bacteria	2747
165	Ga0070658_10096762	3300005327	Bacteria	2437
166	Ga0070658_10312682	3300005327	Bacteria	1340
167	Ga0070658_10329856	3300005327	Bacteria	1304
168	Ga0070658_10414192	3300005327	Bacteria	1158
169	Ga0070658_10477454	3300005327	Bacteria	1076
170	Ga0070658_10800888	3300005327	Bacteria	819
171	Ga0070658_11102002	3300005327	Bacteria	691
172	Ga0070676_10014562	3300005328	Bacteria	4324
173	Ga0070676_10027314	3300005328	Bacteria	3236
174	Ga0070676_10102074	3300005328	Bacteria	1774
175	Ga0070676_10126351	3300005328	Bacteria	1612
176	Ga0070676_10178520	3300005328	Bacteria	1379
177	Ga0070676_10431646	3300005328	Bacteria	923
178	Ga0070683_100000027	3300005329	Bacteria	172200
179	Ga0070683_100200042	3300005329	Bacteria	1897
180	Ga0070683_100659333	3300005329	Bacteria	1002
181	Ga0070683_101401801	3300005329	Bacteria	672
182	Ga0070690_100049964	3300005330	Bacteria	2668
183	Ga0070690_100402343	3300005330	Bacteria	1006
184	Ga0070690_100818087	3300005330	Bacteria	723
185	Ga0070670_100000025	3300005331	Bacteria	188514
186	Ga0070670_100007799	3300005331	Bacteria	9108
187	Ga0070670_100040516	3300005331	Bacteria	4004
188	Ga0070670_100101803	3300005331	Bacteria	2473
189	Ga0070670_100220575	3300005331	Bacteria	1650
190	Ga0070670_100501288	3300005331	Bacteria	1079
191	Ga0070670_100504094	3300005331	Bacteria	1077
192	Ga0070670_100526883	3300005331	Bacteria	1052
193	Ga0070670_100579695	3300005331	Bacteria	1002
194	Ga0070677_10028276	3300005333	Bacteria	2117
195	Ga0070677_10109216	3300005333	Bacteria	1232
196	Ga0070677_10277695	3300005333	Bacteria	842
197	Ga0068869_100072077	3300005334	Bacteria	2559
198	Ga0068869_100090533	3300005334	Bacteria	2299
199	Ga0068869_100263376	3300005334	Bacteria	1381
200	Ga0068869_100290958	3300005334	Bacteria	1316
201	Ga0068869_100367700	3300005334	Bacteria	1176
202	Ga0068869_100778080	3300005334	Bacteria	821
203	Ga0070666_10039968	3300005335	Bacteria	3128
204	Ga0070666_10340008	3300005335	Bacteria	1073
205	Ga0070680_100061816	3300005336	Bacteria	3066
206	Ga0070680_100141917	3300005336	Bacteria	2015
207	Ga0070680_100686543	3300005336	Bacteria	881
208	Ga0070682_100000003	3300005337	Bacteria	469319
209	Ga0070682_100015834	3300005337	Bacteria	4376
210	Ga0070682_100411087	3300005337	Bacteria	1026
211	Ga0068868_100001474	3300005338	Bacteria	16252
212	Ga0068868_100003285	3300005338	Bacteria	11257
213	Ga0068868_100004641	3300005338	Bacteria	9646
214	Ga0068868_100050966	3300005338	Bacteria	3253
215	Ga0068868_100051527	3300005338	Bacteria	3238
216	Ga0068868_100073073	3300005338	Bacteria	2737
217	Ga0068868_100097187	3300005338	Bacteria	2379
218	Ga0068868_100225438	3300005338	Bacteria	1570
219	Ga0068868_100266363	3300005338	Bacteria	1446
220	Ga0070660_100027602	3300005339	Bacteria	4238
221	Ga0070660_100061097	3300005339	Bacteria	2925
222	Ga0070660_100515499	3300005339	Bacteria	995
223	Ga0070660_100547108	3300005339	Bacteria	965
224	Ga0070660_100548357	3300005339	Bacteria	964
225	Ga0070660_100587045	3300005339	Bacteria	931
226	Ga0070660_100587450	3300005339	Bacteria	930
227	Ga0070689_100000725	3300005340	Bacteria	20129
228	Ga0070691_10151862	3300005341	Bacteria	1188
229	Ga0070687_100095521	3300005343	Bacteria	1653
230	Ga0070687_100111868	3300005343	Bacteria	1547
231	Ga0070661_100000361	3300005344	Bacteria	35932
232	Ga0070661_100095429	3300005344	Bacteria	2206
233	Ga0070661_100127555	3300005344	Bacteria	1909
234	Ga0070661_100274651	3300005344	Bacteria	1306
235	Ga0070661_100384046	3300005344	Bacteria	1107
236	Ga0070668_100041330	3300005347	Bacteria	3532
237	Ga0070668_100229905	3300005347	Bacteria	1533
238	Ga0070668_100586801	3300005347	Bacteria	973
239	Ga0070669_100030898	3300005353	Bacteria	3866
240	Ga0070675_100000011	3300005354	Bacteria	242011
241	Ga0070675_100003086	3300005354	Bacteria	12588
242	Ga0070675_100034151	3300005354	Bacteria	4126
243	Ga0070675_100104884	3300005354	Bacteria	2385
244	Ga0070675_100262993	3300005354	Bacteria	1512
245	Ga0070675_100377327	3300005354	Bacteria	1261
246	Ga0070675_100587267	3300005354	Bacteria	1010
247	Ga0070675_100603934	3300005354	Bacteria	995
248	Ga0070671_100007825	3300005355	Bacteria	8540
249	Ga0070671_100076424	3300005355	Bacteria	2798
250	Ga0070671_100290449	3300005355	Bacteria	1391
251	Ga0070671_100292791	3300005355	Bacteria	1385
252	Ga0070671_100455580	3300005355	Bacteria	1098
253	Ga0070674_100049856	3300005356	Bacteria	2880
254	Ga0070674_100170126	3300005356	Bacteria	1660
255	Ga0070674_100803256	3300005356	Bacteria	812
256	Ga0070673_100009942	3300005364	Bacteria	6412
257	Ga0070673_100016285	3300005364	Bacteria	5252
258	Ga0070673_100068367	3300005364	Bacteria	2844
259	Ga0070673_100228207	3300005364	Unclassified	1614
260	Ga0070673_100469285	3300005364	Bacteria	1134
261	Ga0070659_100013243	3300005366	Bacteria	6133
262	Ga0070659_100047516	3300005366	Bacteria	3367
263	Ga0070659_100119560	3300005366	Bacteria	2132
264	Ga0070659_100165977	3300005366	Bacteria	1807
265	Ga0070659_100406868	3300005366	Bacteria	1149
266	Ga0070667_100000616	3300005367	Bacteria	34708
267	Ga0070667_100017969	3300005367	Bacteria	5862
268	Ga0070667_100150957	3300005367	Bacteria	2041
269	Ga0070667_100163538	3300005367	Bacteria	1961
270	Ga0070667_100199658	3300005367	Bacteria	1774
271	Ga0070709_10292685	3300005434	Bacteria	1187
272	Ga0070714_100189244	3300005435	Bacteria	1877
273	Ga0070701_10015145	3300005438	Bacteria	3553
274	Ga0070711_100000825	3300005439	Bacteria	16220
275	Ga0070700_100000016	3300005441	Bacteria	147213
276	Ga0070700_100042363	3300005441	Bacteria	2795
277	Ga0070700_100174215	3300005441	Bacteria	1492
278	Ga0070694_100175035	3300005444	Bacteria	1583
279	Ga0070694_100707977	3300005444	Bacteria	819
280	Ga0070708_100005527	3300005445	Bacteria	10018
281	Ga0070708_100093634	3300005445	Bacteria	2739
282	Ga0070708_100335076	3300005445	Bacteria	1426
283	Ga0070663_100000113	3300005455	Bacteria	37716
284	Ga0070663_100044012	3300005455	Bacteria	3145
285	Ga0070663_100062131	3300005455	Bacteria	2692
286	Ga0070663_100062362	3300005455	Bacteria	2687
287	Ga0070663_100546677	3300005455	Bacteria	967
288	Ga0070678_100010968	3300005456	Bacteria	5564
289	Ga0070678_100082714	3300005456	Bacteria	2438
290	Ga0070678_100160522	3300005456	Bacteria	1821
291	Ga0070678_100188811	3300005456	Bacteria	1693
292	Ga0070678_100239506	3300005456	Bacteria	1516
293	Ga0070678_100304503	3300005456	Bacteria	1355
294	Ga0070678_100335203	3300005456	Bacteria	1296
295	Ga0070678_101088052	3300005456	Bacteria	738
296	Ga0070662_100001973	3300005457	Bacteria	12604
297	Ga0070662_100018849	3300005457	Bacteria	4675
298	Ga0070662_100035406	3300005457	Bacteria	3525
299	Ga0070662_100075049	3300005457	Bacteria	2503
300	Ga0070662_100099006	3300005457	Bacteria	2203
301	Ga0070662_100140854	3300005457	Bacteria	1869
302	Ga0070662_100221415	3300005457	Bacteria	1510
303	Ga0070662_100603351	3300005457	Bacteria	923
304	Ga0070662_101078088	3300005457	Bacteria	689
305	Ga0070681_10003149	3300005458	Bacteria	15336
306	Ga0070681_10020040	3300005458	Bacteria	6701
307	Ga0068867_100000063	3300005459	Bacteria	64286
308	Ga0068867_100089260	3300005459	Bacteria	2337
309	Ga0068867_100725127	3300005459	Bacteria	879
310	Ga0068867_100891535	3300005459	Bacteria	800
311	Ga0070706_100000700	3300005467	Bacteria	37931
312	Ga0070706_100039200	3300005467	Bacteria	4374
313	Ga0070706_100069789	3300005467	Bacteria	3250
314	Ga0070706_100108837	3300005467	Bacteria	2578
315	Ga0070706_100423051	3300005467	Bacteria	1240
316	Ga0070706_100659702	3300005467	Bacteria	971
317	Ga0070706_101003021	3300005467	Bacteria	770
318	Ga0070707_100075753	3300005468	Bacteria	3246
319	Ga0070707_100142410	3300005468	Bacteria	2333
320	Ga0070707_100152551	3300005468	Bacteria	2250
321	Ga0070707_100158609	3300005468	Bacteria	2204
322	Ga0070707_100283950	3300005468	Bacteria	1608
323	Ga0070707_100304134	3300005468	Bacteria	1550
324	Ga0070707_100495219	3300005468	Bacteria	1184
325	Ga0070707_100668894	3300005468	Bacteria	1001
326	Ga0070698_100061006	3300005471	Bacteria	3804
327	Ga0070698_100333729	3300005471	Bacteria	1448
328	Ga0070698_100599992	3300005471	Bacteria	1041
329	Ga0070699_100054500	3300005518	Bacteria	3461
330	Ga0070699_100471147	3300005518	Bacteria	1139
331	Ga0070679_100025716	3300005530	Bacteria	5777
332	Ga0070679_100117553	3300005530	Bacteria	2644
333	Ga0070679_100281760	3300005530	Bacteria	1615
334	Ga0070679_100871533	3300005530	Bacteria	844
335	Ga0070684_100011258	3300005535	Bacteria	7123
336	Ga0070684_100420459	3300005535	Bacteria	1234
337	Ga0070697_100033729	3300005536	Bacteria	4124
338	Ga0070697_100143438	3300005536	Bacteria	2009
339	Ga0070697_100287459	3300005536	Bacteria	1412
340	Ga0068853_100000012	3300005539	Bacteria	228770
341	Ga0068853_100009734	3300005539	Bacteria	7753
342	Ga0068853_100011382	3300005539	Bacteria	7225
343	Ga0068853_100376764	3300005539	Bacteria	1325
344	Ga0068853_100926093	3300005539	Bacteria	837
345	Ga0068853_100926094	3300005539	Bacteria	837
346	Ga0070672_100002553	3300005543	Bacteria	11610
347	Ga0070672_100003141	3300005543	Bacteria	10672
348	Ga0070672_100003858	3300005543	Bacteria	9758
349	Ga0070672_100133869	3300005543	Bacteria	2040
350	Ga0070672_100193371	3300005543	Bacteria	1699
351	Ga0070672_100279376	3300005543	Bacteria	1411
352	Ga0070672_100311990	3300005543	Bacteria	1335
353	Ga0070672_100338749	3300005543	Bacteria	1280
354	Ga0070672_100628873	3300005543	Bacteria	936
355	Ga0070672_100642009	3300005543	Bacteria	927
356	Ga0070693_100034414	3300005547	Bacteria	2803
357	Ga0070693_100117914	3300005547	Bacteria	1642
358	Ga0070693_100123055	3300005547	Bacteria	1611
359	Ga0070693_100665736	3300005547	Bacteria	759
360	Ga0070665_100061513	3300005548	Bacteria	3764
361	Ga0070665_100108139	3300005548	Bacteria	2783
362	Ga0070665_100329763	3300005548	Bacteria	1531
363	Ga0070665_101191133	3300005548	Bacteria	773
364	Ga0070704_100309787	3300005549	Bacteria	1319
365	Ga0068855_100002624	3300005563	Bacteria	22148
366	Ga0068855_100006806	3300005563	Bacteria	13869
367	Ga0068855_100189943	3300005563	Bacteria	2317
368	Ga0068855_100225652	3300005563	Bacteria	2099
369	Ga0068855_100309133	3300005563	Bacteria	1749
370	Ga0068855_100334075	3300005563	Bacteria	1672
371	Ga0068855_100441750	3300005563	Bacteria	1421
372	Ga0068855_100480293	3300005563	Bacteria	1353
373	Ga0068855_101071297	3300005563	Bacteria	844
374	Ga0070664_100001095	3300005564	Bacteria	21389
375	Ga0070664_100002102	3300005564	Bacteria	15915
376	Ga0070664_100003147	3300005564	Bacteria	13337
377	Ga0070664_100013607	3300005564	Bacteria	6630
378	Ga0070664_100355510	3300005564	Bacteria	1333
379	Ga0070664_100397149	3300005564	Bacteria	1260
380	Ga0070664_100408289	3300005564	Bacteria	1243
381	Ga0070664_100440298	3300005564	Bacteria	1195
382	Ga0068857_100013493	3300005577	Bacteria	7118
383	Ga0068857_100013938	3300005577	Bacteria	6996
384	Ga0068857_100030554	3300005577	Bacteria	4757
385	Ga0068857_100086208	3300005577	Bacteria	2807
386	Ga0068857_100263780	3300005577	Bacteria	1581
387	Ga0068857_100788626	3300005577	Bacteria	907
388	Ga0068857_101033687	3300005577	Bacteria	792
389	Ga0068857_101168496	3300005577	Bacteria	745
390	Ga0068854_100017693	3300005578	Bacteria	4774
391	Ga0068854_100147797	3300005578	Bacteria	1809
392	Ga0068854_100174262	3300005578	Bacteria	1676
393	Ga0068856_100014860	3300005614	Bacteria	7514
394	Ga0068856_100106391	3300005614	Bacteria	2800
395	Ga0068856_100208651	3300005614	Bacteria	1968
396	Ga0068856_100272049	3300005614	Bacteria	1710
397	Ga0068856_100468959	3300005614	Bacteria	1280
398	Ga0070702_100007279	3300005615	Bacteria	5291
399	Ga0070702_100244455	3300005615	Bacteria	1213
400	Ga0070702_100492207	3300005615	Bacteria	899
401	Ga0070702_100595799	3300005615	Bacteria	828
402	Ga0068852_100107451	3300005616	Bacteria	2531
403	Ga0068852_100135582	3300005616	Bacteria	2272
404	Ga0068852_100146397	3300005616	Bacteria	2191
405	Ga0068852_100152571	3300005616	Bacteria	2150
406	Ga0068852_100198755	3300005616	Bacteria	1896
407	Ga0068852_100225051	3300005616	Bacteria	1786
408	Ga0068852_100240566	3300005616	Bacteria	1729
409	Ga0068852_100363788	3300005616	Bacteria	1415
410	Ga0068852_100368581	3300005616	Bacteria	1406
411	Ga0068852_100745178	3300005616	Bacteria	991
412	Ga0068852_101097997	3300005616	Bacteria	816
413	Ga0068852_101576460	3300005616	Bacteria	679
414	Ga0068859_100139308	3300005617	Bacteria	2500
415	Ga0068859_100263617	3300005617	Bacteria	1815
416	Ga0068864_100000033	3300005618	Bacteria	209441
417	Ga0068864_100000471	3300005618	Bacteria	34903
418	Ga0068864_100045780	3300005618	Bacteria	3753
419	Ga0068864_100195981	3300005618	Bacteria	1853
420	Ga0068864_100232278	3300005618	Bacteria	1706
421	Ga0068864_100481195	3300005618	Bacteria	1192
422	Ga0068864_100607833	3300005618	Bacteria	1061
423	Ga0068861_100017071	3300005719	Bacteria	5148
424	Ga0068861_100034888	3300005719	Bacteria	3722
425	Ga0068851_10008349	3300005834	Bacteria	4787
426	Ga0068851_10010947	3300005834	Bacteria	4243
427	Ga0068851_10112661	3300005834	Bacteria	1454
428	Ga0068851_10130686	3300005834	Bacteria	1358
429	Ga0068851_10194842	3300005834	Bacteria	1128
430	Ga0068870_10132202	3300005840	Bacteria	1451
431	Ga0068870_10317448	3300005840	Bacteria	989
432	Ga0068863_100022218	3300005841	Bacteria	6058
433	Ga0068863_100092780	3300005841	Bacteria	2865
434	Ga0068863_100866449	3300005841	Bacteria	902
435	Ga0068863_101495533	3300005841	Bacteria	684
436	Ga0068858_100000574	3300005842	Bacteria	38469
437	Ga0068858_100016150	3300005842	Bacteria	7013
438	Ga0068858_100047057	3300005842	Bacteria	4000
439	Ga0068858_100091601	3300005842	Bacteria	2829
440	Ga0068858_100365792	3300005842	Bacteria	1383
441	Ga0068860_100068406	3300005843	Bacteria	3374
442	Ga0068860_100129404	3300005843	Bacteria	2422
443	Ga0068860_100223080	3300005843	Bacteria	1830
444	Ga0068862_100100307	3300005844	Bacteria	2532
445	Ga0068862_100716258	3300005844	Bacteria	971
446	Ga0070717_10000041	3300006028	Bacteria	110187
447	Ga0070717_10001122	3300006028	Bacteria	18094
448	Ga0070717_10523096	3300006028	Bacteria	1073
449	Ga0075365_10049373	3300006038	Bacteria	2772
450	Ga0075365_10069730	3300006038	Bacteria	2363
451	Ga0075365_10458095	3300006038	Bacteria	901
452	Ga0075365_10591657	3300006038	Bacteria	785
453	Ga0075368_10026094	3300006042	Bacteria	2246
454	Ga0075368_10070471	3300006042	Bacteria	1411
455	Ga0075368_10080949	3300006042	Bacteria	1321
456	Ga0075368_10085024	3300006042	Bacteria	1290
457	Ga0075363_100002569	3300006048	Bacteria	7462
458	Ga0075363_100012547	3300006048	Bacteria	4090
459	Ga0075363_100038287	3300006048	Bacteria	2521
460	Ga0075363_100077454	3300006048	Bacteria	1814
461	Ga0075363_100219795	3300006048	Bacteria	1089
462	Ga0075363_100267632	3300006048	Bacteria	987
463	Ga0075364_10000064	3300006051	Bacteria	40534
464	Ga0075364_10008008	3300006051	Bacteria	6298
465	Ga0075364_10063260	3300006051	Bacteria	2429
466	Ga0075364_10095891	3300006051	Bacteria	1972
467	Ga0075364_10136135	3300006051	Bacteria	1650
468	Ga0075364_10193752	3300006051	Bacteria	1377
469	Ga0075364_10372648	3300006051	Bacteria	974
470	Ga0075432_10002610	3300006058	Bacteria	6018
471	Ga0075432_10003468	3300006058	Bacteria	5336
472	Ga0075432_10052639	3300006058	Bacteria	1438
473	Ga0070715_10119776	3300006163	Bacteria	1253
474	Ga0070716_100014135	3300006173	Bacteria	4084
475	Ga0075362_10003058	3300006177	Bacteria	5756
476	Ga0075362_10008277	3300006177	Bacteria	3972
477	Ga0075362_10014396	3300006177	Bacteria	3192
478	Ga0075362_10021197	3300006177	Bacteria	2723
479	Ga0075362_10046075	3300006177	Bacteria	1938
480	Ga0075367_10001893	3300006178	Bacteria	9269
481	Ga0075367_10020029	3300006178	Bacteria	3720
482	Ga0075367_10025097	3300006178	Bacteria	3368
483	Ga0075367_10042652	3300006178	Bacteria	2655
484	Ga0075367_10059062	3300006178	Bacteria	2283
485	Ga0075367_10089860	3300006178	Bacteria	1867
486	Ga0075369_10235873	3300006186	Bacteria	848
487	Ga0075366_10001287	3300006195	Bacteria	12501
488	Ga0075366_10010351	3300006195	Bacteria	5236
489	Ga0075366_10011144	3300006195	Bacteria	5068
490	Ga0075366_10011179	3300006195	Bacteria	5061
491	Ga0075366_10026650	3300006195	Bacteria	3387
492	Ga0075366_10041111	3300006195	Bacteria	2736
493	Ga0075366_10062590	3300006195	Bacteria	2212
494	Ga0075366_10118569	3300006195	Bacteria	1594
495	Ga0075366_10141535	3300006195	Bacteria	1454
496	Ga0075366_10156491	3300006195	Bacteria	1380
497	Ga0075366_10201183	3300006195	Bacteria	1212
498	Ga0075366_10221180	3300006195	Bacteria	1153
499	Ga0075366_10224886	3300006195	Bacteria	1143
500	Ga0075366_10235982	3300006195	Bacteria	1115
501	Ga0075366_10309760	3300006195	Bacteria	966
502	Ga0097621_100027903	3300006237	Bacteria	4445
503	Ga0097621_100232726	3300006237	Bacteria	1609
504	Ga0097621_100437917	3300006237	Bacteria	1176
505	Ga0097621_100927917	3300006237	Bacteria	812
506	Ga0075370_10000133	3300006353	Bacteria	24995
507	Ga0075370_10000282	3300006353	Bacteria	18351
508	Ga0075370_10000304	3300006353	Bacteria	17728
509	Ga0075370_10001450	3300006353	Bacteria	10303
510	Ga0075370_10002199	3300006353	Bacteria	8956
511	Ga0075370_10002475	3300006353	Bacteria	8564
512	Ga0075370_10004243	3300006353	Bacteria	6935
513	Ga0075370_10009367	3300006353	Bacteria	5082
514	Ga0075370_10010743	3300006353	Bacteria	4798
515	Ga0075370_10032528	3300006353	Bacteria	2917
516	Ga0075370_10051377	3300006353	Bacteria	2338
517	Ga0075370_10061287	3300006353	Bacteria	2143
518	Ga0075370_10070323	3300006353	Bacteria	2001
519	Ga0075370_10095836	3300006353	Bacteria	1714
520	Ga0075370_10135539	3300006353	Bacteria	1438
521	Ga0075370_10238961	3300006353	Bacteria	1075
522	Ga0075370_10304719	3300006353	Bacteria	948
523	Ga0075370_10354711	3300006353	Bacteria	876
524	Ga0068871_100004100	3300006358	Bacteria	10076
525	Ga0068871_100064740	3300006358	Bacteria	2993
526	Ga0068871_100097969	3300006358	Bacteria	2452
527	Ga0068871_100163793	3300006358	Bacteria	1903
528	Ga0068871_100211717	3300006358	Bacteria	1677
529	Ga0068871_100249539	3300006358	Bacteria	1545
530	Ga0068871_100347787	3300006358	Bacteria	1310
531	Ga0068871_100352602	3300006358	Bacteria	1302
532	Ga0075428_100009243	3300006844	Bacteria	10930
533	Ga0075428_100172591	3300006844	Bacteria	2343
534	Ga0075428_100228332	3300006844	Bacteria	2009
535	Ga0075428_100881362	3300006844	Bacteria	950
536	Ga0075431_100005849	3300006847	Bacteria	12169
537	Ga0075434_100063325	3300006871	Bacteria	3681
538	Ga0075434_100292181	3300006871	Bacteria	1650
539	Ga0075434_100299060	3300006871	Bacteria	1630
540	Ga0075429_100152323	3300006880	Bacteria	2025
541	Ga0068865_100021718	3300006881	Bacteria	4178
542	Ga0068865_100052251	3300006881	Bacteria	2831
543	Ga0068865_100233096	3300006881	Bacteria	1445
544	Ga0075436_100009404	3300006914	Bacteria	6682
545	Ga0075436_100213086	3300006914	Bacteria	1370
546	Ga0097620_100139310	3300006931	Bacteria	2500
547	Ga0097620_100263614	3300006931	Bacteria	1815
548	Ga0099823_1000155	3300006944	Bacteria	36540
549	Ga0079104_1000711	3300006946	Bacteria	30224
550	Ga0079104_1002711	3300006946	Bacteria	9088
551	Ga0079104_1024800	3300006946	Bacteria	1575
552	Ga0099826_10000008	3300006948	Bacteria	380974
553	Ga0099826_10000101	3300006948	Bacteria	40408
554	Ga0099826_10323990	3300006948	Bacteria	777
555	Ga0075435_100006134	3300007076	Bacteria	8470
556	Ga0075435_100007940	3300007076	Bacteria	7594
557	Ga0075435_100285034	3300007076	Bacteria	1410
558	Ga0075435_100563487	3300007076	Bacteria	987
559	Ga0075435_100886231	3300007076	Bacteria	778
560	Ga0105251_10006725	3300009011	Bacteria	7257
561	Ga0105244_10018946	3300009036	Bacteria	3853
562	Ga0105244_10026050	3300009036	Bacteria	3170
563	Ga0105244_10038393	3300009036	Bacteria	2498
564	Ga0105244_10049052	3300009036	Bacteria	2159
565	Ga0105250_10001470	3300009092	Bacteria	12739
566	Ga0105250_10013912	3300009092	Bacteria	3313
567	Ga0105250_10313015	3300009092	Bacteria	681
568	Ga0105240_10013981	3300009093	Bacteria	10986
569	Ga0105240_10166541	3300009093	Bacteria	2614
570	Ga0105240_10247624	3300009093	Bacteria	2063
571	Ga0111539_10000030	3300009094	Bacteria	175454
572	Ga0111539_10163078	3300009094	Bacteria	2607
573	Ga0111539_10256520	3300009094	Bacteria	2036
574	Ga0111539_10741130	3300009094	Bacteria	1144
575	Ga0105245_10000052	3300009098	Bacteria	126402
576	Ga0105245_10001463	3300009098	Bacteria	21346
577	Ga0105245_10001605	3300009098	Bacteria	20565
578	Ga0105245_10212067	3300009098	Bacteria	1864
579	Ga0105245_10299731	3300009098	Bacteria	1577
580	Ga0105245_10404375	3300009098	Bacteria	1365
581	Ga0105245_10406820	3300009098	Bacteria	1361
582	Ga0105245_10524917	3300009098	Bacteria	1203
583	Ga0105245_10657319	3300009098	Bacteria	1079
584	Ga0105247_10314179	3300009101	Bacteria	1091
585	Ga0114129_10085847	3300009147	Bacteria	4366
586	Ga0105243_10000047	3300009148	Bacteria	154272
587	Ga0105243_10002786	3300009148	Bacteria	14519
588	Ga0105243_10021082	3300009148	Bacteria	4945
589	Ga0105243_10031956	3300009148	Bacteria	4062
590	Ga0105243_10035082	3300009148	Bacteria	3888
591	Ga0105243_10048075	3300009148	Bacteria	3361
592	Ga0105243_10269263	3300009148	Bacteria	1529
593	Ga0105241_10012959	3300009174	Bacteria	6115
594	Ga0105241_10128738	3300009174	Bacteria	2047
595	Ga0105241_10427164	3300009174	Bacteria	1167
596	Ga0105242_10007787	3300009176	Bacteria	8243
597	Ga0105242_10201242	3300009176	Bacteria	1769
598	Ga0105242_10560450	3300009176	Bacteria	1097
599	Ga0105242_10984121	3300009176	Bacteria	850
600	Ga0105248_10004052	3300009177	Bacteria	16195
601	Ga0105248_10007726	3300009177	Bacteria	11808
602	Ga0105248_10010956	3300009177	Bacteria	10004
603	Ga0105248_10043852	3300009177	Bacteria	5016
604	Ga0105248_10227023	3300009177	Bacteria	2102
605	Ga0105237_10001363	3300009545	Bacteria	32325
606	Ga0105237_10091295	3300009545	Bacteria	3035
607	Ga0105237_10104141	3300009545	Bacteria	2829
608	Ga0105237_10309784	3300009545	Bacteria	1582
609	Ga0105237_10383105	3300009545	Bacteria	1411
610	Ga0105238_10000002	3300009551	Bacteria	772711
611	Ga0105238_10005849	3300009551	Bacteria	12180
612	Ga0105238_10019535	3300009551	Bacteria	6900
613	Ga0105238_10023177	3300009551	Bacteria	6331
614	Ga0105238_10097633	3300009551	Bacteria	2923
615	Ga0105238_10102780	3300009551	Bacteria	2839
616	Ga0105238_10303557	3300009551	Bacteria	1580
617	Ga0105249_10047324	3300009553	Bacteria	3918
618	Ga0105239_10000954	3300010375	Bacteria	40769
619	Ga0105239_10026451	3300010375	Bacteria	6385
620	Ga0105239_10159575	3300010375	Bacteria	2519
621	Ga0105239_10191146	3300010375	Bacteria	2291
622	Ga0105239_10279213	3300010375	Bacteria	1880
623	Ga0105239_11164350	3300010375	Bacteria	888
624	Ga0105239_11567655	3300010375	Bacteria	761
625	Ga0105246_10024413	3300011119	Bacteria	3928
626	Ga0105246_10083319	3300011119	Bacteria	2285
627	Ga0105246_10139035	3300011119	Bacteria	1824
628	Ga0105246_10283164	3300011119	Bacteria	1331
629	Ga0105246_10291801	3300011119	Bacteria	1313
630	Ga0105246_10705166	3300011119	Bacteria	885
631	Ga0157319_1000003	3300012497	Bacteria	397199
632	Ga0157347_1005821	3300012502	Bacteria	1188
633	Ga0157347_1006832	3300012502	Bacteria	1126
634	Ga0157339_1006226	3300012505	Bacteria	967
635	Ga0157324_1018974	3300012506	Bacteria	680
636	Ga0157327_1015107	3300012512	Bacteria	799
637	Ga0157326_1004854	3300012513	Bacteria	1416
638	Ga0157373_10043497	3300013100	Bacteria	3208
639	Ga0157373_10096536	3300013100	Bacteria	2081
640	Ga0157373_10101206	3300013100	Bacteria	2027
641	Ga0157373_10511793	3300013100	Bacteria	868
642	Ga0157371_10000003	3300013102	Bacteria	543317
643	Ga0157371_10037911	3300013102	Bacteria	3449
644	Ga0157371_10254273	3300013102	Bacteria	1266
645	Ga0157371_10266445	3300013102	Bacteria	1236
646	Ga0157371_10387953	3300013102	Bacteria	1020
647	Ga0157370_10033859	3300013104	Bacteria	4979
648	Ga0157370_10104976	3300013104	Bacteria	2645
649	Ga0157370_10660307	3300013104	Bacteria	955
650	Ga0157369_10000431	3300013105	Bacteria	55677
651	Ga0157369_10003810	3300013105	Bacteria	17909
652	Ga0157369_10023413	3300013105	Bacteria	6878
653	Ga0157369_10115053	3300013105	Bacteria	2857
654	Ga0157369_10120724	3300013105	Bacteria	2781
655	Ga0157374_10000016	3300013296	Bacteria	293656
656	Ga0157374_10087400	3300013296	Bacteria	2967
657	Ga0157374_10112402	3300013296	Bacteria	2621
658	Ga0157374_10199049	3300013296	Bacteria	1961
659	Ga0157378_10000948	3300013297	Bacteria	26647
660	Ga0157378_10001650	3300013297	Bacteria	20170
661	Ga0157378_10088231	3300013297	Bacteria	2815
662	Ga0157378_10101606	3300013297	Bacteria	2626
663	Ga0157378_10208528	3300013297	Bacteria	1852
664	Ga0163162_10001870	3300013306	Bacteria	19803
665	Ga0163162_10087416	3300013306	Bacteria	3195
666	Ga0163162_10188928	3300013306	Bacteria	2187
667	Ga0163162_10561285	3300013306	Bacteria	1269
668	Ga0163162_11573802	3300013306	Bacteria	749
669	Ga0157372_10056641	3300013307	Bacteria	4379
670	Ga0157372_10400538	3300013307	Bacteria	1599
671	Ga0157372_10547858	3300013307	Bacteria	1348
672	Ga0157372_11300421	3300013307	Bacteria	839
673	Ga0157375_10000010	3300013308	Bacteria	361011
674	Ga0157375_10000012	3300013308	Bacteria	330517
675	Ga0157375_10000185	3300013308	Bacteria	58274
676	Ga0157375_10035151	3300013308	Bacteria	4780
677	Ga0157375_10062862	3300013308	Bacteria	3690
678	Ga0157375_10104000	3300013308	Bacteria	2928
679	Ga0157375_10476078	3300013308	Bacteria	1414
680	Ga0163163_10124689	3300014325	Bacteria	2612
681	Ga0163163_10154852	3300014325	Bacteria	2336
682	Ga0163163_10259944	3300014325	Bacteria	1787
683	Ga0163163_10645207	3300014325	Bacteria	1122
684	Ga0163163_10823425	3300014325	Bacteria	992
685	Ga0157380_10014055	3300014326	Bacteria	5850
686	Ga0182008_10000066	3300014497	Bacteria	88047
687	Ga0182008_10001633	3300014497	Bacteria	14849
688	Ga0182008_10001806	3300014497	Bacteria	13972
689	Ga0182008_10005156	3300014497	Bacteria	7495
690	Ga0182008_10006253	3300014497	Bacteria	6690
691	Ga0182008_10029674	3300014497	Bacteria	2762
692	Ga0182008_10084926	3300014497	Bacteria	1559
693	Ga0182008_10164253	3300014497	Bacteria	1119
694	Ga0182008_10339440	3300014497	Bacteria	794
695	Ga0157377_10000004	3300014745	Bacteria	430019
696	Ga0157377_10000041	3300014745	Bacteria	110626
697	Ga0157377_10000132	3300014745	Bacteria	47931
698	Ga0157377_10042995	3300014745	Bacteria	2512
699	Ga0157379_10010913	3300014968	Bacteria	7920
700	Ga0157379_10078014	3300014968	Bacteria	2966
701	Ga0157379_10114916	3300014968	Bacteria	2419
702	Ga0157379_10128498	3300014968	Bacteria	2280
703	Ga0157379_10219521	3300014968	Bacteria	1722
704	Ga0157379_11028091	3300014968	Bacteria	786
705	Ga0157376_10000018	3300014969	Bacteria	259397
706	Ga0157376_10176251	3300014969	Bacteria	1951
707	Ga0157376_10240092	3300014969	Bacteria	1688
708	Ga0157376_10301903	3300014969	Bacteria	1516
709	Ga0157376_10374879	3300014969	Bacteria	1369
710	Ga0182006_1006614	3300015261	Bacteria	5367
711	Ga0182006_1052011	3300015261	Bacteria	1574
712	Ga0182006_1116733	3300015261	Bacteria	932
713	Ga0182007_10000738	3300015262	Bacteria	18494
714	Ga0182007_10000853	3300015262	Bacteria	16919
715	Ga0182007_10003308	3300015262	Bacteria	7639
716	Ga0182007_10027364	3300015262	Bacteria	1966
717	Ga0182007_10036086	3300015262	Bacteria	1664
718	Ga0182007_10064208	3300015262	Bacteria	1203
719	Ga0182005_1000405	3300015265	Bacteria	23552
720	Ga0183362_10003	3300015683	Bacteria	977584
721	Ga0163161_10001891	3300017792	Bacteria	15283
722	Ga0163161_10015556	3300017792	Bacteria	5306
723	Ga0163161_10066343	3300017792	Bacteria	2635
724	Ga0163161_10098086	3300017792	Bacteria	2177
725	Ga0163161_10237529	3300017792	Bacteria	1416
726	Ga0206351_10037144	3300020077	Bacteria	1068
727	Ga0213873_10000724	3300021358	Bacteria	5324
728	Ga0213872_10000031	3300021361	Bacteria	139321
729	Ga0213872_10000175	3300021361	Bacteria	57086
730	Ga0213872_10000474	3300021361	Bacteria	32444
731	Ga0213872_10001386	3300021361	Bacteria	15948
732	Ga0213872_10010796	3300021361	Bacteria	4335
733	Ga0213872_10026256	3300021361	Bacteria	2676
734	Ga0213872_10035330	3300021361	Bacteria	2286
735	Ga0213876_10002354	3300021384	Bacteria	11128
736	Ga0209435_100002	3300025206	Bacteria	794178
737	Ga0209760_100059	3300025207	Bacteria	97774
738	Ga0209760_100140	3300025207	Bacteria	45356
739	Ga0209760_105981	3300025207	Bacteria	985
740	Ga0209436_102173	3300025208	Bacteria	6125
741	Ga0209436_105445	3300025208	Bacteria	2931
742	Ga0209436_107262	3300025208	Bacteria	2335
743	Ga0209784_100010	3300025224	Bacteria	683664
744	Ga0209566_100008	3300025225	Bacteria	683664
745	Ga0209674_100019	3300025226	Bacteria	683664
746	Ga0209674_100066	3300025226	Bacteria	256739
747	Ga0209672_100378	3300025228	Bacteria	27209
748	Ga0209672_105575	3300025228	Bacteria	2140
749	Ga0209147_100010	3300025229	Bacteria	741391
750	Ga0209147_100696	3300025229	Bacteria	17227
751	Ga0209563_100011	3300025230	Bacteria	1187808
752	Ga0209563_100021	3300025230	Bacteria	683764
753	Ga0209563_100044	3300025230	Bacteria	396812
754	Ga0209563_100107	3300025230	Bacteria	143807
755	Ga0209563_100467	3300025230	Bacteria	13927
756	Ga0207427_100014	3300025231	Bacteria	561361
757	Ga0207427_100016	3300025231	Bacteria	538697
758	Ga0207427_100266	3300025231	Bacteria	40361
759	Ga0207427_100432	3300025231	Bacteria	23437
760	Ga0209437_100011	3300025233	Bacteria	818520
761	Ga0209437_100016	3300025233	Bacteria	710118
762	Ga0209437_100019	3300025233	Bacteria	683764
763	Ga0209258_100074	3300025242	Bacteria	271062
764	Ga0209258_100093	3300025242	Bacteria	223559
765	Ga0209258_100489	3300025242	Bacteria	40371
766	Ga0207425_1000009	3300025245	Bacteria	593135
767	Ga0207425_1000036	3300025245	Bacteria	225783
768	Ga0207425_1001221	3300025245	Bacteria	11309
769	Ga0207425_1001814	3300025245	Bacteria	8276
770	Ga0207425_1002888	3300025245	Bacteria	5767
771	Ga0207425_1051674	3300025245	Bacteria	748
772	Ga0209646_1000001	3300025246	Bacteria	3092932
773	Ga0209646_1000039	3300025246	Bacteria	349637
774	Ga0209026_1000001	3300025250	Bacteria	1228671
775	Ga0209026_1000006	3300025250	Bacteria	677225
776	Ga0209026_1004124	3300025250	Bacteria	4465
777	Ga0209677_100011	3300025253	Bacteria	683664
778	Ga0209677_100052	3300025253	Bacteria	167826
779	Ga0209677_100914	3300025253	Bacteria	14434
780	Ga0209148_1000007	3300025254	Bacteria	1592273
781	Ga0209148_1000470	3300025254	Bacteria	42979
782	Ga0209148_1011502	3300025254	Bacteria	1642
783	Ga0209759_1000001	3300025256	Bacteria	2799452
784	Ga0209759_1000020	3300025256	Bacteria	344904
785	Ga0209759_1000909	3300025256	Bacteria	21990
786	Ga0209759_1002131	3300025256	Bacteria	9135
787	Ga0209759_1003276	3300025256	Bacteria	6535
788	Ga0209759_1007665	3300025256	Bacteria	3442
789	Ga0209129_1000024	3300025258	Bacteria	417268
790	Ga0209129_1000269	3300025258	Bacteria	51170
791	Ga0209129_1003815	3300025258	Bacteria	6302
792	Ga0209129_1004573	3300025258	Bacteria	5325
793	Ga0209129_1020085	3300025258	Bacteria	1249
794	Ga0209129_1029454	3300025258	Bacteria	925
795	Ga0209233_1000019	3300025261	Bacteria	818520
796	Ga0209233_1000025	3300025261	Bacteria	683764
797	Ga0209233_1000036	3300025261	Bacteria	561361
798	Ga0209565_1000098	3300025263	Bacteria	132021
799	Ga0209565_1000128	3300025263	Bacteria	108959
800	Ga0209565_1000574	3300025263	Bacteria	24961
801	Ga0209565_1000633	3300025263	Bacteria	22947
802	Ga0209565_1001293	3300025263	Bacteria	11598
803	Ga0209565_1005965	3300025263	Bacteria	3484
804	Ga0209565_1006949	3300025263	Bacteria	3109
805	Ga0209565_1009387	3300025263	Bacteria	2486
806	Ga0209565_1014279	3300025263	Bacteria	1829
807	Ga0209455_1000066	3300025272	Bacteria	316811
808	Ga0209455_1034990	3300025272	Bacteria	812
809	Ga0209673_1000008	3300025273	Bacteria	626013
810	Ga0209673_1000058	3300025273	Bacteria	269028
811	Ga0209673_1002178	3300025273	Bacteria	14443
812	Ga0209673_1002449	3300025273	Bacteria	12865
813	Ga0209673_1003591	3300025273	Bacteria	9019
814	Ga0209673_1007404	3300025273	Bacteria	5069
815	Ga0209673_1009216	3300025273	Bacteria	4303
816	Ga0209673_1014331	3300025273	Bacteria	3071
817	Ga0209673_1015359	3300025273	Bacteria	2913
818	Ga0209673_1016306	3300025273	Bacteria	2784
819	Ga0209130_1000072	3300025284	Bacteria	175726
820	Ga0209130_1000338	3300025284	Bacteria	53907
821	Ga0209130_1000654	3300025284	Bacteria	31825
822	Ga0209130_1001114	3300025284	Bacteria	19756
823	Ga0209130_1003201	3300025284	Bacteria	7226
824	Ga0209130_1008057	3300025284	Bacteria	3157
825	Ga0209130_1024602	3300025284	Bacteria	1312
826	Ga0209130_1027649	3300025284	Bacteria	1202
827	Ga0209675_1000010	3300025291	Bacteria	541927
828	Ga0209675_1000099	3300025291	Bacteria	128911
829	Ga0209675_1000151	3300025291	Bacteria	91172
830	Ga0209675_1000431	3300025291	Bacteria	33567
831	Ga0209675_1002776	3300025291	Bacteria	8744
832	Ga0209675_1002921	3300025291	Bacteria	8455
833	Ga0209675_1010411	3300025291	Bacteria	3178
834	Ga0209675_1016135	3300025291	Bacteria	2187
835	Ga0209675_1035251	3300025291	Bacteria	1143
836	Ga0209675_1038614	3300025291	Bacteria	1063
837	Ga0209676_1000023	3300025292	Bacteria	589732
838	Ga0209676_1000028	3300025292	Bacteria	559745
839	Ga0209676_1000032	3300025292	Bacteria	469558
840	Ga0209676_1001191	3300025292	Bacteria	27954
841	Ga0209676_1002526	3300025292	Bacteria	12760
842	Ga0209676_1005235	3300025292	Bacteria	6871
843	Ga0209676_1005287	3300025292	Bacteria	6807
844	Ga0209025_1000127	3300025294	Bacteria	200766
845	Ga0209025_1000302	3300025294	Bacteria	110301
846	Ga0209025_1000685	3300025294	Bacteria	58093
847	Ga0209025_1001904	3300025294	Bacteria	24327
848	Ga0209025_1002647	3300025294	Bacteria	18311
849	Ga0209025_1004381	3300025294	Bacteria	12294
850	Ga0209025_1005469	3300025294	Bacteria	10341
851	Ga0209025_1006074	3300025294	Bacteria	9549
852	Ga0209025_1006765	3300025294	Bacteria	8792
853	Ga0209025_1010798	3300025294	Bacteria	6132
854	Ga0209025_1039025	3300025294	Bacteria	2078
855	Ga0209564_1000021	3300025295	Bacteria	571316
856	Ga0209564_1000209	3300025295	Bacteria	133651
857	Ga0209564_1000300	3300025295	Bacteria	98386
858	Ga0209564_1002281	3300025295	Bacteria	15652
859	Ga0209564_1002522	3300025295	Bacteria	14144
860	Ga0209564_1003391	3300025295	Bacteria	10974
861	Ga0209564_1006015	3300025295	Bacteria	6699
862	Ga0209564_1007914	3300025295	Bacteria	5364
863	Ga0209564_1008172	3300025295	Bacteria	5228
864	Ga0209758_1000049	3300025297	Bacteria	345104
865	Ga0209758_1000054	3300025297	Bacteria	337655
866	Ga0209758_1000453	3300025297	Bacteria	68482
867	Ga0209758_1000605	3300025297	Bacteria	55552
868	Ga0209758_1005721	3300025297	Bacteria	9380
869	Ga0209758_1013703	3300025297	Bacteria	4392
870	Ga0209050_1000022	3300025298	Bacteria	565239
871	Ga0209050_1000025	3300025298	Bacteria	528225
872	Ga0209050_1000072	3300025298	Bacteria	293619
873	Ga0209050_1000086	3300025298	Bacteria	262009
874	Ga0209050_1000721	3300025298	Bacteria	48376
875	Ga0209050_1000770	3300025298	Bacteria	46024
876	Ga0209050_1000927	3300025298	Bacteria	38487
877	Ga0209050_1003829	3300025298	Bacteria	10730
878	Ga0209050_1006011	3300025298	Bacteria	7356
879	Ga0209050_1011261	3300025298	Bacteria	4272
880	Ga0209256_1000001	3300025299	Bacteria	2166974
881	Ga0209256_1000018	3300025299	Bacteria	568467
882	Ga0209256_1000049	3300025299	Bacteria	310696
883	Ga0209256_1000085	3300025299	Bacteria	219043
884	Ga0209256_1000088	3300025299	Bacteria	217236
885	Ga0209256_1000437	3300025299	Bacteria	64248
886	Ga0209256_1004126	3300025299	Bacteria	9396
887	Ga0209256_1018549	3300025299	Bacteria	2253
888	Ga0209256_1019740	3300025299	Bacteria	2132
889	Ga0209256_1026460	3300025299	Bacteria	1671
890	Ga0207426_1000038	3300025302	Bacteria	441522
891	Ga0207426_1000053	3300025302	Bacteria	384818
892	Ga0207426_1000319	3300025302	Bacteria	92696
893	Ga0207426_1004949	3300025302	Bacteria	6281
894	Ga0207426_1005271	3300025302	Bacteria	5953
895	Ga0209051_1000013	3300025303	Bacteria	565239
896	Ga0209051_1000015	3300025303	Bacteria	546798
897	Ga0209051_1000039	3300025303	Bacteria	319632
898	Ga0209051_1000047	3300025303	Bacteria	293227
899	Ga0209051_1000056	3300025303	Bacteria	271616
900	Ga0209051_1000196	3300025303	Bacteria	107028
901	Ga0209051_1000247	3300025303	Bacteria	91122
902	Ga0209051_1000424	3300025303	Bacteria	57966
903	Ga0209051_1000545	3300025303	Bacteria	46076
904	Ga0209051_1001914	3300025303	Bacteria	16167
905	Ga0209051_1001930	3300025303	Bacteria	16022
906	Ga0209051_1006138	3300025303	Bacteria	6826
907	Ga0209051_1011319	3300025303	Bacteria	4413
908	Ga0209051_1012803	3300025303	Bacteria	4036
909	Ga0209051_1015850	3300025303	Bacteria	3449
910	Ga0209257_1000042	3300025304	Bacteria	537149
911	Ga0209257_1000047	3300025304	Bacteria	460507
912	Ga0209257_1000087	3300025304	Bacteria	282503
913	Ga0209257_1000141	3300025304	Bacteria	201130
914	Ga0209257_1000305	3300025304	Bacteria	107001
915	Ga0209257_1000479	3300025304	Bacteria	72716
916	Ga0209257_1000758	3300025304	Bacteria	48724
917	Ga0209257_1003278	3300025304	Bacteria	14122
918	Ga0209257_1003691	3300025304	Bacteria	12748
919	Ga0209257_1011169	3300025304	Bacteria	4373
920	Ga0209257_1016509	3300025304	Bacteria	2981
921	Ga0209257_1017019	3300025304	Bacteria	2894
922	Ga0209257_1017545	3300025304	Bacteria	2811
923	Ga0209257_1023916	3300025304	Bacteria	2131
924	Ga0207697_10010759	3300025315	Bacteria	3897
925	Ga0207697_10022554	3300025315	Bacteria	2579
926	Ga0207656_10110244	3300025321	Bacteria	1271
927	Ga0207656_10151970	3300025321	Unclassified	1097
928	Ga0207656_10169840	3300025321	Bacteria	1042
929	Ga0207696_1000020	3300025711	Bacteria	434998
930	Ga0207696_1000057	3300025711	Bacteria	249404
931	Ga0207696_1020394	3300025711	Bacteria	2140
932	Ga0207655_1000014	3300025728	Bacteria	607124
933	Ga0207655_1001081	3300025728	Bacteria	26963
934	Ga0207655_1008750	3300025728	Bacteria	6374
935	Ga0207655_1013363	3300025728	Bacteria	4721
936	Ga0207655_1036477	3300025728	Bacteria	2178
937	Ga0207655_1082677	3300025728	Bacteria	1154
938	Ga0207713_1000032	3300025735	Bacteria	276465
939	Ga0207713_1027834	3300025735	Bacteria	2560
940	Ga0207713_1040903	3300025735	Bacteria	1940
941	Ga0207682_10011568	3300025893	Bacteria	3446
942	Ga0207682_10364985	3300025893	Bacteria	681
943	Ga0207642_10205931	3300025899	Bacteria	1090
944	Ga0207688_10042087	3300025901	Bacteria	2543
945	Ga0207680_10134990	3300025903	Bacteria	1630
946	Ga0207680_10135512	3300025903	Bacteria	1627
947	Ga0207680_10144417	3300025903	Bacteria	1580
948	Ga0207647_10174855	3300025904	Bacteria	1249
949	Ga0207647_10224875	3300025904	Bacteria	1081
950	Ga0207685_10404339	3300025905	Bacteria	700
951	Ga0207645_10002962	3300025907	Bacteria	13115
952	Ga0207645_10037853	3300025907	Bacteria	3096
953	Ga0207645_10048976	3300025907	Bacteria	2698
954	Ga0207645_10092004	3300025907	Bacteria	1951
955	Ga0207645_10276710	3300025907	Bacteria	1114
956	Ga0207643_10061224	3300025908	Bacteria	2149
957	Ga0207643_10069322	3300025908	Bacteria	2027
958	Ga0207643_10137232	3300025908	Bacteria	1459
959	Ga0207705_10011658	3300025909	Bacteria	6351
960	Ga0207705_10049753	3300025909	Bacteria	3017
961	Ga0207705_10066373	3300025909	Bacteria	2609
962	Ga0207705_10585350	3300025909	Bacteria	868
963	Ga0207684_10004795	3300025910	Bacteria	12670
964	Ga0207684_10104738	3300025910	Bacteria	2419
965	Ga0207684_10216811	3300025910	Bacteria	1651
966	Ga0207684_10229852	3300025910	Bacteria	1600
967	Ga0207684_10231262	3300025910	Bacteria	1595
968	Ga0207684_10342761	3300025910	Bacteria	1287
969	Ga0207707_10023079	3300025912	Bacteria	5443
970	Ga0207707_10114144	3300025912	Bacteria	2361
971	Ga0207695_10007397	3300025913	Bacteria	14006
972	Ga0207695_10021837	3300025913	Bacteria	7289
973	Ga0207695_10040003	3300025913	Bacteria	5034
974	Ga0207695_10499486	3300025913	Bacteria	1099
975	Ga0207695_10592364	3300025913	Bacteria	990
976	Ga0207671_10006057	3300025914	Bacteria	10906
977	Ga0207671_10016698	3300025914	Bacteria	5697
978	Ga0207671_10082951	3300025914	Bacteria	2406
979	Ga0207671_10206808	3300025914	Bacteria	1534
980	Ga0207671_10756595	3300025914	Bacteria	772
981	Ga0207693_10069086	3300025915	Bacteria	2765
982	Ga0207663_10000952	3300025916	Bacteria	13236
983	Ga0207660_10062563	3300025917	Bacteria	2681
984	Ga0207660_10259245	3300025917	Bacteria	1374
985	Ga0207660_10573827	3300025917	Bacteria	918
986	Ga0207662_10126478	3300025918	Bacteria	1608
987	Ga0207662_10138778	3300025918	Bacteria	1538
988	Ga0207657_10051118	3300025919	Bacteria	3593
989	Ga0207657_10110833	3300025919	Bacteria	2267
990	Ga0207657_10224081	3300025919	Bacteria	1505
991	Ga0207657_10363868	3300025919	Bacteria	1140
992	Ga0207649_10000335	3300025920	Bacteria	35710
993	Ga0207649_10010700	3300025920	Bacteria	5044
994	Ga0207649_10118963	3300025920	Bacteria	1778
995	Ga0207649_10269012	3300025920	Bacteria	1234
996	Ga0207649_10310822	3300025920	Bacteria	1155
997	Ga0207649_10980716	3300025920	Bacteria	664
998	Ga0207652_10277347	3300025921	Bacteria	1512
999	Ga0207646_10067761	3300025922	Bacteria	3186
1000	Ga0207646_10072274	3300025922	Bacteria	3081
1001	Ga0207646_10090557	3300025922	Bacteria	2738
1002	Ga0207646_10537440	3300025922	Bacteria	1052
1003	Ga0207681_10043811	3300025923	Bacteria	2996
1004	Ga0207681_10104220	3300025923	Bacteria	2051
1005	Ga0207681_10346476	3300025923	Bacteria	1188
1006	Ga0207681_10741760	3300025923	Bacteria	818
1007	Ga0207694_10000001	3300025924	Bacteria	4078485
1008	Ga0207694_10009970	3300025924	Bacteria	7161
1009	Ga0207694_10022029	3300025924	Bacteria	4832
1010	Ga0207694_10336234	3300025924	Bacteria	1248
1011	Ga0207694_10390583	3300025924	Bacteria	1156
1012	Ga0207650_10000117	3300025925	Bacteria	104348
1013	Ga0207650_10001863	3300025925	Bacteria	14872
1014	Ga0207650_10009692	3300025925	Bacteria	6585
1015	Ga0207650_10017113	3300025925	Bacteria	5074
1016	Ga0207650_10333956	3300025925	Bacteria	1243
1017	Ga0207650_10359473	3300025925	Bacteria	1199
1018	Ga0207650_10418862	3300025925	Bacteria	1111
1019	Ga0207650_10729062	3300025925	Bacteria	838
1020	Ga0207659_10000003	3300025926	Bacteria	523949
1021	Ga0207659_10008963	3300025926	Bacteria	6237
1022	Ga0207659_10011636	3300025926	Bacteria	5566
1023	Ga0207659_10018526	3300025926	Bacteria	4565
1024	Ga0207659_10018605	3300025926	Bacteria	4558
1025	Ga0207659_10039403	3300025926	Bacteria	3295
1026	Ga0207659_10466798	3300025926	Bacteria	1065
1027	Ga0207659_10619944	3300025926	Unclassified	923
1028	Ga0207687_10000005	3300025927	Bacteria	770649
1029	Ga0207687_10000670	3300025927	Bacteria	23060
1030	Ga0207687_10000854	3300025927	Bacteria	20618
1031	Ga0207687_10007032	3300025927	Bacteria	7418
1032	Ga0207687_10071690	3300025927	Bacteria	2476
1033	Ga0207687_10448095	3300025927	Bacteria	1070
1034	Ga0207687_10775317	3300025927	Bacteria	817
1035	Ga0207644_10002300	3300025931	Bacteria	12388
1036	Ga0207644_10055268	3300025931	Bacteria	2861
1037	Ga0207644_10297149	3300025931	Bacteria	1300
1038	Ga0207690_10000176	3300025932	Bacteria	49560
1039	Ga0207690_10035082	3300025932	Bacteria	3236
1040	Ga0207690_10129170	3300025932	Bacteria	1847
1041	Ga0207690_10146916	3300025932	Bacteria	1744
1042	Ga0207706_10004610	3300025933	Bacteria	12933
1043	Ga0207706_10018377	3300025933	Bacteria	6291
1044	Ga0207706_10030294	3300025933	Bacteria	4827
1045	Ga0207706_10034754	3300025933	Bacteria	4484
1046	Ga0207706_10059884	3300025933	Bacteria	3353
1047	Ga0207706_10060483	3300025933	Bacteria	3336
1048	Ga0207706_10062015	3300025933	Bacteria	3293
1049	Ga0207706_10137009	3300025933	Bacteria	2154
1050	Ga0207706_10321070	3300025933	Bacteria	1348
1051	Ga0207706_10856832	3300025933	Bacteria	769
1052	Ga0207686_10170757	3300025934	Bacteria	1533
1053	Ga0207686_10361778	3300025934	Bacteria	1095
1054	Ga0207709_10000111	3300025935	Bacteria	127580
1055	Ga0207709_10000249	3300025935	Bacteria	65683
1056	Ga0207709_10000958	3300025935	Bacteria	21596
1057	Ga0207709_10001025	3300025935	Bacteria	20674
1058	Ga0207709_10001786	3300025935	Bacteria	14415
1059	Ga0207709_10002735	3300025935	Bacteria	10877
1060	Ga0207709_10008739	3300025935	Bacteria	5588
1061	Ga0207709_10009543	3300025935	Bacteria	5341
1062	Ga0207709_10094484	3300025935	Bacteria	1963
1063	Ga0207709_10101596	3300025935	Bacteria	1902
1064	Ga0207709_10169994	3300025935	Bacteria	1529
1065	Ga0207709_10323165	3300025935	Bacteria	1156
1066	Ga0207670_10000538	3300025936	Bacteria	20889
1067	Ga0207670_10426450	3300025936	Bacteria	1065
1068	Ga0207669_10101297	3300025937	Bacteria	1905
1069	Ga0207669_10173859	3300025937	Bacteria	1536
1070	Ga0207704_10210593	3300025938	Bacteria	1430
1071	Ga0207704_10270681	3300025938	Bacteria	1286
1072	Ga0207691_10007320	3300025940	Bacteria	10647
1073	Ga0207691_10009300	3300025940	Bacteria	9431
1074	Ga0207691_10012349	3300025940	Bacteria	8186
1075	Ga0207691_10049674	3300025940	Bacteria	3844
1076	Ga0207691_10063550	3300025940	Bacteria	3348
1077	Ga0207691_10085580	3300025940	Bacteria	2830
1078	Ga0207691_10087785	3300025940	Bacteria	2790
1079	Ga0207691_10118381	3300025940	Bacteria	2350
1080	Ga0207691_10148675	3300025940	Bacteria	2061
1081	Ga0207691_10208057	3300025940	Bacteria	1701
1082	Ga0207691_10230261	3300025940	Bacteria	1605
1083	Ga0207691_10318116	3300025940	Bacteria	1335
1084	Ga0207691_10354512	3300025940	Bacteria	1255
1085	Ga0207711_10005931	3300025941	Bacteria	10325
1086	Ga0207711_10021877	3300025941	Bacteria	5341
1087	Ga0207711_10030778	3300025941	Bacteria	4527
1088	Ga0207711_10069905	3300025941	Bacteria	3044
1089	Ga0207711_10083482	3300025941	Bacteria	2794
1090	Ga0207711_10183962	3300025941	Bacteria	1901
1091	Ga0207711_10736938	3300025941	Bacteria	919
1092	Ga0207689_10015904	3300025942	Bacteria	6371
1093	Ga0207689_10016938	3300025942	Bacteria	6165
1094	Ga0207689_10020967	3300025942	Bacteria	5493
1095	Ga0207689_10021363	3300025942	Bacteria	5443
1096	Ga0207689_10025465	3300025942	Bacteria	4958
1097	Ga0207689_10032851	3300025942	Bacteria	4313
1098	Ga0207689_10148381	3300025942	Bacteria	1933
1099	Ga0207689_10319353	3300025942	Bacteria	1289
1100	Ga0207689_10385995	3300025942	Bacteria	1166
1101	Ga0207689_10426979	3300025942	Bacteria	1106
1102	Ga0207689_10484504	3300025942	Bacteria	1036
1103	Ga0207661_10000015	3300025944	Bacteria	318960
1104	Ga0207661_10010874	3300025944	Bacteria	6568
1105	Ga0207661_10319230	3300025944	Bacteria	1396
1106	Ga0207661_11389163	3300025944	Bacteria	644
1107	Ga0207679_10000168	3300025945	Bacteria	54187
1108	Ga0207679_10003901	3300025945	Bacteria	9250
1109	Ga0207679_10060887	3300025945	Bacteria	2807
1110	Ga0207679_10143731	3300025945	Bacteria	1932
1111	Ga0207679_10263780	3300025945	Bacteria	1470
1112	Ga0207679_10286520	3300025945	Bacteria	1414
1113	Ga0207679_10719886	3300025945	Bacteria	906
1114	Ga0207667_10001245	3300025949	Bacteria	31911
1115	Ga0207667_10021851	3300025949	Bacteria	7081
1116	Ga0207667_10028439	3300025949	Bacteria	6073
1117	Ga0207667_10061794	3300025949	Bacteria	3918
1118	Ga0207667_10420058	3300025949	Bacteria	1361
1119	Ga0207667_10567821	3300025949	Bacteria	1146
1120	Ga0207651_10004471	3300025960	Bacteria	7054
1121	Ga0207651_10013385	3300025960	Bacteria	4693
1122	Ga0207651_10023534	3300025960	Bacteria	3792
1123	Ga0207651_10059515	3300025960	Bacteria	2647
1124	Ga0207651_10197993	3300025960	Bacteria	1607
1125	Ga0207651_10404247	3300025960	Bacteria	1162
1126	Ga0207651_10524905	3300025960	Bacteria	1026
1127	Ga0207651_10611900	3300025960	Bacteria	953
1128	Ga0207712_10032361	3300025961	Bacteria	3529
1129	Ga0207712_10157469	3300025961	Bacteria	1761
1130	Ga0207712_10275946	3300025961	Bacteria	1370
1131	Ga0207668_10198350	3300025972	Bacteria	1596
1132	Ga0207668_10270529	3300025972	Bacteria	1389
1133	Ga0207668_10684703	3300025972	Bacteria	900
1134	Ga0207640_10000966	3300025981	Bacteria	15956
1135	Ga0207640_10007491	3300025981	Bacteria	6030
1136	Ga0207640_10192384	3300025981	Bacteria	1539
1137	Ga0207658_10016004	3300025986	Bacteria	5152
1138	Ga0207658_10097031	3300025986	Bacteria	2300
1139	Ga0207658_10183724	3300025986	Unclassified	1732
1140	Ga0207658_10352341	3300025986	Bacteria	1282
1141	Ga0207658_10768528	3300025986	Bacteria	873
1142	Ga0207677_10000002	3300026023	Bacteria	478921
1143	Ga0207677_10000075	3300026023	Bacteria	83195
1144	Ga0207677_10074186	3300026023	Bacteria	2413
1145	Ga0207677_10095075	3300026023	Bacteria	2177
1146	Ga0207677_10096601	3300026023	Bacteria	2162
1147	Ga0207677_10189089	3300026023	Bacteria	1627
1148	Ga0207703_10000004	3300026035	Bacteria	526312
1149	Ga0207703_10009554	3300026035	Bacteria	7614
1150	Ga0207703_10039008	3300026035	Bacteria	3794
1151	Ga0207703_10053310	3300026035	Unclassified	3287
1152	Ga0207703_10071333	3300026035	Bacteria	2869
1153	Ga0207639_10000006	3300026041	Bacteria	544415
1154	Ga0207639_10027068	3300026041	Bacteria	4173
1155	Ga0207639_10078144	3300026041	Bacteria	2611
1156	Ga0207639_10294177	3300026041	Bacteria	1433
1157	Ga0207678_10002401	3300026067	Bacteria	17019
1158	Ga0207678_10089692	3300026067	Bacteria	2628
1159	Ga0207678_10109851	3300026067	Bacteria	2352
1160	Ga0207678_10144351	3300026067	Bacteria	2032
1161	Ga0207678_10351873	3300026067	Bacteria	1270
1162	Ga0207678_10634402	3300026067	Bacteria	938
1163	Ga0207678_10828762	3300026067	Bacteria	817
1164	Ga0207708_10000005	3300026075	Bacteria	284735
1165	Ga0207708_10063045	3300026075	Bacteria	2832
1166	Ga0207702_10000310	3300026078	Bacteria	55596
1167	Ga0207702_10351016	3300026078	Bacteria	1411
1168	Ga0207641_10444129	3300026088	Bacteria	1252
1169	Ga0207641_10796754	3300026088	Unclassified	934
1170	Ga0207648_10000176	3300026089	Bacteria	66707
1171	Ga0207648_10022863	3300026089	Bacteria	5608
1172	Ga0207648_10061942	3300026089	Bacteria	3262
1173	Ga0207648_10247487	3300026089	Bacteria	1589
1174	Ga0207648_10636712	3300026089	Bacteria	985
1175	Ga0207676_10000007	3300026095	Bacteria	591074
1176	Ga0207676_10013945	3300026095	Bacteria	5769
1177	Ga0207676_10060396	3300026095	Bacteria	2998
1178	Ga0207676_10062711	3300026095	Bacteria	2949
1179	Ga0207674_10023346	3300026116	Bacteria	6628
1180	Ga0207674_10025604	3300026116	Bacteria	6286
1181	Ga0207674_10031984	3300026116	Bacteria	5521
1182	Ga0207674_10032648	3300026116	Bacteria	5458
1183	Ga0207674_10129406	3300026116	Bacteria	2489
1184	Ga0207674_10264030	3300026116	Bacteria	1669
1185	Ga0207674_10407676	3300026116	Bacteria	1314
1186	Ga0207674_10409947	3300026116	Bacteria	1310
1187	Ga0207674_10419067	3300026116	Bacteria	1294
1188	Ga0207674_10859661	3300026116	Bacteria	875
1189	Ga0207675_100002752	3300026118	Bacteria	17286
1190	Ga0207675_100009550	3300026118	Bacteria	9073
1191	Ga0207675_100049480	3300026118	Bacteria	3923
1192	Ga0207683_10039605	3300026121	Bacteria	4112
1193	Ga0207683_10040526	3300026121	Bacteria	4065
1194	Ga0207683_10079139	3300026121	Bacteria	2914
1195	Ga0207683_10140105	3300026121	Bacteria	2179
1196	Ga0207683_10198143	3300026121	Bacteria	1825
1197	Ga0207683_10232501	3300026121	Bacteria	1681
1198	Ga0207683_10361740	3300026121	Bacteria	1333
1199	Ga0207683_10396924	3300026121	Bacteria	1269
1200	Ga0207683_10751271	3300026121	Bacteria	905
1201	Ga0207698_10018899	3300026142	Bacteria	4706
1202	Ga0207698_10069179	3300026142	Bacteria	2790
1203	Ga0207698_10097101	3300026142	Bacteria	2430
1204	Ga0207698_10128440	3300026142	Bacteria	2161
1205	Ga0207698_10150527	3300026142	Bacteria	2019
1206	Ga0207698_10297717	3300026142	Bacteria	1500
1207	Ga0207698_10346660	3300026142	Bacteria	1401
1208	Ga0207698_10380535	3300026142	Bacteria	1343
1209	Ga0207698_10928782	3300026142	Bacteria	878
1210	Ga0209281_1000017	3300027111	Bacteria	583251
1211	Ga0209281_1000395	3300027111	Bacteria	67983
1212	Ga0209371_1027302	3300027312	Bacteria	1286
1213	Ga0209981_1001724	3300027378	Bacteria	2769
1214	Ga0209970_1000036	3300027614	Bacteria	17242
1215	Ga0210002_1014916	3300027617	Bacteria	1222
1216	Ga0209983_1020811	3300027665	Bacteria	1369
1217	Ga0209282_1000005	3300027666	Bacteria	380858
1218	Ga0209282_1001024	3300027666	Bacteria	14706
1219	Ga0209282_1102538	3300027666	Bacteria	1470
1220	Ga0209971_1094442	3300027682	Bacteria	730
1221	Ga0209966_1000008	3300027695	Bacteria	88938
1222	Ga0209813_10005861	3300027866	Bacteria	3010
1223	Ga0209813_10009313	3300027866	Bacteria	2508
1224	Ga0209813_10088726	3300027866	Bacteria	1034
1225	Ga0209974_10004129	3300027876	Bacteria	5190
1226	Ga0209974_10011375	3300027876	Bacteria	2989
1227	Ga0207428_10000038	3300027907	Bacteria	216105
1228	Ga0207428_10057906	3300027907	Bacteria	3076
1229	Ga0268266_10018918	3300028379	Bacteria	5868
1230	Ga0268266_10069481	3300028379	Bacteria	3051
1231	Ga0268266_10682119	3300028379	Bacteria	990
1232	Ga0268265_10020224	3300028380	Bacteria	4644
1233	Ga0268265_10155670	3300028380	Bacteria	1933
1234	Ga0268265_10902744	3300028380	Bacteria	868
1235	Ga0268265_11285007	3300028380	Bacteria	731
1236	Ga0268264_10011893	3300028381	Bacteria	7170
1237	Ga0268264_10206739	3300028381	Bacteria	1799
1238	Ga0268264_10339836	3300028381	Bacteria	1426
1239	Ga0265319_1056779	3300028563	Bacteria	1278
1240	Ga0265336_10000024	3300028666	Bacteria	188787
1241	Ga0307517_10005635	3300028786	Bacteria	18785
1242	Ga0307517_10110044	3300028786	Bacteria	2103
1243	Ga0307515_10000011	3300028794	Bacteria	633903
1244	Ga0307515_10000084	3300028794	Bacteria	221434
1245	Ga0307515_10000382	3300028794	Bacteria	107907
1246	Ga0307515_10001774	3300028794	Bacteria	48109
1247	Ga0307515_10001854	3300028794	Bacteria	47116
1248	Ga0307515_10001873	3300028794	Bacteria	46808
1249	Ga0307515_10020861	3300028794	Bacteria	11649
1250	Ga0307515_10041325	3300028794	Bacteria	7253
1251	Ga0307515_10041425	3300028794	Bacteria	7241
1252	Ga0307515_10057425	3300028794	Bacteria	5632
1253	Ga0307515_10094035	3300028794	Bacteria	3708
1254	Ga0307515_10209111	3300028794	Bacteria	1801
1255	Ga0307515_10296558	3300028794	Bacteria	1306
1256	Ga0307515_10315740	3300028794	Bacteria	1233
1257	Ga0265324_10001883	3300029957	Bacteria	11301
1258	Ga0265324_10017125	3300029957	Bacteria	2637
1259	Ga0268256_1031075	3300030500	Bacteria	1286
1260	Ga0307511_10001491	3300030521	Bacteria	24787
1261	Ga0307512_10046777	3300030522	Bacteria	3524
1262	Ga0307512_10097717	3300030522	Bacteria	2007
1263	Ga0307512_10122876	3300030522	Bacteria	1660
1264	Ga0316177_1038579	3300030731	Bacteria	3229
1265	Ga0314311_1036973	3300030733	Bacteria	6291
1266	Ga0316180_1020266	3300030736	Bacteria	2933
1267	Ga0316181_1089984	3300030744	Bacteria	894
1268	Ga0316182_1193434	3300030745	Bacteria	1556
1269	Ga0316182_1239831	3300030745	Bacteria	1874
1270	Ga0265329_10012180	3300031242	Bacteria	3101
1271	Ga0265329_10068692	3300031242	Bacteria	1121
1272	Ga0265331_10001682	3300031250	Bacteria	15989
1273	Ga0265327_10000042	3300031251	Bacteria	287487
1274	Ga0265327_10000320	3300031251	Bacteria	91776
1275	Ga0265327_10000789	3300031251	Bacteria	48791
1276	Ga0265327_10022404	3300031251	Bacteria	3778
1277	Ga0265316_10009418	3300031344	Bacteria	8999
1278	Ga0307513_10000029	3300031456	Bacteria	191823
1279	Ga0307513_10000038	3300031456	Bacteria	174780
1280	Ga0307513_10002473	3300031456	Bacteria	25565
1281	Ga0307513_10009162	3300031456	Bacteria	12537
1282	Ga0307513_10051009	3300031456	Bacteria	4467
1283	Ga0307513_10076689	3300031456	Bacteria	3465
1284	Ga0307513_10102595	3300031456	Bacteria	2879
1285	Ga0307513_10184118	3300031456	Bacteria	1948
1286	Ga0307513_10242255	3300031456	Bacteria	1607
1287	Ga0307513_10334235	3300031456	Bacteria	1268
1288	Ga0307513_10383157	3300031456	Bacteria	1145
1289	Ga0307509_10000063	3300031507	Bacteria	143708
1290	Ga0307509_10018446	3300031507	Bacteria	8000
1291	Ga0307509_10028664	3300031507	Bacteria	6187
1292	Ga0307509_10055353	3300031507	Bacteria	4216
1293	Ga0307509_10081292	3300031507	Bacteria	3347
1294	Ga0307509_10200024	3300031507	Bacteria	1836
1295	Ga0307509_10201150	3300031507	Bacteria	1829
1296	Ga0307509_10300514	3300031507	Bacteria	1354
1297	Ga0307408_100000029	3300031548	Bacteria	227806
1298	Ga0307408_100000557	3300031548	Bacteria	32161
1299	Ga0307408_100004302	3300031548	Bacteria	9664
1300	Ga0307408_100011106	3300031548	Bacteria	5949
1301	Ga0307408_100034792	3300031548	Bacteria	3531
1302	Ga0307408_100082521	3300031548	Bacteria	2406
1303	Ga0307408_100088754	3300031548	Bacteria	2329
1304	Ga0307408_100254451	3300031548	Bacteria	1450
1305	Ga0307408_100442493	3300031548	Bacteria	1125
1306	Ga0307408_100702724	3300031548	Bacteria	909
1307	Ga0265313_10020122	3300031595	Bacteria	3690
1308	Ga0307508_10000053	3300031616	Bacteria	128020
1309	Ga0307508_10000109	3300031616	Bacteria	97316
1310	Ga0307508_10005254	3300031616	Bacteria	12357
1311	Ga0307508_10094248	3300031616	Bacteria	2584
1312	Ga0307514_10000560	3300031649	Bacteria	71030
1313	Ga0307514_10000954	3300031649	Bacteria	43472
1314	Ga0307514_10004647	3300031649	Bacteria	12588
1315	Ga0307514_10010207	3300031649	Bacteria	7861
1316	Ga0316575_10017473	3300031665	Bacteria	2725
1317	Ga0265314_10006203	3300031711	Bacteria	10617
1318	Ga0265314_10007074	3300031711	Bacteria	9791
1319	Ga0316578_10023186	3300031728	Bacteria	3472
1320	Ga0307516_10000676	3300031730	Bacteria	46208
1321	Ga0307516_10001245	3300031730	Bacteria	35441
1322	Ga0307516_10003615	3300031730	Bacteria	19669
1323	Ga0307516_10005097	3300031730	Bacteria	15875
1324	Ga0307516_10035006	3300031730	Bacteria	5041
1325	Ga0307516_10049964	3300031730	Bacteria	4105
1326	Ga0307516_10069011	3300031730	Bacteria	3401
1327	Ga0307516_10121630	3300031730	Bacteria	2400
1328	Ga0307516_10169610	3300031730	Bacteria	1924
1329	Ga0307405_10035608	3300031731	Bacteria	2975
1330	Ga0307405_10092287	3300031731	Bacteria	2008
1331	Ga0307405_10470994	3300031731	Bacteria	1000
1332	Ga0307405_10809444	3300031731	Bacteria	785
1333	Ga0316577_10221137	3300031733	Bacteria	1070
1334	Ga0307413_10406793	3300031824	Bacteria	1068
1335	Ga0307518_10010469	3300031838	Bacteria	6621
1336	Ga0307406_10012286	3300031901	Bacteria	4882
1337	Ga0307406_10029832	3300031901	Bacteria	3305
1338	Ga0307406_10125627	3300031901	Bacteria	1791
1339	Ga0307406_10255639	3300031901	Bacteria	1322
1340	Ga0307407_10149175	3300031903	Bacteria	1517
1341	Ga0307412_10023379	3300031911	Bacteria	3802
1342	Ga0307412_10032448	3300031911	Bacteria	3309
1343	Ga0307412_10048788	3300031911	Bacteria	2786
1344	Ga0307412_10081734	3300031911	Bacteria	2235
1345	Ga0307412_10172485	3300031911	Bacteria	1618
1346	Ga0307412_10536603	3300031911	Bacteria	980
1347	Ga0307412_10876777	3300031911	Bacteria	785
1348	Ga0307412_10907389	3300031911	Bacteria	772
1349	Ga0307409_100001998	3300031995	Bacteria	10463
1350	Ga0307416_100012509	3300032002	Bacteria	5719
1351	Ga0307416_100033193	3300032002	Bacteria	3910
1352	Ga0307416_100041495	3300032002	Bacteria	3584
1353	Ga0307416_100060692	3300032002	Bacteria	3081
1354	Ga0307416_100176804	3300032002	Bacteria	1995
1355	Ga0307416_100405488	3300032002	Bacteria	1402
1356	Ga0307416_100640847	3300032002	Bacteria	1146
1357	Ga0307416_100908739	3300032002	Bacteria	981
1358	Ga0307414_10038295	3300032004	Bacteria	3219
1359	Ga0307414_10334091	3300032004	Bacteria	1295
1360	Ga0307411_10010673	3300032005	Bacteria	4911
1361	Ga0307411_10013248	3300032005	Bacteria	4541
1362	Ga0307411_10018685	3300032005	Bacteria	3984
1363	Ga0307411_10019929	3300032005	Bacteria	3887
1364	Ga0307411_10191926	3300032005	Bacteria	1560
1365	Ga0307411_10233377	3300032005	Bacteria	1436
1366	Ga0307411_10331172	3300032005	Bacteria	1234
1367	Ga0307411_10518170	3300032005	Bacteria	1011
1368	Ga0307411_10810181	3300032005	Bacteria	825
1369	Ga0307415_100201816	3300032126	Bacteria	1579
1370	Ga0316593_10011174	3300032168	Bacteria	2601
1371	Ga0307507_10066771	3300033179	Bacteria	3294
1372	Ga0307507_10078126	3300033179	Bacteria	2937
1373	Ga0307507_10163464	3300033179	Bacteria	1638
1374	Ga0307510_10000429	3300033180	Bacteria	40378
1375	Ga0307510_10017213	3300033180	Bacteria	8527
1376	Ga0307510_10151247	3300033180	Bacteria	1939
1377	Ga0307510_10264741	3300033180	Bacteria	1198
1378	Ga0316596_1116781	3300033541	Bacteria	725
1379	Ga0373930_0113174	3300034816	Bacteria	655
1380	Ga0373926_0180231	3300035083	Bacteria	810
1381	Ga0373934_0113188	3300035086	Bacteria	1101
1382	Ga0373940_0036529	3300035088	Bacteria	1334
1383	Ga0373940_0086545	3300035088	Bacteria	933
1384	Ga0373940_0125632	3300035088	Bacteria	799
1385	Ga0373944_0156966	3300035089	Bacteria	805
1386	Ga0373932_0000069	3300035112	Bacteria	25689
1387	Ga0373939_0000012	3300035114	Bacteria	67223
1388	Ga0373953_0182972	3300035117	Bacteria	904
1389	Ga0373954_0006395	3300035118	Bacteria	5137
1390	Ga0373956_0245766	3300035119	Unclassified	850
1391	Ga0373957_0308019	3300035120	Unclassified	672
1392	Ga0373960_0003041	3300035121	Bacteria	3787
1393	Ga0373960_0105342	3300035121	Bacteria	919
1394	Ga0373943_0075365	3300035170	Bacteria	1718
1395	Ga0373946_0041021	3300035171	Bacteria	1897
1396	Ga0373955_0011223	3300035172	Bacteria	4260
1397	Ga0316574_0007020	3300035398	Bacteria	6137
1398	Ga0373931_0002689	3300035691	Bacteria	7910
1399	Ga0373931_0011591	3300035691	Bacteria	4259
1400	Ga0373931_0042353	3300035691	Bacteria	2394
1401	Ga0373931_0043621	3300035691	Bacteria	2363
1402	Ga0373931_0047400	3300035691	Bacteria	2274
1403	Ga0373927_0105123	3300035695	Bacteria	1838
1404	Ga0373947_0438489	3300035725	Bacteria	884
1405	Ga0373937_0000872	3300036401	Bacteria	25896
1406	Ga0373937_0038865	3300036401	Bacteria	4336
1407	Ga0373937_0050704	3300036401	Bacteria	3802
1408	Ga0373937_0090127	3300036401	Bacteria	2840
1409	Ga0373937_0273537	3300036401	Bacteria	1594
1410	Ga0373937_0465070	3300036401	Bacteria	1201
1411	Ga0316584_0040376	3300036712	Bacteria	3476
1412	Ga0373925_0011775	3300037068	Bacteria	6329
1413	Ga0373925_0115295	3300037068	Bacteria	2080
1414	Ga0373925_0404493	3300037068	Bacteria	1114
1415	Ga0373925_0514432	3300037068	Bacteria	983
1416	Ga0395899_0000078	3300037312	Bacteria	174141
1417	Ga0395899_0001210	3300037312	Bacteria	22624
1418	Ga0395899_0007047	3300037312	Bacteria	8699
1419	Ga0395899_0017845	3300037312	Bacteria	5403
1420	Ga0395899_0019414	3300037312	Bacteria	5165
1421	Ga0395899_0059491	3300037312	Bacteria	2816
1422	Ga0395899_0115401	3300037312	Bacteria	1927
1423	Ga0395899_0223690	3300037312	Bacteria	1302
1424	Ga0395900_0000183	3300037418	Bacteria	100749
1425	Ga0395900_0001670	3300037418	Bacteria	25876
1426	Ga0395900_0019815	3300037418	Bacteria	6854
1427	Ga0395900_0047184	3300037418	Bacteria	4435
1428	Ga0395900_0050324	3300037418	Bacteria	4291
1429	Ga0395900_0098013	3300037418	Bacteria	3012
1430	Ga0395900_0103028	3300037418	Bacteria	2932
1431	Ga0395900_0151888	3300037418	Bacteria	2365
1432	Ga0395900_0173899	3300037418	Bacteria	2191
1433	Ga0395900_0252451	3300037418	Bacteria	1764
1434	Ga0395900_0303045	3300037418	Bacteria	1583
1435	Ga0395900_0385231	3300037418	Bacteria	1369
1436	Ga0395900_0832162	3300037418	Bacteria	849
1437	Ga0395900_1071263	3300037418	Bacteria	724
1438	Ga0395898_0003251	3300037466	Bacteria	18262
1439	Ga0395898_0012246	3300037466	Bacteria	8867
1440	Ga0395898_0022445	3300037466	Bacteria	6391
1441	Ga0395898_0034026	3300037466	Bacteria	5082
1442	Ga0395898_0168484	3300037466	Bacteria	2094
1443	Ga0395898_0188761	3300037466	Bacteria	1969
1444	Ga0395898_0723198	3300037466	Bacteria	937
1445	Ga0395898_0728067	3300037466	Bacteria	933
1446	Ga0395898_1103470	3300037466	Bacteria	727
1447	Ga0395905_0000027	3300037471	Bacteria	297239
1448	Ga0395905_0000544	3300037471	Bacteria	51411
1449	Ga0395905_0000728	3300037471	Bacteria	43400
1450	Ga0395905_0001411	3300037471	Bacteria	29041
1451	Ga0395905_0002682	3300037471	Bacteria	19512
1452	Ga0395905_0002893	3300037471	Bacteria	18759
1453	Ga0395905_0006280	3300037471	Bacteria	11985
1454	Ga0395905_0011168	3300037471	Bacteria	8682
1455	Ga0395905_0013332	3300037471	Bacteria	7879
1456	Ga0395905_0023393	3300037471	Bacteria	5839
1457	Ga0395905_0048969	3300037471	Bacteria	3959
1458	Ga0395905_0095837	3300037471	Bacteria	2785
1459	Ga0395905_0099391	3300037471	Bacteria	2733
1460	Ga0395905_0103949	3300037471	Bacteria	2666
1461	Ga0395905_0129390	3300037471	Bacteria	2374
1462	Ga0395905_0138877	3300037471	Bacteria	2286
1463	Ga0395905_0167078	3300037471	Bacteria	2067
1464	Ga0395905_0284768	3300037471	Bacteria	1539
1465	Ga0395905_0370508	3300037471	Bacteria	1325
1466	Ga0395905_0677611	3300037471	Bacteria	933
1467	Ga0436364_0023791	3300037853	Bacteria	1065
1468	Ga0395901_0000393	3300038443	Bacteria	52127
1469	Ga0395901_0009156	3300038443	Bacteria	10030
1470	Ga0395901_0009647	3300038443	Bacteria	9792
1471	Ga0395901_0058565	3300038443	Bacteria	4006
1472	Ga0395901_0059163	3300038443	Bacteria	3986
1473	Ga0395901_0146495	3300038443	Bacteria	2481
1474	Ga0395901_0166691	3300038443	Bacteria	2312
1475	Ga0395901_0258861	3300038443	Bacteria	1811
1476	Ga0395901_0483101	3300038443	Bacteria	1263
1477	Ga0395901_0688570	3300038443	Bacteria	1021
1478	Ga0400484_17823	3300038725	Bacteria	23465
1479	Ga0400484_38898	3300038725	Bacteria	4506
1480	Ga0400490_07386	3300038726	Bacteria	36331
1481	Ga0400491_11309	3300038727	Bacteria	1067
1482	Ga0400485_18000	3300038735	Bacteria	11435
1483	Ga0400486_08314	3300038742	Bacteria	6167
1484	Ga0400486_12922	3300038742	Bacteria	15803
1485	Ga0400483_031251	3300039062	Bacteria	1061
1486	Ga0400483_092543	3300039062	Bacteria	6152
1487	Ga0400483_217411	3300039062	Bacteria	2523
1488	Ga0400487_09481	3300039110	Bacteria	50869
1489	Ga0400487_43376	3300039110	Bacteria	1681
1490	Ga0400487_53816	3300039110	Bacteria	1705
1491	Ga0436365_0481100	3300039437	Bacteria	13670
1492	Ga0436365_0509370	3300039437	Bacteria	2054
1493	Ga0436365_0791820	3300039437	Bacteria	1475
1494	Ga0436361_0469917	3300039447	Bacteria	4155
1495	Ga0436361_0599717	3300039447	Bacteria	43072
1496	Ga0436361_0913791	3300039447	Bacteria	99691
1497	Ga0436361_0920355	3300039447	Bacteria	16590
1498	Ga0436361_0975627	3300039447	Bacteria	3487
1499	Ga0436361_1151553	3300039447	Bacteria	66661
1500	Ga0436363_0084700	3300039450	Bacteria	1740
1501	Ga0436363_1064835	3300039450	Bacteria	13627
1502	Ga0436362_0101780	3300039453	Bacteria	814
1503	Ga0436362_0953380	3300039453	Bacteria	7478
1504	Ga0439436_0022164	3300041404	Bacteria	1882
1505	Ga0439439_0013598	3300041406	Bacteria	1974
1506	Ga0439439_0020853	3300041406	Bacteria	1630
1507	Ga0439447_016801	3300041407	Bacteria	2002
1508	Ga0439461_0008197	3300041410	Bacteria	1868
1509	Ga0439461_0026532	3300041410	Bacteria	1182
1510	Ga0439466_0063858	3300041411	Bacteria	1181
1511	Ga0439465_0004991	3300041413	Bacteria	4262
1512	Ga0439465_0014292	3300041413	Bacteria	2474
1513	Ga0439465_0059439	3300041413	Bacteria	1265
1514	Ga0451793_1026268	3300041452	Bacteria	2932
1515	Ga0451795_0542047	3300041456	Bacteria	1016
1516	Ga0451800_0593114	3300041459	Bacteria	818
1517	Ga0451800_1220815	3300041459	Bacteria	1368
1518	Ga0451802_1094500	3300041460	Bacteria	1680
1519	Ga0451807_0802435	3300041486	Bacteria	2236
1520	Ga0451833_0289815	3300041491	Bacteria	1326
1521	Ga0451833_0541929	3300041491	Bacteria	716
1522	Ga0451833_0985501	3300041491	Bacteria	967
1523	Ga0451839_0884354	3300041496	Bacteria	638
1524	Ga0451853_0135472	3300041512	Bacteria	937
1525	Ga0451853_0940956	3300041512	Bacteria	1055
1526	Ga0439431_0002005	3300041997	Bacteria	4508
1527	Ga0439431_0004784	3300041997	Bacteria	2981
1528	Ga0439431_0135976	3300041997	Bacteria	692
1529	Ga0439433_0002498	3300041999	Bacteria	3903
1530	Ga0439437_002093	3300042000	Bacteria	2114
1531	Ga0439437_002431	3300042000	Bacteria	1989
1532	Ga0439442_002272	3300042002	Bacteria	3775
1533	Ga0439442_029546	3300042002	Bacteria	1143
1534	Ga0439445_0000954	3300042004	Bacteria	6155
1535	Ga0439445_0007049	3300042004	Bacteria	2598
1536	Ga0439448_0018401	3300042005	Bacteria	2140
1537	Ga0439448_0034491	3300042005	Bacteria	1617
1538	Ga0439432_001040	3300042006	Bacteria	10528
1539	Ga0439432_015392	3300042006	Bacteria	2582
1540	Ga0439432_044439	3300042006	Bacteria	1399
1541	Ga0439432_066196	3300042006	Bacteria	1107
1542	Ga0439449_0001931	3300042007	Bacteria	8140
1543	Ga0439449_0004240	3300042007	Bacteria	5542
1544	Ga0439449_0007886	3300042007	Bacteria	4043
1545	Ga0439449_0011935	3300042007	Bacteria	3265
1546	Ga0439449_0023834	3300042007	Bacteria	2288
1547	Ga0439452_003432	3300042010	Bacteria	5550
1548	Ga0439454_012582	3300042011	Bacteria	1149
1549	Ga0439454_020981	3300042011	Bacteria	962
1550	Ga0439455_0006669	3300042012	Bacteria	2408
1551	Ga0439457_015663	3300042014	Bacteria	1692
1552	Ga0439457_023056	3300042014	Bacteria	1378
1553	Ga0439462_0006257	3300042015	Bacteria	2954
1554	Ga0439462_0008185	3300042015	Bacteria	2631
1555	Ga0439462_0112811	3300042015	Bacteria	753
1556	Ga0450911_001866	3300042115	Bacteria	4462
1557	Ga0450913_002443	3300042117	Bacteria	1143
1558	Ga0450917_000077	3300042120	Bacteria	5580
1559	Ga0450919_001238	3300042121	Bacteria	3338
1560	Ga0450923_012936	3300042125	Bacteria	1527
1561	Ga0450923_019439	3300042125	Bacteria	1309
1562	Ga0450888_020869	3300042126	Bacteria	834
1563	Ga0450890_000247	3300042127	Bacteria	8050
1564	Ga0450894_005235	3300042131	Bacteria	1679
1565	Ga0450896_003697	3300042133	Bacteria	2047
1566	Ga0450896_009390	3300042133	Bacteria	1362
1567	Ga0450902_004098	3300042137	Bacteria	2159
1568	Ga0450904_000386	3300042139	Bacteria	9139
1569	Ga0450905_001349	3300042142	Bacteria	3117
1570	Ga0450889_000766	3300042144	Bacteria	3448
1571	Ga0450906_005957	3300042145	Bacteria	2481
1572	Ga0450910_024229	3300042147	Bacteria	930
1573	Ga0439446_0070720	3300042156	Bacteria	1067
1574	Ga0439446_0135407	3300042156	Bacteria	802
1575	Ga0439458_0018624	3300042157	Bacteria	1593
1576	Ga0439434_0007314	3300042435	Bacteria	3236
1577	Ga0439434_0009278	3300042435	Bacteria	2890
1578	Ga0439434_0027144	3300042435	Bacteria	1730
1579	Ga0439459_0003530	3300042438	Bacteria	2487
1580	Ga0439464_0009070	3300042439	Bacteria	2614
1581	Ga0439460_0014657	3300042461	Bacteria	2062
1582	Ga0450918_000077	3300042531	Bacteria	20527
1583	Ga0450918_002840	3300042531	Bacteria	3251
1584	Ga0450893_0010637	3300042532	Bacteria	1514
1585	Ga0450893_0018942	3300042532	Bacteria	1175
1586	Ga0450901_010414	3300042533	Bacteria	963
1587	Ga0451577_0000152	3300042876	Bacteria	153284
1588	Ga0451577_0003222	3300042876	Bacteria	18340
1589	Ga0451577_0003233	3300042876	Bacteria	18316
1590	Ga0451577_0011903	3300042876	Bacteria	8203
1591	Ga0451577_0039198	3300042876	Bacteria	4258
1592	Ga0451577_0041487	3300042876	Bacteria	4130
1593	Ga0451577_0045310	3300042876	Bacteria	3937
1594	Ga0451577_0046474	3300042876	Bacteria	3884
1595	Ga0451577_0108081	3300042876	Bacteria	2487
1596	Ga0451577_0151969	3300042876	Bacteria	2083
1597	Ga0466969_0000020	3300044656	Bacteria	101861
1598	Ga0466969_0006251	3300044656	Bacteria	6337
1599	Ga0466969_0008028	3300044656	Bacteria	5606
1600	Ga0466969_0072895	3300044656	Bacteria	1648
1601	Ga0466969_0235304	3300044656	Bacteria	832
1602	Ga0466972_0001353	3300044658	Bacteria	11872
1603	Ga0466972_0004693	3300044658	Bacteria	6847
1604	Ga0466972_0108333	3300044658	Bacteria	1313
1605	Ga0466972_0134602	3300044658	Bacteria	1164
1606	Ga0466972_0140276	3300044658	Bacteria	1137
1607	Ga0453683_0001910	3300044673	Bacteria	17016
1608	Ga0453683_0249432	3300044673	Bacteria	1131
1609	Ga0466965_0001255	3300044683	Bacteria	10064
1610	Ga0466965_0003434	3300044683	Bacteria	6950
1611	Ga0466965_0017692	3300044683	Bacteria	3410
1612	Ga0466965_0023889	3300044683	Bacteria	2954
1613	Ga0466965_0026491	3300044683	Bacteria	2810
1614	Ga0466965_0083400	3300044683	Bacteria	1618
1615	Ga0466965_0086347	3300044683	Bacteria	1591
1616	Ga0466966_0008910	3300044684	Bacteria	6648
1617	Ga0466966_0015082	3300044684	Bacteria	5111
1618	Ga0466966_0015396	3300044684	Bacteria	5056
1619	Ga0466966_0018583	3300044684	Bacteria	4582
1620	Ga0466966_0026337	3300044684	Bacteria	3797
1621	Ga0466966_0034907	3300044684	Bacteria	3251
1622	Ga0466961_0005878	3300044693	Bacteria	7772
1623	Ga0466961_0021393	3300044693	Bacteria	4163
1624	Ga0466961_0029616	3300044693	Bacteria	3517
1625	Ga0466961_0045487	3300044693	Bacteria	2808
1626	Ga0466961_0061063	3300044693	Bacteria	2395
1627	Ga0466961_0084518	3300044693	Bacteria	2007
1628	Ga0466963_0022154	3300044694	Bacteria	4021
1629	Ga0466963_0043260	3300044694	Bacteria	2960
1630	Ga0466964_0002495	3300044706	Bacteria	6543
1631	Ga0466964_0205734	3300044706	Bacteria	947
1632	Ga0453684_0000122	3300044712	Bacteria	340529
1633	Ga0453684_0005422	3300044712	Bacteria	25271
1634	Ga0453684_0041490	3300044712	Bacteria	6222
1635	Ga0453684_0061027	3300044712	Bacteria	4843
1636	Ga0453684_0088806	3300044712	Bacteria	3826
1637	Ga0453684_0139836	3300044712	Bacteria	2893
1638	Ga0453684_0949189	3300044712	Bacteria	918
1639	Ga0466971_0040422	3300044719	Bacteria	2095
1640	Ga0466971_0052809	3300044719	Bacteria	1830
1641	Ga0466968_0085226	3300044735	Bacteria	1393
1642	Ga0466970_0008552	3300044765	Bacteria	5154
1643	Ga0466970_0064839	3300044765	Bacteria	1959
1644	Ga0466970_0118951	3300044765	Bacteria	1446
1645	Ga0466970_0442509	3300044765	Bacteria	744
1646	Ga0466957_0017820	3300044842	Bacteria	4166
1647	Ga0466957_0027319	3300044842	Bacteria	3391
1648	Ga0466960_0001088	3300044901	Bacteria	9760
1649	Ga0466960_0203042	3300044901	Bacteria	1084
1650	Ga0466959_0004682	3300045049	Bacteria	9207
1651	Ga0466959_0013509	3300045049	Bacteria	5917
1652	Ga0466959_0020814	3300045049	Bacteria	4834
1653	Ga0466959_0047499	3300045049	Bacteria	3157
1654	Ga0466959_0071101	3300045049	Bacteria	2520
1655	Ga0466959_0072394	3300045049	Bacteria	2495
1656	Ga0466959_0096073	3300045049	Bacteria	2125
1657	Ga0466959_0145820	3300045049	Bacteria	1670
1658	Ga0466959_0273915	3300045049	Bacteria	1159
1659	Ga0466959_0287485	3300045049	Bacteria	1127
1660	Ga0466959_0355029	3300045049	Bacteria	999
1661	Ga0451576_0000559	3300045051	Bacteria	79734
1662	Ga0451576_0040585	3300045051	Bacteria	4924
1663	Ga0451576_0063511	3300045051	Bacteria	3849
1664	Ga0451576_0096124	3300045051	Bacteria	3081
1665	Ga0451576_0111895	3300045051	Bacteria	2841
1666	Ga0451576_0190340	3300045051	Bacteria	2143
1667	Ga0451576_0218762	3300045051	Bacteria	1989
1668	Ga0451576_0240554	3300045051	Bacteria	1891
1669	Ga0451576_0516686	3300045051	Bacteria	1255
1670	Ga0451576_1262246	3300045051	Bacteria	771
1671	Ga0466958_0050288	3300045836	Bacteria	2523
1672	Ga0466958_0165309	3300045836	Bacteria	1400
1673	Ga0466958_0253220	3300045836	Bacteria	1126
1674	Ga0466958_0353178	3300045836	Bacteria	947
1675	Ga0466967_0508763	3300045976	Bacteria	1182
1676	Ga0495617_000010	3300046452	Bacteria	310258
1677	Ga0495627_000192	3300046453	Bacteria	67494
1678	Ga0495627_002330	3300046453	Bacteria	9310
1679	Ga0495627_025534	3300046453	Bacteria	1915
1680	Ga0495627_090410	3300046453	Bacteria	880
1681	Ga0495592_0006972	3300046454	Bacteria	8442
1682	Ga0495592_0077146	3300046454	Bacteria	2416
1683	Ga0495592_0111168	3300046454	Bacteria	1939
1684	Ga0495592_0347089	3300046454	Unclassified	952
1685	Ga0495603_0025991	3300046455	Bacteria	3539
1686	Ga0495603_0335652	3300046455	Bacteria	867
1687	Ga0495590_0000009	3300046457	Bacteria	320425
1688	Ga0495590_0000709	3300046457	Bacteria	15238
1689	Ga0495590_0012513	3300046457	Bacteria	3148
1690	Ga0495590_0014687	3300046457	Bacteria	2855
1691	Ga0495591_001557	3300046458	Bacteria	13998
1692	Ga0495629_0353858	3300046459	Bacteria	1001
1693	Ga0495629_0354312	3300046459	Bacteria	1001
1694	Ga0495638_0101410	3300046460	Bacteria	1721
1695	Ga0495651_0036560	3300046462	Bacteria	3823
1696	Ga0495651_0086108	3300046462	Bacteria	2365
1697	Ga0495651_0183775	3300046462	Bacteria	1477
1698	Ga0495651_0339997	3300046462	Bacteria	995
1699	Ga0495651_0422238	3300046462	Bacteria	867
1700	Ga0495653_0002868	3300046463	Bacteria	13781
1701	Ga0495653_0049561	3300046463	Bacteria	3234
1702	Ga0495653_0051679	3300046463	Bacteria	3153
1703	Ga0495650_0000077	3300046471	Bacteria	245511
1704	Ga0495650_0008457	3300046471	Bacteria	6006
1705	Ga0495580_0071593	3300046472	Bacteria	2422
1706	Ga0495580_0250177	3300046472	Bacteria	1213
1707	Ga0495582_0060641	3300046473	Bacteria	2087
1708	Ga0495582_0165177	3300046473	Bacteria	1259
1709	Ga0495582_0359267	3300046473	Bacteria	839
1710	Ga0495605_0000055	3300046474	Bacteria	157514
1711	Ga0495605_0000620	3300046474	Bacteria	27429
1712	Ga0495605_0034982	3300046474	Bacteria	2540
1713	Ga0495605_0036685	3300046474	Bacteria	2470
1714	Ga0495605_0077645	3300046474	Bacteria	1557
1715	Ga0495605_0113012	3300046474	Bacteria	1237
1716	Ga0495639_0009801	3300046475	Bacteria	4112
1717	Ga0495639_0214208	3300046475	Bacteria	946
1718	Ga0495664_0226002	3300046477	Bacteria	1133
1719	Ga0495584_0000004	3300046491	Bacteria	314714
1720	Ga0495584_0000073	3300046491	Bacteria	72062
1721	Ga0495584_0006926	3300046491	Bacteria	5924
1722	Ga0495584_0024810	3300046491	Bacteria	3040
1723	Ga0495584_0027126	3300046491	Bacteria	2902
1724	Ga0495584_0057248	3300046491	Bacteria	1961
1725	Ga0495585_0000119	3300046492	Bacteria	85131
1726	Ga0495585_0000859	3300046492	Bacteria	25985
1727	Ga0495585_0001551	3300046492	Bacteria	17822
1728	Ga0495585_0001611	3300046492	Bacteria	17407
1729	Ga0495585_0002189	3300046492	Bacteria	14194
1730	Ga0495585_0006902	3300046492	Bacteria	6995
1731	Ga0495585_0018557	3300046492	Bacteria	4011
1732	Ga0495585_0018869	3300046492	Bacteria	3978
1733	Ga0495585_0029343	3300046492	Bacteria	3131
1734	Ga0495585_0033083	3300046492	Bacteria	2928
1735	Ga0495585_0034325	3300046492	Bacteria	2867
1736	Ga0495585_0047404	3300046492	Bacteria	2393
1737	Ga0495585_0069533	3300046492	Bacteria	1921
1738	Ga0495594_0024328	3300046499	Bacteria	3252
1739	Ga0495594_0107108	3300046499	Bacteria	1574
1740	Ga0495594_0223960	3300046499	Bacteria	1072
1741	Ga0495594_0441844	3300046499	Bacteria	739
1742	Ga0495596_0000968	3300046500	Bacteria	17100
1743	Ga0495596_0006160	3300046500	Bacteria	5566
1744	Ga0495596_0008411	3300046500	Bacteria	4595
1745	Ga0495596_0046646	3300046500	Bacteria	1701
1746	Ga0495596_0058545	3300046500	Bacteria	1502
1747	Ga0495596_0178879	3300046500	Bacteria	824
1748	Ga0495607_0009405	3300046501	Bacteria	6617
1749	Ga0495607_0011112	3300046501	Bacteria	6010
1750	Ga0495607_0013585	3300046501	Bacteria	5329
1751	Ga0495607_0034018	3300046501	Bacteria	3096
1752	Ga0495607_0036861	3300046501	Bacteria	2942
1753	Ga0495607_0037111	3300046501	Bacteria	2929
1754	Ga0495583_0000034	3300046506	Bacteria	246856
1755	Ga0495583_0000132	3300046506	Bacteria	125343
1756	Ga0495583_0000493	3300046506	Bacteria	57328
1757	Ga0495583_0001058	3300046506	Bacteria	30795
1758	Ga0495583_0006944	3300046506	Bacteria	7262
1759	Ga0495583_0010382	3300046506	Bacteria	5436
1760	Ga0495583_0048025	3300046506	Bacteria	1960
1761	Ga0495583_0050175	3300046506	Bacteria	1908
1762	Ga0495606_0018881	3300046507	Bacteria	5154
1763	Ga0495606_0035207	3300046507	Bacteria	3425
1764	Ga0495606_0052593	3300046507	Bacteria	2647
1765	Ga0495606_0111408	3300046507	Bacteria	1650
1766	Ga0495606_0135864	3300046507	Bacteria	1456
1767	Ga0495608_0007317	3300046511	Bacteria	7801
1768	Ga0495608_0034285	3300046511	Bacteria	3427
1769	Ga0495608_0035957	3300046511	Bacteria	3336
1770	Ga0495610_0001174	3300046512	Bacteria	23735
1771	Ga0495610_0059491	3300046512	Bacteria	1823
1772	Ga0495610_0107542	3300046512	Bacteria	1240
1773	Ga0495610_0173713	3300046512	Bacteria	901
1774	Ga0495616_0003730	3300046513	Bacteria	9718
1775	Ga0495616_0005975	3300046513	Bacteria	7426
1776	Ga0495616_0006125	3300046513	Bacteria	7322
1777	Ga0495616_0008804	3300046513	Bacteria	5944
1778	Ga0495616_0009471	3300046513	Bacteria	5690
1779	Ga0495616_0013452	3300046513	Bacteria	4615
1780	Ga0495616_0033516	3300046513	Bacteria	2675
1781	Ga0495616_0037201	3300046513	Bacteria	2505
1782	Ga0495616_0049417	3300046513	Bacteria	2108
1783	Ga0495616_0055832	3300046513	Bacteria	1953
1784	Ga0495616_0189603	3300046513	Bacteria	909
1785	Ga0495616_0270402	3300046513	Bacteria	724
1786	Ga0495616_0288978	3300046513	Bacteria	695
1787	Ga0495618_0056878	3300046514	Bacteria	2476
1788	Ga0495620_0002466	3300046515	Bacteria	10724
1789	Ga0495620_0098990	3300046515	Bacteria	1163
1790	Ga0495628_0001227	3300046516	Bacteria	23459
1791	Ga0495628_0002006	3300046516	Bacteria	18454
1792	Ga0495628_0021760	3300046516	Bacteria	5269
1793	Ga0495628_0094361	3300046516	Bacteria	2313
1794	Ga0495628_0133253	3300046516	Bacteria	1900
1795	Ga0495628_0293891	3300046516	Bacteria	1204
1796	Ga0495630_0083057	3300046517	Bacteria	2418
1797	Ga0495630_0094363	3300046517	Bacteria	2262
1798	Ga0495630_0703540	3300046517	Bacteria	773
1799	Ga0495631_0000272	3300046518	Bacteria	36059
1800	Ga0495631_0000791	3300046518	Bacteria	20226
1801	Ga0495631_0004715	3300046518	Bacteria	7206
1802	Ga0495631_0009008	3300046518	Bacteria	5001
1803	Ga0495631_0009119	3300046518	Bacteria	4968
1804	Ga0495631_0009648	3300046518	Bacteria	4812
1805	Ga0495631_0016867	3300046518	Bacteria	3468
1806	Ga0495631_0021879	3300046518	Bacteria	2975
1807	Ga0495631_0045428	3300046518	Bacteria	1934
1808	Ga0495631_0147493	3300046518	Bacteria	1009
1809	Ga0495632_0000017	3300046519	Bacteria	228941
1810	Ga0495632_0000252	3300046519	Bacteria	53265
1811	Ga0495632_0005292	3300046519	Bacteria	8572
1812	Ga0495632_0011802	3300046519	Bacteria	5084
1813	Ga0495632_0012223	3300046519	Bacteria	4959
1814	Ga0495632_0013586	3300046519	Bacteria	4639
1815	Ga0495632_0026212	3300046519	Bacteria	3072
1816	Ga0495632_0042736	3300046519	Bacteria	2270
1817	Ga0495632_0046979	3300046519	Bacteria	2143
1818	Ga0495632_0173821	3300046519	Bacteria	988
1819	Ga0495632_0244250	3300046519	Bacteria	807
1820	Ga0495637_0000003	3300046520	Bacteria	623293
1821	Ga0495637_0010369	3300046520	Bacteria	4511
1822	Ga0495637_0036167	3300046520	Bacteria	2152
1823	Ga0495643_0000399	3300046522	Bacteria	57013
1824	Ga0495643_0000764	3300046522	Bacteria	36033
1825	Ga0495643_0022803	3300046522	Bacteria	3565
1826	Ga0495643_0052018	3300046522	Bacteria	2201
1827	Ga0495643_0056519	3300046522	Bacteria	2094
1828	Ga0495643_0067872	3300046522	Bacteria	1877
1829	Ga0495643_0123728	3300046522	Bacteria	1304
1830	Ga0495643_0148711	3300046522	Bacteria	1161
1831	Ga0495644_0000831	3300046523	Bacteria	12737
1832	Ga0495644_0008295	3300046523	Bacteria	3999
1833	Ga0495644_0080256	3300046523	Bacteria	1229
1834	Ga0495644_0108574	3300046523	Bacteria	1052
1835	Ga0495644_0226340	3300046523	Bacteria	723
1836	Ga0495648_0000052	3300046524	Bacteria	162169
1837	Ga0495648_0007157	3300046524	Bacteria	8966
1838	Ga0495648_0012877	3300046524	Bacteria	6213
1839	Ga0495648_0018336	3300046524	Bacteria	4959
1840	Ga0495648_0030288	3300046524	Bacteria	3580
1841	Ga0495648_0031484	3300046524	Bacteria	3491
1842	Ga0495648_0051550	3300046524	Bacteria	2506
1843	Ga0495663_0004769	3300046525	Bacteria	3796
1844	Ga0495663_0156168	3300046525	Bacteria	781
1845	Ga0495666_0004516	3300046526	Bacteria	7030
1846	Ga0495642_0000382	3300046528	Bacteria	23967
1847	Ga0495642_0001035	3300046528	Bacteria	12914
1848	Ga0495642_0005660	3300046528	Bacteria	4797
1849	Ga0495642_0086813	3300046528	Bacteria	1321
1850	Ga0495642_0116559	3300046528	Bacteria	1144
1851	Ga0495642_0138920	3300046528	Bacteria	1048
1852	Ga0495652_0005308	3300046529	Bacteria	12152
1853	Ga0495652_0050484	3300046529	Bacteria	3555
1854	Ga0495652_0379897	3300046529	Bacteria	1005
1855	Ga0495654_0001208	3300046530	Bacteria	18401
1856	Ga0495654_0005229	3300046530	Bacteria	7569
1857	Ga0495654_0010327	3300046530	Bacteria	5080
1858	Ga0495654_0051076	3300046530	Bacteria	2018
1859	Ga0495665_0019765	3300046531	Bacteria	3622
1860	Ga0495665_0045855	3300046531	Bacteria	2322
1861	Ga0495640_0204081	3300046533	Bacteria	1252
1862	Ga0495586_0038879	3300046535	Bacteria	2557
1863	Ga0495587_0004310	3300046536	Bacteria	9395
1864	Ga0495587_0057695	3300046536	Bacteria	2282
1865	Ga0495587_0343412	3300046536	Bacteria	832
1866	Ga0495598_0046578	3300046537	Bacteria	1289
1867	Ga0495609_0000023	3300046538	Bacteria	269702
1868	Ga0495609_0000038	3300046538	Bacteria	182264
1869	Ga0495609_0006238	3300046538	Bacteria	6121
1870	Ga0495609_0019983	3300046538	Bacteria	3096
1871	Ga0495609_0022921	3300046538	Bacteria	2875
1872	Ga0495609_0059154	3300046538	Bacteria	1694
1873	Ga0495621_0023417	3300046539	Bacteria	2053
1874	Ga0495597_0000516	3300046542	Bacteria	31996
1875	Ga0495597_0004947	3300046542	Bacteria	7163
1876	Ga0495597_0028634	3300046542	Bacteria	2548
1877	Ga0495597_0051538	3300046542	Bacteria	1814
1878	Ga0495597_0159039	3300046542	Bacteria	923
1879	Ga0495645_0001792	3300046543	Bacteria	14572
1880	Ga0495645_0028629	3300046543	Bacteria	4049
1881	Ga0495645_0157374	3300046543	Bacteria	1573
1882	Ga0495645_0385035	3300046543	Bacteria	896
1883	Ga0495622_0011213	3300046557	Bacteria	4138
1884	Ga0495622_0016004	3300046557	Bacteria	3488
1885	Ga0495622_0065870	3300046557	Bacteria	1674
1886	Ga0495622_0074227	3300046557	Bacteria	1568
1887	Ga0495633_0003997	3300046558	Bacteria	9546
1888	Ga0495633_0008649	3300046558	Bacteria	5715
1889	Ga0495633_0015961	3300046558	Bacteria	3886
1890	Ga0495633_0016138	3300046558	Bacteria	3859
1891	Ga0495633_0023247	3300046558	Bacteria	3072
1892	Ga0495633_0024696	3300046558	Bacteria	2966
1893	Ga0495633_0044931	3300046558	Bacteria	2092
1894	Ga0495633_0056998	3300046558	Bacteria	1835
1895	Ga0495667_0219259	3300046559	Bacteria	1214
1896	Ga0495667_0376601	3300046559	Unclassified	895
1897	Ga0495656_0000646	3300046615	Bacteria	11165
1898	Ga0495656_0032961	3300046615	Bacteria	2111
1899	Ga0495656_0096322	3300046615	Bacteria	1361
1900	Ga0495656_0257294	3300046615	Bacteria	883
1901	Ga0495656_0345151	3300046615	Bacteria	770
1902	Ga0495656_0356818	3300046615	Bacteria	758
1903	Ga0495668_0000822	3300046616	Bacteria	35513
1904	Ga0495668_0001569	3300046616	Bacteria	21645
1905	Ga0495668_0018646	3300046616	Bacteria	4010
1906	Ga0495668_0030790	3300046616	Bacteria	3026
1907	Ga0495668_0031533	3300046616	Bacteria	2986
1908	Ga0495668_0040126	3300046616	Bacteria	2611
1909	Ga0495668_0286530	3300046616	Bacteria	902
1910	Ga0495634_0008989	3300046642	Bacteria	7394
1911	Ga0495611_0005203	3300046648	Bacteria	5575
1912	Ga0495611_0022675	3300046648	Bacteria	2717
1913	Ga0495611_0029855	3300046648	Bacteria	2393
1914	Ga0495611_0052362	3300046648	Bacteria	1841
1915	Ga0495625_0000950	3300046660	Bacteria	38751
1916	Ga0495625_0001672	3300046660	Bacteria	25960
1917	Ga0495625_0007721	3300046660	Bacteria	9310
1918	Ga0495625_0017800	3300046660	Bacteria	5554
1919	Ga0495625_0037554	3300046660	Bacteria	3553
1920	Ga0495625_0256381	3300046660	Bacteria	1133
1921	Ga0495625_0319340	3300046660	Bacteria	989
1922	Ga0495625_0536291	3300046660	Bacteria	710
1923	Ga0495635_0024618	3300046663	Bacteria	4195
1924	Ga0495635_0056883	3300046663	Bacteria	2692
1925	Ga0495635_0377982	3300046663	Bacteria	943
1926	Ga0495661_0000072	3300046665	Bacteria	120743
1927	Ga0495661_0001562	3300046665	Bacteria	18875
1928	Ga0495661_0001766	3300046665	Bacteria	17376
1929	Ga0495661_0007851	3300046665	Bacteria	7424
1930	Ga0495661_0017010	3300046665	Bacteria	4805
1931	Ga0495661_0048811	3300046665	Bacteria	2570
1932	Ga0495661_0051107	3300046665	Bacteria	2497
1933	Ga0495661_0055793	3300046665	Bacteria	2366
1934	Ga0495661_0061892	3300046665	Bacteria	2219
1935	Ga0495661_0068281	3300046665	Bacteria	2085
1936	Ga0495661_0074994	3300046665	Bacteria	1967
1937	Ga0495661_0107613	3300046665	Bacteria	1558
1938	Ga0495661_0282772	3300046665	Bacteria	835
1939	Ga0495661_0402261	3300046665	Bacteria	665
1940	Ga0495588_0000156	3300046674	Bacteria	93559
1941	Ga0495588_0020755	3300046674	Bacteria	3232
1942	Ga0495588_0033908	3300046674	Bacteria	2581
1943	Ga0495588_0055123	3300046674	Bacteria	2051
1944	Ga0495588_0074528	3300046674	Bacteria	1767
1945	Ga0495657_0005491	3300046675	Bacteria	10033
1946	Ga0495657_0104282	3300046675	Bacteria	1803
1947	Ga0495657_0189302	3300046675	Bacteria	1259
1948	Ga0495657_0273178	3300046675	Bacteria	1013
1949	Ga0495599_0016178	3300046678	Bacteria	4629
1950	Ga0495599_0016887	3300046678	Bacteria	4534
1951	Ga0495599_0060917	3300046678	Bacteria	2359
1952	Ga0495623_0019950	3300046679	Bacteria	4333
1953	Ga0495623_0254007	3300046679	Bacteria	987
1954	Ga0495646_0004004	3300046680	Bacteria	9228
1955	Ga0495646_0047627	3300046680	Bacteria	2608
1956	Ga0495647_0073897	3300046681	Unclassified	1370
1957	Ga0495658_0008742	3300046683	Bacteria	5030
1958	Ga0495658_0059340	3300046683	Bacteria	2190
1959	Ga0495658_0128234	3300046683	Bacteria	1542
1960	Ga0495658_0172524	3300046683	Bacteria	1339
1961	Ga0495658_0239182	3300046683	Bacteria	1140
1962	Ga0495669_0000032	3300046684	Bacteria	100472
1963	Ga0495669_0002103	3300046684	Bacteria	8161
1964	Ga0495669_0008657	3300046684	Bacteria	4282
1965	Ga0495669_0008828	3300046684	Bacteria	4246
1966	Ga0495669_0047937	3300046684	Bacteria	1910
1967	Ga0495669_0048032	3300046684	Bacteria	1908
1968	Ga0495669_0071843	3300046684	Bacteria	1578
1969	Ga0495613_0046310	3300046689	Bacteria	3216
1970	Ga0495624_0053297	3300046690	Bacteria	2554
1971	Ga0495624_0096613	3300046690	Bacteria	1820
1972	Ga0495624_0201788	3300046690	Bacteria	1208
1973	Ga0495624_0226600	3300046690	Bacteria	1133
1974	Ga0495670_0000920	3300046691	Bacteria	14206
1975	Ga0495670_0044456	3300046691	Bacteria	2217
1976	Ga0495670_0105717	3300046691	Bacteria	1453
1977	Ga0495671_0001885	3300046692	Bacteria	13469
1978	Ga0495671_0005567	3300046692	Bacteria	7360
1979	Ga0495671_0192073	3300046692	Bacteria	991
1980	Ga0495649_0000428	3300046694	Bacteria	36408
1981	Ga0495649_0002075	3300046694	Bacteria	14397
1982	Ga0495649_0005989	3300046694	Bacteria	7617
1983	Ga0495649_0007905	3300046694	Bacteria	6434
1984	Ga0495649_0008870	3300046694	Bacteria	6020
1985	Ga0495649_0008873	3300046694	Bacteria	6019
1986	Ga0495649_0038186	3300046694	Bacteria	2635
1987	Ga0495649_0051414	3300046694	Bacteria	2234
1988	Ga0495649_0061526	3300046694	Bacteria	2018
1989	Ga0495589_0000074	3300046794	Bacteria	93716
1990	Ga0495589_0000099	3300046794	Bacteria	83606
1991	Ga0495589_0013487	3300046794	Bacteria	4215
1992	Ga0495589_0016849	3300046794	Bacteria	3752
1993	Ga0495589_0044621	3300046794	Bacteria	2204
1994	Ga0495589_0164384	3300046794	Bacteria	1056
1995	Ga0495600_0001954	3300046809	Bacteria	11584
1996	Ga0495600_0030144	3300046809	Bacteria	3513
1997	Ga0495600_0090954	3300046809	Bacteria	1991
1998	Ga0495660_0000047	3300046810	Bacteria	149291
1999	Ga0495660_0013470	3300046810	Bacteria	4738
2000	Ga0495660_0013814	3300046810	Bacteria	4680
2001	Ga0495660_0026319	3300046810	Bacteria	3298
2002	Ga0495660_0044472	3300046810	Bacteria	2442
2003	Ga0495660_0064121	3300046810	Bacteria	1964
2004	Ga0495660_0131374	3300046810	Bacteria	1256
2005	Ga0495581_0024735	3300047315	Bacteria	3480
2006	Ga0495581_0049686	3300047315	Bacteria	2422
2007	Ga0495604_0045167	3300047317	Bacteria	3439
2008	Ga0495604_0051766	3300047317	Bacteria	3181
2009	Ga0495636_0022505	3300047318	Bacteria	2548
2010	Ga0495636_0100314	3300047318	Bacteria	1265
2011	Ga0495672_0000256	3300047320	Bacteria	74232
2012	Ga0495672_0000421	3300047320	Bacteria	50887
2013	Ga0495672_0000532	3300047320	Bacteria	43305
2014	Ga0495672_0036931	3300047320	Bacteria	2994
2015	Ga0495672_0038221	3300047320	Bacteria	2929
2016	Ga0495672_0041261	3300047320	Bacteria	2791
2017	Ga0495672_0057799	3300047320	Bacteria	2251
2018	Ga0495676_0000031	3300047321	Bacteria	132364
2019	Ga0495676_0015996	3300047321	Bacteria	6662
2020	Ga0495676_0072293	3300047321	Bacteria	2649
2021	Ga0495676_0073681	3300047321	Bacteria	2617
2022	Ga0495676_0130522	3300047321	Bacteria	1814
2023	Ga0495676_0167914	3300047321	Bacteria	1546
2024	Ga0495676_0469989	3300047321	Bacteria	828
2025	Ga0495680_0021336	3300047322	Bacteria	5423
2026	Ga0495683_0000211	3300047323	Bacteria	55182
2027	Ga0495683_0001058	3300047323	Bacteria	19080
2028	Ga0495683_0012086	3300047323	Bacteria	4538
2029	Ga0495683_0061577	3300047323	Bacteria	1858
2030	Ga0495683_0077634	3300047323	Bacteria	1623
2031	Ga0495683_0104525	3300047323	Bacteria	1358
2032	Ga0495683_0189299	3300047323	Bacteria	934
2033	Ga0495687_000071	3300047443	Bacteria	159096
2034	Ga0495687_000167	3300047443	Bacteria	97418
2035	Ga0495687_000238	3300047443	Bacteria	76186
2036	Ga0495687_000775	3300047443	Bacteria	34536
2037	Ga0495687_004764	3300047443	Bacteria	8963
2038	Ga0495687_013982	3300047443	Bacteria	4153
2039	Ga0495675_0066266	3300047444	Bacteria	2282
2040	Ga0495675_0175113	3300047444	Bacteria	1316
2041	Ga0495677_0000016	3300047445	Bacteria	126981
2042	Ga0495677_0008926	3300047445	Bacteria	3708
2043	Ga0495677_0011836	3300047445	Bacteria	3185
2044	Ga0495677_0023445	3300047445	Bacteria	2240
2045	Ga0495677_0033995	3300047445	Bacteria	1859
2046	Ga0495677_0038533	3300047445	Bacteria	1746
2047	Ga0495679_004470	3300047446	Bacteria	6435
2048	Ga0495679_018934	3300047446	Bacteria	2431
2049	Ga0495679_022846	3300047446	Bacteria	2133
2050	Ga0495681_0000455	3300047470	Bacteria	31371
2051	Ga0495681_0001167	3300047470	Bacteria	19943
2052	Ga0495681_0004083	3300047470	Bacteria	10043
2053	Ga0495681_0015442	3300047470	Bacteria	4319
2054	Ga0495681_0018928	3300047470	Bacteria	3777
2055	Ga0495681_0026068	3300047470	Bacteria	3052
2056	Ga0495681_0030938	3300047470	Bacteria	2717
2057	Ga0495681_0087430	3300047470	Bacteria	1382
2058	Ga0495681_0122857	3300047470	Bacteria	1112
2059	Ga0495681_0141390	3300047470	Bacteria	1016
2060	Ga0495684_0036446	3300047471	Bacteria	3771
2061	Ga0495684_0230707	3300047471	Bacteria	1354
2062	Ga0495684_0537550	3300047471	Bacteria	798
2063	Ga0495686_0000130	3300047472	Bacteria	152244
2064	Ga0495686_0001215	3300047472	Bacteria	29567
2065	Ga0495686_0014427	3300047472	Bacteria	5436
2066	Ga0495686_0210377	3300047472	Bacteria	1111
2067	Ga0495593_0008695	3300047673	Bacteria	5900
2068	Ga0495593_0028693	3300047673	Bacteria	3055
2069	Ga0495593_0034812	3300047673	Bacteria	2737
2070	Ga0495593_0099678	3300047673	Bacteria	1491
2071	Ga0495602_0044498	3300048088	Bacteria	4026
2072	Ga0495602_0057123	3300048088	Bacteria	3426
2073	Ga0495602_0062195	3300048088	Bacteria	3240
2074	Ga0495602_0062781	3300048088	Bacteria	3222
2075	Ga0495602_0321209	3300048088	Bacteria	1126
2076	Ga0495614_0035030	3300048089	Bacteria	2157
2077	Ga0495614_0087107	3300048089	Bacteria	1356
2078	Ga0495614_0156738	3300048089	Bacteria	1017
2079	Ga0495615_0004649	3300048090	Bacteria	2412
2080	Ga0495626_0000042	3300048091	Bacteria	169058
2081	Ga0495626_0002441	3300048091	Bacteria	12900
2082	Ga0495626_0009568	3300048091	Bacteria	5232
2083	Ga0495626_0010342	3300048091	Bacteria	4986
2084	Ga0495626_0017320	3300048091	Bacteria	3641
2085	Ga0495626_0022348	3300048091	Bacteria	3125
2086	Ga0495626_0034400	3300048091	Bacteria	2423
2087	Ga0495626_0037070	3300048091	Bacteria	2319
2088	Ga0495626_0043494	3300048091	Bacteria	2106
2089	Ga0495626_0133223	3300048091	Bacteria	1059
2090	Ga0495626_0148313	3300048091	Bacteria	990
2091	Ga0496100_0062349	3300048903	Bacteria	2460
2092	Ga0496100_0079522	3300048903	Bacteria	2209
2093	Ga0496101_0005231	3300048904	Bacteria	8256
2094	Ga0496101_0048808	3300048904	Bacteria	3043
2095	Ga0496101_0082422	3300048904	Bacteria	2380
2096	Ga0496101_0263203	3300048904	Bacteria	1345
2097	Ga0496101_0425976	3300048904	Bacteria	1046
2098	Ga0496102_0051648	3300048905	Bacteria	3745
2099	Ga0496102_0088537	3300048905	Bacteria	2862
2100	Ga0496102_0109300	3300048905	Bacteria	2576
2101	Ga0496102_0166776	3300048905	Bacteria	2072
2102	Ga0496102_0187708	3300048905	Bacteria	1948
2103	Ga0496102_0205369	3300048905	Bacteria	1857
2104	Ga0496102_0245981	3300048905	Bacteria	1686
2105	Ga0496103_0014199	3300048906	Bacteria	4728
2106	Ga0496103_0036090	3300048906	Bacteria	3027
2107	Ga0496103_0135877	3300048906	Bacteria	1571
2108	Ga0496103_0271541	3300048906	Bacteria	1091
2109	Ga0496104_0023214	3300048907	Bacteria	5703
2110	Ga0496104_0035495	3300048907	Bacteria	4655
2111	Ga0496104_0108684	3300048907	Bacteria	2658
2112	Ga0496104_0173705	3300048907	Bacteria	2065
2113	Ga0496104_0412861	3300048907	Bacteria	1262
2114	Ga0496105_0004053	3300048908	Bacteria	10967
2115	Ga0496105_0144873	3300048908	Bacteria	1954
2116	Ga0496106_0008554	3300048909	Bacteria	7572
2117	Ga0496106_0009081	3300048909	Bacteria	7347
2118	Ga0496106_0049394	3300048909	Bacteria	3169
2119	Ga0496106_0087145	3300048909	Bacteria	2405
2120	Ga0496106_0233650	3300048909	Bacteria	1468
2121	Ga0496107_0063908	3300048910	Bacteria	2668
2122	Ga0496107_0128972	3300048910	Bacteria	1866
2123	Ga0496107_0425478	3300048910	Bacteria	987
2124	Ga0496107_0463229	3300048910	Bacteria	941
2125	Ga0496108_0071225	3300048911	Bacteria	2933
2126	Ga0496108_0116603	3300048911	Bacteria	2288
2127	Ga0496108_0208034	3300048911	Bacteria	1698
2128	Ga0496109_0096150	3300048912	Bacteria	2744
2129	Ga0496109_0156251	3300048912	Bacteria	2136
2130	Ga0496109_0272233	3300048912	Bacteria	1595
2131	Ga0496109_0309046	3300048912	Bacteria	1491
2132	Ga0496109_0370820	3300048912	Bacteria	1352
2133	Ga0496109_0410009	3300048912	Bacteria	1280
2134	Ga0496109_0590962	3300048912	Bacteria	1046
2135	Ga0496109_0641087	3300048912	Bacteria	999
2136	Ga0496110_0001119	3300048913	Bacteria	18923
2137	Ga0496110_0122033	3300048913	Bacteria	2348
2138	Ga0496110_0176636	3300048913	Bacteria	1938
2139	Ga0496110_0181965	3300048913	Bacteria	1908
2140	Ga0496110_0270221	3300048913	Bacteria	1548
2141	Ga0496110_0318517	3300048913	Bacteria	1416
2142	Ga0496111_0017568	3300048914	Bacteria	4945
2143	Ga0496111_0133054	3300048914	Bacteria	1841
2144	Ga0496111_0386493	3300048914	Bacteria	1035
2145	Ga0496112_0004885	3300048915	Bacteria	11462
2146	Ga0496112_0170140	3300048915	Bacteria	2144
2147	Ga0496112_0328783	3300048915	Bacteria	1473
2148	Ga0496112_0429739	3300048915	Bacteria	1259
2149	Ga0496112_0584967	3300048915	Bacteria	1049
2150	Ga0496113_0002985	3300048916	Bacteria	10015
2151	Ga0496113_0034910	3300048916	Bacteria	3673
2152	Ga0496113_0108262	3300048916	Bacteria	2160
2153	Ga0496114_0013611	3300048917	Bacteria	6524
2154	Ga0496114_0038355	3300048917	Bacteria	3964
2155	Ga0496114_0165167	3300048917	Bacteria	1927
2156	Ga0496114_0203027	3300048917	Bacteria	1736
2157	Ga0496114_0374886	3300048917	Bacteria	1260
2158	Ga0496114_0434398	3300048917	Bacteria	1163
2159	Ga0496114_0481194	3300048917	Bacteria	1098
2160	Ga0496115_0109513	3300048918	Bacteria	2268
2161	Ga0496116_0000239	3300048919	Bacteria	100609
2162	Ga0496116_0025714	3300048919	Bacteria	4322
2163	Ga0496116_0045013	3300048919	Bacteria	2991
2164	Ga0496117_0000553	3300048920	Bacteria	61439
2165	Ga0496117_0013061	3300048920	Bacteria	7270
2166	Ga0496117_0015225	3300048920	Bacteria	6575
2167	Ga0496118_0007283	3300048921	Bacteria	11780
2168	Ga0496118_0007370	3300048921	Bacteria	11680
2169	Ga0496118_0025618	3300048921	Bacteria	5049
2170	Ga0496119_0063738	3300048922	Bacteria	2191
2171	Ga0496121_0000262	3300048924	Bacteria	109686
2172	Ga0496121_0013420	3300048924	Bacteria	8804
2173	Ga0496121_0020087	3300048924	Bacteria	6636
2174	Ga0496121_0063204	3300048924	Bacteria	3027
2175	Ga0496121_0089713	3300048924	Bacteria	2406
2176	Ga0496121_0101785	3300048924	Bacteria	2214
2177	Ga0496121_0101817	3300048924	Bacteria	2214
2178	Ga0496121_0241065	3300048924	Bacteria	1260
2179	Ga0496121_0331363	3300048924	Bacteria	1021
2180	Ga0496121_0350396	3300048924	Bacteria	983
2181	Ga0496122_0000482	3300048925	Bacteria	82868
2182	Ga0496122_0022840	3300048925	Bacteria	5541
2183	Ga0496122_0037643	3300048925	Bacteria	3890
2184	Ga0496122_0044239	3300048925	Bacteria	3478
2185	Ga0496122_0183788	3300048925	Bacteria	1243
2186	Ga0496123_0000662	3300048926	Bacteria	56930
2187	Ga0496123_0001108	3300048926	Bacteria	40430
2188	Ga0496123_0025307	3300048926	Bacteria	4478
2189	Ga0496123_0070033	3300048926	Bacteria	2198
2190	Ga0496124_0000073	3300048927	Bacteria	219306
2191	Ga0496124_0000108	3300048927	Bacteria	167473
2192	Ga0496124_0021958	3300048927	Bacteria	5869
2193	Ga0496124_0054980	3300048927	Bacteria	3367
2194	Ga0496124_0057704	3300048927	Bacteria	3270
2195	Ga0496124_0082415	3300048927	Bacteria	2640
2196	Ga0496124_0083503	3300048927	Bacteria	2620
2197	Ga0496124_0151527	3300048927	Bacteria	1818
2198	Ga0496125_0001380	3300048928	Bacteria	35616
2199	Ga0496125_0005865	3300048928	Bacteria	13487
2200	Ga0496125_0008324	3300048928	Bacteria	10885
2201	Ga0496125_0012862	3300048928	Bacteria	8270
2202	Ga0496125_0068640	3300048928	Bacteria	2787
2203	Ga0496125_0100067	3300048928	Bacteria	2138
2204	Ga0496125_0140767	3300048928	Bacteria	1678
2205	Ga0496125_0154915	3300048928	Bacteria	1567
2206	Ga0496126_0079885	3300048929	Bacteria	2895
2207	Ga0496126_0148644	3300048929	Bacteria	2010
2208	Ga0501308_000174	3300049128	Bacteria	3516
2209	Ga0495678_000353	3300049459	Bacteria	47333
2210	Ga0495678_000462	3300049459	Bacteria	40442
2211	Ga0495678_000660	3300049459	Bacteria	31650
2212	Ga0495678_000868	3300049459	Bacteria	26928
2213	Ga0495678_008424	3300049459	Bacteria	5201
2214	Ga0495682_0000226	3300049460	Bacteria	44179
2215	Ga0501292_006409	3300049515	Bacteria	1670
2216	Ga0501298_061517	3300049521	Bacteria	796
2217	Ga0501300_002049	3300049523	Bacteria	3006
2218	Ga0501311_025932	3300049527	Bacteria	824
2219	Ga0501318_025000	3300049534	Bacteria	780
2220	Ga0501034_0077417	3300049571	Bacteria	3332
2221	Ga0501034_0096969	3300049571	Bacteria	2944
2222	Ga0501034_0311554	3300049571	Bacteria	1508
2223	Ga0501037_0473992	3300049573	Bacteria	852
2224	Ga0501038_0412693	3300049574	Bacteria	1043
2225	Ga0501043_0000002	3300049579	Bacteria	351081
2226	Ga0501046_0000008	3300049580	Bacteria	351167
2227	Ga0501047_0000003	3300049581	Bacteria	508375
2228	Ga0501047_0047097	3300049581	Bacteria	4166
2229	Ga0501047_0216864	3300049581	Bacteria	1770
2230	Ga0501048_0078742	3300049582	Bacteria	2326
2231	Ga0501048_0093101	3300049582	Bacteria	2126
2232	Ga0501070_0067442	3300049586	Bacteria	2963
2233	Ga0501073_0008581	3300049589	Bacteria	7574
2234	Ga0501073_0142367	3300049589	Bacteria	1662
2235	Ga0501198_000024	3300049649	Bacteria	67171
2236	Ga0501206_009866	3300049653	Bacteria	1273
2237	Ga0501207_005913	3300049654	Bacteria	1706
2238	Ga0501208_032322	3300049655	Bacteria	931
2239	Ga0501211_003535	3300049658	Bacteria	1606
2240	Ga0501211_007252	3300049658	Bacteria	1090
2241	Ga0501217_016764	3300049661	Bacteria	1683
2242	Ga0501222_000020	3300049662	Bacteria	67164
2243	Ga0501222_005849	3300049662	Bacteria	1655
2244	Ga0501222_026782	3300049662	Bacteria	783
2245	Ga0501223_034244	3300049663	Bacteria	988
2246	Ga0501223_048755	3300049663	Bacteria	822
2247	Ga0501227_001594	3300049665	Bacteria	5056
2248	Ga0501249_005254	3300049679	Bacteria	2646
2249	Ga0501257_066310	3300049686	Bacteria	917
2250	Ga0501225_0009291	3300049705	Bacteria	2802
2251	Ga0501229_004190	3300049706	Bacteria	1748
2252	Ga0501080_0011645	3300049742	Bacteria	8054
2253	Ga0501232_007291	3300049757	Bacteria	1162
2254	Ga0501265_002284	3300049762	Bacteria	2173
2255	Ga0501269_002550	3300049766	Bacteria	2234
2256	Ga0501281_01350	3300049777	Bacteria	1949
2257	Ga0501035_0003996	3300049822	Bacteria	14068
2258	Ga0501035_0033897	3300049822	Bacteria	4642
2259	Ga0501044_0000086	3300049823	Bacteria	114287
2260	Ga0501044_0252644	3300049823	Bacteria	1703
2261	Ga0501044_0959767	3300049823	Bacteria	728
2262	Ga0501045_0003417	3300049824	Bacteria	10864
2263	nmdc:mga03683_108280_c1	3300050489	Bacteria	1226
2264	nmdc:mga03683_113214_c1	3300050489	Bacteria	1201
2265	nmdc:mga03683_210910_c1	3300050489	Bacteria	894
2266	nmdc:mga03683_24118_c1	3300050489	Bacteria	2377
2267	nmdc:mga03683_3463_c1	3300050489	Bacteria	5097
2268	nmdc:mga03683_3784_c1	3300050489	Bacteria	4935
2269	nmdc:mga03683_4639_c1	3300050489	Bacteria	4577
2270	nmdc:mga03n38_192656_c1	3300050490	Bacteria	1051
2271	nmdc:mga03n38_29675_c1	3300050490	Bacteria	2292
2272	nmdc:mga03n38_35682_c1	3300050490	Bacteria	2132
2273	nmdc:mga00v17_161866_c1	3300050491	Bacteria	1441
2274	nmdc:mga00v17_170_c1	3300050491	Bacteria	38298
2275	nmdc:mga00v17_68878_c1	3300050491	Bacteria	2188
2276	nmdc:mga00v17_8095_c2	3300050491	Bacteria	2510
2277	nmdc:mga0yw44_25142_c1	3300050492	Bacteria	3381
2278	nmdc:mga0yw44_59406_c1	3300050492	Bacteria	2339
2279	nmdc:mga0k408_108650_c1	3300050493	Bacteria	1639
2280	nmdc:mga0k408_113417_c1	3300050493	Bacteria	1603
2281	nmdc:mga0k408_140891_c1	3300050493	Bacteria	1435
2282	nmdc:mga0k408_15012_c1	3300050493	Bacteria	4280
2283	nmdc:mga0k408_16277_c1	3300050493	Bacteria	4124
2284	nmdc:mga0k408_213_c1	3300050493	Bacteria	31180
2285	nmdc:mga0k408_2586_c1	3300050493	Bacteria	9608
2286	nmdc:mga0k408_2734_c1	3300050493	Bacteria	9371
2287	nmdc:mga0k408_2741_c1	3300050493	Bacteria	9364
2288	nmdc:mga0k408_28547_c1	3300050493	Bacteria	3173
2289	nmdc:mga0k408_302_c1	3300050493	Bacteria	26707
2290	nmdc:mga0k408_314404_c1	3300050493	Bacteria	935
2291	nmdc:mga0k408_32697_c1	3300050493	Bacteria	2971
2292	nmdc:mga0k408_344377_c1	3300050493	Bacteria	889
2293	nmdc:mga0k408_40308_c1	3300050493	Bacteria	2686
2294	nmdc:mga0k408_48946_c1	3300050493	Bacteria	2447
2295	nmdc:mga0k408_52541_c1	3300050493	Bacteria	2362
2296	nmdc:mga0k408_66578_c1	3300050493	Bacteria	2098
2297	nmdc:mga0k408_93384_c1	3300050493	Bacteria	1769
2298	nmdc:mga06z11_199198_c1	3300050494	Bacteria	1162
2299	nmdc:mga06z11_208695_c1	3300050494	Bacteria	1137
2300	nmdc:mga06z11_5393_c1	3300050494	Bacteria	5126
2301	nmdc:mga06z11_59620_c1	3300050494	Bacteria	1984
2302	nmdc:mga06z11_79587_c1	3300050494	Bacteria	1755
2303	nmdc:mga04h51_110553_c1	3300050495	Bacteria	1012
2304	nmdc:mga04h51_111787_c1	3300050495	Bacteria	1008
2305	nmdc:mga04h51_12857_c1	3300050495	Bacteria	2359
2306	nmdc:mga04h51_61158_c1	3300050495	Bacteria	1291
2307	nmdc:mga07m45_110700_c1	3300050496	Bacteria	1581
2308	nmdc:mga07m45_171854_c1	3300050496	Bacteria	1260
2309	nmdc:mga07m45_19627_c1	3300050496	Bacteria	3664
2310	nmdc:mga07m45_203935_c1	3300050496	Bacteria	1151
2311	nmdc:mga07m45_24195_c1	3300050496	Bacteria	3325
2312	nmdc:mga07m45_25655_c1	3300050496	Bacteria	3234
2313	nmdc:mga07m45_26799_c1	3300050496	Bacteria	3170
2314	nmdc:mga07m45_3613_c1	3300050496	Bacteria	7473
2315	nmdc:mga07m45_4636_c1	3300050496	Bacteria	6743
2316	nmdc:mga07m45_5424_c1	3300050496	Bacteria	6347
2317	nmdc:mga07m45_54758_c1	3300050496	Bacteria	2254
2318	nmdc:mga07m45_58494_c1	3300050496	Bacteria	2181
2319	nmdc:mga07m45_6318_c1	3300050496	Bacteria	5985
2320	nmdc:mga07m45_6363_c1	3300050496	Bacteria	4415
2321	nmdc:mga07m45_7565_c1	3300050496	Bacteria	5555
2322	nmdc:mga07m45_769_c1	3300050496	Bacteria	13783
2323	nmdc:mga07m45_847_c1	3300050496	Bacteria	13276
2324	nmdc:mga05p37_273235_c1	3300050507	Bacteria	2018
2325	nmdc:mga09592_161914_c1	3300050508	Bacteria	1933
2326	nmdc:mga09592_347153_c1	3300050508	Bacteria	1284
2327	nmdc:mga08y16_27_c1	3300050511	Bacteria	214573
2328	nmdc:mga08y16_75525_c1	3300050511	Bacteria	3513
2329	nmdc:mga08y16_892651_c1	3300050511	Bacteria	875
2330	nmdc:mga0n895_220842_c1	3300050512	Bacteria	1924
2331	nmdc:mga0n895_246521_c1	3300050512	Bacteria	1813
2332	nmdc:mga0rr50_14961_c1	3300050513	Bacteria	5109
2333	nmdc:mga0rr50_444160_c1	3300050513	Bacteria	1099
2334	nmdc:mga0rr50_5257_c1	3300050513	Bacteria	7702
2335	nmdc:mga0rr50_593957_c1	3300050513	Bacteria	944
2336	nmdc:mga0rr50_6956_c1	3300050513	Bacteria	6936
2337	nmdc:mga08x19_27425_c1	3300050514	Bacteria	3562
2338	nmdc:mga08x19_514680_c1	3300050514	Bacteria	845
2339	nmdc:mga0sz30_30187_c1	3300050516	Bacteria	2239
2340	Ga0495601_0030951	3300053077	Bacteria	3326
2341	Ga0495601_0067508	3300053077	Bacteria	2278
2342	Ga0495601_0067565	3300053077	Bacteria	2278
2343	Ga0500610_0038379	3300053079	Bacteria	2468
2344	Ga0500610_0163456	3300053079	Bacteria	1105
2345	Ga0500635_0000008	3300053080	Bacteria	167327
2346	Ga0495655_0001045	3300053083	Bacteria	4268
2347	Ga0495595_0053453	3300053084	Bacteria	1876
2348	Ga0495619_0011475	3300053085	Bacteria	5585
2349	Ga0500578_0000025	3300053086	Bacteria	151485
2350	Ga0500578_0019420	3300053086	Bacteria	4364
2351	Ga0500578_0177070	3300053086	Bacteria	1316
2352	Ga0500643_025592	3300053087	Bacteria	1859
2353	Ga0500644_0005645	3300053088	Bacteria	3163
2354	Ga0500644_0007282	3300053088	Bacteria	2876
2355	Ga0500583_0114293	3300053092	Bacteria	1332
2356	Ga0500651_0000347	3300053093	Bacteria	26028
2357	Ga0500651_0007319	3300053093	Bacteria	6442
2358	Ga0500651_0126864	3300053093	Bacteria	1545
2359	Ga0500651_0171760	3300053093	Bacteria	1291
2360	Ga0500641_0076517	3300053096	Bacteria	1415
2361	Ga0500650_0047704	3300053098	Bacteria	1986
2362	Ga0500562_020379	3300053108	Bacteria	1721
2363	Ga0500571_013161	3300053110	Bacteria	4605
2364	Ga0500593_000047	3300053117	Bacteria	42992
2365	Ga0500593_001062	3300053117	Bacteria	9919
2366	Ga0500593_001145	3300053117	Bacteria	9554
2367	Ga0500607_017870	3300053121	Bacteria	4035
2368	Ga0500607_150388	3300053121	Bacteria	1080
2369	Ga0500608_008119	3300053122	Bacteria	4392
2370	Ga0500608_050703	3300053122	Bacteria	1994
2371	Ga0500618_002784	3300053125	Bacteria	6340
2372	Ga0500652_000177	3300053131	Bacteria	24784
2373	Ga0500652_015172	3300053131	Bacteria	2775
2374	Ga0500655_006394	3300053133	Bacteria	2121
2375	Ga0500658_0000560	3300053134	Bacteria	15661
2376	Ga0500559_0000013	3300053136	Bacteria	163436
2377	Ga0500559_0045153	3300053136	Bacteria	1928
2378	Ga0500568_0038908	3300053139	Bacteria	1923
2379	Ga0500568_0061262	3300053139	Bacteria	1455
2380	Ga0500574_002285	3300053141	Bacteria	3119
2381	Ga0500574_008596	3300053141	Bacteria	2179
2382	Ga0500616_0018646	3300053153	Bacteria	3920
2383	Ga0500619_000032	3300053154	Bacteria	44712
2384	Ga0500619_003040	3300053154	Bacteria	3356
2385	Ga0500622_0002547	3300053156	Bacteria	13059
2386	Ga0500622_0003359	3300053156	Bacteria	10781
2387	Ga0500627_0019181	3300053158	Bacteria	2720
2388	Ga0500634_0024759	3300053161	Bacteria	3266
2389	Ga0500570_042244	3300053724	Bacteria	2372
2390	Ga0500645_001112	3300053730	Bacteria	14708
2391	Ga0500645_005684	3300053730	Bacteria	4553
2392	Ga0500645_017475	3300053730	Bacteria	2248
2393	Ga0500645_019096	3300053730	Bacteria	2135
2394	Ga0590071_007597	3300059421	Bacteria	2565
2395	Ga0590075_008347	3300059424	Bacteria	2473
2396	Ga0587073_0077871	3300059492	Bacteria	816
2397	Ga0587077_062537	3300059493	Bacteria	810
2398	Ga0587080_031267	3300059503	Bacteria	929
2399	Ga0587088_029625	3300059508	Bacteria	970
2400	Ga0587090_064642	3300059510	Bacteria	702
2401	Ga0587091_020515	3300059511	Bacteria	1148
2402	Ga0587094_029273	3300059513	Bacteria	846
2403	Ga0587098_002320	3300059604	Bacteria	1592
2404	Ga0587129_004738	3300059608	Bacteria	906
2405	Ga0587101_035658	3300059623	Bacteria	798
2406	Ga0587062_006669	3300059639	Bacteria	1320
2407	Ga0587067_026328	3300059640	Bacteria	1041
2408	Ga0587068_031431	3300059641	Bacteria	922
2409	Ga0587076_014022	3300059645	Bacteria	1226
2410	Ga0587079_046995	3300059647	Bacteria	893
2411	Ga0587105_006486	3300059651	Bacteria	805
2412	Ga0587111_0010618	3300060346	Bacteria	1585
2413	Ga0587111_0079511	3300060346	Bacteria	781
2414	Ga0501082_0388127	3300060353	Bacteria	1218
2415	Ga0466962_0005789	3300061719	Bacteria	5938
2416	Ga0466962_0027384	3300061719	Bacteria	2735
2417	Ga0466962_0029686	3300061719	Bacteria	2617
2418	Ga0466962_0039862	3300061719	Bacteria	2248

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300005355	Ga0070671_100292791	Ga0070671_1002927912	152
2	3300045051	Ga0451576_1262246	Ga0451576_1262246_212_691	155
3	3300005539	Ga0068853_100926093	Ga0068853_1009260931	172
4	3300005539	Ga0068853_100926094	Ga0068853_1009260941	172
5	3300005547	Ga0070693_100034414	Ga0070693_1000344141	172
6	3300009093	Ga0105240_10013981	Ga0105240_100139819	172
7	3300025913	Ga0207695_10007397	Ga0207695_100073976	172
8	3300026041	Ga0207639_10000006	Ga0207639_10000006369	172
9	3300035725	Ga0373947_0438489	Ga0373947_0438489_110_703	175
10	3300037418	Ga0395900_1071263	Ga0395900_1071263_17_595	176
11	3300005456	Ga0070678_100335203	Ga0070678_1003352032	178
12	3300014969	Ga0157376_10301903	Ga0157376_103019032	178
13	3300025940	Ga0207691_10148675	Ga0207691_101486753	178
14	3300046615	Ga0495656_0000646	Ga0495656_0000646_7043_7672	178
15	3300031548	Ga0307408_100254451	Ga0307408_1002544512	179
16	3300031731	Ga0307405_10035608	Ga0307405_100356082	179
17	3300031911	Ga0307412_10023379	Ga0307412_100233795	179
18	3300031995	Ga0307409_100001998	Ga0307409_10000199815	179
19	3300032002	Ga0307416_100041495	Ga0307416_1000414952	179
20	3300032005	Ga0307411_10013248	Ga0307411_100132483	179
21	3300005456	Ga0070678_100082714	Ga0070678_1000827142	180
22	3300005577	Ga0068857_100788626	Ga0068857_1007886261	180
23	3300026116	Ga0207674_10859661	Ga0207674_108596612	180
24	3300026121	Ga0207683_10040526	Ga0207683_100405262	180
25	3300031456	Ga0307513_10102595	Ga0307513_101025953	180
26	3300039450	Ga0436363_1064835	Ga0436363_1064835_11740_12288	180
27	3300005327	Ga0070658_11102002	Ga0070658_111020021	181
28	3300005330	Ga0070690_100818087	Ga0070690_1008180871	181
29	3300005333	Ga0070677_10277695	Ga0070677_102776951	181
30	3300005354	Ga0070675_100377327	Ga0070675_1003773271	181
31	3300005355	Ga0070671_100290449	Ga0070671_1002904492	181
32	3300005364	Ga0070673_100469285	Ga0070673_1004692852	181
33	3300005456	Ga0070678_100160522	Ga0070678_1001605222	181
34	3300005543	Ga0070672_100628873	Ga0070672_1006288732	181
35	3300005547	Ga0070693_100123055	Ga0070693_1001230552	181
36	3300005564	Ga0070664_100397149	Ga0070664_1003971492	181
37	3300005616	Ga0068852_100745178	Ga0068852_1007451782	181
38	3300009553	Ga0105249_10047324	Ga0105249_100473243	181
39	3300025903	Ga0207680_10134990	Ga0207680_101349902	181
40	3300025907	Ga0207645_10276710	Ga0207645_102767101	181
41	3300025920	Ga0207649_10269012	Ga0207649_102690122	181
42	3300025925	Ga0207650_10729062	Ga0207650_107290621	181
43	3300025940	Ga0207691_10354512	Ga0207691_103545121	181
44	3300025945	Ga0207679_10263780	Ga0207679_102637802	181
45	3300026121	Ga0207683_10361740	Ga0207683_103617401	181
46	3300035083	Ga0373926_0180231	Ga0373926_0180231_44_667	181
47	3300035112	Ga0373932_0000069	Ga0373932_0000069_11242_11832	181
48	3300035171	Ga0373946_0041021	Ga0373946_0041021_407_1030	181
49	3300037068	Ga0373925_0115295	Ga0373925_0115295_192_815	181
50	3300046683	Ga0495658_0059340	Ga0495658_0059340_1365_1988	181
51	3300047471	Ga0495684_0537550	Ga0495684_0537550_146_769	181
52	3300005331	Ga0070670_100101803	Ga0070670_1001018033	182
53	3300005331	Ga0070670_100220575	Ga0070670_1002205752	182
54	3300005335	Ga0070666_10039968	Ga0070666_100399682	182
55	3300005336	Ga0070680_100061816	Ga0070680_1000618163	182
56	3300005338	Ga0068868_100097187	Ga0068868_1000971873	182
57	3300005347	Ga0070668_100041330	Ga0070668_1000413302	182
58	3300005353	Ga0070669_100030898	Ga0070669_1000308984	182
59	3300005354	Ga0070675_100587267	Ga0070675_1005872672	182
60	3300005355	Ga0070671_100007825	Ga0070671_1000078259	182
61	3300005441	Ga0070700_100174215	Ga0070700_1001742152	182
62	3300005455	Ga0070663_100546677	Ga0070663_1005466772	182
63	3300005456	Ga0070678_100010968	Ga0070678_1000109683	182
64	3300005456	Ga0070678_100304503	Ga0070678_1003045032	182
65	3300005458	Ga0070681_10020040	Ga0070681_100200408	182
66	3300005530	Ga0070679_100025716	Ga0070679_1000257166	182
67	3300005535	Ga0070684_100420459	Ga0070684_1004204592	182
68	3300005543	Ga0070672_100279376	Ga0070672_1002793761	182
69	3300005543	Ga0070672_100338749	Ga0070672_1003387492	182
70	3300005547	Ga0070693_100665736	Ga0070693_1006657361	182
71	3300005548	Ga0070665_101191133	Ga0070665_1011911332	182
72	3300005564	Ga0070664_100355510	Ga0070664_1003555102	182
73	3300005616	Ga0068852_100146397	Ga0068852_1001463972	182
74	3300005618	Ga0068864_100045780	Ga0068864_1000457802	182
75	3300005841	Ga0068863_100092780	Ga0068863_1000927803	182
76	3300005842	Ga0068858_100091601	Ga0068858_1000916014	182
77	3300005843	Ga0068860_100068406	Ga0068860_1000684062	182
78	3300005844	Ga0068862_100100307	Ga0068862_1001003073	182
79	3300006358	Ga0068871_100249539	Ga0068871_1002495391	182
80	3300006881	Ga0068865_100052251	Ga0068865_1000522512	182
81	3300009177	Ga0105248_10043852	Ga0105248_100438522	182
82	3300013306	Ga0163162_10087416	Ga0163162_100874163	182
83	3300013308	Ga0157375_10035151	Ga0157375_100351513	182
84	3300013308	Ga0157375_10476078	Ga0157375_104760782	182
85	3300014968	Ga0157379_10078014	Ga0157379_100780142	182
86	3300025315	Ga0207697_10022554	Ga0207697_100225543	182
87	3300025912	Ga0207707_10114144	Ga0207707_101141443	182
88	3300025917	Ga0207660_10062563	Ga0207660_100625632	182
89	3300025919	Ga0207657_10363868	Ga0207657_103638682	182
90	3300025921	Ga0207652_10277347	Ga0207652_102773471	182
91	3300025923	Ga0207681_10043811	Ga0207681_100438113	182
92	3300025925	Ga0207650_10333956	Ga0207650_103339562	182
93	3300025926	Ga0207659_10008963	Ga0207659_100089636	182
94	3300025931	Ga0207644_10002300	Ga0207644_100023008	182
95	3300025933	Ga0207706_10060483	Ga0207706_100604832	182
96	3300025938	Ga0207704_10210593	Ga0207704_102105931	182
97	3300025940	Ga0207691_10049674	Ga0207691_100496744	182
98	3300025940	Ga0207691_10063550	Ga0207691_100635502	182
99	3300025940	Ga0207691_10087785	Ga0207691_100877853	182
100	3300025941	Ga0207711_10005931	Ga0207711_100059316	182
101	3300025941	Ga0207711_10030778	Ga0207711_100307786	182
102	3300025942	Ga0207689_10016938	Ga0207689_100169384	182
103	3300025961	Ga0207712_10157469	Ga0207712_101574692	182
104	3300025986	Ga0207658_10016004	Ga0207658_100160047	182
105	3300026023	Ga0207677_10095075	Ga0207677_100950752	182
106	3300026067	Ga0207678_10089692	Ga0207678_100896922	182
107	3300026067	Ga0207678_10634402	Ga0207678_106344022	182
108	3300026089	Ga0207648_10022863	Ga0207648_100228634	182
109	3300026095	Ga0207676_10062711	Ga0207676_100627113	182
110	3300026118	Ga0207675_100009550	Ga0207675_1000095504	182
111	3300026121	Ga0207683_10039605	Ga0207683_100396054	182
112	3300026142	Ga0207698_10097101	Ga0207698_100971013	182
113	3300027378	Ga0209981_1001724	Ga0209981_10017242	182
114	3300027695	Ga0209966_1000008	Ga0209966_100000835	182
115	3300028379	Ga0268266_10682119	Ga0268266_106821191	182
116	3300028380	Ga0268265_10155670	Ga0268265_101556701	182
117	3300028381	Ga0268264_10011893	Ga0268264_100118937	182
118	3300041512	Ga0451853_0940956	Ga0451853_0940956_428_1015	182
119	3300044683	Ga0466965_0001255	Ga0466965_0001255_2773_3402	182
120	3300044901	Ga0466960_0001088	Ga0466960_0001088_2331_2960	182
121	3300046516	Ga0495628_0133253	Ga0495628_0133253_312_944	182
122	3300048917	Ga0496114_0038355	Ga0496114_0038355_2402_3025	182
123	3300050508	nmdc:mga09592_347153_c1	nmdc:mga09592_347153_c1_42_629	182
124	3300003322	rootL2_10003477	rootL2_1000347712	183
125	3300005288	Ga0065714_10031694	Ga0065714_100316942	183
126	3300005549	Ga0070704_100309787	Ga0070704_1003097872	183
127	3300005617	Ga0068859_100139308	Ga0068859_1001393084	183
128	3300006195	Ga0075366_10221180	Ga0075366_102211802	183
129	3300006931	Ga0097620_100139310	Ga0097620_1001393104	183
130	3300017792	Ga0163161_10015556	Ga0163161_100155566	183
131	3300025961	Ga0207712_10275946	Ga0207712_102759462	183
132	3300027907	Ga0207428_10057906	Ga0207428_100579063	183
133	3300028380	Ga0268265_11285007	Ga0268265_112850071	183
134	3300050511	nmdc:mga08y16_75525_c1	nmdc:mga08y16_75525_c1_1649_2236	183
135	3300005328	Ga0070676_10126351	Ga0070676_101263512	184
136	3300005616	Ga0068852_101576460	Ga0068852_1015764602	184
137	3300025901	Ga0207688_10042087	Ga0207688_100420873	184
138	3300025903	Ga0207680_10144417	Ga0207680_101444172	184
139	3300003775	Ga0055524_1000274	Ga0055524_100027417	185
140	3300005262	Ga0065165_1037216	Ga0065165_10372162	185
141	3300006948	Ga0099826_10000008	Ga0099826_1000000857	185
142	3300025263	Ga0209565_1005965	Ga0209565_10059654	185
143	3300025299	Ga0209256_1000018	Ga0209256_100001860	185
144	3300027666	Ga0209282_1000005	Ga0209282_100000557	185
145	3300046557	Ga0495622_0074227	Ga0495622_0074227_979_1542	185
146	3300025933	Ga0207706_10034754	Ga0207706_100347546	186
147	3300026116	Ga0207674_10409947	Ga0207674_104099472	186
148	3300044712	Ga0453684_0041490	Ga0453684_0041490_3926_4522	186
149	3300005458	Ga0070681_10003149	Ga0070681_1000314922	187
150	3300009174	Ga0105241_10427164	Ga0105241_104271642	187
151	3300025912	Ga0207707_10023079	Ga0207707_100230792	187
152	3300039437	Ga0436365_0791820	Ga0436365_0791820_81_656	187
153	3300046683	Ga0495658_0239182	Ga0495658_0239182_173_784	187
154	3300042007	Ga0439449_0023834	Ga0439449_0023834_499_1128	188
155	3300042015	Ga0439462_0112811	Ga0439462_0112811_30_659	188
156	3300048905	Ga0496102_0245981	Ga0496102_0245981_469_1035	188
157	iso_pu_bacteria	2593339131	2595089268	188
158	iso_pu_bacteria	2738543017	2739268476	188
159	iso_pu_bacteria	2757320391	2757565030	188
160	iso_pu_bacteria	2775507177	2777763997	188
161	iso_pu_bacteria	2775507192	2777835560	188
162	iso_pu_bacteria	2857586860	2857588502	188
163	iso_pu_bacteria	2936340661	2936343522	188
164	3300006178	Ga0075367_10042652	Ga0075367_100426523	189
165	3300037471	Ga0395905_0099391	Ga0395905_0099391_758_1345	189
166	3300038725	Ga0400484_17823	Ga0400484_17823_9216_9806	189
167	3300050493	nmdc:mga0k408_113417_c1	nmdc:mga0k408_113417_c1_110_706	189
168	3300050493	nmdc:mga0k408_40308_c1	nmdc:mga0k408_40308_c1_15_590	189
169	3300049586	Ga0501070_0067442	Ga0501070_0067442_221_799	190
170	3300028794	Ga0307515_10315740	Ga0307515_103157402	191
171	3300041456	Ga0451795_0542047	Ga0451795_0542047_38_613	191
172	3300053088	Ga0500644_0007282	Ga0500644_0007282_726_1346	191
173	iso_pu_bacteria	2881412998	2881415619	191
174	2162886012	MBSR1b_contig_5927048	MBSR1b_0502.00003610	192
175	3300003187	JGI25151J46595_10001029	JGI25151J46595_1000102917	192
176	3300003187	JGI25151J46595_10002886	JGI25151J46595_100028869	192
177	3300003187	JGI25151J46595_10003276	JGI25151J46595_100032764	192
178	3300003758	Ga0055532_1000004	Ga0055532_1000004452	192
179	3300003781	Ga0055536_1001456	Ga0055536_100145611	192
180	3300005293	Ga0065715_10133781	Ga0065715_101337812	192
181	3300005293	Ga0065715_10264815	Ga0065715_102648152	192
182	3300005295	Ga0065707_10317575	Ga0065707_103175751	192
183	3300005327	Ga0070658_10070483	Ga0070658_100704833	192
184	3300005329	Ga0070683_100000027	Ga0070683_10000002757	192
185	3300005329	Ga0070683_100659333	Ga0070683_1006593332	192
186	3300005329	Ga0070683_101401801	Ga0070683_1014018011	192
187	3300005331	Ga0070670_100000025	Ga0070670_10000002573	192
188	3300005331	Ga0070670_100504094	Ga0070670_1005040941	192
189	3300005333	Ga0070677_10109216	Ga0070677_101092161	192
190	3300005334	Ga0068869_100263376	Ga0068869_1002633761	192
191	3300005334	Ga0068869_100290958	Ga0068869_1002909582	192
192	3300005334	Ga0068869_100778080	Ga0068869_1007780801	192
193	3300005336	Ga0070680_100686543	Ga0070680_1006865432	192
194	3300005338	Ga0068868_100003285	Ga0068868_1000032856	192
195	3300005338	Ga0068868_100004641	Ga0068868_1000046418	192
196	3300005354	Ga0070675_100000011	Ga0070675_10000001111	192
197	3300005434	Ga0070709_10292685	Ga0070709_102926852	192
198	3300005441	Ga0070700_100000016	Ga0070700_10000001641	192
199	3300005530	Ga0070679_100281760	Ga0070679_1002817602	192
200	3300005535	Ga0070684_100011258	Ga0070684_1000112585	192
201	3300005543	Ga0070672_100003141	Ga0070672_1000031415	192
202	3300005577	Ga0068857_100013493	Ga0068857_1000134933	192
203	3300005578	Ga0068854_100174262	Ga0068854_1001742622	192
204	3300005618	Ga0068864_100000033	Ga0068864_100000033120	192
205	3300005840	Ga0068870_10317448	Ga0068870_103174482	192
206	3300006237	Ga0097621_100437917	Ga0097621_1004379172	192
207	3300006358	Ga0068871_100352602	Ga0068871_1003526022	192
208	3300006844	Ga0075428_100009243	Ga0075428_1000092439	192
209	3300006844	Ga0075428_100172591	Ga0075428_1001725913	192
210	3300006844	Ga0075428_100228332	Ga0075428_1002283322	192
211	3300006847	Ga0075431_100005849	Ga0075431_10000584911	192
212	3300006871	Ga0075434_100299060	Ga0075434_1002990602	192
213	3300007076	Ga0075435_100006134	Ga0075435_1000061347	192
214	3300007076	Ga0075435_100563487	Ga0075435_1005634872	192
215	3300009036	Ga0105244_10049052	Ga0105244_100490523	192
216	3300009094	Ga0111539_10000030	Ga0111539_1000003037	192
217	3300009098	Ga0105245_10000052	Ga0105245_10000052101	192
218	3300009176	Ga0105242_10007787	Ga0105242_100077872	192
219	3300009176	Ga0105242_10560450	Ga0105242_105604502	192
220	3300009551	Ga0105238_10000002	Ga0105238_10000002282	192
221	3300013105	Ga0157369_10000431	Ga0157369_1000043144	192
222	3300013296	Ga0157374_10000016	Ga0157374_10000016128	192
223	3300013297	Ga0157378_10000948	Ga0157378_1000094813	192
224	3300013297	Ga0157378_10001650	Ga0157378_100016508	192
225	3300013308	Ga0157375_10000010	Ga0157375_10000010262	192
226	3300013308	Ga0157375_10000012	Ga0157375_10000012143	192
227	3300013308	Ga0157375_10000185	Ga0157375_1000018545	192
228	3300014326	Ga0157380_10014055	Ga0157380_100140552	192
229	3300014745	Ga0157377_10000004	Ga0157377_1000000485	192
230	3300014745	Ga0157377_10000041	Ga0157377_1000004172	192
231	3300014969	Ga0157376_10000018	Ga0157376_10000018116	192
232	3300021358	Ga0213873_10000724	Ga0213873_100007245	192
233	3300021384	Ga0213876_10002354	Ga0213876_1000235413	192
234	3300025229	Ga0209147_100010	Ga0209147_10001049	192
235	3300025728	Ga0207655_1036477	Ga0207655_10364773	192
236	3300025893	Ga0207682_10364985	Ga0207682_103649851	192
237	3300025909	Ga0207705_10049753	Ga0207705_100497532	192
238	3300025924	Ga0207694_10000001	Ga0207694_10000001284	192
239	3300025925	Ga0207650_10000117	Ga0207650_1000011782	192
240	3300025925	Ga0207650_10009692	Ga0207650_100096922	192
241	3300025925	Ga0207650_10418862	Ga0207650_104188621	192
242	3300025926	Ga0207659_10000003	Ga0207659_10000003402	192
243	3300025927	Ga0207687_10000005	Ga0207687_1000000516	192
244	3300025935	Ga0207709_10323165	Ga0207709_103231652	192
245	3300025940	Ga0207691_10007320	Ga0207691_100073205	192
246	3300025942	Ga0207689_10015904	Ga0207689_100159045	192
247	3300025942	Ga0207689_10020967	Ga0207689_100209672	192
248	3300025942	Ga0207689_10426979	Ga0207689_104269792	192
249	3300025944	Ga0207661_10000015	Ga0207661_10000015128	192
250	3300025944	Ga0207661_11389163	Ga0207661_113891631	192
251	3300025945	Ga0207679_10143731	Ga0207679_101437312	192
252	3300025981	Ga0207640_10000966	Ga0207640_100009667	192
253	3300026023	Ga0207677_10000002	Ga0207677_10000002126	192
254	3300026023	Ga0207677_10000075	Ga0207677_1000007530	192
255	3300026075	Ga0207708_10000005	Ga0207708_1000000541	192
256	3300026089	Ga0207648_10636712	Ga0207648_106367122	192
257	3300026095	Ga0207676_10000007	Ga0207676_10000007479	192
258	3300026116	Ga0207674_10031984	Ga0207674_100319842	192
259	3300027907	Ga0207428_10000038	Ga0207428_1000003888	192
260	3300030521	Ga0307511_10001491	Ga0307511_100014913	192
261	3300031595	Ga0265313_10020122	Ga0265313_100201224	192
262	3300037853	Ga0436364_0023791	Ga0436364_0023791_289_876	192
263	3300039437	Ga0436365_0481100	Ga0436365_0481100_2739_3329	192
264	3300039453	Ga0436362_0953380	Ga0436362_0953380_3919_4509	192
265	3300045051	Ga0451576_0516686	Ga0451576_0516686_606_1196	192
266	3300048909	Ga0496106_0049394	Ga0496106_0049394_1511_2101	192
267	3300048915	Ga0496112_0429739	Ga0496112_0429739_340_930	192
268	3300049589	Ga0501073_0008581	Ga0501073_0008581_2792_3379	192
269	3300049742	Ga0501080_0011645	Ga0501080_0011645_4760_5347	192
270	3300050507	nmdc:mga05p37_273235_c1	nmdc:mga05p37_273235_c1_1311_1898	192
271	3300050511	nmdc:mga08y16_27_c1	nmdc:mga08y16_27_c1_79028_79615	192
272	3300050512	nmdc:mga0n895_246521_c1	nmdc:mga0n895_246521_c1_886_1473	192
273	3300050513	nmdc:mga0rr50_14961_c1	nmdc:mga0rr50_14961_c1_608_1195	192
274	3300050513	nmdc:mga0rr50_444160_c1	nmdc:mga0rr50_444160_c1_284_871	192
275	iso_pu_bacteria	2643221554	2643792566	192
276	iso_pu_bacteria	2643221638	2644216918	192
277	iso_pu_bacteria	8047673197	8047674666	192
278	3300002704	JGI25155J39150_1000022	JGI25155J39150_1000022129	193
279	3300002705	JGI25156J39149_1000005	JGI25156J39149_1000005121	193
280	3300002738	JGI25154J39366_1000017	JGI25154J39366_1000017113	193
281	3300002741	JGI25157J39369_1000003	JGI25157J39369_1000003129	193
282	3300005337	Ga0070682_100000003	Ga0070682_100000003235	193
283	3300005340	Ga0070689_100000725	Ga0070689_1000007255	193
284	3300005343	Ga0070687_100111868	Ga0070687_1001118682	193
285	3300005364	Ga0070673_100009942	Ga0070673_1000099423	193
286	3300005438	Ga0070701_10015145	Ga0070701_100151453	193
287	3300005445	Ga0070708_100005527	Ga0070708_1000055273	193
288	3300005445	Ga0070708_100093634	Ga0070708_1000936341	193
289	3300005467	Ga0070706_100069789	Ga0070706_1000697892	193
290	3300005467	Ga0070706_100108837	Ga0070706_1001088371	193
291	3300005467	Ga0070706_100423051	Ga0070706_1004230512	193
292	3300005467	Ga0070706_100659702	Ga0070706_1006597022	193
293	3300005467	Ga0070706_101003021	Ga0070706_1010030211	193
294	3300005468	Ga0070707_100142410	Ga0070707_1001424103	193
295	3300005468	Ga0070707_100152551	Ga0070707_1001525513	193
296	3300005468	Ga0070707_100158609	Ga0070707_1001586091	193
297	3300005468	Ga0070707_100283950	Ga0070707_1002839501	193
298	3300005468	Ga0070707_100304134	Ga0070707_1003041342	193
299	3300005471	Ga0070698_100061006	Ga0070698_1000610062	193
300	3300005471	Ga0070698_100333729	Ga0070698_1003337291	193
301	3300005471	Ga0070698_100599992	Ga0070698_1005999921	193
302	3300005518	Ga0070699_100054500	Ga0070699_1000545003	193
303	3300005518	Ga0070699_100471147	Ga0070699_1004711472	193
304	3300005536	Ga0070697_100033729	Ga0070697_1000337293	193
305	3300005536	Ga0070697_100143438	Ga0070697_1001434383	193
306	3300005615	Ga0070702_100007279	Ga0070702_1000072792	193
307	3300005834	Ga0068851_10194842	Ga0068851_101948422	193
308	3300005840	Ga0068870_10132202	Ga0068870_101322022	193
309	3300005842	Ga0068858_100000574	Ga0068858_10000057426	193
310	3300006028	Ga0070717_10000041	Ga0070717_1000004118	193
311	3300006028	Ga0070717_10523096	Ga0070717_105230962	193
312	3300006173	Ga0070716_100014135	Ga0070716_1000141352	193
313	3300006871	Ga0075434_100063325	Ga0075434_1000633253	193
314	3300006871	Ga0075434_100292181	Ga0075434_1002921813	193
315	3300006914	Ga0075436_100009404	Ga0075436_1000094047	193
316	3300007076	Ga0075435_100007940	Ga0075435_1000079404	193
317	3300007076	Ga0075435_100886231	Ga0075435_1008862312	193
318	3300009098	Ga0105245_10001463	Ga0105245_1000146313	193
319	3300009098	Ga0105245_10001605	Ga0105245_100016059	193
320	3300010375	Ga0105239_11164350	Ga0105239_111643502	193
321	3300013297	Ga0157378_10088231	Ga0157378_100882313	193
322	3300013306	Ga0163162_10561285	Ga0163162_105612852	193
323	3300025206	Ga0209435_100002	Ga0209435_100002237	193
324	3300025246	Ga0209646_1000001	Ga0209646_10000012380	193
325	3300025256	Ga0209759_1000001	Ga0209759_10000012011	193
326	3300025321	Ga0207656_10169840	Ga0207656_101698402	193
327	3300025908	Ga0207643_10137232	Ga0207643_101372322	193
328	3300025910	Ga0207684_10104738	Ga0207684_101047383	193
329	3300025910	Ga0207684_10229852	Ga0207684_102298522	193
330	3300025910	Ga0207684_10231262	Ga0207684_102312623	193
331	3300025910	Ga0207684_10342761	Ga0207684_103427612	193
332	3300025917	Ga0207660_10573827	Ga0207660_105738272	193
333	3300025918	Ga0207662_10126478	Ga0207662_101264782	193
334	3300025922	Ga0207646_10067761	Ga0207646_100677612	193
335	3300025922	Ga0207646_10072274	Ga0207646_100722741	193
336	3300025927	Ga0207687_10000670	Ga0207687_100006708	193
337	3300025927	Ga0207687_10000854	Ga0207687_1000085411	193
338	3300025936	Ga0207670_10000538	Ga0207670_1000053816	193
339	3300025937	Ga0207669_10101297	Ga0207669_101012972	193
340	3300025942	Ga0207689_10484504	Ga0207689_104845042	193
341	3300025960	Ga0207651_10013385	Ga0207651_100133854	193
342	3300026035	Ga0207703_10000004	Ga0207703_10000004229	193
343	3300035088	Ga0373940_0125632	Ga0373940_0125632_52_642	193
344	3300039437	Ga0436365_0509370	Ga0436365_0509370_911_1501	193
345	3300042876	Ga0451577_0011903	Ga0451577_0011903_7244_7834	193
346	3300044712	Ga0453684_0005422	Ga0453684_0005422_19146_19736	193
347	3300049523	Ga0501300_002049	Ga0501300_002049_1476_2090	193
348	3300049534	Ga0501318_025000	Ga0501318_025000_130_744	193
349	3300049654	Ga0501207_005913	Ga0501207_005913_598_1212	193
350	3300049658	Ga0501211_003535	Ga0501211_003535_471_1085	193
351	3300049661	Ga0501217_016764	Ga0501217_016764_1051_1665	193
352	3300049662	Ga0501222_026782	Ga0501222_026782_141_755	193
353	3300049663	Ga0501223_034244	Ga0501223_034244_191_805	193
354	3300049706	Ga0501229_004190	Ga0501229_004190_84_698	193
355	3300049757	Ga0501232_007291	Ga0501232_007291_316_930	193
356	3300049766	Ga0501269_002550	Ga0501269_002550_36_650	193
357	3300050512	nmdc:mga0n895_220842_c1	nmdc:mga0n895_220842_c1_323_913	193
358	3300050513	nmdc:mga0rr50_5257_c1	nmdc:mga0rr50_5257_c1_4310_4903	193
359	3300050513	nmdc:mga0rr50_6956_c1	nmdc:mga0rr50_6956_c1_3689_4279	193
360	3300050514	nmdc:mga08x19_27425_c1	nmdc:mga08x19_27425_c1_932_1525	193
361	3300053083	Ga0495655_0001045	Ga0495655_0001045_1588_2181	193
362	iso_pu_bacteria	2510065053	2510283074	193
363	iso_pu_bacteria	2510065055	2510293748	193
364	iso_pu_bacteria	2510065058	2510310646	193
365	iso_pu_bacteria	2511231006	2511263579	193
366	iso_pu_bacteria	2511231011	2511293865	193
367	iso_pu_bacteria	2511231023	2511368522	193
368	iso_pu_bacteria	2511231031	2511411205	193
369	iso_pu_bacteria	2512047018	2512327873	193
370	iso_pu_bacteria	2554235341	2555667307	193
371	iso_pu_bacteria	2582580891	2583789912	193
372	iso_pu_bacteria	2585428062	2587758441	193
373	iso_pu_bacteria	2597489887	2597855547	193
374	iso_pu_bacteria	2599185155	2599331128	193
375	iso_pu_bacteria	2599185160	2599356529	193
376	iso_pu_bacteria	2599185161	2599363441	193
377	iso_pu_bacteria	2599185162	2599369607	193
378	iso_pu_bacteria	2599185163	2599376550	193
379	iso_pu_bacteria	2599185164	2599381634	193
380	iso_pu_bacteria	2599185165	2599388222	193
381	iso_pu_bacteria	2599185166	2599395254	193
382	iso_pu_bacteria	2599185168	2599407019	193
383	iso_pu_bacteria	2599185181	2599463362	193
384	iso_pu_bacteria	2599185182	2599469288	193
385	iso_pu_bacteria	2599185185	2599485450	193
386	iso_pu_bacteria	2599185186	2599492379	193
387	iso_pu_bacteria	2599185257	2599806585	193
388	iso_pu_bacteria	2599185307	2599972243	193
389	iso_pu_bacteria	2599185356	2600215991	193
390	iso_pu_bacteria	2600254931	2600364986	193
391	iso_pu_bacteria	2600255283	2601627332	193
392	iso_pu_bacteria	2600255313	2601776158	193
393	iso_pu_bacteria	2643221570	2643867724	193
394	iso_pu_bacteria	2643221596	2643991587	193
395	iso_pu_bacteria	2643221652	2644293333	193
396	iso_pu_bacteria	2667528171	2671100081	193
397	iso_pu_bacteria	2671180172	2671772236	193
398	iso_pu_bacteria	2718217725	2718632055	193
399	iso_pu_bacteria	2738541271	2738691920	193
400	iso_pu_bacteria	2738543016	2739263330	193
401	iso_pu_bacteria	2738543025	2739311172	193
402	iso_pu_bacteria	2740892503	2743734966	193
403	iso_pu_bacteria	2773857672	2774131228	193
404	iso_pu_bacteria	2773857673	2774134632	193
405	iso_pu_bacteria	2784132063	2784261159	193
406	iso_pu_bacteria	2818991456	2819657118	193
407	iso_pu_bacteria	2818991464	2819705103	193
408	iso_pu_bacteria	2844665904	2844667784	193
409	iso_pu_bacteria	2852657418	2852660562	193
410	iso_pu_bacteria	2880230671	2880231005	193
411	iso_pu_bacteria	2904518522	2904519464	193
412	iso_pu_bacteria	2912963787	2912968747	193
413	iso_pu_bacteria	2917070673	2917071056	193
414	iso_pu_bacteria	2917832318	2917837021	193
415	iso_pu_bacteria	2919125081	2919127158	193
416	iso_pu_bacteria	2923153595	2923153959	193
417	iso_pu_bacteria	2935353572	2935358884	193
418	iso_pu_bacteria	2969304461	2969304850	193
419	iso_pu_bacteria	2974298342	2974302705	193
420	iso_pu_bacteria	2984286254	2984292096	193
421	iso_pu_bacteria	2984499530	2984499710	193
422	iso_pu_bacteria	2984504281	2984506090	193
423	iso_pu_bacteria	3007395558	3007397974	193
424	iso_pu_bacteria	3007419365	3007419906	193
425	iso_pu_bacteria	3007614139	3007617428	193
426	iso_pu_bacteria	3007861166	3007864444	193
427	iso_pu_bacteria	3007872151	3007876325	193
428	iso_pu_bacteria	637000220	637317704	193
429	iso_pu_bacteria	8011350971	8011351664	193
430	iso_pu_bacteria	8015687852	8015688208	193
431	iso_pu_bacteria	8016728285	8016731934	193
432	iso_pu_bacteria	8019769354	8019770205	193
433	iso_pu_bacteria	8055770955	8055771310	193
434	iso_pu_bacteria	8056172158	8056176810	193
435	iso_pu_bacteria	8056569372	8056572214	193
436	iso_pu_bacteria	8057798959	8057802604	193
437	3300002739	JGI25158J39367_1001690	JGI25158J39367_10016902	194
438	3300002987	JGI25159J45721_1009878	JGI25159J45721_10098782	194
439	3300003215	JGI25153J46596_10024815	JGI25153J46596_100248152	194
440	3300003322	rootL2_10003476	rootL2_100034763	194
441	3300003354	JGI25160J50197_1013514	JGI25160J50197_10135142	194
442	3300003574	Ga0007410J51695_1038032	Ga0007410J51695_10380321	194
443	3300003575	Ga0007409J51694_1014336	Ga0007409J51694_10143362	194
444	3300003577	Ga0007416J51690_1049488	Ga0007416J51690_10494882	194
445	3300003759	Ga0055525_1000028	Ga0055525_1000028156	194
446	3300003762	Ga0055542_1008087	Ga0055542_10080872	194
447	3300003771	Ga0055526_1008377	Ga0055526_10083773	194
448	3300003773	Ga0055537_1005406	Ga0055537_10054064	194
449	3300003775	Ga0055524_1018272	Ga0055524_10182722	194
450	3300003784	Ga0055534_1004167	Ga0055534_10041672	194
451	3300003791	Ga0055530_10017806	Ga0055530_100178062	194
452	3300005327	Ga0070658_10024403	Ga0070658_100244033	194
453	3300005327	Ga0070658_10025395	Ga0070658_100253952	194
454	3300005327	Ga0070658_10096762	Ga0070658_100967622	194
455	3300005327	Ga0070658_10312682	Ga0070658_103126821	194
456	3300005327	Ga0070658_10414192	Ga0070658_104141921	194
457	3300005327	Ga0070658_10800888	Ga0070658_108008881	194
458	3300005328	Ga0070676_10014562	Ga0070676_100145624	194
459	3300005328	Ga0070676_10027314	Ga0070676_100273143	194
460	3300005328	Ga0070676_10102074	Ga0070676_101020742	194
461	3300005328	Ga0070676_10178520	Ga0070676_101785202	194
462	3300005329	Ga0070683_100200042	Ga0070683_1002000421	194
463	3300005331	Ga0070670_100007799	Ga0070670_10000779910	194
464	3300005334	Ga0068869_100072077	Ga0068869_1000720773	194
465	3300005334	Ga0068869_100367700	Ga0068869_1003677002	194
466	3300005338	Ga0068868_100001474	Ga0068868_1000014747	194
467	3300005338	Ga0068868_100050966	Ga0068868_1000509664	194
468	3300005339	Ga0070660_100027602	Ga0070660_1000276022	194
469	3300005339	Ga0070660_100061097	Ga0070660_1000610974	194
470	3300005339	Ga0070660_100548357	Ga0070660_1005483572	194
471	3300005341	Ga0070691_10151862	Ga0070691_101518621	194
472	3300005343	Ga0070687_100095521	Ga0070687_1000955212	194
473	3300005344	Ga0070661_100095429	Ga0070661_1000954292	194
474	3300005344	Ga0070661_100127555	Ga0070661_1001275553	194
475	3300005347	Ga0070668_100229905	Ga0070668_1002299052	194
476	3300005354	Ga0070675_100104884	Ga0070675_1001048843	194
477	3300005354	Ga0070675_100262993	Ga0070675_1002629932	194
478	3300005354	Ga0070675_100603934	Ga0070675_1006039342	194
479	3300005364	Ga0070673_100228207	Ga0070673_1002282071	194
480	3300005366	Ga0070659_100119560	Ga0070659_1001195603	194
481	3300005366	Ga0070659_100165977	Ga0070659_1001659772	194
482	3300005366	Ga0070659_100406868	Ga0070659_1004068682	194
483	3300005367	Ga0070667_100000616	Ga0070667_1000006163	194
484	3300005367	Ga0070667_100017969	Ga0070667_1000179695	194
485	3300005441	Ga0070700_100042363	Ga0070700_1000423633	194
486	3300005444	Ga0070694_100707977	Ga0070694_1007079771	194
487	3300005445	Ga0070708_100335076	Ga0070708_1003350761	194
488	3300005455	Ga0070663_100000113	Ga0070663_10000011315	194
489	3300005455	Ga0070663_100044012	Ga0070663_1000440122	194
490	3300005455	Ga0070663_100062362	Ga0070663_1000623622	194
491	3300005457	Ga0070662_100075049	Ga0070662_1000750493	194
492	3300005457	Ga0070662_100099006	Ga0070662_1000990062	194
493	3300005457	Ga0070662_100221415	Ga0070662_1002214152	194
494	3300005457	Ga0070662_100603351	Ga0070662_1006033512	194
495	3300005467	Ga0070706_100039200	Ga0070706_1000392002	194
496	3300005468	Ga0070707_100495219	Ga0070707_1004952192	194
497	3300005530	Ga0070679_100871533	Ga0070679_1008715332	194
498	3300005536	Ga0070697_100287459	Ga0070697_1002874592	194
499	3300005539	Ga0068853_100000012	Ga0068853_10000001249	194
500	3300005539	Ga0068853_100011382	Ga0068853_1000113823	194
501	3300005539	Ga0068853_100376764	Ga0068853_1003767642	194
502	3300005543	Ga0070672_100002553	Ga0070672_1000025539	194
503	3300005543	Ga0070672_100193371	Ga0070672_1001933712	194
504	3300005547	Ga0070693_100117914	Ga0070693_1001179142	194
505	3300005563	Ga0068855_100189943	Ga0068855_1001899432	194
506	3300005563	Ga0068855_100225652	Ga0068855_1002256522	194
507	3300005564	Ga0070664_100002102	Ga0070664_10000210215	194
508	3300005564	Ga0070664_100440298	Ga0070664_1004402982	194
509	3300005577	Ga0068857_101033687	Ga0068857_1010336872	194
510	3300005577	Ga0068857_101168496	Ga0068857_1011684962	194
511	3300005578	Ga0068854_100147797	Ga0068854_1001477972	194
512	3300005614	Ga0068856_100106391	Ga0068856_1001063914	194
513	3300005614	Ga0068856_100208651	Ga0068856_1002086513	194
514	3300005615	Ga0070702_100244455	Ga0070702_1002444552	194
515	3300005615	Ga0070702_100492207	Ga0070702_1004922072	194
516	3300005615	Ga0070702_100595799	Ga0070702_1005957992	194
517	3300005616	Ga0068852_100107451	Ga0068852_1001074513	194
518	3300005616	Ga0068852_100198755	Ga0068852_1001987552	194
519	3300005617	Ga0068859_100263617	Ga0068859_1002636172	194
520	3300005618	Ga0068864_100000471	Ga0068864_1000004713	194
521	3300005618	Ga0068864_100232278	Ga0068864_1002322782	194
522	3300005618	Ga0068864_100481195	Ga0068864_1004811952	194
523	3300005618	Ga0068864_100607833	Ga0068864_1006078332	194
524	3300005719	Ga0068861_100034888	Ga0068861_1000348883	194
525	3300005834	Ga0068851_10112661	Ga0068851_101126612	194
526	3300005834	Ga0068851_10130686	Ga0068851_101306861	194
527	3300005841	Ga0068863_100022218	Ga0068863_1000222185	194
528	3300005841	Ga0068863_100866449	Ga0068863_1008664491	194
529	3300005842	Ga0068858_100047057	Ga0068858_1000470575	194
530	3300005842	Ga0068858_100365792	Ga0068858_1003657922	194
531	3300005843	Ga0068860_100129404	Ga0068860_1001294043	194
532	3300005843	Ga0068860_100223080	Ga0068860_1002230802	194
533	3300005844	Ga0068862_100716258	Ga0068862_1007162582	194
534	3300006038	Ga0075365_10049373	Ga0075365_100493732	194
535	3300006038	Ga0075365_10458095	Ga0075365_104580952	194
536	3300006042	Ga0075368_10026094	Ga0075368_100260943	194
537	3300006042	Ga0075368_10080949	Ga0075368_100809492	194
538	3300006042	Ga0075368_10085024	Ga0075368_100850242	194
539	3300006048	Ga0075363_100012547	Ga0075363_1000125472	194
540	3300006048	Ga0075363_100077454	Ga0075363_1000774543	194
541	3300006051	Ga0075364_10000064	Ga0075364_1000006422	194
542	3300006051	Ga0075364_10008008	Ga0075364_100080085	194
543	3300006051	Ga0075364_10372648	Ga0075364_103726482	194
544	3300006177	Ga0075362_10014396	Ga0075362_100143963	194
545	3300006178	Ga0075367_10020029	Ga0075367_100200293	194
546	3300006178	Ga0075367_10059062	Ga0075367_100590622	194
547	3300006195	Ga0075366_10011144	Ga0075366_100111445	194
548	3300006195	Ga0075366_10011179	Ga0075366_100111796	194
549	3300006195	Ga0075366_10118569	Ga0075366_101185692	194
550	3300006195	Ga0075366_10224886	Ga0075366_102248862	194
551	3300006195	Ga0075366_10309760	Ga0075366_103097602	194
552	3300006237	Ga0097621_100027903	Ga0097621_1000279033	194
553	3300006353	Ga0075370_10000133	Ga0075370_1000013313	194
554	3300006353	Ga0075370_10001450	Ga0075370_100014508	194
555	3300006353	Ga0075370_10095836	Ga0075370_100958362	194
556	3300006353	Ga0075370_10304719	Ga0075370_103047192	194
557	3300006358	Ga0068871_100004100	Ga0068871_1000041003	194
558	3300006358	Ga0068871_100064740	Ga0068871_1000647403	194
559	3300006358	Ga0068871_100163793	Ga0068871_1001637932	194
560	3300006358	Ga0068871_100347787	Ga0068871_1003477872	194
561	3300006881	Ga0068865_100021718	Ga0068865_1000217185	194
562	3300006881	Ga0068865_100233096	Ga0068865_1002330962	194
563	3300006931	Ga0097620_100263614	Ga0097620_1002636142	194
564	3300007076	Ga0075435_100285034	Ga0075435_1002850342	194
565	3300009036	Ga0105244_10026050	Ga0105244_100260505	194
566	3300009093	Ga0105240_10166541	Ga0105240_101665412	194
567	3300009098	Ga0105245_10406820	Ga0105245_104068202	194
568	3300009098	Ga0105245_10524917	Ga0105245_105249172	194
569	3300009148	Ga0105243_10048075	Ga0105243_100480753	194
570	3300009174	Ga0105241_10012959	Ga0105241_100129596	194
571	3300009176	Ga0105242_10201242	Ga0105242_102012422	194
572	3300009176	Ga0105242_10984121	Ga0105242_109841212	194
573	3300009177	Ga0105248_10007726	Ga0105248_100077265	194
574	3300009177	Ga0105248_10010956	Ga0105248_100109562	194
575	3300009545	Ga0105237_10091295	Ga0105237_100912953	194
576	3300009545	Ga0105237_10104141	Ga0105237_101041412	194
577	3300009545	Ga0105237_10309784	Ga0105237_103097843	194
578	3300009551	Ga0105238_10023177	Ga0105238_100231776	194
579	3300011119	Ga0105246_10024413	Ga0105246_100244135	194
580	3300011119	Ga0105246_10291801	Ga0105246_102918012	194
581	3300012506	Ga0157324_1018974	Ga0157324_10189741	194
582	3300012512	Ga0157327_1015107	Ga0157327_10151072	194
583	3300013100	Ga0157373_10096536	Ga0157373_100965362	194
584	3300013102	Ga0157371_10000003	Ga0157371_10000003374	194
585	3300013102	Ga0157371_10387953	Ga0157371_103879532	194
586	3300013104	Ga0157370_10660307	Ga0157370_106603071	194
587	3300013105	Ga0157369_10023413	Ga0157369_100234136	194
588	3300013296	Ga0157374_10087400	Ga0157374_100874003	194
589	3300013296	Ga0157374_10112402	Ga0157374_101124022	194
590	3300013296	Ga0157374_10199049	Ga0157374_101990492	194
591	3300013297	Ga0157378_10101606	Ga0157378_101016063	194
592	3300013306	Ga0163162_10001870	Ga0163162_1000187012	194
593	3300013306	Ga0163162_10188928	Ga0163162_101889282	194
594	3300013306	Ga0163162_11573802	Ga0163162_115738021	194
595	3300013307	Ga0157372_10056641	Ga0157372_100566412	194
596	3300013307	Ga0157372_10547858	Ga0157372_105478582	194
597	3300013307	Ga0157372_11300421	Ga0157372_113004212	194
598	3300013308	Ga0157375_10062862	Ga0157375_100628622	194
599	3300014325	Ga0163163_10124689	Ga0163163_101246892	194
600	3300014325	Ga0163163_10154852	Ga0163163_101548522	194
601	3300014325	Ga0163163_10259944	Ga0163163_102599441	194
602	3300014497	Ga0182008_10084926	Ga0182008_100849262	194
603	3300014745	Ga0157377_10042995	Ga0157377_100429953	194
604	3300014968	Ga0157379_10010913	Ga0157379_100109133	194
605	3300014968	Ga0157379_10114916	Ga0157379_101149162	194
606	3300014968	Ga0157379_10219521	Ga0157379_102195212	194
607	3300014969	Ga0157376_10374879	Ga0157376_103748792	194
608	3300015262	Ga0182007_10064208	Ga0182007_100642082	194
609	3300020077	Ga0206351_10037144	Ga0206351_100371442	194
610	3300021361	Ga0213872_10000474	Ga0213872_1000047434	194
611	3300025208	Ga0209436_102173	Ga0209436_1021734	194
612	3300025230	Ga0209563_100011	Ga0209563_100011153	194
613	3300025245	Ga0207425_1000009	Ga0207425_100000978	194
614	3300025245	Ga0207425_1000036	Ga0207425_100003632	194
615	3300025254	Ga0209148_1000470	Ga0209148_100047016	194
616	3300025263	Ga0209565_1001293	Ga0209565_10012934	194
617	3300025263	Ga0209565_1014279	Ga0209565_10142792	194
618	3300025273	Ga0209673_1009216	Ga0209673_10092165	194
619	3300025284	Ga0209130_1003201	Ga0209130_10032017	194
620	3300025284	Ga0209130_1024602	Ga0209130_10246022	194
621	3300025291	Ga0209675_1002921	Ga0209675_10029214	194
622	3300025291	Ga0209675_1038614	Ga0209675_10386141	194
623	3300025292	Ga0209676_1001191	Ga0209676_100119113	194
624	3300025294	Ga0209025_1000127	Ga0209025_100012712	194
625	3300025294	Ga0209025_1000302	Ga0209025_100030279	194
626	3300025294	Ga0209025_1004381	Ga0209025_10043816	194
627	3300025295	Ga0209564_1006015	Ga0209564_10060156	194
628	3300025295	Ga0209564_1007914	Ga0209564_10079144	194
629	3300025297	Ga0209758_1000054	Ga0209758_100005478	194
630	3300025298	Ga0209050_1000086	Ga0209050_100008671	194
631	3300025302	Ga0207426_1004949	Ga0207426_10049494	194
632	3300025304	Ga0209257_1000087	Ga0209257_1000087116	194
633	3300025304	Ga0209257_1000758	Ga0209257_100075812	194
634	3300025315	Ga0207697_10010759	Ga0207697_100107594	194
635	3300025321	Ga0207656_10151970	Ga0207656_101519702	194
636	3300025899	Ga0207642_10205931	Ga0207642_102059311	194
637	3300025903	Ga0207680_10135512	Ga0207680_101355121	194
638	3300025904	Ga0207647_10224875	Ga0207647_102248752	194
639	3300025907	Ga0207645_10037853	Ga0207645_100378534	194
640	3300025907	Ga0207645_10048976	Ga0207645_100489763	194
641	3300025908	Ga0207643_10069322	Ga0207643_100693222	194
642	3300025909	Ga0207705_10011658	Ga0207705_100116587	194
643	3300025910	Ga0207684_10216811	Ga0207684_102168112	194
644	3300025914	Ga0207671_10016698	Ga0207671_100166985	194
645	3300025914	Ga0207671_10082951	Ga0207671_100829512	194
646	3300025914	Ga0207671_10206808	Ga0207671_102068082	194
647	3300025918	Ga0207662_10138778	Ga0207662_101387782	194
648	3300025920	Ga0207649_10010700	Ga0207649_100107005	194
649	3300025920	Ga0207649_10118963	Ga0207649_101189633	194
650	3300025922	Ga0207646_10537440	Ga0207646_105374402	194
651	3300025923	Ga0207681_10104220	Ga0207681_101042202	194
652	3300025925	Ga0207650_10359473	Ga0207650_103594731	194
653	3300025926	Ga0207659_10018526	Ga0207659_100185265	194
654	3300025926	Ga0207659_10466798	Ga0207659_104667982	194
655	3300025926	Ga0207659_10619944	Ga0207659_106199441	194
656	3300025927	Ga0207687_10007032	Ga0207687_100070327	194
657	3300025927	Ga0207687_10775317	Ga0207687_107753172	194
658	3300025931	Ga0207644_10055268	Ga0207644_100552682	194
659	3300025932	Ga0207690_10129170	Ga0207690_101291702	194
660	3300025933	Ga0207706_10004610	Ga0207706_1000461015	194
661	3300025933	Ga0207706_10137009	Ga0207706_101370093	194
662	3300025933	Ga0207706_10321070	Ga0207706_103210702	194
663	3300025935	Ga0207709_10009543	Ga0207709_100095434	194
664	3300025938	Ga0207704_10270681	Ga0207704_102706812	194
665	3300025940	Ga0207691_10085580	Ga0207691_100855802	194
666	3300025940	Ga0207691_10118381	Ga0207691_101183812	194
667	3300025941	Ga0207711_10021877	Ga0207711_100218775	194
668	3300025941	Ga0207711_10083482	Ga0207711_100834822	194
669	3300025941	Ga0207711_10183962	Ga0207711_101839622	194
670	3300025941	Ga0207711_10736938	Ga0207711_107369382	194
671	3300025942	Ga0207689_10032851	Ga0207689_100328513	194
672	3300025942	Ga0207689_10319353	Ga0207689_103193532	194
673	3300025944	Ga0207661_10010874	Ga0207661_100108743	194
674	3300025945	Ga0207679_10003901	Ga0207679_100039017	194
675	3300025949	Ga0207667_10061794	Ga0207667_100617943	194
676	3300025960	Ga0207651_10404247	Ga0207651_104042472	194
677	3300025972	Ga0207668_10198350	Ga0207668_101983502	194
678	3300025981	Ga0207640_10192384	Ga0207640_101923842	194
679	3300025986	Ga0207658_10183724	Ga0207658_101837241	194
680	3300025986	Ga0207658_10352341	Ga0207658_103523412	194
681	3300025986	Ga0207658_10768528	Ga0207658_107685282	194
682	3300026023	Ga0207677_10096601	Ga0207677_100966012	194
683	3300026035	Ga0207703_10039008	Ga0207703_100390085	194
684	3300026035	Ga0207703_10053310	Ga0207703_100533103	194
685	3300026035	Ga0207703_10071333	Ga0207703_100713332	194
686	3300026041	Ga0207639_10027068	Ga0207639_100270684	194
687	3300026041	Ga0207639_10078144	Ga0207639_100781444	194
688	3300026067	Ga0207678_10002401	Ga0207678_100024017	194
689	3300026067	Ga0207678_10109851	Ga0207678_101098513	194
690	3300026067	Ga0207678_10144351	Ga0207678_101443512	194
691	3300026075	Ga0207708_10063045	Ga0207708_100630453	194
692	3300026088	Ga0207641_10444129	Ga0207641_104441292	194
693	3300026088	Ga0207641_10796754	Ga0207641_107967542	194
694	3300026095	Ga0207676_10013945	Ga0207676_100139454	194
695	3300026095	Ga0207676_10060396	Ga0207676_100603964	194
696	3300026116	Ga0207674_10032648	Ga0207674_100326484	194
697	3300026116	Ga0207674_10129406	Ga0207674_101294061	194
698	3300026118	Ga0207675_100002752	Ga0207675_1000027522	194
699	3300026121	Ga0207683_10198143	Ga0207683_101981432	194
700	3300026142	Ga0207698_10128440	Ga0207698_101284402	194
701	3300026142	Ga0207698_10297717	Ga0207698_102977172	194
702	3300026142	Ga0207698_10346660	Ga0207698_103466602	194
703	3300027665	Ga0209983_1020811	Ga0209983_10208112	194
704	3300027866	Ga0209813_10005861	Ga0209813_100058612	194
705	3300027866	Ga0209813_10088726	Ga0209813_100887262	194
706	3300027876	Ga0209974_10004129	Ga0209974_100041292	194
707	3300028380	Ga0268265_10902744	Ga0268265_109027442	194
708	3300028381	Ga0268264_10206739	Ga0268264_102067392	194
709	3300028794	Ga0307515_10000011	Ga0307515_10000011167	194
710	3300028794	Ga0307515_10001873	Ga0307515_100018739	194
711	3300028794	Ga0307515_10020861	Ga0307515_100208619	194
712	3300028794	Ga0307515_10296558	Ga0307515_102965582	194
713	3300030522	Ga0307512_10097717	Ga0307512_100977173	194
714	3300030731	Ga0316177_1038579	Ga0316177_10385793	194
715	3300030736	Ga0316180_1020266	Ga0316180_10202662	194
716	3300030744	Ga0316181_1089984	Ga0316181_10899842	194
717	3300030745	Ga0316182_1193434	Ga0316182_11934342	194
718	3300031456	Ga0307513_10002473	Ga0307513_1000247318	194
719	3300031456	Ga0307513_10051009	Ga0307513_100510093	194
720	3300031456	Ga0307513_10242255	Ga0307513_102422552	194
721	3300031456	Ga0307513_10334235	Ga0307513_103342352	194
722	3300031507	Ga0307509_10055353	Ga0307509_100553533	194
723	3300031507	Ga0307509_10300514	Ga0307509_103005142	194
724	3300031548	Ga0307408_100088754	Ga0307408_1000887543	194
725	3300031616	Ga0307508_10000053	Ga0307508_1000005384	194
726	3300031649	Ga0307514_10010207	Ga0307514_100102078	194
727	3300031730	Ga0307516_10005097	Ga0307516_100050977	194
728	3300031730	Ga0307516_10049964	Ga0307516_100499645	194
729	3300031730	Ga0307516_10121630	Ga0307516_101216302	194
730	3300031911	Ga0307412_10081734	Ga0307412_100817343	194
731	3300032002	Ga0307416_100012509	Ga0307416_1000125092	194
732	3300032002	Ga0307416_100176804	Ga0307416_1001768042	194
733	3300032002	Ga0307416_100640847	Ga0307416_1006408472	194
734	3300032005	Ga0307411_10019929	Ga0307411_100199293	194
735	3300032005	Ga0307411_10810181	Ga0307411_108101811	194
736	3300032126	Ga0307415_100201816	Ga0307415_1002018162	194
737	3300033179	Ga0307507_10078126	Ga0307507_100781262	194
738	3300034816	Ga0373930_0113174	Ga0373930_0113174_17_631	194
739	3300035086	Ga0373934_0113188	Ga0373934_0113188_457_1044	194
740	3300035088	Ga0373940_0036529	Ga0373940_0036529_452_1066	194
741	3300035119	Ga0373956_0245766	Ga0373956_0245766_154_747	194
742	3300035120	Ga0373957_0308019	Ga0373957_0308019_15_608	194
743	3300035121	Ga0373960_0105342	Ga0373960_0105342_284_898	194
744	3300035691	Ga0373931_0047400	Ga0373931_0047400_222_836	194
745	3300036401	Ga0373937_0000872	Ga0373937_0000872_24101_24694	194
746	3300036401	Ga0373937_0038865	Ga0373937_0038865_2694_3287	194
747	3300036401	Ga0373937_0273537	Ga0373937_0273537_517_1104	194
748	3300036401	Ga0373937_0465070	Ga0373937_0465070_26_619	194
749	3300037312	Ga0395899_0000078	Ga0395899_0000078_84848_85438	194
750	3300037312	Ga0395899_0059491	Ga0395899_0059491_1606_2196	194
751	3300037312	Ga0395899_0115401	Ga0395899_0115401_870_1460	194
752	3300037312	Ga0395899_0223690	Ga0395899_0223690_581_1171	194
753	3300037418	Ga0395900_0001670	Ga0395900_0001670_23765_24355	194
754	3300037418	Ga0395900_0047184	Ga0395900_0047184_31_621	194
755	3300037418	Ga0395900_0098013	Ga0395900_0098013_2109_2696	194
756	3300037418	Ga0395900_0252451	Ga0395900_0252451_440_1030	194
757	3300037418	Ga0395900_0832162	Ga0395900_0832162_223_813	194
758	3300037466	Ga0395898_0723198	Ga0395898_0723198_110_700	194
759	3300037466	Ga0395898_0728067	Ga0395898_0728067_102_692	194
760	3300037471	Ga0395905_0006280	Ga0395905_0006280_8396_8983	194
761	3300037471	Ga0395905_0013332	Ga0395905_0013332_3493_4080	194
762	3300037471	Ga0395905_0095837	Ga0395905_0095837_1470_2060	194
763	3300037471	Ga0395905_0103949	Ga0395905_0103949_677_1264	194
764	3300037471	Ga0395905_0370508	Ga0395905_0370508_450_1040	194
765	3300038443	Ga0395901_0000393	Ga0395901_0000393_33420_34010	194
766	3300038443	Ga0395901_0009156	Ga0395901_0009156_1847_2437	194
767	3300038443	Ga0395901_0146495	Ga0395901_0146495_1406_1996	194
768	3300038443	Ga0395901_0688570	Ga0395901_0688570_33_620	194
769	3300038725	Ga0400484_38898	Ga0400484_38898_3723_4313	194
770	3300038726	Ga0400490_07386	Ga0400490_07386_2172_2762	194
771	3300038727	Ga0400491_11309	Ga0400491_11309_115_705	194
772	3300038735	Ga0400485_18000	Ga0400485_18000_880_1470	194
773	3300038742	Ga0400486_08314	Ga0400486_08314_1756_2346	194
774	3300038742	Ga0400486_12922	Ga0400486_12922_9809_10399	194
775	3300039062	Ga0400483_031251	Ga0400483_031251_375_965	194
776	3300039062	Ga0400483_092543	Ga0400483_092543_5476_6066	194
777	3300039062	Ga0400483_217411	Ga0400483_217411_1615_2205	194
778	3300039110	Ga0400487_09481	Ga0400487_09481_13691_14281	194
779	3300039110	Ga0400487_43376	Ga0400487_43376_427_1017	194
780	3300039110	Ga0400487_53816	Ga0400487_53816_15_605	194
781	3300039447	Ga0436361_0920355	Ga0436361_0920355_2237_2830	194
782	3300039450	Ga0436363_0084700	Ga0436363_0084700_411_1025	194
783	3300041410	Ga0439461_0008197	Ga0439461_0008197_450_1037	194
784	3300041413	Ga0439465_0059439	Ga0439465_0059439_184_774	194
785	3300041452	Ga0451793_1026268	Ga0451793_1026268_493_1086	194
786	3300042005	Ga0439448_0018401	Ga0439448_0018401_1509_2099	194
787	3300042005	Ga0439448_0034491	Ga0439448_0034491_783_1373	194
788	3300042006	Ga0439432_066196	Ga0439432_066196_286_873	194
789	3300042007	Ga0439449_0007886	Ga0439449_0007886_389_979	194
790	3300042011	Ga0439454_012582	Ga0439454_012582_464_1054	194
791	3300042011	Ga0439454_020981	Ga0439454_020981_91_678	194
792	3300042012	Ga0439455_0006669	Ga0439455_0006669_624_1214	194
793	3300042139	Ga0450904_000386	Ga0450904_000386_1560_2150	194
794	3300042147	Ga0450910_024229	Ga0450910_024229_71_661	194
795	3300042156	Ga0439446_0135407	Ga0439446_0135407_163_759	194
796	3300042439	Ga0439464_0009070	Ga0439464_0009070_201_788	194
797	3300042876	Ga0451577_0039198	Ga0451577_0039198_82_669	194
798	3300042876	Ga0451577_0045310	Ga0451577_0045310_1768_2355	194
799	3300042876	Ga0451577_0108081	Ga0451577_0108081_397_987	194
800	3300044656	Ga0466969_0000020	Ga0466969_0000020_42310_42903	194
801	3300044656	Ga0466969_0072895	Ga0466969_0072895_113_703	194
802	3300044658	Ga0466972_0004693	Ga0466972_0004693_1174_1764	194
803	3300044684	Ga0466966_0008910	Ga0466966_0008910_1459_2049	194
804	3300044684	Ga0466966_0015396	Ga0466966_0015396_1251_1841	194
805	3300044693	Ga0466961_0061063	Ga0466961_0061063_308_898	194
806	3300044693	Ga0466961_0084518	Ga0466961_0084518_320_910	194
807	3300044706	Ga0466964_0002495	Ga0466964_0002495_4453_5043	194
808	3300044706	Ga0466964_0205734	Ga0466964_0205734_191_781	194
809	3300044765	Ga0466970_0442509	Ga0466970_0442509_87_677	194
810	3300044842	Ga0466957_0027319	Ga0466957_0027319_1498_2088	194
811	3300045049	Ga0466959_0013509	Ga0466959_0013509_5106_5696	194
812	3300045049	Ga0466959_0071101	Ga0466959_0071101_1504_2097	194
813	3300045049	Ga0466959_0145820	Ga0466959_0145820_940_1530	194
814	3300045049	Ga0466959_0287485	Ga0466959_0287485_390_980	194
815	3300045051	Ga0451576_0111895	Ga0451576_0111895_1075_1665	194
816	3300045051	Ga0451576_0240554	Ga0451576_0240554_323_937	194
817	3300045836	Ga0466958_0353178	Ga0466958_0353178_80_670	194
818	3300045976	Ga0466967_0508763	Ga0466967_0508763_265_855	194
819	3300046452	Ga0495617_000010	Ga0495617_000010_140289_140879	194
820	3300046453	Ga0495627_002330	Ga0495627_002330_2550_3140	194
821	3300046453	Ga0495627_090410	Ga0495627_090410_124_714	194
822	3300046454	Ga0495592_0111168	Ga0495592_0111168_1021_1620	194
823	3300046454	Ga0495592_0347089	Ga0495592_0347089_29_622	194
824	3300046455	Ga0495603_0025991	Ga0495603_0025991_27_617	194
825	3300046455	Ga0495603_0335652	Ga0495603_0335652_108_698	194
826	3300046457	Ga0495590_0000009	Ga0495590_0000009_144090_144680	194
827	3300046457	Ga0495590_0000709	Ga0495590_0000709_1447_2037	194
828	3300046457	Ga0495590_0014687	Ga0495590_0014687_1001_1591	194
829	3300046458	Ga0495591_001557	Ga0495591_001557_2517_3107	194
830	3300046459	Ga0495629_0353858	Ga0495629_0353858_245_835	194
831	3300046462	Ga0495651_0086108	Ga0495651_0086108_1432_2019	194
832	3300046463	Ga0495653_0049561	Ga0495653_0049561_1500_2090	194
833	3300046463	Ga0495653_0051679	Ga0495653_0051679_1665_2255	194
834	3300046471	Ga0495650_0000077	Ga0495650_0000077_198424_199014	194
835	3300046471	Ga0495650_0008457	Ga0495650_0008457_4811_5401	194
836	3300046472	Ga0495580_0250177	Ga0495580_0250177_337_927	194
837	3300046473	Ga0495582_0060641	Ga0495582_0060641_871_1461	194
838	3300046473	Ga0495582_0165177	Ga0495582_0165177_73_663	194
839	3300046474	Ga0495605_0000055	Ga0495605_0000055_19591_20181	194
840	3300046474	Ga0495605_0034982	Ga0495605_0034982_189_779	194
841	3300046474	Ga0495605_0036685	Ga0495605_0036685_899_1489	194
842	3300046474	Ga0495605_0077645	Ga0495605_0077645_806_1396	194
843	3300046474	Ga0495605_0113012	Ga0495605_0113012_188_778	194
844	3300046491	Ga0495584_0000004	Ga0495584_0000004_24132_24722	194
845	3300046491	Ga0495584_0000073	Ga0495584_0000073_55689_56279	194
846	3300046491	Ga0495584_0006926	Ga0495584_0006926_3173_3763	194
847	3300046491	Ga0495584_0024810	Ga0495584_0024810_762_1352	194
848	3300046491	Ga0495584_0027126	Ga0495584_0027126_821_1411	194
849	3300046491	Ga0495584_0057248	Ga0495584_0057248_514_1104	194
850	3300046492	Ga0495585_0000119	Ga0495585_0000119_18704_19294	194
851	3300046492	Ga0495585_0000859	Ga0495585_0000859_11049_11639	194
852	3300046492	Ga0495585_0001551	Ga0495585_0001551_13587_14177	194
853	3300046492	Ga0495585_0001611	Ga0495585_0001611_3073_3663	194
854	3300046492	Ga0495585_0002189	Ga0495585_0002189_5356_5946	194
855	3300046492	Ga0495585_0006902	Ga0495585_0006902_3391_3981	194
856	3300046492	Ga0495585_0018869	Ga0495585_0018869_399_989	194
857	3300046492	Ga0495585_0029343	Ga0495585_0029343_1673_2263	194
858	3300046492	Ga0495585_0033083	Ga0495585_0033083_2316_2906	194
859	3300046492	Ga0495585_0034325	Ga0495585_0034325_2160_2750	194
860	3300046492	Ga0495585_0047404	Ga0495585_0047404_1404_1994	194
861	3300046492	Ga0495585_0069533	Ga0495585_0069533_486_1076	194
862	3300046499	Ga0495594_0024328	Ga0495594_0024328_215_805	194
863	3300046499	Ga0495594_0107108	Ga0495594_0107108_822_1412	194
864	3300046499	Ga0495594_0223960	Ga0495594_0223960_27_617	194
865	3300046499	Ga0495594_0441844	Ga0495594_0441844_84_674	194
866	3300046500	Ga0495596_0000968	Ga0495596_0000968_8794_9384	194
867	3300046500	Ga0495596_0006160	Ga0495596_0006160_2691_3281	194
868	3300046500	Ga0495596_0008411	Ga0495596_0008411_3901_4491	194
869	3300046500	Ga0495596_0046646	Ga0495596_0046646_652_1242	194
870	3300046500	Ga0495596_0058545	Ga0495596_0058545_105_695	194
871	3300046500	Ga0495596_0178879	Ga0495596_0178879_19_609	194
872	3300046501	Ga0495607_0009405	Ga0495607_0009405_4984_5574	194
873	3300046501	Ga0495607_0011112	Ga0495607_0011112_3338_3928	194
874	3300046501	Ga0495607_0013585	Ga0495607_0013585_3652_4242	194
875	3300046501	Ga0495607_0034018	Ga0495607_0034018_1627_2217	194
876	3300046501	Ga0495607_0036861	Ga0495607_0036861_1136_1726	194
877	3300046501	Ga0495607_0037111	Ga0495607_0037111_1536_2126	194
878	3300046506	Ga0495583_0000132	Ga0495583_0000132_69383_69973	194
879	3300046506	Ga0495583_0000493	Ga0495583_0000493_51147_51737	194
880	3300046506	Ga0495583_0001058	Ga0495583_0001058_18214_18804	194
881	3300046506	Ga0495583_0006944	Ga0495583_0006944_1019_1609	194
882	3300046506	Ga0495583_0010382	Ga0495583_0010382_1082_1672	194
883	3300046506	Ga0495583_0048025	Ga0495583_0048025_979_1569	194
884	3300046506	Ga0495583_0050175	Ga0495583_0050175_1140_1730	194
885	3300046507	Ga0495606_0035207	Ga0495606_0035207_2083_2673	194
886	3300046507	Ga0495606_0052593	Ga0495606_0052593_1039_1629	194
887	3300046507	Ga0495606_0111408	Ga0495606_0111408_982_1572	194
888	3300046507	Ga0495606_0135864	Ga0495606_0135864_602_1192	194
889	3300046511	Ga0495608_0034285	Ga0495608_0034285_407_994	194
890	3300046512	Ga0495610_0001174	Ga0495610_0001174_4120_4710	194
891	3300046512	Ga0495610_0173713	Ga0495610_0173713_151_741	194
892	3300046513	Ga0495616_0003730	Ga0495616_0003730_4151_4741	194
893	3300046513	Ga0495616_0005975	Ga0495616_0005975_3587_4177	194
894	3300046513	Ga0495616_0006125	Ga0495616_0006125_785_1375	194
895	3300046513	Ga0495616_0009471	Ga0495616_0009471_84_674	194
896	3300046513	Ga0495616_0013452	Ga0495616_0013452_172_762	194
897	3300046513	Ga0495616_0033516	Ga0495616_0033516_650_1240	194
898	3300046513	Ga0495616_0037201	Ga0495616_0037201_1134_1724	194
899	3300046513	Ga0495616_0049417	Ga0495616_0049417_788_1378	194
900	3300046513	Ga0495616_0055832	Ga0495616_0055832_739_1329	194
901	3300046513	Ga0495616_0189603	Ga0495616_0189603_306_896	194
902	3300046513	Ga0495616_0270402	Ga0495616_0270402_50_640	194
903	3300046515	Ga0495620_0098990	Ga0495620_0098990_376_966	194
904	3300046516	Ga0495628_0021760	Ga0495628_0021760_4492_5079	194
905	3300046517	Ga0495630_0083057	Ga0495630_0083057_469_1059	194
906	3300046517	Ga0495630_0703540	Ga0495630_0703540_148_741	194
907	3300046518	Ga0495631_0000272	Ga0495631_0000272_24466_25056	194
908	3300046518	Ga0495631_0000791	Ga0495631_0000791_18580_19170	194
909	3300046518	Ga0495631_0009008	Ga0495631_0009008_1137_1727	194
910	3300046518	Ga0495631_0009119	Ga0495631_0009119_3529_4119	194
911	3300046518	Ga0495631_0009648	Ga0495631_0009648_2536_3126	194
912	3300046518	Ga0495631_0016867	Ga0495631_0016867_1926_2516	194
913	3300046518	Ga0495631_0021879	Ga0495631_0021879_1511_2101	194
914	3300046518	Ga0495631_0045428	Ga0495631_0045428_216_806	194
915	3300046518	Ga0495631_0147493	Ga0495631_0147493_99_689	194
916	3300046519	Ga0495632_0000017	Ga0495632_0000017_35813_36403	194
917	3300046519	Ga0495632_0000252	Ga0495632_0000252_126_716	194
918	3300046519	Ga0495632_0011802	Ga0495632_0011802_1054_1644	194
919	3300046519	Ga0495632_0012223	Ga0495632_0012223_727_1317	194
920	3300046519	Ga0495632_0026212	Ga0495632_0026212_1170_1760	194
921	3300046519	Ga0495632_0046979	Ga0495632_0046979_1030_1620	194
922	3300046519	Ga0495632_0244250	Ga0495632_0244250_94_693	194
923	3300046520	Ga0495637_0000003	Ga0495637_0000003_159762_160352	194
924	3300046520	Ga0495637_0010369	Ga0495637_0010369_391_981	194
925	3300046522	Ga0495643_0000399	Ga0495643_0000399_52865_53455	194
926	3300046522	Ga0495643_0000764	Ga0495643_0000764_11614_12210	194
927	3300046522	Ga0495643_0022803	Ga0495643_0022803_1052_1642	194
928	3300046522	Ga0495643_0056519	Ga0495643_0056519_934_1524	194
929	3300046522	Ga0495643_0067872	Ga0495643_0067872_411_1001	194
930	3300046522	Ga0495643_0123728	Ga0495643_0123728_375_965	194
931	3300046522	Ga0495643_0148711	Ga0495643_0148711_509_1099	194
932	3300046523	Ga0495644_0000831	Ga0495644_0000831_10035_10625	194
933	3300046523	Ga0495644_0008295	Ga0495644_0008295_1087_1677	194
934	3300046523	Ga0495644_0080256	Ga0495644_0080256_38_628	194
935	3300046523	Ga0495644_0108574	Ga0495644_0108574_135_725	194
936	3300046523	Ga0495644_0226340	Ga0495644_0226340_39_629	194
937	3300046524	Ga0495648_0000052	Ga0495648_0000052_143863_144453	194
938	3300046524	Ga0495648_0007157	Ga0495648_0007157_3748_4338	194
939	3300046524	Ga0495648_0012877	Ga0495648_0012877_1860_2450	194
940	3300046524	Ga0495648_0018336	Ga0495648_0018336_2991_3581	194
941	3300046524	Ga0495648_0030288	Ga0495648_0030288_1740_2330	194
942	3300046524	Ga0495648_0031484	Ga0495648_0031484_1828_2418	194
943	3300046524	Ga0495648_0051550	Ga0495648_0051550_1328_1918	194
944	3300046525	Ga0495663_0004769	Ga0495663_0004769_1438_2028	194
945	3300046526	Ga0495666_0004516	Ga0495666_0004516_1834_2424	194
946	3300046528	Ga0495642_0000382	Ga0495642_0000382_2564_3154	194
947	3300046528	Ga0495642_0001035	Ga0495642_0001035_10984_11574	194
948	3300046528	Ga0495642_0005660	Ga0495642_0005660_1691_2281	194
949	3300046528	Ga0495642_0086813	Ga0495642_0086813_517_1107	194
950	3300046528	Ga0495642_0116559	Ga0495642_0116559_340_930	194
951	3300046530	Ga0495654_0005229	Ga0495654_0005229_3727_4317	194
952	3300046530	Ga0495654_0010327	Ga0495654_0010327_3384_3974	194
953	3300046530	Ga0495654_0051076	Ga0495654_0051076_162_752	194
954	3300046531	Ga0495665_0019765	Ga0495665_0019765_642_1232	194
955	3300046531	Ga0495665_0045855	Ga0495665_0045855_1607_2197	194
956	3300046533	Ga0495640_0204081	Ga0495640_0204081_618_1205	194
957	3300046535	Ga0495586_0038879	Ga0495586_0038879_681_1271	194
958	3300046536	Ga0495587_0004310	Ga0495587_0004310_1602_2189	194
959	3300046536	Ga0495587_0057695	Ga0495587_0057695_1602_2192	194
960	3300046536	Ga0495587_0343412	Ga0495587_0343412_84_674	194
961	3300046538	Ga0495609_0000038	Ga0495609_0000038_160904_161494	194
962	3300046538	Ga0495609_0006238	Ga0495609_0006238_24_614	194
963	3300046538	Ga0495609_0019983	Ga0495609_0019983_702_1292	194
964	3300046538	Ga0495609_0022921	Ga0495609_0022921_1313_1903	194
965	3300046538	Ga0495609_0059154	Ga0495609_0059154_652_1242	194
966	3300046542	Ga0495597_0004947	Ga0495597_0004947_1036_1626	194
967	3300046542	Ga0495597_0028634	Ga0495597_0028634_896_1486	194
968	3300046542	Ga0495597_0051538	Ga0495597_0051538_948_1538	194
969	3300046542	Ga0495597_0159039	Ga0495597_0159039_244_843	194
970	3300046543	Ga0495645_0001792	Ga0495645_0001792_10877_11464	194
971	3300046543	Ga0495645_0385035	Ga0495645_0385035_288_878	194
972	3300046557	Ga0495622_0011213	Ga0495622_0011213_1335_1925	194
973	3300046557	Ga0495622_0065870	Ga0495622_0065870_883_1473	194
974	3300046558	Ga0495633_0008649	Ga0495633_0008649_2332_2922	194
975	3300046558	Ga0495633_0015961	Ga0495633_0015961_843_1433	194
976	3300046558	Ga0495633_0016138	Ga0495633_0016138_2426_3016	194
977	3300046558	Ga0495633_0023247	Ga0495633_0023247_424_1014	194
978	3300046558	Ga0495633_0024696	Ga0495633_0024696_2158_2748	194
979	3300046558	Ga0495633_0044931	Ga0495633_0044931_309_899	194
980	3300046558	Ga0495633_0056998	Ga0495633_0056998_483_1073	194
981	3300046559	Ga0495667_0219259	Ga0495667_0219259_406_993	194
982	3300046559	Ga0495667_0376601	Ga0495667_0376601_188_781	194
983	3300046615	Ga0495656_0032961	Ga0495656_0032961_137_727	194
984	3300046615	Ga0495656_0096322	Ga0495656_0096322_275_865	194
985	3300046615	Ga0495656_0257294	Ga0495656_0257294_196_786	194
986	3300046615	Ga0495656_0345151	Ga0495656_0345151_58_648	194
987	3300046616	Ga0495668_0000822	Ga0495668_0000822_10238_10828	194
988	3300046616	Ga0495668_0001569	Ga0495668_0001569_3567_4157	194
989	3300046616	Ga0495668_0018646	Ga0495668_0018646_2431_3021	194
990	3300046616	Ga0495668_0030790	Ga0495668_0030790_1533_2123	194
991	3300046616	Ga0495668_0031533	Ga0495668_0031533_964_1554	194
992	3300046616	Ga0495668_0040126	Ga0495668_0040126_638_1228	194
993	3300046616	Ga0495668_0286530	Ga0495668_0286530_244_834	194
994	3300046642	Ga0495634_0008989	Ga0495634_0008989_6786_7376	194
995	3300046648	Ga0495611_0005203	Ga0495611_0005203_2750_3340	194
996	3300046648	Ga0495611_0022675	Ga0495611_0022675_374_964	194
997	3300046648	Ga0495611_0029855	Ga0495611_0029855_1357_1947	194
998	3300046648	Ga0495611_0052362	Ga0495611_0052362_462_1052	194
999	3300046660	Ga0495625_0001672	Ga0495625_0001672_1639_2232	194
1000	3300046660	Ga0495625_0007721	Ga0495625_0007721_1023_1622	194
1001	3300046660	Ga0495625_0037554	Ga0495625_0037554_1931_2521	194
1002	3300046660	Ga0495625_0256381	Ga0495625_0256381_215_805	194
1003	3300046660	Ga0495625_0319340	Ga0495625_0319340_310_900	194
1004	3300046660	Ga0495625_0536291	Ga0495625_0536291_21_611	194
1005	3300046663	Ga0495635_0024618	Ga0495635_0024618_2333_2920	194
1006	3300046663	Ga0495635_0377982	Ga0495635_0377982_189_779	194
1007	3300046665	Ga0495661_0001562	Ga0495661_0001562_14762_15352	194
1008	3300046665	Ga0495661_0001766	Ga0495661_0001766_13300_13890	194
1009	3300046665	Ga0495661_0007851	Ga0495661_0007851_5985_6575	194
1010	3300046665	Ga0495661_0017010	Ga0495661_0017010_2095_2685	194
1011	3300046665	Ga0495661_0048811	Ga0495661_0048811_1135_1725	194
1012	3300046665	Ga0495661_0051107	Ga0495661_0051107_365_955	194
1013	3300046665	Ga0495661_0055793	Ga0495661_0055793_335_925	194
1014	3300046665	Ga0495661_0061892	Ga0495661_0061892_1138_1728	194
1015	3300046665	Ga0495661_0068281	Ga0495661_0068281_1032_1622	194
1016	3300046665	Ga0495661_0107613	Ga0495661_0107613_331_921	194
1017	3300046665	Ga0495661_0282772	Ga0495661_0282772_219_809	194
1018	3300046665	Ga0495661_0402261	Ga0495661_0402261_49_639	194
1019	3300046674	Ga0495588_0000156	Ga0495588_0000156_20166_20756	194
1020	3300046674	Ga0495588_0033908	Ga0495588_0033908_862_1452	194
1021	3300046674	Ga0495588_0055123	Ga0495588_0055123_1096_1686	194
1022	3300046675	Ga0495657_0005491	Ga0495657_0005491_22_615	194
1023	3300046678	Ga0495599_0016178	Ga0495599_0016178_3002_3589	194
1024	3300046678	Ga0495599_0060917	Ga0495599_0060917_1245_1835	194
1025	3300046679	Ga0495623_0019950	Ga0495623_0019950_2688_3278	194
1026	3300046681	Ga0495647_0073897	Ga0495647_0073897_59_652	194
1027	3300046683	Ga0495658_0128234	Ga0495658_0128234_862_1455	194
1028	3300046684	Ga0495669_0000032	Ga0495669_0000032_78805_79395	194
1029	3300046684	Ga0495669_0002103	Ga0495669_0002103_785_1375	194
1030	3300046684	Ga0495669_0008828	Ga0495669_0008828_2548_3138	194
1031	3300046684	Ga0495669_0048032	Ga0495669_0048032_428_1018	194
1032	3300046684	Ga0495669_0071843	Ga0495669_0071843_98_688	194
1033	3300046689	Ga0495613_0046310	Ga0495613_0046310_2403_2993	194
1034	3300046690	Ga0495624_0226600	Ga0495624_0226600_169_759	194
1035	3300046691	Ga0495670_0000920	Ga0495670_0000920_9704_10294	194
1036	3300046691	Ga0495670_0044456	Ga0495670_0044456_502_1092	194
1037	3300046691	Ga0495670_0105717	Ga0495670_0105717_555_1145	194
1038	3300046692	Ga0495671_0001885	Ga0495671_0001885_5100_5690	194
1039	3300046694	Ga0495649_0005989	Ga0495649_0005989_2184_2783	194
1040	3300046694	Ga0495649_0007905	Ga0495649_0007905_4008_4598	194
1041	3300046694	Ga0495649_0008870	Ga0495649_0008870_4911_5501	194
1042	3300046694	Ga0495649_0008873	Ga0495649_0008873_768_1358	194
1043	3300046694	Ga0495649_0038186	Ga0495649_0038186_496_1086	194
1044	3300046694	Ga0495649_0051414	Ga0495649_0051414_1216_1806	194
1045	3300046694	Ga0495649_0061526	Ga0495649_0061526_986_1576	194
1046	3300046794	Ga0495589_0000074	Ga0495589_0000074_73277_73867	194
1047	3300046794	Ga0495589_0000099	Ga0495589_0000099_19509_20099	194
1048	3300046794	Ga0495589_0013487	Ga0495589_0013487_1064_1654	194
1049	3300046794	Ga0495589_0044621	Ga0495589_0044621_1030_1620	194
1050	3300046794	Ga0495589_0164384	Ga0495589_0164384_370_960	194
1051	3300046809	Ga0495600_0030144	Ga0495600_0030144_2496_3083	194
1052	3300046810	Ga0495660_0000047	Ga0495660_0000047_143452_144042	194
1053	3300046810	Ga0495660_0013470	Ga0495660_0013470_1691_2281	194
1054	3300046810	Ga0495660_0013814	Ga0495660_0013814_1116_1706	194
1055	3300046810	Ga0495660_0044472	Ga0495660_0044472_1113_1703	194
1056	3300046810	Ga0495660_0064121	Ga0495660_0064121_637_1227	194
1057	3300047315	Ga0495581_0024735	Ga0495581_0024735_1661_2251	194
1058	3300047315	Ga0495581_0049686	Ga0495581_0049686_420_1010	194
1059	3300047317	Ga0495604_0045167	Ga0495604_0045167_913_1503	194
1060	3300047318	Ga0495636_0022505	Ga0495636_0022505_347_937	194
1061	3300047318	Ga0495636_0100314	Ga0495636_0100314_211_801	194
1062	3300047320	Ga0495672_0000256	Ga0495672_0000256_5762_6352	194
1063	3300047320	Ga0495672_0000421	Ga0495672_0000421_32853_33443	194
1064	3300047320	Ga0495672_0000532	Ga0495672_0000532_10899_11489	194
1065	3300047320	Ga0495672_0038221	Ga0495672_0038221_1487_2077	194
1066	3300047320	Ga0495672_0041261	Ga0495672_0041261_1349_1939	194
1067	3300047320	Ga0495672_0057799	Ga0495672_0057799_765_1355	194
1068	3300047321	Ga0495676_0000031	Ga0495676_0000031_109500_110090	194
1069	3300047321	Ga0495676_0015996	Ga0495676_0015996_5093_5683	194
1070	3300047321	Ga0495676_0072293	Ga0495676_0072293_706_1296	194
1071	3300047321	Ga0495676_0167914	Ga0495676_0167914_187_777	194
1072	3300047321	Ga0495676_0469989	Ga0495676_0469989_32_625	194
1073	3300047322	Ga0495680_0021336	Ga0495680_0021336_2688_3278	194
1074	3300047323	Ga0495683_0000211	Ga0495683_0000211_1759_2349	194
1075	3300047323	Ga0495683_0001058	Ga0495683_0001058_1771_2361	194
1076	3300047323	Ga0495683_0012086	Ga0495683_0012086_1687_2277	194
1077	3300047323	Ga0495683_0077634	Ga0495683_0077634_265_855	194
1078	3300047323	Ga0495683_0104525	Ga0495683_0104525_193_783	194
1079	3300047323	Ga0495683_0189299	Ga0495683_0189299_281_871	194
1080	3300047443	Ga0495687_000071	Ga0495687_000071_20575_21165	194
1081	3300047443	Ga0495687_000167	Ga0495687_000167_216_806	194
1082	3300047443	Ga0495687_000238	Ga0495687_000238_69824_70414	194
1083	3300047443	Ga0495687_000775	Ga0495687_000775_1023_1622	194
1084	3300047443	Ga0495687_004764	Ga0495687_004764_5262_5852	194
1085	3300047443	Ga0495687_013982	Ga0495687_013982_1190_1789	194
1086	3300047444	Ga0495675_0066266	Ga0495675_0066266_222_812	194
1087	3300047444	Ga0495675_0175113	Ga0495675_0175113_689_1282	194
1088	3300047445	Ga0495677_0000016	Ga0495677_0000016_20440_21030	194
1089	3300047445	Ga0495677_0008926	Ga0495677_0008926_2582_3172	194
1090	3300047445	Ga0495677_0011836	Ga0495677_0011836_1542_2132	194
1091	3300047445	Ga0495677_0023445	Ga0495677_0023445_1163_1753	194
1092	3300047445	Ga0495677_0033995	Ga0495677_0033995_158_748	194
1093	3300047445	Ga0495677_0038533	Ga0495677_0038533_788_1378	194
1094	3300047446	Ga0495679_004470	Ga0495679_004470_898_1488	194
1095	3300047446	Ga0495679_018934	Ga0495679_018934_453_1043	194
1096	3300047446	Ga0495679_022846	Ga0495679_022846_1160_1750	194
1097	3300047470	Ga0495681_0000455	Ga0495681_0000455_7010_7600	194
1098	3300047470	Ga0495681_0001167	Ga0495681_0001167_18322_18912	194
1099	3300047470	Ga0495681_0004083	Ga0495681_0004083_3466_4056	194
1100	3300047470	Ga0495681_0015442	Ga0495681_0015442_1414_2004	194
1101	3300047470	Ga0495681_0018928	Ga0495681_0018928_1122_1712	194
1102	3300047470	Ga0495681_0026068	Ga0495681_0026068_1203_1793	194
1103	3300047470	Ga0495681_0030938	Ga0495681_0030938_1025_1615	194
1104	3300047470	Ga0495681_0122857	Ga0495681_0122857_149_739	194
1105	3300047470	Ga0495681_0141390	Ga0495681_0141390_118_708	194
1106	3300047471	Ga0495684_0230707	Ga0495684_0230707_180_773	194
1107	3300047472	Ga0495686_0000130	Ga0495686_0000130_95618_96208	194
1108	3300047472	Ga0495686_0001215	Ga0495686_0001215_6678_7268	194
1109	3300047472	Ga0495686_0210377	Ga0495686_0210377_70_660	194
1110	3300047673	Ga0495593_0034812	Ga0495593_0034812_1979_2569	194
1111	3300047673	Ga0495593_0099678	Ga0495593_0099678_599_1189	194
1112	3300048088	Ga0495602_0044498	Ga0495602_0044498_2061_2651	194
1113	3300048088	Ga0495602_0062781	Ga0495602_0062781_1745_2335	194
1114	3300048088	Ga0495602_0321209	Ga0495602_0321209_252_839	194
1115	3300048091	Ga0495626_0000042	Ga0495626_0000042_19430_20020	194
1116	3300048091	Ga0495626_0002441	Ga0495626_0002441_10789_11379	194
1117	3300048091	Ga0495626_0009568	Ga0495626_0009568_3382_3972	194
1118	3300048091	Ga0495626_0010342	Ga0495626_0010342_3772_4362	194
1119	3300048091	Ga0495626_0017320	Ga0495626_0017320_2752_3342	194
1120	3300048091	Ga0495626_0022348	Ga0495626_0022348_1480_2070	194
1121	3300048091	Ga0495626_0034400	Ga0495626_0034400_95_685	194
1122	3300048091	Ga0495626_0037070	Ga0495626_0037070_1159_1749	194
1123	3300048091	Ga0495626_0043494	Ga0495626_0043494_433_1032	194
1124	3300048091	Ga0495626_0133223	Ga0495626_0133223_340_930	194
1125	3300048091	Ga0495626_0148313	Ga0495626_0148313_131_730	194
1126	3300048903	Ga0496100_0079522	Ga0496100_0079522_57_647	194
1127	3300048904	Ga0496101_0005231	Ga0496101_0005231_815_1405	194
1128	3300048904	Ga0496101_0048808	Ga0496101_0048808_1156_1770	194
1129	3300048904	Ga0496101_0263203	Ga0496101_0263203_716_1306	194
1130	3300048904	Ga0496101_0425976	Ga0496101_0425976_198_788	194
1131	3300048905	Ga0496102_0051648	Ga0496102_0051648_1572_2165	194
1132	3300048905	Ga0496102_0088537	Ga0496102_0088537_648_1235	194
1133	3300048905	Ga0496102_0109300	Ga0496102_0109300_1400_1990	194
1134	3300048905	Ga0496102_0205369	Ga0496102_0205369_96_710	194
1135	3300048906	Ga0496103_0014199	Ga0496103_0014199_3021_3611	194
1136	3300048906	Ga0496103_0135877	Ga0496103_0135877_691_1281	194
1137	3300048907	Ga0496104_0412861	Ga0496104_0412861_489_1079	194
1138	3300048908	Ga0496105_0144873	Ga0496105_0144873_700_1290	194
1139	3300048909	Ga0496106_0008554	Ga0496106_0008554_3842_4432	194
1140	3300048909	Ga0496106_0087145	Ga0496106_0087145_726_1340	194
1141	3300048910	Ga0496107_0063908	Ga0496107_0063908_1730_2344	194
1142	3300048910	Ga0496107_0128972	Ga0496107_0128972_137_727	194
1143	3300048911	Ga0496108_0116603	Ga0496108_0116603_1040_1630	194
1144	3300048912	Ga0496109_0156251	Ga0496109_0156251_974_1588	194
1145	3300048912	Ga0496109_0410009	Ga0496109_0410009_425_1015	194
1146	3300048912	Ga0496109_0641087	Ga0496109_0641087_77_667	194
1147	3300048913	Ga0496110_0001119	Ga0496110_0001119_17245_17835	194
1148	3300048913	Ga0496110_0122033	Ga0496110_0122033_1468_2082	194
1149	3300048913	Ga0496110_0176636	Ga0496110_0176636_1308_1898	194
1150	3300048913	Ga0496110_0181965	Ga0496110_0181965_1180_1770	194
1151	3300048914	Ga0496111_0133054	Ga0496111_0133054_71_685	194
1152	3300048915	Ga0496112_0170140	Ga0496112_0170140_1114_1728	194
1153	3300048915	Ga0496112_0328783	Ga0496112_0328783_27_617	194
1154	3300048915	Ga0496112_0584967	Ga0496112_0584967_313_903	194
1155	3300048916	Ga0496113_0034910	Ga0496113_0034910_844_1434	194
1156	3300048916	Ga0496113_0108262	Ga0496113_0108262_699_1289	194
1157	3300048917	Ga0496114_0165167	Ga0496114_0165167_1235_1849	194
1158	3300048917	Ga0496114_0374886	Ga0496114_0374886_213_803	194
1159	3300048918	Ga0496115_0109513	Ga0496115_0109513_1341_1955	194
1160	3300048924	Ga0496121_0013420	Ga0496121_0013420_3474_4061	194
1161	3300048924	Ga0496121_0063204	Ga0496121_0063204_2127_2717	194
1162	3300048924	Ga0496121_0101785	Ga0496121_0101785_1542_2138	194
1163	3300048924	Ga0496121_0241065	Ga0496121_0241065_425_1015	194
1164	3300048925	Ga0496122_0000482	Ga0496122_0000482_78163_78753	194
1165	3300048925	Ga0496122_0022840	Ga0496122_0022840_1641_2231	194
1166	3300048925	Ga0496122_0037643	Ga0496122_0037643_814_1404	194
1167	3300048926	Ga0496123_0000662	Ga0496123_0000662_3899_4489	194
1168	3300048926	Ga0496123_0025307	Ga0496123_0025307_3782_4372	194
1169	3300048927	Ga0496124_0057704	Ga0496124_0057704_83_673	194
1170	3300048927	Ga0496124_0083503	Ga0496124_0083503_1152_1742	194
1171	3300048928	Ga0496125_0001380	Ga0496125_0001380_31056_31646	194
1172	3300048928	Ga0496125_0012862	Ga0496125_0012862_2761_3357	194
1173	3300048928	Ga0496125_0154915	Ga0496125_0154915_831_1421	194
1174	3300048929	Ga0496126_0079885	Ga0496126_0079885_1208_1798	194
1175	3300049128	Ga0501308_000174	Ga0501308_000174_111_701	194
1176	3300049459	Ga0495678_000353	Ga0495678_000353_43005_43595	194
1177	3300049459	Ga0495678_000462	Ga0495678_000462_2613_3203	194
1178	3300049459	Ga0495678_000660	Ga0495678_000660_5593_6183	194
1179	3300049459	Ga0495678_000868	Ga0495678_000868_1166_1756	194
1180	3300049459	Ga0495678_008424	Ga0495678_008424_879_1469	194
1181	3300049460	Ga0495682_0000226	Ga0495682_0000226_3666_4256	194
1182	3300049515	Ga0501292_006409	Ga0501292_006409_270_866	194
1183	3300049521	Ga0501298_061517	Ga0501298_061517_107_703	194
1184	3300049527	Ga0501311_025932	Ga0501311_025932_186_776	194
1185	3300049571	Ga0501034_0077417	Ga0501034_0077417_328_918	194
1186	3300049579	Ga0501043_0000002	Ga0501043_0000002_211834_212430	194
1187	3300049580	Ga0501046_0000008	Ga0501046_0000008_211917_212513	194
1188	3300049581	Ga0501047_0000003	Ga0501047_0000003_235099_235695	194
1189	3300049582	Ga0501048_0078742	Ga0501048_0078742_1016_1612	194
1190	3300049649	Ga0501198_000024	Ga0501198_000024_15155_15754	194
1191	3300049653	Ga0501206_009866	Ga0501206_009866_489_1085	194
1192	3300049658	Ga0501211_007252	Ga0501211_007252_16_606	194
1193	3300049662	Ga0501222_000020	Ga0501222_000020_51436_52035	194
1194	3300049662	Ga0501222_005849	Ga0501222_005849_587_1177	194
1195	3300049665	Ga0501227_001594	Ga0501227_001594_1972_2562	194
1196	3300049686	Ga0501257_066310	Ga0501257_066310_166_762	194
1197	3300049762	Ga0501265_002284	Ga0501265_002284_1253_1849	194
1198	3300049777	Ga0501281_01350	Ga0501281_01350_14_610	194
1199	3300049822	Ga0501035_0003996	Ga0501035_0003996_11660_12250	194
1200	3300049824	Ga0501045_0003417	Ga0501045_0003417_2393_2989	194
1201	3300050489	nmdc:mga03683_210910_c1	nmdc:mga03683_210910_c1_92_691	194
1202	3300050489	nmdc:mga03683_4639_c1	nmdc:mga03683_4639_c1_2108_2707	194
1203	3300050490	nmdc:mga03n38_35682_c1	nmdc:mga03n38_35682_c1_994_1593	194
1204	3300050491	nmdc:mga00v17_170_c1	nmdc:mga00v17_170_c1_34742_35329	194
1205	3300050491	nmdc:mga00v17_68878_c1	nmdc:mga00v17_68878_c1_1037_1636	194
1206	3300050492	nmdc:mga0yw44_59406_c1	nmdc:mga0yw44_59406_c1_968_1567	194
1207	3300050493	nmdc:mga0k408_108650_c1	nmdc:mga0k408_108650_c1_501_1100	194
1208	3300050493	nmdc:mga0k408_15012_c1	nmdc:mga0k408_15012_c1_3093_3692	194
1209	3300050493	nmdc:mga0k408_16277_c1	nmdc:mga0k408_16277_c1_585_1184	194
1210	3300050493	nmdc:mga0k408_213_c1	nmdc:mga0k408_213_c1_15588_16187	194
1211	3300050493	nmdc:mga0k408_2734_c1	nmdc:mga0k408_2734_c1_4214_4813	194
1212	3300050493	nmdc:mga0k408_28547_c1	nmdc:mga0k408_28547_c1_1086_1685	194
1213	3300050493	nmdc:mga0k408_48946_c1	nmdc:mga0k408_48946_c1_1222_1815	194
1214	3300050493	nmdc:mga0k408_93384_c1	nmdc:mga0k408_93384_c1_321_908	194
1215	3300050494	nmdc:mga06z11_5393_c1	nmdc:mga06z11_5393_c1_1192_1791	194
1216	3300050494	nmdc:mga06z11_59620_c1	nmdc:mga06z11_59620_c1_895_1494	194
1217	3300050494	nmdc:mga06z11_79587_c1	nmdc:mga06z11_79587_c1_177_770	194
1218	3300050495	nmdc:mga04h51_110553_c1	nmdc:mga04h51_110553_c1_44_637	194
1219	3300050495	nmdc:mga04h51_111787_c1	nmdc:mga04h51_111787_c1_181_780	194
1220	3300050495	nmdc:mga04h51_12857_c1	nmdc:mga04h51_12857_c1_1003_1602	194
1221	3300050495	nmdc:mga04h51_61158_c1	nmdc:mga04h51_61158_c1_423_1022	194
1222	3300050496	nmdc:mga07m45_110700_c1	nmdc:mga07m45_110700_c1_337_933	194
1223	3300050496	nmdc:mga07m45_171854_c1	nmdc:mga07m45_171854_c1_633_1226	194
1224	3300050496	nmdc:mga07m45_19627_c1	nmdc:mga07m45_19627_c1_1043_1642	194
1225	3300050496	nmdc:mga07m45_203935_c1	nmdc:mga07m45_203935_c1_409_1008	194
1226	3300050496	nmdc:mga07m45_58494_c1	nmdc:mga07m45_58494_c1_743_1342	194
1227	3300050496	nmdc:mga07m45_769_c1	nmdc:mga07m45_769_c1_6572_7171	194
1228	3300050496	nmdc:mga07m45_847_c1	nmdc:mga07m45_847_c1_8911_9510	194
1229	3300050513	nmdc:mga0rr50_593957_c1	nmdc:mga0rr50_593957_c1_157_744	194
1230	3300050514	nmdc:mga08x19_514680_c1	nmdc:mga08x19_514680_c1_209_823	194
1231	3300050516	nmdc:mga0sz30_30187_c1	nmdc:mga0sz30_30187_c1_767_1366	194
1232	3300053077	Ga0495601_0067565	Ga0495601_0067565_794_1381	194
1233	3300053084	Ga0495595_0053453	Ga0495595_0053453_258_845	194
1234	3300053085	Ga0495619_0011475	Ga0495619_0011475_4389_4976	194
1235	3300053117	Ga0500593_000047	Ga0500593_000047_5968_6567	194
1236	3300053154	Ga0500619_000032	Ga0500619_000032_1369_1956	194
1237	3300059492	Ga0587073_0077871	Ga0587073_0077871_189_779	194
1238	3300059503	Ga0587080_031267	Ga0587080_031267_174_764	194
1239	3300059508	Ga0587088_029625	Ga0587088_029625_342_932	194
1240	3300059511	Ga0587091_020515	Ga0587091_020515_119_709	194
1241	3300059513	Ga0587094_029273	Ga0587094_029273_218_808	194
1242	3300059604	Ga0587098_002320	Ga0587098_002320_425_1015	194
1243	3300059608	Ga0587129_004738	Ga0587129_004738_194_784	194
1244	3300059623	Ga0587101_035658	Ga0587101_035658_180_770	194
1245	3300059640	Ga0587067_026328	Ga0587067_026328_298_888	194
1246	3300059641	Ga0587068_031431	Ga0587068_031431_313_903	194
1247	3300059647	Ga0587079_046995	Ga0587079_046995_25_615	194
1248	3300059651	Ga0587105_006486	Ga0587105_006486_31_621	194
1249	3300060346	Ga0587111_0079511	Ga0587111_0079511_176_766	194
1250	3300060353	Ga0501082_0388127	Ga0501082_0388127_507_1103	194
1251	3300061719	Ga0466962_0029686	Ga0466962_0029686_1581_2171	194
1252	iso_pu_bacteria	2511231026	2511385820	194
1253	iso_pu_bacteria	2585428057	2587725533	194
1254	iso_pu_bacteria	2585428058	2587735001	194
1255	iso_pu_bacteria	2588253510	2588290533	194
1256	iso_pu_bacteria	2643221544	2643743624	194
1257	iso_pu_bacteria	2643221585	2643936609	194
1258	iso_pu_bacteria	2643221592	2643970048	194
1259	iso_pu_bacteria	2643221603	2644027016	194
1260	iso_pu_bacteria	2643221625	2644142978	194
1261	iso_pu_bacteria	2643221644	2644244839	194
1262	iso_pu_bacteria	2643221648	2644271962	194
1263	iso_pu_bacteria	2643221654	2644303303	194
1264	iso_pu_bacteria	2643221656	2644317965	194
1265	iso_pu_bacteria	2643221660	2644341109	194
1266	iso_pu_bacteria	2738541337	2739058157	194
1267	iso_pu_bacteria	2808606386	2808982589	194
1268	iso_pu_bacteria	2808606415	2809129584	194
1269	iso_pu_bacteria	2808606419	2809149361	194
1270	iso_pu_bacteria	2818991436	2819543792	194
1271	iso_pu_bacteria	2831864461	2831865189	194
1272	iso_pu_bacteria	2852618963	2852619503	194
1273	iso_pu_bacteria	2886848708	2886851784	194
1274	iso_pu_bacteria	2904479285	2904481552	194
1275	iso_pu_bacteria	2919704043	2919707091	194
1276	iso_pu_bacteria	2939631187	2939635095	194
1277	iso_pu_bacteria	2945909444	2945913941	194
1278	iso_pu_bacteria	2945984333	2945990661	194
1279	iso_pu_bacteria	8057160832	8057163528	194
1280	3300001979	JGI24740J21852_10018769	JGI24740J21852_100187692	195
1281	3300002705	JGI25156J39149_1000403	JGI25156J39149_100040328	195
1282	3300002705	JGI25156J39149_1017222	JGI25156J39149_10172222	195
1283	3300002705	JGI25156J39149_1025159	JGI25156J39149_10251591	195
1284	3300002737	JGI25162J39368_1000040	JGI25162J39368_100004040	195
1285	3300002737	JGI25162J39368_1000098	JGI25162J39368_100009883	195
1286	3300002737	JGI25162J39368_1000129	JGI25162J39368_100012971	195
1287	3300002738	JGI25154J39366_1001215	JGI25154J39366_10012154	195
1288	3300002741	JGI25157J39369_1000008	JGI25157J39369_1000008123	195
1289	3300002772	JGI25164J39214_1000076	JGI25164J39214_10000767	195
1290	3300002772	JGI25164J39214_1000101	JGI25164J39214_10001016	195
1291	3300002772	JGI25164J39214_1004161	JGI25164J39214_10041613	195
1292	3300002773	JGI25152J39213_1000516	JGI25152J39213_100051612	195
1293	3300002774	JGI25150J39212_1005216	JGI25150J39212_10052163	195
1294	3300003214	JGI25165J46597_1000051	JGI25165J46597_1000051160	195
1295	3300003214	JGI25165J46597_1000150	JGI25165J46597_100015097	195
1296	3300003214	JGI25165J46597_1000180	JGI25165J46597_100018083	195
1297	3300003215	JGI25153J46596_10002374	JGI25153J46596_1000237411	195
1298	3300003215	JGI25153J46596_10003174	JGI25153J46596_1000317411	195
1299	3300003316	rootH1_10011053	rootH1_100110539	195
1300	3300003544	Ga0007417J51691_1039383	Ga0007417J51691_10393831	195
1301	3300003574	Ga0007410J51695_1046628	Ga0007410J51695_10466282	195
1302	3300003575	Ga0007409J51694_1026410	Ga0007409J51694_10264102	195
1303	3300003577	Ga0007416J51690_1028051	Ga0007416J51690_10280512	195
1304	3300003611	Ga0007411J51799_120039	Ga0007411J51799_1200392	195
1305	3300003693	Ga0032354_1041297	Ga0032354_10412972	195
1306	3300003751	Ga0055538_1000025	Ga0055538_100002574	195
1307	3300003752	Ga0055539_1000032	Ga0055539_1000032160	195
1308	3300003752	Ga0055539_1000255	Ga0055539_10002552	195
1309	3300003752	Ga0055539_1002085	Ga0055539_10020854	195
1310	3300003756	Ga0055533_1000040	Ga0055533_1000040125	195
1311	3300003756	Ga0055533_1000042	Ga0055533_100004274	195
1312	3300003759	Ga0055525_1000031	Ga0055525_100003167	195
1313	3300003759	Ga0055525_1000050	Ga0055525_100005074	195
1314	3300003759	Ga0055525_1000815	Ga0055525_10008153	195
1315	3300003761	Ga0055535_1000052	Ga0055535_10000526	195
1316	3300003761	Ga0055535_1013209	Ga0055535_10132092	195
1317	3300003763	Ga0055529_1000053	Ga0055529_1000053151	195
1318	3300003771	Ga0055526_1002127	Ga0055526_10021273	195
1319	3300003771	Ga0055526_1004387	Ga0055526_10043879	195
1320	3300003781	Ga0055536_1000232	Ga0055536_10002327	195
1321	3300003790	Ga0055528_1045368	Ga0055528_10453682	195
1322	3300003791	Ga0055530_10000390	Ga0055530_1000039031	195
1323	3300003791	Ga0055530_10059012	Ga0055530_100590122	195
1324	3300003792	Ga0055540_1001014	Ga0055540_100101414	195
1325	3300003792	Ga0055540_1010345	Ga0055540_10103452	195
1326	3300003792	Ga0055540_1015724	Ga0055540_10157242	195
1327	3300003794	Ga0055531_10000105	Ga0055531_1000010519	195
1328	3300003794	Ga0055531_10008464	Ga0055531_100084644	195
1329	3300003841	Ga0055541_1000023	Ga0055541_100002373	195
1330	3300005262	Ga0065165_1000170	Ga0065165_100017034	195
1331	3300005262	Ga0065165_1000273	Ga0065165_100027354	195
1332	3300005327	Ga0070658_10049682	Ga0070658_100496822	195
1333	3300005327	Ga0070658_10076377	Ga0070658_100763772	195
1334	3300005327	Ga0070658_10477454	Ga0070658_104774542	195
1335	3300005330	Ga0070690_100049964	Ga0070690_1000499641	195
1336	3300005330	Ga0070690_100402343	Ga0070690_1004023432	195
1337	3300005337	Ga0070682_100015834	Ga0070682_1000158343	195
1338	3300005339	Ga0070660_100515499	Ga0070660_1005154991	195
1339	3300005339	Ga0070660_100587045	Ga0070660_1005870452	195
1340	3300005364	Ga0070673_100068367	Ga0070673_1000683673	195
1341	3300005366	Ga0070659_100047516	Ga0070659_1000475163	195
1342	3300005439	Ga0070711_100000825	Ga0070711_1000008254	195
1343	3300005444	Ga0070694_100175035	Ga0070694_1001750352	195
1344	3300005457	Ga0070662_100001973	Ga0070662_1000019732	195
1345	3300005457	Ga0070662_100035406	Ga0070662_1000354064	195
1346	3300005457	Ga0070662_101078088	Ga0070662_1010780881	195
1347	3300005543	Ga0070672_100642009	Ga0070672_1006420092	195
1348	3300005548	Ga0070665_100108139	Ga0070665_1001081392	195
1349	3300005563	Ga0068855_100002624	Ga0068855_1000026249	195
1350	3300005563	Ga0068855_100309133	Ga0068855_1003091332	195
1351	3300005563	Ga0068855_100334075	Ga0068855_1003340752	195
1352	3300005563	Ga0068855_100480293	Ga0068855_1004802932	195
1353	3300005563	Ga0068855_101071297	Ga0068855_1010712972	195
1354	3300005577	Ga0068857_100013938	Ga0068857_1000139388	195
1355	3300005577	Ga0068857_100086208	Ga0068857_1000862082	195
1356	3300005578	Ga0068854_100017693	Ga0068854_1000176936	195
1357	3300005614	Ga0068856_100014860	Ga0068856_1000148602	195
1358	3300005616	Ga0068852_100135582	Ga0068852_1001355823	195
1359	3300005616	Ga0068852_100225051	Ga0068852_1002250513	195
1360	3300005719	Ga0068861_100017071	Ga0068861_1000170716	195
1361	3300005841	Ga0068863_101495533	Ga0068863_1014955331	195
1362	3300005842	Ga0068858_100016150	Ga0068858_1000161505	195
1363	3300006028	Ga0070717_10001122	Ga0070717_100011222	195
1364	3300006048	Ga0075363_100038287	Ga0075363_1000382872	195
1365	3300006051	Ga0075364_10095891	Ga0075364_100958913	195
1366	3300006058	Ga0075432_10052639	Ga0075432_100526393	195
1367	3300006163	Ga0070715_10119776	Ga0070715_101197761	195
1368	3300006195	Ga0075366_10001287	Ga0075366_1000128716	195
1369	3300006195	Ga0075366_10010351	Ga0075366_100103512	195
1370	3300006195	Ga0075366_10062590	Ga0075366_100625902	195
1371	3300006195	Ga0075366_10201183	Ga0075366_102011832	195
1372	3300006195	Ga0075366_10235982	Ga0075366_102359822	195
1373	3300006353	Ga0075370_10000282	Ga0075370_1000028222	195
1374	3300006353	Ga0075370_10002199	Ga0075370_100021996	195
1375	3300006353	Ga0075370_10010743	Ga0075370_100107435	195
1376	3300006353	Ga0075370_10051377	Ga0075370_100513772	195
1377	3300006353	Ga0075370_10061287	Ga0075370_100612872	195
1378	3300006353	Ga0075370_10238961	Ga0075370_102389611	195
1379	3300006844	Ga0075428_100881362	Ga0075428_1008813622	195
1380	3300006914	Ga0075436_100213086	Ga0075436_1002130862	195
1381	3300006944	Ga0099823_1000155	Ga0099823_100015524	195
1382	3300009011	Ga0105251_10006725	Ga0105251_100067257	195
1383	3300009092	Ga0105250_10001470	Ga0105250_100014701	195
1384	3300009092	Ga0105250_10313015	Ga0105250_103130151	195
1385	3300009093	Ga0105240_10247624	Ga0105240_102476243	195
1386	3300009094	Ga0111539_10256520	Ga0111539_102565203	195
1387	3300009094	Ga0111539_10741130	Ga0111539_107411301	195
1388	3300009098	Ga0105245_10299731	Ga0105245_102997311	195
1389	3300009101	Ga0105247_10314179	Ga0105247_103141791	195
1390	3300009147	Ga0114129_10085847	Ga0114129_100858473	195
1391	3300009148	Ga0105243_10000047	Ga0105243_10000047137	195
1392	3300009148	Ga0105243_10035082	Ga0105243_100350823	195
1393	3300009148	Ga0105243_10269263	Ga0105243_102692632	195
1394	3300009174	Ga0105241_10128738	Ga0105241_101287382	195
1395	3300009177	Ga0105248_10004052	Ga0105248_1000405212	195
1396	3300009545	Ga0105237_10001363	Ga0105237_1000136314	195
1397	3300009545	Ga0105237_10383105	Ga0105237_103831052	195
1398	3300009551	Ga0105238_10019535	Ga0105238_100195355	195
1399	3300009551	Ga0105238_10102780	Ga0105238_101027802	195
1400	3300010375	Ga0105239_10000954	Ga0105239_1000095422	195
1401	3300010375	Ga0105239_10026451	Ga0105239_100264514	195
1402	3300010375	Ga0105239_11567655	Ga0105239_115676551	195
1403	3300011119	Ga0105246_10705166	Ga0105246_107051662	195
1404	3300012497	Ga0157319_1000003	Ga0157319_10000036	195
1405	3300013100	Ga0157373_10043497	Ga0157373_100434972	195
1406	3300013102	Ga0157371_10037911	Ga0157371_100379113	195
1407	3300013102	Ga0157371_10254273	Ga0157371_102542732	195
1408	3300013105	Ga0157369_10003810	Ga0157369_100038107	195
1409	3300013105	Ga0157369_10115053	Ga0157369_101150532	195
1410	3300013307	Ga0157372_10400538	Ga0157372_104005382	195
1411	3300014497	Ga0182008_10000066	Ga0182008_1000006678	195
1412	3300014497	Ga0182008_10164253	Ga0182008_101642532	195
1413	3300014497	Ga0182008_10339440	Ga0182008_103394401	195
1414	3300014968	Ga0157379_10128498	Ga0157379_101284983	195
1415	3300014968	Ga0157379_11028091	Ga0157379_110280912	195
1416	3300015261	Ga0182006_1052011	Ga0182006_10520112	195
1417	3300015262	Ga0182007_10000738	Ga0182007_1000073814	195
1418	3300015262	Ga0182007_10027364	Ga0182007_100273641	195
1419	3300015262	Ga0182007_10036086	Ga0182007_100360862	195
1420	3300015265	Ga0182005_1000405	Ga0182005_10004053	195
1421	3300017792	Ga0163161_10098086	Ga0163161_100980862	195
1422	3300021361	Ga0213872_10000031	Ga0213872_10000031122	195
1423	3300021361	Ga0213872_10000175	Ga0213872_1000017530	195
1424	3300021361	Ga0213872_10001386	Ga0213872_100013864	195
1425	3300021361	Ga0213872_10010796	Ga0213872_100107963	195
1426	3300021361	Ga0213872_10026256	Ga0213872_100262562	195
1427	3300021361	Ga0213872_10035330	Ga0213872_100353302	195
1428	3300025207	Ga0209760_100059	Ga0209760_1000597	195
1429	3300025207	Ga0209760_100140	Ga0209760_10014029	195
1430	3300025207	Ga0209760_105981	Ga0209760_1059812	195
1431	3300025224	Ga0209784_100010	Ga0209784_100010451	195
1432	3300025225	Ga0209566_100008	Ga0209566_100008451	195
1433	3300025226	Ga0209674_100019	Ga0209674_100019451	195
1434	3300025226	Ga0209674_100066	Ga0209674_100066114	195
1435	3300025228	Ga0209672_105575	Ga0209672_1055752	195
1436	3300025230	Ga0209563_100021	Ga0209563_100021451	195
1437	3300025230	Ga0209563_100044	Ga0209563_100044136	195
1438	3300025230	Ga0209563_100107	Ga0209563_10010797	195
1439	3300025230	Ga0209563_100467	Ga0209563_1004678	195
1440	3300025231	Ga0207427_100014	Ga0207427_100014259	195
1441	3300025231	Ga0207427_100016	Ga0207427_10001629	195
1442	3300025231	Ga0207427_100266	Ga0207427_10026636	195
1443	3300025231	Ga0207427_100432	Ga0207427_1004328	195
1444	3300025233	Ga0209437_100011	Ga0209437_100011218	195
1445	3300025233	Ga0209437_100016	Ga0209437_100016378	195
1446	3300025233	Ga0209437_100019	Ga0209437_100019451	195
1447	3300025242	Ga0209258_100074	Ga0209258_100074113	195
1448	3300025242	Ga0209258_100489	Ga0209258_10048912	195
1449	3300025245	Ga0207425_1001221	Ga0207425_100122112	195
1450	3300025246	Ga0209646_1000039	Ga0209646_1000039134	195
1451	3300025250	Ga0209026_1000006	Ga0209026_1000006467	195
1452	3300025250	Ga0209026_1004124	Ga0209026_10041242	195
1453	3300025253	Ga0209677_100011	Ga0209677_100011451	195
1454	3300025253	Ga0209677_100052	Ga0209677_100052114	195
1455	3300025253	Ga0209677_100914	Ga0209677_1009149	195
1456	3300025254	Ga0209148_1011502	Ga0209148_10115022	195
1457	3300025256	Ga0209759_1000020	Ga0209759_1000020122	195
1458	3300025256	Ga0209759_1000909	Ga0209759_100090910	195
1459	3300025256	Ga0209759_1002131	Ga0209759_10021312	195
1460	3300025256	Ga0209759_1003276	Ga0209759_10032765	195
1461	3300025256	Ga0209759_1007665	Ga0209759_10076654	195
1462	3300025258	Ga0209129_1000269	Ga0209129_100026955	195
1463	3300025261	Ga0209233_1000019	Ga0209233_1000019218	195
1464	3300025261	Ga0209233_1000025	Ga0209233_1000025451	195
1465	3300025261	Ga0209233_1000036	Ga0209233_1000036259	195
1466	3300025272	Ga0209455_1000066	Ga0209455_1000066153	195
1467	3300025272	Ga0209455_1034990	Ga0209455_10349902	195
1468	3300025273	Ga0209673_1002449	Ga0209673_10024492	195
1469	3300025273	Ga0209673_1003591	Ga0209673_100359111	195
1470	3300025273	Ga0209673_1007404	Ga0209673_10074046	195
1471	3300025273	Ga0209673_1014331	Ga0209673_10143313	195
1472	3300025273	Ga0209673_1016306	Ga0209673_10163062	195
1473	3300025292	Ga0209676_1000032	Ga0209676_1000032240	195
1474	3300025295	Ga0209564_1000021	Ga0209564_1000021514	195
1475	3300025295	Ga0209564_1000300	Ga0209564_100030055	195
1476	3300025297	Ga0209758_1000453	Ga0209758_100045350	195
1477	3300025297	Ga0209758_1000605	Ga0209758_100060536	195
1478	3300025298	Ga0209050_1000025	Ga0209050_1000025241	195
1479	3300025298	Ga0209050_1000770	Ga0209050_100077016	195
1480	3300025299	Ga0209256_1000085	Ga0209256_100008536	195
1481	3300025299	Ga0209256_1000437	Ga0209256_100043754	195
1482	3300025299	Ga0209256_1018549	Ga0209256_10185492	195
1483	3300025299	Ga0209256_1026460	Ga0209256_10264602	195
1484	3300025303	Ga0209051_1000039	Ga0209051_100003936	195
1485	3300025303	Ga0209051_1000047	Ga0209051_100004736	195
1486	3300025303	Ga0209051_1000196	Ga0209051_1000196115	195
1487	3300025303	Ga0209051_1001914	Ga0209051_100191418	195
1488	3300025303	Ga0209051_1001930	Ga0209051_100193010	195
1489	3300025303	Ga0209051_1012803	Ga0209051_10128034	195
1490	3300025303	Ga0209051_1015850	Ga0209051_10158502	195
1491	3300025304	Ga0209257_1000047	Ga0209257_1000047215	195
1492	3300025304	Ga0209257_1000305	Ga0209257_10003054	195
1493	3300025304	Ga0209257_1000479	Ga0209257_100047936	195
1494	3300025304	Ga0209257_1016509	Ga0209257_10165091	195
1495	3300025711	Ga0207696_1000020	Ga0207696_1000020144	195
1496	3300025711	Ga0207696_1000057	Ga0207696_1000057206	195
1497	3300025728	Ga0207655_1000014	Ga0207655_1000014341	195
1498	3300025728	Ga0207655_1001081	Ga0207655_100108124	195
1499	3300025728	Ga0207655_1008750	Ga0207655_10087503	195
1500	3300025735	Ga0207713_1000032	Ga0207713_1000032238	195
1501	3300025735	Ga0207713_1027834	Ga0207713_10278344	195
1502	3300025735	Ga0207713_1040903	Ga0207713_10409032	195
1503	3300025905	Ga0207685_10404339	Ga0207685_104043391	195
1504	3300025909	Ga0207705_10066373	Ga0207705_100663733	195
1505	3300025913	Ga0207695_10021837	Ga0207695_100218378	195
1506	3300025913	Ga0207695_10499486	Ga0207695_104994862	195
1507	3300025913	Ga0207695_10592364	Ga0207695_105923642	195
1508	3300025914	Ga0207671_10006057	Ga0207671_100060575	195
1509	3300025914	Ga0207671_10756595	Ga0207671_107565952	195
1510	3300025916	Ga0207663_10000952	Ga0207663_1000095212	195
1511	3300025919	Ga0207657_10051118	Ga0207657_100511182	195
1512	3300025919	Ga0207657_10224081	Ga0207657_102240812	195
1513	3300025920	Ga0207649_10310822	Ga0207649_103108222	195
1514	3300025924	Ga0207694_10022029	Ga0207694_100220296	195
1515	3300025932	Ga0207690_10035082	Ga0207690_100350824	195
1516	3300025932	Ga0207690_10146916	Ga0207690_101469162	195
1517	3300025933	Ga0207706_10018377	Ga0207706_100183774	195
1518	3300025934	Ga0207686_10361778	Ga0207686_103617781	195
1519	3300025935	Ga0207709_10000249	Ga0207709_1000024916	195
1520	3300025935	Ga0207709_10008739	Ga0207709_100087393	195
1521	3300025935	Ga0207709_10094484	Ga0207709_100944842	195
1522	3300025935	Ga0207709_10169994	Ga0207709_101699942	195
1523	3300025940	Ga0207691_10318116	Ga0207691_103181162	195
1524	3300025941	Ga0207711_10069905	Ga0207711_100699051	195
1525	3300025942	Ga0207689_10021363	Ga0207689_100213635	195
1526	3300025949	Ga0207667_10001245	Ga0207667_100012459	195
1527	3300025949	Ga0207667_10028439	Ga0207667_100284397	195
1528	3300025949	Ga0207667_10420058	Ga0207667_104200582	195
1529	3300025949	Ga0207667_10567821	Ga0207667_105678212	195
1530	3300025960	Ga0207651_10004471	Ga0207651_100044717	195
1531	3300025961	Ga0207712_10032361	Ga0207712_100323612	195
1532	3300025981	Ga0207640_10007491	Ga0207640_100074912	195
1533	3300026035	Ga0207703_10009554	Ga0207703_100095545	195
1534	3300026041	Ga0207639_10294177	Ga0207639_102941772	195
1535	3300026067	Ga0207678_10351873	Ga0207678_103518731	195
1536	3300026067	Ga0207678_10828762	Ga0207678_108287622	195
1537	3300026078	Ga0207702_10000310	Ga0207702_1000031053	195
1538	3300026116	Ga0207674_10025604	Ga0207674_100256047	195
1539	3300026116	Ga0207674_10407676	Ga0207674_104076762	195
1540	3300026116	Ga0207674_10419067	Ga0207674_104190672	195
1541	3300026118	Ga0207675_100049480	Ga0207675_1000494802	195
1542	3300026121	Ga0207683_10751271	Ga0207683_107512712	195
1543	3300026142	Ga0207698_10150527	Ga0207698_101505273	195
1544	3300026142	Ga0207698_10380535	Ga0207698_103805352	195
1545	3300026142	Ga0207698_10928782	Ga0207698_109287822	195
1546	3300027312	Ga0209371_1027302	Ga0209371_10273021	195
1547	3300027682	Ga0209971_1094442	Ga0209971_10944421	195
1548	3300028379	Ga0268266_10069481	Ga0268266_100694812	195
1549	3300028666	Ga0265336_10000024	Ga0265336_10000024114	195
1550	3300028786	Ga0307517_10110044	Ga0307517_101100442	195
1551	3300028794	Ga0307515_10000382	Ga0307515_1000038218	195
1552	3300028794	Ga0307515_10001774	Ga0307515_1000177440	195
1553	3300028794	Ga0307515_10041325	Ga0307515_100413259	195
1554	3300028794	Ga0307515_10041425	Ga0307515_100414257	195
1555	3300028794	Ga0307515_10094035	Ga0307515_100940352	195
1556	3300029957	Ga0265324_10001883	Ga0265324_100018835	195
1557	3300029957	Ga0265324_10017125	Ga0265324_100171252	195
1558	3300030500	Ga0268256_1031075	Ga0268256_10310752	195
1559	3300031242	Ga0265329_10012180	Ga0265329_100121802	195
1560	3300031250	Ga0265331_10001682	Ga0265331_1000168218	195
1561	3300031251	Ga0265327_10000042	Ga0265327_10000042154	195
1562	3300031507	Ga0307509_10201150	Ga0307509_102011502	195
1563	3300031548	Ga0307408_100000029	Ga0307408_100000029133	195
1564	3300031548	Ga0307408_100034792	Ga0307408_1000347924	195
1565	3300031548	Ga0307408_100082521	Ga0307408_1000825213	195
1566	3300031665	Ga0316575_10017473	Ga0316575_100174732	195
1567	3300031711	Ga0265314_10006203	Ga0265314_100062033	195
1568	3300031728	Ga0316578_10023186	Ga0316578_100231863	195
1569	3300031730	Ga0307516_10000676	Ga0307516_1000067638	195
1570	3300031730	Ga0307516_10001245	Ga0307516_100012454	195
1571	3300031730	Ga0307516_10003615	Ga0307516_1000361519	195
1572	3300031730	Ga0307516_10169610	Ga0307516_101696102	195
1573	3300031733	Ga0316577_10221137	Ga0316577_102211372	195
1574	3300031838	Ga0307518_10010469	Ga0307518_1001046910	195
1575	3300031911	Ga0307412_10876777	Ga0307412_108767771	195
1576	3300032002	Ga0307416_100060692	Ga0307416_1000606923	195
1577	3300032002	Ga0307416_100908739	Ga0307416_1009087392	195
1578	3300032004	Ga0307414_10038295	Ga0307414_100382954	195
1579	3300032004	Ga0307414_10334091	Ga0307414_103340912	195
1580	3300032005	Ga0307411_10010673	Ga0307411_100106731	195
1581	3300032005	Ga0307411_10233377	Ga0307411_102333772	195
1582	3300032005	Ga0307411_10331172	Ga0307411_103311722	195
1583	3300032168	Ga0316593_10011174	Ga0316593_100111742	195
1584	3300033541	Ga0316596_1116781	Ga0316596_11167811	195
1585	3300035088	Ga0373940_0086545	Ga0373940_0086545_297_893	195
1586	3300035114	Ga0373939_0000012	Ga0373939_0000012_24382_24978	195
1587	3300035118	Ga0373954_0006395	Ga0373954_0006395_782_1375	195
1588	3300035121	Ga0373960_0003041	Ga0373960_0003041_3170_3766	195
1589	3300035398	Ga0316574_0007020	Ga0316574_0007020_2205_2798	195
1590	3300035691	Ga0373931_0002689	Ga0373931_0002689_6682_7278	195
1591	3300035691	Ga0373931_0011591	Ga0373931_0011591_2084_2680	195
1592	3300036401	Ga0373937_0090127	Ga0373937_0090127_736_1329	195
1593	3300036712	Ga0316584_0040376	Ga0316584_0040376_1965_2558	195
1594	3300037312	Ga0395899_0001210	Ga0395899_0001210_12944_13540	195
1595	3300037312	Ga0395899_0007047	Ga0395899_0007047_4592_5188	195
1596	3300037312	Ga0395899_0017845	Ga0395899_0017845_1064_1660	195
1597	3300037312	Ga0395899_0019414	Ga0395899_0019414_4158_4754	195
1598	3300037418	Ga0395900_0000183	Ga0395900_0000183_20203_20799	195
1599	3300037418	Ga0395900_0019815	Ga0395900_0019815_5876_6472	195
1600	3300037418	Ga0395900_0050324	Ga0395900_0050324_484_1080	195
1601	3300037418	Ga0395900_0103028	Ga0395900_0103028_887_1483	195
1602	3300037418	Ga0395900_0151888	Ga0395900_0151888_1677_2273	195
1603	3300037418	Ga0395900_0173899	Ga0395900_0173899_908_1504	195
1604	3300037418	Ga0395900_0303045	Ga0395900_0303045_461_1057	195
1605	3300037418	Ga0395900_0385231	Ga0395900_0385231_445_1041	195
1606	3300037466	Ga0395898_0003251	Ga0395898_0003251_11585_12181	195
1607	3300037466	Ga0395898_0012246	Ga0395898_0012246_1632_2228	195
1608	3300037466	Ga0395898_0022445	Ga0395898_0022445_1886_2482	195
1609	3300037466	Ga0395898_0034026	Ga0395898_0034026_2858_3454	195
1610	3300037466	Ga0395898_0168484	Ga0395898_0168484_1042_1638	195
1611	3300037466	Ga0395898_0188761	Ga0395898_0188761_64_660	195
1612	3300037466	Ga0395898_1103470	Ga0395898_1103470_116_712	195
1613	3300037471	Ga0395905_0000027	Ga0395905_0000027_126468_127064	195
1614	3300037471	Ga0395905_0000544	Ga0395905_0000544_13048_13638	195
1615	3300037471	Ga0395905_0001411	Ga0395905_0001411_27309_27905	195
1616	3300037471	Ga0395905_0002682	Ga0395905_0002682_18053_18649	195
1617	3300037471	Ga0395905_0002893	Ga0395905_0002893_11546_12142	195
1618	3300037471	Ga0395905_0011168	Ga0395905_0011168_2903_3493	195
1619	3300037471	Ga0395905_0023393	Ga0395905_0023393_3351_3941	195
1620	3300037471	Ga0395905_0048969	Ga0395905_0048969_1707_2303	195
1621	3300037471	Ga0395905_0129390	Ga0395905_0129390_1582_2178	195
1622	3300037471	Ga0395905_0167078	Ga0395905_0167078_306_902	195
1623	3300038443	Ga0395901_0009647	Ga0395901_0009647_4342_4938	195
1624	3300038443	Ga0395901_0058565	Ga0395901_0058565_2419_3015	195
1625	3300038443	Ga0395901_0059163	Ga0395901_0059163_2749_3345	195
1626	3300038443	Ga0395901_0166691	Ga0395901_0166691_1376_1972	195
1627	3300038443	Ga0395901_0258861	Ga0395901_0258861_574_1170	195
1628	3300038443	Ga0395901_0483101	Ga0395901_0483101_329_925	195
1629	3300039447	Ga0436361_0469917	Ga0436361_0469917_1743_2339	195
1630	3300039447	Ga0436361_0599717	Ga0436361_0599717_12545_13141	195
1631	3300039447	Ga0436361_0913791	Ga0436361_0913791_91325_91921	195
1632	3300039447	Ga0436361_0975627	Ga0436361_0975627_1607_2212	195
1633	3300039447	Ga0436361_1151553	Ga0436361_1151553_26076_26669	195
1634	3300041406	Ga0439439_0013598	Ga0439439_0013598_1219_1809	195
1635	3300041459	Ga0451800_0593114	Ga0451800_0593114_158_751	195
1636	3300041459	Ga0451800_1220815	Ga0451800_1220815_684_1283	195
1637	3300041460	Ga0451802_1094500	Ga0451802_1094500_152_745	195
1638	3300041491	Ga0451833_0289815	Ga0451833_0289815_493_1092	195
1639	3300041491	Ga0451833_0541929	Ga0451833_0541929_67_663	195
1640	3300041496	Ga0451839_0884354	Ga0451839_0884354_17_610	195
1641	3300041512	Ga0451853_0135472	Ga0451853_0135472_255_854	195
1642	3300041997	Ga0439431_0135976	Ga0439431_0135976_37_639	195
1643	3300042000	Ga0439437_002093	Ga0439437_002093_168_764	195
1644	3300042000	Ga0439437_002431	Ga0439437_002431_835_1431	195
1645	3300042007	Ga0439449_0001931	Ga0439449_0001931_2572_3162	195
1646	3300042117	Ga0450913_002443	Ga0450913_002443_403_999	195
1647	3300042120	Ga0450917_000077	Ga0450917_000077_3346_3942	195
1648	3300042126	Ga0450888_020869	Ga0450888_020869_197_793	195
1649	3300042127	Ga0450890_000247	Ga0450890_000247_2400_2996	195
1650	3300042144	Ga0450889_000766	Ga0450889_000766_1578_2174	195
1651	3300042157	Ga0439458_0018624	Ga0439458_0018624_76_672	195
1652	3300042435	Ga0439434_0027144	Ga0439434_0027144_984_1577	195
1653	3300042438	Ga0439459_0003530	Ga0439459_0003530_370_966	195
1654	3300042461	Ga0439460_0014657	Ga0439460_0014657_1394_1990	195
1655	3300042876	Ga0451577_0003222	Ga0451577_0003222_13487_14086	195
1656	3300042876	Ga0451577_0003233	Ga0451577_0003233_17693_18289	195
1657	3300042876	Ga0451577_0151969	Ga0451577_0151969_254_847	195
1658	3300044656	Ga0466969_0006251	Ga0466969_0006251_2921_3517	195
1659	3300044656	Ga0466969_0008028	Ga0466969_0008028_3902_4498	195
1660	3300044656	Ga0466969_0235304	Ga0466969_0235304_34_630	195
1661	3300044658	Ga0466972_0001353	Ga0466972_0001353_4768_5364	195
1662	3300044658	Ga0466972_0108333	Ga0466972_0108333_167_763	195
1663	3300044658	Ga0466972_0134602	Ga0466972_0134602_401_997	195
1664	3300044658	Ga0466972_0140276	Ga0466972_0140276_456_1052	195
1665	3300044673	Ga0453683_0001910	Ga0453683_0001910_10638_11234	195
1666	3300044683	Ga0466965_0003434	Ga0466965_0003434_4889_5485	195
1667	3300044683	Ga0466965_0017692	Ga0466965_0017692_1611_2207	195
1668	3300044683	Ga0466965_0023889	Ga0466965_0023889_192_788	195
1669	3300044683	Ga0466965_0026491	Ga0466965_0026491_714_1310	195
1670	3300044683	Ga0466965_0083400	Ga0466965_0083400_689_1285	195
1671	3300044683	Ga0466965_0086347	Ga0466965_0086347_65_661	195
1672	3300044684	Ga0466966_0015082	Ga0466966_0015082_3575_4171	195
1673	3300044684	Ga0466966_0018583	Ga0466966_0018583_576_1172	195
1674	3300044684	Ga0466966_0026337	Ga0466966_0026337_2237_2833	195
1675	3300044684	Ga0466966_0034907	Ga0466966_0034907_2080_2676	195
1676	3300044693	Ga0466961_0005878	Ga0466961_0005878_2841_3437	195
1677	3300044693	Ga0466961_0021393	Ga0466961_0021393_1608_2204	195
1678	3300044693	Ga0466961_0029616	Ga0466961_0029616_2091_2687	195
1679	3300044693	Ga0466961_0045487	Ga0466961_0045487_121_717	195
1680	3300044694	Ga0466963_0022154	Ga0466963_0022154_2302_2898	195
1681	3300044694	Ga0466963_0043260	Ga0466963_0043260_625_1221	195
1682	3300044712	Ga0453684_0088806	Ga0453684_0088806_2051_2644	195
1683	3300044712	Ga0453684_0139836	Ga0453684_0139836_1232_1819	195
1684	3300044712	Ga0453684_0949189	Ga0453684_0949189_314_907	195
1685	3300044719	Ga0466971_0040422	Ga0466971_0040422_432_1028	195
1686	3300044719	Ga0466971_0052809	Ga0466971_0052809_255_851	195
1687	3300044735	Ga0466968_0085226	Ga0466968_0085226_762_1349	195
1688	3300044765	Ga0466970_0008552	Ga0466970_0008552_1674_2270	195
1689	3300044765	Ga0466970_0064839	Ga0466970_0064839_483_1079	195
1690	3300044765	Ga0466970_0118951	Ga0466970_0118951_34_630	195
1691	3300044842	Ga0466957_0017820	Ga0466957_0017820_995_1591	195
1692	3300044901	Ga0466960_0203042	Ga0466960_0203042_44_640	195
1693	3300045049	Ga0466959_0004682	Ga0466959_0004682_5601_6197	195
1694	3300045049	Ga0466959_0020814	Ga0466959_0020814_1606_2202	195
1695	3300045049	Ga0466959_0047499	Ga0466959_0047499_2324_2920	195
1696	3300045049	Ga0466959_0072394	Ga0466959_0072394_957_1553	195
1697	3300045049	Ga0466959_0096073	Ga0466959_0096073_1228_1824	195
1698	3300045049	Ga0466959_0273915	Ga0466959_0273915_538_1134	195
1699	3300045049	Ga0466959_0355029	Ga0466959_0355029_392_988	195
1700	3300045051	Ga0451576_0096124	Ga0451576_0096124_992_1588	195
1701	3300045051	Ga0451576_0218762	Ga0451576_0218762_585_1175	195
1702	3300045836	Ga0466958_0050288	Ga0466958_0050288_941_1537	195
1703	3300045836	Ga0466958_0165309	Ga0466958_0165309_272_868	195
1704	3300045836	Ga0466958_0253220	Ga0466958_0253220_305_901	195
1705	3300046453	Ga0495627_000192	Ga0495627_000192_12293_12886	195
1706	3300046454	Ga0495592_0077146	Ga0495592_0077146_689_1285	195
1707	3300046460	Ga0495638_0101410	Ga0495638_0101410_1054_1653	195
1708	3300046462	Ga0495651_0036560	Ga0495651_0036560_1472_2068	195
1709	3300046462	Ga0495651_0183775	Ga0495651_0183775_180_776	195
1710	3300046462	Ga0495651_0422238	Ga0495651_0422238_120_710	195
1711	3300046463	Ga0495653_0002868	Ga0495653_0002868_9900_10496	195
1712	3300046474	Ga0495605_0000620	Ga0495605_0000620_2448_3041	195
1713	3300046492	Ga0495585_0018557	Ga0495585_0018557_2211_2807	195
1714	3300046506	Ga0495583_0000034	Ga0495583_0000034_22530_23126	195
1715	3300046507	Ga0495606_0018881	Ga0495606_0018881_1975_2571	195
1716	3300046511	Ga0495608_0007317	Ga0495608_0007317_2177_2773	195
1717	3300046511	Ga0495608_0035957	Ga0495608_0035957_1465_2061	195
1718	3300046514	Ga0495618_0056878	Ga0495618_0056878_1284_1880	195
1719	3300046516	Ga0495628_0001227	Ga0495628_0001227_9161_9757	195
1720	3300046516	Ga0495628_0002006	Ga0495628_0002006_8321_8917	195
1721	3300046519	Ga0495632_0005292	Ga0495632_0005292_3183_3782	195
1722	3300046519	Ga0495632_0013586	Ga0495632_0013586_1435_2028	195
1723	3300046519	Ga0495632_0042736	Ga0495632_0042736_1033_1626	195
1724	3300046522	Ga0495643_0052018	Ga0495643_0052018_662_1261	195
1725	3300046525	Ga0495663_0156168	Ga0495663_0156168_87_683	195
1726	3300046529	Ga0495652_0005308	Ga0495652_0005308_9386_9982	195
1727	3300046529	Ga0495652_0050484	Ga0495652_0050484_1796_2392	195
1728	3300046529	Ga0495652_0379897	Ga0495652_0379897_258_854	195
1729	3300046530	Ga0495654_0001208	Ga0495654_0001208_212_805	195
1730	3300046538	Ga0495609_0000023	Ga0495609_0000023_181024_181617	195
1731	3300046543	Ga0495645_0028629	Ga0495645_0028629_3142_3738	195
1732	3300046543	Ga0495645_0157374	Ga0495645_0157374_379_975	195
1733	3300046615	Ga0495656_0356818	Ga0495656_0356818_131_727	195
1734	3300046660	Ga0495625_0017800	Ga0495625_0017800_2640_3236	195
1735	3300046663	Ga0495635_0056883	Ga0495635_0056883_964_1560	195
1736	3300046665	Ga0495661_0000072	Ga0495661_0000072_95760_96353	195
1737	3300046675	Ga0495657_0104282	Ga0495657_0104282_682_1278	195
1738	3300046675	Ga0495657_0273178	Ga0495657_0273178_225_821	195
1739	3300046678	Ga0495599_0016887	Ga0495599_0016887_1708_2304	195
1740	3300046679	Ga0495623_0254007	Ga0495623_0254007_259_855	195
1741	3300046680	Ga0495646_0004004	Ga0495646_0004004_4392_4988	195
1742	3300046680	Ga0495646_0047627	Ga0495646_0047627_1120_1716	195
1743	3300046683	Ga0495658_0172524	Ga0495658_0172524_361_975	195
1744	3300046684	Ga0495669_0008657	Ga0495669_0008657_1044_1640	195
1745	3300046684	Ga0495669_0047937	Ga0495669_0047937_1239_1835	195
1746	3300046690	Ga0495624_0053297	Ga0495624_0053297_1477_2073	195
1747	3300046690	Ga0495624_0201788	Ga0495624_0201788_284_880	195
1748	3300046692	Ga0495671_0192073	Ga0495671_0192073_328_921	195
1749	3300046694	Ga0495649_0000428	Ga0495649_0000428_2325_2921	195
1750	3300046694	Ga0495649_0002075	Ga0495649_0002075_12553_13146	195
1751	3300046794	Ga0495589_0016849	Ga0495589_0016849_2465_3061	195
1752	3300046809	Ga0495600_0001954	Ga0495600_0001954_7132_7728	195
1753	3300047317	Ga0495604_0051766	Ga0495604_0051766_1132_1728	195
1754	3300047320	Ga0495672_0036931	Ga0495672_0036931_1029_1622	195
1755	3300047323	Ga0495683_0061577	Ga0495683_0061577_368_964	195
1756	3300047472	Ga0495686_0014427	Ga0495686_0014427_1698_2294	195
1757	3300048088	Ga0495602_0057123	Ga0495602_0057123_1824_2420	195
1758	3300048088	Ga0495602_0062195	Ga0495602_0062195_1526_2122	195
1759	3300048090	Ga0495615_0004649	Ga0495615_0004649_564_1160	195
1760	3300048903	Ga0496100_0062349	Ga0496100_0062349_1595_2191	195
1761	3300048906	Ga0496103_0271541	Ga0496103_0271541_325_933	195
1762	3300048907	Ga0496104_0023214	Ga0496104_0023214_3568_4176	195
1763	3300048907	Ga0496104_0035495	Ga0496104_0035495_589_1185	195
1764	3300048911	Ga0496108_0208034	Ga0496108_0208034_714_1322	195
1765	3300048912	Ga0496109_0590962	Ga0496109_0590962_217_813	195
1766	3300048915	Ga0496112_0004885	Ga0496112_0004885_10340_10948	195
1767	3300048916	Ga0496113_0002985	Ga0496113_0002985_8876_9484	195
1768	3300048917	Ga0496114_0203027	Ga0496114_0203027_249_845	195
1769	3300048919	Ga0496116_0000239	Ga0496116_0000239_85874_86467	195
1770	3300048920	Ga0496117_0000553	Ga0496117_0000553_13767_14360	195
1771	3300048921	Ga0496118_0007370	Ga0496118_0007370_1643_2236	195
1772	3300048924	Ga0496121_0000262	Ga0496121_0000262_13785_14378	195
1773	3300048924	Ga0496121_0020087	Ga0496121_0020087_5868_6464	195
1774	3300048924	Ga0496121_0101817	Ga0496121_0101817_1551_2147	195
1775	3300048925	Ga0496122_0044239	Ga0496122_0044239_1419_2012	195
1776	3300048926	Ga0496123_0001108	Ga0496123_0001108_4733_5326	195
1777	3300048927	Ga0496124_0000108	Ga0496124_0000108_137969_138565	195
1778	3300048927	Ga0496124_0054980	Ga0496124_0054980_1949_2545	195
1779	3300048928	Ga0496125_0008324	Ga0496125_0008324_157_753	195
1780	3300049571	Ga0501034_0096969	Ga0501034_0096969_801_1397	195
1781	3300049574	Ga0501038_0412693	Ga0501038_0412693_385_981	195
1782	3300049581	Ga0501047_0047097	Ga0501047_0047097_2529_3122	195
1783	3300049581	Ga0501047_0216864	Ga0501047_0216864_143_739	195
1784	3300049582	Ga0501048_0093101	Ga0501048_0093101_726_1319	195
1785	3300049589	Ga0501073_0142367	Ga0501073_0142367_886_1473	195
1786	3300049663	Ga0501223_048755	Ga0501223_048755_82_684	195
1787	3300049822	Ga0501035_0033897	Ga0501035_0033897_1703_2296	195
1788	3300049823	Ga0501044_0000086	Ga0501044_0000086_77718_78311	195
1789	3300049823	Ga0501044_0252644	Ga0501044_0252644_511_1107	195
1790	3300049823	Ga0501044_0959767	Ga0501044_0959767_51_647	195
1791	3300050489	nmdc:mga03683_108280_c1	nmdc:mga03683_108280_c1_530_1132	195
1792	3300050493	nmdc:mga0k408_140891_c1	nmdc:mga0k408_140891_c1_328_927	195
1793	3300050493	nmdc:mga0k408_302_c1	nmdc:mga0k408_302_c1_23295_23888	195
1794	3300050493	nmdc:mga0k408_52541_c1	nmdc:mga0k408_52541_c1_569_1165	195
1795	3300050496	nmdc:mga07m45_24195_c1	nmdc:mga07m45_24195_c1_628_1224	195
1796	3300050496	nmdc:mga07m45_25655_c1	nmdc:mga07m45_25655_c1_981_1580	195
1797	3300050496	nmdc:mga07m45_3613_c1	nmdc:mga07m45_3613_c1_898_1497	195
1798	3300050496	nmdc:mga07m45_5424_c1	nmdc:mga07m45_5424_c1_688_1284	195
1799	3300050496	nmdc:mga07m45_7565_c1	nmdc:mga07m45_7565_c1_4013_4615	195
1800	3300053077	Ga0495601_0067508	Ga0495601_0067508_544_1140	195
1801	3300053080	Ga0500635_0000008	Ga0500635_0000008_75930_76526	195
1802	3300053086	Ga0500578_0000025	Ga0500578_0000025_46161_46760	195
1803	3300053086	Ga0500578_0177070	Ga0500578_0177070_109_705	195
1804	3300053093	Ga0500651_0171760	Ga0500651_0171760_185_784	195
1805	3300053098	Ga0500650_0047704	Ga0500650_0047704_1097_1696	195
1806	3300053108	Ga0500562_020379	Ga0500562_020379_844_1443	195
1807	3300053125	Ga0500618_002784	Ga0500618_002784_1725_2321	195
1808	3300053131	Ga0500652_000177	Ga0500652_000177_9102_9701	195
1809	3300053141	Ga0500574_008596	Ga0500574_008596_1065_1661	195
1810	3300053154	Ga0500619_003040	Ga0500619_003040_1124_1720	195
1811	3300053156	Ga0500622_0002547	Ga0500622_0002547_4473_5069	195
1812	3300053724	Ga0500570_042244	Ga0500570_042244_968_1567	195
1813	3300059421	Ga0590071_007597	Ga0590071_007597_272_865	195
1814	3300059424	Ga0590075_008347	Ga0590075_008347_1416_2012	195
1815	3300059493	Ga0587077_062537	Ga0587077_062537_166_762	195
1816	3300059510	Ga0587090_064642	Ga0587090_064642_21_617	195
1817	3300059639	Ga0587062_006669	Ga0587062_006669_614_1210	195
1818	3300059645	Ga0587076_014022	Ga0587076_014022_80_676	195
1819	3300060346	Ga0587111_0010618	Ga0587111_0010618_141_737	195
1820	3300061719	Ga0466962_0005789	Ga0466962_0005789_481_1077	195
1821	3300061719	Ga0466962_0027384	Ga0466962_0027384_1903_2499	195
1822	3300061719	Ga0466962_0039862	Ga0466962_0039862_1622_2218	195
1823	iso_pu_bacteria	2511231002	2511244659	195
1824	iso_pu_bacteria	2513020051	2513230081	195
1825	iso_pu_bacteria	2599185214	2599620570	195
1826	iso_pu_bacteria	2599185226	2599673869	195
1827	iso_pu_bacteria	2599185227	2599678814	195
1828	iso_pu_bacteria	2599185229	2599690081	195
1829	iso_pu_bacteria	2643221628	2644162167	195
1830	iso_pu_bacteria	2643221646	2644256659	195
1831	iso_pu_bacteria	2643221658	2644324290	195
1832	iso_pu_bacteria	2643221672	2644396131	195
1833	iso_pu_bacteria	2643221683	2644464957	195
1834	iso_pu_bacteria	2738541277	2738720464	195
1835	iso_pu_bacteria	2738541307	2738884036	195
1836	iso_pu_bacteria	2738543013	2739250126	195
1837	iso_pu_bacteria	2738543019	2739279663	195
1838	iso_pu_bacteria	2818991446	2819601147	195
1839	iso_pu_bacteria	2831265667	2831271539	195
1840	iso_pu_bacteria	2842677519	2842680589	195
1841	iso_pu_bacteria	2885192300	2885196983	195
1842	iso_pu_bacteria	2885198086	2885201027	195
1843	iso_pu_bacteria	2885211737	2885214190	195
1844	iso_pu_bacteria	2899924645	2899927507	195
1845	iso_pu_bacteria	2904449895	2904450766	195
1846	iso_pu_bacteria	2904456579	2904459734	195
1847	iso_pu_bacteria	2904541872	2904547988	195
1848	iso_pu_bacteria	2919462493	2919462704	195
1849	iso_pu_bacteria	2928037797	2928042581	195
1850	iso_pu_bacteria	2928044640	2928048992	195
1851	iso_pu_bacteria	2928051484	2928051542	195
1852	iso_pu_bacteria	2928064002	2928068753	195
1853	iso_pu_bacteria	2928070936	2928073249	195
1854	iso_pu_bacteria	2928084124	2928087010	195
1855	iso_pu_bacteria	2929160207	2929161617	195
1856	iso_pu_bacteria	2929520902	2929521484	195
1857	iso_pu_bacteria	2945945610	2945949496	195
1858	iso_pu_bacteria	2945972063	2945973542	195
1859	iso_pu_bacteria	2954767861	2954770844	195
1860	3300003775	Ga0055524_1000247	Ga0055524_100024721	196
1861	3300003791	Ga0055530_10012347	Ga0055530_100123472	196
1862	3300003792	Ga0055540_1000260	Ga0055540_100026033	196
1863	3300005328	Ga0070676_10431646	Ga0070676_104316462	196
1864	3300005331	Ga0070670_100040516	Ga0070670_1000405163	196
1865	3300005331	Ga0070670_100501288	Ga0070670_1005012881	196
1866	3300005331	Ga0070670_100526883	Ga0070670_1005268831	196
1867	3300005331	Ga0070670_100579695	Ga0070670_1005796952	196
1868	3300005333	Ga0070677_10028276	Ga0070677_100282762	196
1869	3300005334	Ga0068869_100090533	Ga0068869_1000905331	196
1870	3300005337	Ga0070682_100411087	Ga0070682_1004110871	196
1871	3300005338	Ga0068868_100073073	Ga0068868_1000730733	196
1872	3300005338	Ga0068868_100266363	Ga0068868_1002663632	196
1873	3300005339	Ga0070660_100547108	Ga0070660_1005471081	196
1874	3300005344	Ga0070661_100000361	Ga0070661_10000036113	196
1875	3300005344	Ga0070661_100384046	Ga0070661_1003840461	196
1876	3300005354	Ga0070675_100003086	Ga0070675_1000030868	196
1877	3300005354	Ga0070675_100034151	Ga0070675_1000341513	196
1878	3300005355	Ga0070671_100076424	Ga0070671_1000764243	196
1879	3300005356	Ga0070674_100170126	Ga0070674_1001701262	196
1880	3300005356	Ga0070674_100803256	Ga0070674_1008032561	196
1881	3300005364	Ga0070673_100016285	Ga0070673_1000162852	196
1882	3300005366	Ga0070659_100013243	Ga0070659_1000132433	196
1883	3300005367	Ga0070667_100163538	Ga0070667_1001635383	196
1884	3300005367	Ga0070667_100199658	Ga0070667_1001996582	196
1885	3300005455	Ga0070663_100062131	Ga0070663_1000621312	196
1886	3300005456	Ga0070678_100239506	Ga0070678_1002395062	196
1887	3300005457	Ga0070662_100140854	Ga0070662_1001408542	196
1888	3300005459	Ga0068867_100000063	Ga0068867_1000000633	196
1889	3300005459	Ga0068867_100089260	Ga0068867_1000892603	196
1890	3300005459	Ga0068867_100725127	Ga0068867_1007251271	196
1891	3300005543	Ga0070672_100003858	Ga0070672_10000385810	196
1892	3300005543	Ga0070672_100133869	Ga0070672_1001338693	196
1893	3300005543	Ga0070672_100311990	Ga0070672_1003119901	196
1894	3300005564	Ga0070664_100001095	Ga0070664_10000109522	196
1895	3300005564	Ga0070664_100003147	Ga0070664_10000314712	196
1896	3300005564	Ga0070664_100408289	Ga0070664_1004082892	196
1897	3300005577	Ga0068857_100030554	Ga0068857_1000305544	196
1898	3300005616	Ga0068852_100240566	Ga0068852_1002405663	196
1899	3300005616	Ga0068852_101097997	Ga0068852_1010979972	196
1900	3300005618	Ga0068864_100195981	Ga0068864_1001959812	196
1901	3300005834	Ga0068851_10008349	Ga0068851_100083493	196
1902	3300006048	Ga0075363_100267632	Ga0075363_1002676322	196
1903	3300006195	Ga0075366_10141535	Ga0075366_101415352	196
1904	3300006237	Ga0097621_100232726	Ga0097621_1002327262	196
1905	3300006358	Ga0068871_100097969	Ga0068871_1000979693	196
1906	3300006946	Ga0079104_1000711	Ga0079104_10007117	196
1907	3300009098	Ga0105245_10404375	Ga0105245_104043752	196
1908	3300009148	Ga0105243_10002786	Ga0105243_100027863	196
1909	3300009177	Ga0105248_10227023	Ga0105248_102270233	196
1910	3300011119	Ga0105246_10283164	Ga0105246_102831641	196
1911	3300013104	Ga0157370_10033859	Ga0157370_100338596	196
1912	3300013308	Ga0157375_10104000	Ga0157375_101040003	196
1913	3300014325	Ga0163163_10645207	Ga0163163_106452072	196
1914	3300014497	Ga0182008_10006253	Ga0182008_100062531	196
1915	3300014745	Ga0157377_10000132	Ga0157377_1000013255	196
1916	3300014969	Ga0157376_10176251	Ga0157376_101762513	196
1917	3300014969	Ga0157376_10240092	Ga0157376_102400922	196
1918	3300017792	Ga0163161_10001891	Ga0163161_1000189118	196
1919	3300025263	Ga0209565_1006949	Ga0209565_10069493	196
1920	3300025291	Ga0209675_1016135	Ga0209675_10161353	196
1921	3300025298	Ga0209050_1003829	Ga0209050_10038295	196
1922	3300025298	Ga0209050_1011261	Ga0209050_10112612	196
1923	3300025299	Ga0209256_1000049	Ga0209256_100004953	196
1924	3300025303	Ga0209051_1000247	Ga0209051_100024733	196
1925	3300025304	Ga0209257_1000141	Ga0209257_100014133	196
1926	3300025893	Ga0207682_10011568	Ga0207682_100115683	196
1927	3300025907	Ga0207645_10002962	Ga0207645_1000296215	196
1928	3300025908	Ga0207643_10061224	Ga0207643_100612242	196
1929	3300025920	Ga0207649_10000335	Ga0207649_1000033520	196
1930	3300025920	Ga0207649_10980716	Ga0207649_109807161	196
1931	3300025923	Ga0207681_10741760	Ga0207681_107417602	196
1932	3300025925	Ga0207650_10001863	Ga0207650_1000186316	196
1933	3300025925	Ga0207650_10017113	Ga0207650_100171135	196
1934	3300025926	Ga0207659_10011636	Ga0207659_100116368	196
1935	3300025926	Ga0207659_10018605	Ga0207659_100186054	196
1936	3300025926	Ga0207659_10039403	Ga0207659_100394033	196
1937	3300025931	Ga0207644_10297149	Ga0207644_102971492	196
1938	3300025932	Ga0207690_10000176	Ga0207690_1000017629	196
1939	3300025933	Ga0207706_10059884	Ga0207706_100598843	196
1940	3300025933	Ga0207706_10062015	Ga0207706_100620153	196
1941	3300025933	Ga0207706_10856832	Ga0207706_108568321	196
1942	3300025935	Ga0207709_10001786	Ga0207709_1000178617	196
1943	3300025936	Ga0207670_10426450	Ga0207670_104264502	196
1944	3300025940	Ga0207691_10009300	Ga0207691_1000930010	196
1945	3300025940	Ga0207691_10012349	Ga0207691_100123499	196
1946	3300025940	Ga0207691_10208057	Ga0207691_102080573	196
1947	3300025940	Ga0207691_10230261	Ga0207691_102302612	196
1948	3300025942	Ga0207689_10148381	Ga0207689_101483813	196
1949	3300025942	Ga0207689_10385995	Ga0207689_103859952	196
1950	3300025944	Ga0207661_10319230	Ga0207661_103192302	196
1951	3300025945	Ga0207679_10000168	Ga0207679_1000016815	196
1952	3300025945	Ga0207679_10286520	Ga0207679_102865202	196
1953	3300025945	Ga0207679_10719886	Ga0207679_107198862	196
1954	3300025960	Ga0207651_10023534	Ga0207651_100235343	196
1955	3300025960	Ga0207651_10197993	Ga0207651_101979932	196
1956	3300025960	Ga0207651_10524905	Ga0207651_105249052	196
1957	3300025960	Ga0207651_10611900	Ga0207651_106119002	196
1958	3300025972	Ga0207668_10270529	Ga0207668_102705292	196
1959	3300026089	Ga0207648_10000176	Ga0207648_1000017659	196
1960	3300026089	Ga0207648_10061942	Ga0207648_100619423	196
1961	3300026089	Ga0207648_10247487	Ga0207648_102474872	196
1962	3300026116	Ga0207674_10023346	Ga0207674_100233466	196
1963	3300026121	Ga0207683_10079139	Ga0207683_100791392	196
1964	3300027111	Ga0209281_1000395	Ga0209281_100039562	196
1965	3300028786	Ga0307517_10005635	Ga0307517_100056353	196
1966	3300030522	Ga0307512_10046777	Ga0307512_100467773	196
1967	3300030522	Ga0307512_10122876	Ga0307512_101228762	196
1968	3300031456	Ga0307513_10076689	Ga0307513_100766893	196
1969	3300031456	Ga0307513_10383157	Ga0307513_103831572	196
1970	3300031507	Ga0307509_10000063	Ga0307509_10000063106	196
1971	3300031507	Ga0307509_10018446	Ga0307509_100184465	196
1972	3300031507	Ga0307509_10028664	Ga0307509_100286647	196
1973	3300031507	Ga0307509_10081292	Ga0307509_100812922	196
1974	3300031507	Ga0307509_10200024	Ga0307509_102000242	196
1975	3300031616	Ga0307508_10000109	Ga0307508_1000010925	196
1976	3300031616	Ga0307508_10005254	Ga0307508_100052542	196
1977	3300031616	Ga0307508_10094248	Ga0307508_100942482	196
1978	3300031824	Ga0307413_10406793	Ga0307413_104067932	196
1979	3300031911	Ga0307412_10048788	Ga0307412_100487883	196
1980	3300033179	Ga0307507_10066771	Ga0307507_100667712	196
1981	3300033179	Ga0307507_10163464	Ga0307507_101634642	196
1982	3300033180	Ga0307510_10017213	Ga0307510_100172138	196
1983	3300033180	Ga0307510_10151247	Ga0307510_101512472	196
1984	3300033180	Ga0307510_10264741	Ga0307510_102647412	196
1985	3300035089	Ga0373944_0156966	Ga0373944_0156966_118_729	196
1986	3300035117	Ga0373953_0182972	Ga0373953_0182972_139_774	196
1987	3300035170	Ga0373943_0075365	Ga0373943_0075365_1059_1694	196
1988	3300035172	Ga0373955_0011223	Ga0373955_0011223_1768_2403	196
1989	3300035691	Ga0373931_0043621	Ga0373931_0043621_1246_1845	196
1990	3300036401	Ga0373937_0050704	Ga0373937_0050704_1952_2587	196
1991	3300037068	Ga0373925_0404493	Ga0373925_0404493_162_797	196
1992	3300037068	Ga0373925_0514432	Ga0373925_0514432_194_793	196
1993	3300037471	Ga0395905_0138877	Ga0395905_0138877_469_1065	196
1994	3300037471	Ga0395905_0284768	Ga0395905_0284768_792_1391	196
1995	3300037471	Ga0395905_0677611	Ga0395905_0677611_294_893	196
1996	3300039453	Ga0436362_0101780	Ga0436362_0101780_68_688	196
1997	3300041413	Ga0439465_0014292	Ga0439465_0014292_1853_2449	196
1998	3300041491	Ga0451833_0985501	Ga0451833_0985501_216_815	196
1999	3300041997	Ga0439431_0004784	Ga0439431_0004784_38_634	196
2000	3300042121	Ga0450919_001238	Ga0450919_001238_2335_2931	196
2001	3300042435	Ga0439434_0009278	Ga0439434_0009278_1681_2277	196
2002	3300042531	Ga0450918_000077	Ga0450918_000077_15021_15617	196
2003	3300042532	Ga0450893_0018942	Ga0450893_0018942_346_942	196
2004	3300042876	Ga0451577_0041487	Ga0451577_0041487_461_1060	196
2005	3300046454	Ga0495592_0006972	Ga0495592_0006972_1099_1698	196
2006	3300046459	Ga0495629_0354312	Ga0495629_0354312_172_771	196
2007	3300046462	Ga0495651_0339997	Ga0495651_0339997_206_841	196
2008	3300046473	Ga0495582_0359267	Ga0495582_0359267_96_731	196
2009	3300046475	Ga0495639_0214208	Ga0495639_0214208_247_870	196
2010	3300046477	Ga0495664_0226002	Ga0495664_0226002_193_828	196
2011	3300046512	Ga0495610_0107542	Ga0495610_0107542_101_700	196
2012	3300046513	Ga0495616_0288978	Ga0495616_0288978_15_626	196
2013	3300046516	Ga0495628_0094361	Ga0495628_0094361_703_1338	196
2014	3300046517	Ga0495630_0094363	Ga0495630_0094363_990_1589	196
2015	3300046519	Ga0495632_0173821	Ga0495632_0173821_334_945	196
2016	3300046537	Ga0495598_0046578	Ga0495598_0046578_17_640	196
2017	3300046539	Ga0495621_0023417	Ga0495621_0023417_896_1507	196
2018	3300046557	Ga0495622_0016004	Ga0495622_0016004_2250_2849	196
2019	3300046683	Ga0495658_0008742	Ga0495658_0008742_982_1593	196
2020	3300046690	Ga0495624_0096613	Ga0495624_0096613_1166_1765	196
2021	3300047321	Ga0495676_0130522	Ga0495676_0130522_145_744	196
2022	3300047471	Ga0495684_0036446	Ga0495684_0036446_2146_2781	196
2023	3300047673	Ga0495593_0008695	Ga0495593_0008695_4337_4936	196
2024	3300048089	Ga0495614_0156738	Ga0495614_0156738_77_676	196
2025	3300048907	Ga0496104_0173705	Ga0496104_0173705_1225_1848	196
2026	3300048909	Ga0496106_0233650	Ga0496106_0233650_807_1415	196
2027	3300048912	Ga0496109_0272233	Ga0496109_0272233_308_943	196
2028	3300048912	Ga0496109_0370820	Ga0496109_0370820_542_1165	196
2029	3300048917	Ga0496114_0013611	Ga0496114_0013611_5299_5895	196
2030	3300048917	Ga0496114_0434398	Ga0496114_0434398_281_901	196
2031	3300048924	Ga0496121_0089713	Ga0496121_0089713_1197_1805	196
2032	3300048929	Ga0496126_0148644	Ga0496126_0148644_460_1056	196
2033	3300049571	Ga0501034_0311554	Ga0501034_0311554_214_810	196
2034	3300049573	Ga0501037_0473992	Ga0501037_0473992_180_779	196
2035	3300050493	nmdc:mga0k408_66578_c1	nmdc:mga0k408_66578_c1_1069_1683	196
2036	3300053077	Ga0495601_0030951	Ga0495601_0030951_1461_2096	196
2037	3300053086	Ga0500578_0019420	Ga0500578_0019420_2057_2665	196
2038	3300053088	Ga0500644_0005645	Ga0500644_0005645_1536_2135	196
2039	3300053092	Ga0500583_0114293	Ga0500583_0114293_247_858	196
2040	3300053093	Ga0500651_0126864	Ga0500651_0126864_897_1496	196
2041	3300053136	Ga0500559_0000013	Ga0500559_0000013_107149_107748	196
2042	3300053156	Ga0500622_0003359	Ga0500622_0003359_1886_2485	196
2043	3300053730	Ga0500645_017475	Ga0500645_017475_352_960	196
2044	iso_pu_bacteria	2643221639	2644222495	196
2045	iso_pu_bacteria	2687453129	2687580753	196
2046	iso_pu_bacteria	2838054893	2838055440	196
2047	iso_pu_bacteria	2842733646	2842736409	196
2048	iso_pu_bacteria	2881101125	2881103406	196
2049	3300001979	JGI24740J21852_10003858	JGI24740J21852_100038585	197
2050	3300002077	JGI24744J21845_10018634	JGI24744J21845_100186342	197
2051	3300002739	JGI25158J39367_1002842	JGI25158J39367_10028424	197
2052	3300002739	JGI25158J39367_1005105	JGI25158J39367_10051052	197
2053	3300002773	JGI25152J39213_1004641	JGI25152J39213_10046415	197
2054	3300002773	JGI25152J39213_1022434	JGI25152J39213_10224341	197
2055	3300002774	JGI25150J39212_1007128	JGI25150J39212_10071283	197
2056	3300002774	JGI25150J39212_1009905	JGI25150J39212_10099052	197
2057	3300002987	JGI25159J45721_1000561	JGI25159J45721_100056117	197
2058	3300002987	JGI25159J45721_1001840	JGI25159J45721_10018407	197
2059	3300002987	JGI25159J45721_1005446	JGI25159J45721_10054462	197
2060	3300002987	JGI25159J45721_1019835	JGI25159J45721_10198352	197
2061	3300003187	JGI25151J46595_10004893	JGI25151J46595_100048936	197
2062	3300003187	JGI25151J46595_10004998	JGI25151J46595_100049987	197
2063	3300003187	JGI25151J46595_10007286	JGI25151J46595_100072866	197
2064	3300003215	JGI25153J46596_10010237	JGI25153J46596_100102372	197
2065	3300003215	JGI25153J46596_10034417	JGI25153J46596_100344172	197
2066	3300003215	JGI25153J46596_10066806	JGI25153J46596_100668062	197
2067	3300003354	JGI25160J50197_1000691	JGI25160J50197_10006918	197
2068	3300003354	JGI25160J50197_1008221	JGI25160J50197_10082212	197
2069	3300003354	JGI25160J50197_1009957	JGI25160J50197_10099574	197
2070	3300003374	JGI25161J50226_1000095	JGI25161J50226_100009567	197
2071	3300003374	JGI25161J50226_1002715	JGI25161J50226_10027153	197
2072	3300003374	JGI25161J50226_1003084	JGI25161J50226_10030842	197
2073	3300003578	Ga0006562J51391_1040310	Ga0006562J51391_10403103	197
2074	3300003578	Ga0006562J51391_1040314	Ga0006562J51391_10403142	197
2075	3300003761	Ga0055535_1000966	Ga0055535_100096618	197
2076	3300003762	Ga0055542_1000080	Ga0055542_100008088	197
2077	3300003771	Ga0055526_1016604	Ga0055526_10166043	197
2078	3300003771	Ga0055526_1020873	Ga0055526_10208732	197
2079	3300003771	Ga0055526_1023266	Ga0055526_10232663	197
2080	3300003771	Ga0055526_1024718	Ga0055526_10247182	197
2081	3300003773	Ga0055537_1000150	Ga0055537_10001509	197
2082	3300003773	Ga0055537_1000205	Ga0055537_100020532	197
2083	3300003773	Ga0055537_1001935	Ga0055537_10019357	197
2084	3300003773	Ga0055537_1008735	Ga0055537_10087352	197
2085	3300003775	Ga0055524_1000073	Ga0055524_100007342	197
2086	3300003775	Ga0055524_1005814	Ga0055524_10058146	197
2087	3300003775	Ga0055524_1005838	Ga0055524_10058386	197
2088	3300003781	Ga0055536_1005910	Ga0055536_10059103	197
2089	3300003781	Ga0055536_1010264	Ga0055536_10102643	197
2090	3300003781	Ga0055536_1019004	Ga0055536_10190042	197
2091	3300003784	Ga0055534_1000016	Ga0055534_1000016101	197
2092	3300003784	Ga0055534_1003549	Ga0055534_10035492	197
2093	3300003784	Ga0055534_1005062	Ga0055534_10050622	197
2094	3300003784	Ga0055534_1008144	Ga0055534_10081442	197
2095	3300003784	Ga0055534_1013820	Ga0055534_10138201	197
2096	3300003790	Ga0055528_1000894	Ga0055528_100089411	197
2097	3300003790	Ga0055528_1002836	Ga0055528_100283610	197
2098	3300003790	Ga0055528_1018968	Ga0055528_10189682	197
2099	3300003791	Ga0055530_10000848	Ga0055530_1000084818	197
2100	3300003791	Ga0055530_10005116	Ga0055530_100051167	197
2101	3300003792	Ga0055540_1000037	Ga0055540_100003754	197
2102	3300003792	Ga0055540_1004443	Ga0055540_10044437	197
2103	3300003792	Ga0055540_1005600	Ga0055540_10056002	197
2104	3300003792	Ga0055540_1005810	Ga0055540_10058105	197
2105	3300003792	Ga0055540_1011326	Ga0055540_10113263	197
2106	3300003794	Ga0055531_10002177	Ga0055531_100021778	197
2107	3300003794	Ga0055531_10006920	Ga0055531_100069207	197
2108	3300003794	Ga0055531_10010770	Ga0055531_100107705	197
2109	3300003794	Ga0055531_10011977	Ga0055531_100119772	197
2110	3300004625	Ga0055543_1001829	Ga0055543_10018293	197
2111	3300004625	Ga0055543_1009482	Ga0055543_10094822	197
2112	3300005262	Ga0065165_1006524	Ga0065165_10065247	197
2113	3300005262	Ga0065165_1032908	Ga0065165_10329082	197
2114	3300005288	Ga0065714_10006621	Ga0065714_100066212	197
2115	3300005288	Ga0065714_10187054	Ga0065714_101870541	197
2116	3300005289	Ga0065704_10153173	Ga0065704_101531732	197
2117	3300005289	Ga0065704_10158801	Ga0065704_101588012	197
2118	3300005289	Ga0065704_10172773	Ga0065704_101727731	197
2119	3300005327	Ga0070658_10329856	Ga0070658_103298562	197
2120	3300005335	Ga0070666_10340008	Ga0070666_103400082	197
2121	3300005336	Ga0070680_100141917	Ga0070680_1001419172	197
2122	3300005338	Ga0068868_100051527	Ga0068868_1000515271	197
2123	3300005338	Ga0068868_100225438	Ga0068868_1002254382	197
2124	3300005339	Ga0070660_100587450	Ga0070660_1005874502	197
2125	3300005347	Ga0070668_100586801	Ga0070668_1005868012	197
2126	3300005355	Ga0070671_100455580	Ga0070671_1004555802	197
2127	3300005356	Ga0070674_100049856	Ga0070674_1000498564	197
2128	3300005367	Ga0070667_100150957	Ga0070667_1001509572	197
2129	3300005435	Ga0070714_100189244	Ga0070714_1001892441	197
2130	3300005456	Ga0070678_100188811	Ga0070678_1001888112	197
2131	3300005456	Ga0070678_101088052	Ga0070678_1010880521	197
2132	3300005457	Ga0070662_100018849	Ga0070662_1000188492	197
2133	3300005459	Ga0068867_100891535	Ga0068867_1008915351	197
2134	3300005468	Ga0070707_100668894	Ga0070707_1006688941	197
2135	3300005530	Ga0070679_100117553	Ga0070679_1001175532	197
2136	3300005539	Ga0068853_100009734	Ga0068853_1000097346	197
2137	3300005548	Ga0070665_100061513	Ga0070665_1000615134	197
2138	3300005548	Ga0070665_100329763	Ga0070665_1003297632	197
2139	3300005563	Ga0068855_100006806	Ga0068855_1000068065	197
2140	3300005563	Ga0068855_100441750	Ga0068855_1004417502	197
2141	3300005564	Ga0070664_100013607	Ga0070664_1000136075	197
2142	3300005577	Ga0068857_100263780	Ga0068857_1002637802	197
2143	3300005614	Ga0068856_100272049	Ga0068856_1002720492	197
2144	3300005614	Ga0068856_100468959	Ga0068856_1004689592	197
2145	3300005616	Ga0068852_100152571	Ga0068852_1001525712	197
2146	3300005616	Ga0068852_100363788	Ga0068852_1003637882	197
2147	3300005616	Ga0068852_100368581	Ga0068852_1003685812	197
2148	3300005834	Ga0068851_10010947	Ga0068851_100109475	197
2149	3300006038	Ga0075365_10069730	Ga0075365_100697302	197
2150	3300006038	Ga0075365_10591657	Ga0075365_105916572	197
2151	3300006048	Ga0075363_100002569	Ga0075363_1000025693	197
2152	3300006048	Ga0075363_100219795	Ga0075363_1002197952	197
2153	3300006051	Ga0075364_10063260	Ga0075364_100632602	197
2154	3300006051	Ga0075364_10136135	Ga0075364_101361352	197
2155	3300006051	Ga0075364_10193752	Ga0075364_101937522	197
2156	3300006058	Ga0075432_10002610	Ga0075432_100026104	197
2157	3300006058	Ga0075432_10003468	Ga0075432_100034685	197
2158	3300006177	Ga0075362_10003058	Ga0075362_100030583	197
2159	3300006177	Ga0075362_10008277	Ga0075362_100082771	197
2160	3300006177	Ga0075362_10021197	Ga0075362_100211973	197
2161	3300006177	Ga0075362_10046075	Ga0075362_100460752	197
2162	3300006178	Ga0075367_10025097	Ga0075367_100250972	197
2163	3300006178	Ga0075367_10089860	Ga0075367_100898602	197
2164	3300006195	Ga0075366_10026650	Ga0075366_100266502	197
2165	3300006195	Ga0075366_10041111	Ga0075366_100411113	197
2166	3300006195	Ga0075366_10156491	Ga0075366_101564912	197
2167	3300006237	Ga0097621_100927917	Ga0097621_1009279172	197
2168	3300006353	Ga0075370_10000304	Ga0075370_1000030417	197
2169	3300006353	Ga0075370_10002475	Ga0075370_100024753	197
2170	3300006353	Ga0075370_10004243	Ga0075370_100042439	197
2171	3300006353	Ga0075370_10009367	Ga0075370_100093673	197
2172	3300006353	Ga0075370_10070323	Ga0075370_100703232	197
2173	3300006353	Ga0075370_10135539	Ga0075370_101355392	197
2174	3300006353	Ga0075370_10354711	Ga0075370_103547112	197
2175	3300006358	Ga0068871_100211717	Ga0068871_1002117173	197
2176	3300006880	Ga0075429_100152323	Ga0075429_1001523232	197
2177	3300006946	Ga0079104_1024800	Ga0079104_10248002	197
2178	3300006948	Ga0099826_10000101	Ga0099826_1000010129	197
2179	3300006948	Ga0099826_10323990	Ga0099826_103239902	197
2180	3300009036	Ga0105244_10038393	Ga0105244_100383932	197
2181	3300009094	Ga0111539_10163078	Ga0111539_101630783	197
2182	3300009098	Ga0105245_10212067	Ga0105245_102120672	197
2183	3300009098	Ga0105245_10657319	Ga0105245_106573192	197
2184	3300009148	Ga0105243_10031956	Ga0105243_100319562	197
2185	3300009551	Ga0105238_10005849	Ga0105238_1000584918	197
2186	3300009551	Ga0105238_10097633	Ga0105238_100976333	197
2187	3300009551	Ga0105238_10303557	Ga0105238_103035572	197
2188	3300010375	Ga0105239_10159575	Ga0105239_101595752	197
2189	3300010375	Ga0105239_10191146	Ga0105239_101911462	197
2190	3300010375	Ga0105239_10279213	Ga0105239_102792132	197
2191	3300011119	Ga0105246_10083319	Ga0105246_100833192	197
2192	3300011119	Ga0105246_10139035	Ga0105246_101390352	197
2193	3300012502	Ga0157347_1005821	Ga0157347_10058212	197
2194	3300012502	Ga0157347_1006832	Ga0157347_10068322	197
2195	3300012505	Ga0157339_1006226	Ga0157339_10062262	197
2196	3300012513	Ga0157326_1004854	Ga0157326_10048542	197
2197	3300013100	Ga0157373_10101206	Ga0157373_101012063	197
2198	3300013100	Ga0157373_10511793	Ga0157373_105117932	197
2199	3300013102	Ga0157371_10266445	Ga0157371_102664452	197
2200	3300013104	Ga0157370_10104976	Ga0157370_101049763	197
2201	3300013105	Ga0157369_10120724	Ga0157369_101207244	197
2202	3300013297	Ga0157378_10208528	Ga0157378_102085282	197
2203	3300014325	Ga0163163_10823425	Ga0163163_108234251	197
2204	3300014497	Ga0182008_10001633	Ga0182008_1000163317	197
2205	3300014497	Ga0182008_10001806	Ga0182008_100018064	197
2206	3300014497	Ga0182008_10005156	Ga0182008_100051567	197
2207	3300014497	Ga0182008_10029674	Ga0182008_100296743	197
2208	3300015261	Ga0182006_1006614	Ga0182006_10066147	197
2209	3300015261	Ga0182006_1116733	Ga0182006_11167332	197
2210	3300015262	Ga0182007_10000853	Ga0182007_100008538	197
2211	3300015262	Ga0182007_10003308	Ga0182007_100033085	197
2212	3300015683	Ga0183362_10003	Ga0183362_10003632	197
2213	3300017792	Ga0163161_10066343	Ga0163161_100663432	197
2214	3300017792	Ga0163161_10237529	Ga0163161_102375292	197
2215	3300025208	Ga0209436_105445	Ga0209436_1054452	197
2216	3300025208	Ga0209436_107262	Ga0209436_1072623	197
2217	3300025228	Ga0209672_100378	Ga0209672_10037824	197
2218	3300025229	Ga0209147_100696	Ga0209147_10069616	197
2219	3300025242	Ga0209258_100093	Ga0209258_10009322	197
2220	3300025245	Ga0207425_1001814	Ga0207425_10018146	197
2221	3300025245	Ga0207425_1002888	Ga0207425_10028886	197
2222	3300025245	Ga0207425_1051674	Ga0207425_10516742	197
2223	3300025250	Ga0209026_1000001	Ga0209026_10000011037	197
2224	3300025254	Ga0209148_1000007	Ga0209148_1000007989	197
2225	3300025258	Ga0209129_1000024	Ga0209129_100002488	197
2226	3300025258	Ga0209129_1003815	Ga0209129_10038153	197
2227	3300025258	Ga0209129_1004573	Ga0209129_10045736	197
2228	3300025258	Ga0209129_1020085	Ga0209129_10200852	197
2229	3300025258	Ga0209129_1029454	Ga0209129_10294542	197
2230	3300025263	Ga0209565_1000098	Ga0209565_100009877	197
2231	3300025263	Ga0209565_1000128	Ga0209565_100012852	197
2232	3300025263	Ga0209565_1000574	Ga0209565_100057419	197
2233	3300025263	Ga0209565_1000633	Ga0209565_100063321	197
2234	3300025263	Ga0209565_1009387	Ga0209565_10093872	197
2235	3300025273	Ga0209673_1000008	Ga0209673_100000875	197
2236	3300025273	Ga0209673_1000058	Ga0209673_1000058174	197
2237	3300025273	Ga0209673_1002178	Ga0209673_100217813	197
2238	3300025273	Ga0209673_1015359	Ga0209673_10153594	197
2239	3300025284	Ga0209130_1000072	Ga0209130_100007235	197
2240	3300025284	Ga0209130_1000338	Ga0209130_100033818	197
2241	3300025284	Ga0209130_1000654	Ga0209130_100065424	197
2242	3300025284	Ga0209130_1001114	Ga0209130_100111419	197
2243	3300025284	Ga0209130_1008057	Ga0209130_10080574	197
2244	3300025284	Ga0209130_1027649	Ga0209130_10276492	197
2245	3300025291	Ga0209675_1000010	Ga0209675_100001091	197
2246	3300025291	Ga0209675_1000099	Ga0209675_100009921	197
2247	3300025291	Ga0209675_1000151	Ga0209675_10001519	197
2248	3300025291	Ga0209675_1000431	Ga0209675_10004312	197
2249	3300025291	Ga0209675_1002776	Ga0209675_10027766	197
2250	3300025291	Ga0209675_1010411	Ga0209675_10104114	197
2251	3300025291	Ga0209675_1035251	Ga0209675_10352512	197
2252	3300025292	Ga0209676_1000023	Ga0209676_1000023359	197
2253	3300025292	Ga0209676_1000028	Ga0209676_1000028268	197
2254	3300025292	Ga0209676_1002526	Ga0209676_10025267	197
2255	3300025292	Ga0209676_1005235	Ga0209676_10052354	197
2256	3300025292	Ga0209676_1005287	Ga0209676_10052877	197
2257	3300025294	Ga0209025_1000685	Ga0209025_100068519	197
2258	3300025294	Ga0209025_1001904	Ga0209025_100190420	197
2259	3300025294	Ga0209025_1002647	Ga0209025_100264718	197
2260	3300025294	Ga0209025_1005469	Ga0209025_100546912	197
2261	3300025294	Ga0209025_1006074	Ga0209025_10060749	197
2262	3300025294	Ga0209025_1006765	Ga0209025_100676510	197
2263	3300025294	Ga0209025_1010798	Ga0209025_10107988	197
2264	3300025294	Ga0209025_1039025	Ga0209025_10390253	197
2265	3300025295	Ga0209564_1000209	Ga0209564_100020985	197
2266	3300025295	Ga0209564_1002281	Ga0209564_100228113	197
2267	3300025295	Ga0209564_1002522	Ga0209564_100252214	197
2268	3300025295	Ga0209564_1003391	Ga0209564_10033912	197
2269	3300025295	Ga0209564_1008172	Ga0209564_10081727	197
2270	3300025297	Ga0209758_1000049	Ga0209758_10000497	197
2271	3300025297	Ga0209758_1005721	Ga0209758_10057216	197
2272	3300025297	Ga0209758_1013703	Ga0209758_10137035	197
2273	3300025298	Ga0209050_1000022	Ga0209050_1000022341	197
2274	3300025298	Ga0209050_1000072	Ga0209050_100007224	197
2275	3300025298	Ga0209050_1000721	Ga0209050_100072144	197
2276	3300025298	Ga0209050_1000927	Ga0209050_100092720	197
2277	3300025298	Ga0209050_1006011	Ga0209050_10060117	197
2278	3300025299	Ga0209256_1000001	Ga0209256_10000011827	197
2279	3300025299	Ga0209256_1000088	Ga0209256_1000088177	197
2280	3300025299	Ga0209256_1004126	Ga0209256_10041266	197
2281	3300025299	Ga0209256_1019740	Ga0209256_10197402	197
2282	3300025302	Ga0207426_1000038	Ga0207426_1000038371	197
2283	3300025302	Ga0207426_1000053	Ga0207426_100005343	197
2284	3300025302	Ga0207426_1000319	Ga0207426_100031929	197
2285	3300025302	Ga0207426_1005271	Ga0207426_10052714	197
2286	3300025303	Ga0209051_1000013	Ga0209051_1000013341	197
2287	3300025303	Ga0209051_1000015	Ga0209051_1000015197	197
2288	3300025303	Ga0209051_1000056	Ga0209051_1000056203	197
2289	3300025303	Ga0209051_1000424	Ga0209051_100042418	197
2290	3300025303	Ga0209051_1000545	Ga0209051_100054535	197
2291	3300025303	Ga0209051_1006138	Ga0209051_10061387	197
2292	3300025303	Ga0209051_1011319	Ga0209051_10113193	197
2293	3300025304	Ga0209257_1000042	Ga0209257_1000042146	197
2294	3300025304	Ga0209257_1003278	Ga0209257_10032787	197
2295	3300025304	Ga0209257_1003691	Ga0209257_100369111	197
2296	3300025304	Ga0209257_1011169	Ga0209257_10111693	197
2297	3300025304	Ga0209257_1017019	Ga0209257_10170193	197
2298	3300025304	Ga0209257_1017545	Ga0209257_10175453	197
2299	3300025304	Ga0209257_1023916	Ga0209257_10239163	197
2300	3300025321	Ga0207656_10110244	Ga0207656_101102442	197
2301	3300025728	Ga0207655_1013363	Ga0207655_10133633	197
2302	3300025728	Ga0207655_1082677	Ga0207655_10826771	197
2303	3300025904	Ga0207647_10174855	Ga0207647_101748552	197
2304	3300025907	Ga0207645_10092004	Ga0207645_100920042	197
2305	3300025909	Ga0207705_10585350	Ga0207705_105853502	197
2306	3300025913	Ga0207695_10040003	Ga0207695_100400038	197
2307	3300025915	Ga0207693_10069086	Ga0207693_100690862	197
2308	3300025917	Ga0207660_10259245	Ga0207660_102592452	197
2309	3300025919	Ga0207657_10110833	Ga0207657_101108332	197
2310	3300025923	Ga0207681_10346476	Ga0207681_103464762	197
2311	3300025924	Ga0207694_10009970	Ga0207694_1000997012	197
2312	3300025924	Ga0207694_10336234	Ga0207694_103362342	197
2313	3300025927	Ga0207687_10071690	Ga0207687_100716904	197
2314	3300025927	Ga0207687_10448095	Ga0207687_104480952	197
2315	3300025933	Ga0207706_10030294	Ga0207706_100302946	197
2316	3300025934	Ga0207686_10170757	Ga0207686_101707572	197
2317	3300025935	Ga0207709_10000958	Ga0207709_1000095816	197
2318	3300025935	Ga0207709_10001025	Ga0207709_1000102516	197
2319	3300025935	Ga0207709_10002735	Ga0207709_1000273513	197
2320	3300025935	Ga0207709_10101596	Ga0207709_101015962	197
2321	3300025937	Ga0207669_10173859	Ga0207669_101738593	197
2322	3300025942	Ga0207689_10025465	Ga0207689_100254656	197
2323	3300025945	Ga0207679_10060887	Ga0207679_100608875	197
2324	3300025949	Ga0207667_10021851	Ga0207667_100218515	197
2325	3300025960	Ga0207651_10059515	Ga0207651_100595153	197
2326	3300025972	Ga0207668_10684703	Ga0207668_106847032	197
2327	3300025986	Ga0207658_10097031	Ga0207658_100970312	197
2328	3300026023	Ga0207677_10074186	Ga0207677_100741862	197
2329	3300026023	Ga0207677_10189089	Ga0207677_101890892	197
2330	3300026078	Ga0207702_10351016	Ga0207702_103510162	197
2331	3300026116	Ga0207674_10264030	Ga0207674_102640302	197
2332	3300026121	Ga0207683_10140105	Ga0207683_101401051	197
2333	3300026121	Ga0207683_10232501	Ga0207683_102325012	197
2334	3300026121	Ga0207683_10396924	Ga0207683_103969242	197
2335	3300026142	Ga0207698_10018899	Ga0207698_100188995	197
2336	3300026142	Ga0207698_10069179	Ga0207698_100691791	197
2337	3300027614	Ga0209970_1000036	Ga0209970_10000363	197
2338	3300027617	Ga0210002_1014916	Ga0210002_10149162	197
2339	3300027666	Ga0209282_1001024	Ga0209282_10010245	197
2340	3300027666	Ga0209282_1102538	Ga0209282_11025382	197
2341	3300027866	Ga0209813_10009313	Ga0209813_100093133	197
2342	3300027876	Ga0209974_10011375	Ga0209974_100113754	197
2343	3300028379	Ga0268266_10018918	Ga0268266_100189182	197
2344	3300028380	Ga0268265_10020224	Ga0268265_100202242	197
2345	3300028563	Ga0265319_1056779	Ga0265319_10567792	197
2346	3300028794	Ga0307515_10000084	Ga0307515_10000084172	197
2347	3300028794	Ga0307515_10001854	Ga0307515_100018545	197
2348	3300028794	Ga0307515_10057425	Ga0307515_100574257	197
2349	3300028794	Ga0307515_10209111	Ga0307515_102091112	197
2350	3300030733	Ga0314311_1036973	Ga0314311_10369737	197
2351	3300030745	Ga0316182_1239831	Ga0316182_12398312	197
2352	3300031242	Ga0265329_10068692	Ga0265329_100686922	197
2353	3300031251	Ga0265327_10000320	Ga0265327_1000032067	197
2354	3300031251	Ga0265327_10000789	Ga0265327_1000078914	197
2355	3300031251	Ga0265327_10022404	Ga0265327_100224043	197
2356	3300031344	Ga0265316_10009418	Ga0265316_100094181	197
2357	3300031456	Ga0307513_10000029	Ga0307513_10000029171	197
2358	3300031456	Ga0307513_10000038	Ga0307513_10000038129	197
2359	3300031456	Ga0307513_10009162	Ga0307513_1000916214	197
2360	3300031456	Ga0307513_10184118	Ga0307513_101841182	197
2361	3300031548	Ga0307408_100004302	Ga0307408_10000430211	197
2362	3300031548	Ga0307408_100011106	Ga0307408_1000111066	197
2363	3300031548	Ga0307408_100442493	Ga0307408_1004424932	197
2364	3300031548	Ga0307408_100702724	Ga0307408_1007027242	197
2365	3300031649	Ga0307514_10000954	Ga0307514_1000095434	197
2366	3300031649	Ga0307514_10004647	Ga0307514_100046474	197
2367	3300031711	Ga0265314_10007074	Ga0265314_1000707411	197
2368	3300031730	Ga0307516_10035006	Ga0307516_100350064	197
2369	3300031730	Ga0307516_10069011	Ga0307516_100690112	197
2370	3300031731	Ga0307405_10092287	Ga0307405_100922873	197
2371	3300031731	Ga0307405_10470994	Ga0307405_104709942	197
2372	3300031731	Ga0307405_10809444	Ga0307405_108094442	197
2373	3300031901	Ga0307406_10012286	Ga0307406_100122863	197
2374	3300031901	Ga0307406_10125627	Ga0307406_101256272	197
2375	3300031901	Ga0307406_10255639	Ga0307406_102556392	197
2376	3300031903	Ga0307407_10149175	Ga0307407_101491752	197
2377	3300031911	Ga0307412_10032448	Ga0307412_100324482	197
2378	3300031911	Ga0307412_10172485	Ga0307412_101724852	197
2379	3300031911	Ga0307412_10536603	Ga0307412_105366032	197
2380	3300031911	Ga0307412_10907389	Ga0307412_109073891	197
2381	3300032002	Ga0307416_100033193	Ga0307416_1000331934	197
2382	3300032002	Ga0307416_100405488	Ga0307416_1004054882	197
2383	3300032005	Ga0307411_10018685	Ga0307411_100186852	197
2384	3300032005	Ga0307411_10191926	Ga0307411_101919262	197
2385	3300032005	Ga0307411_10518170	Ga0307411_105181702	197
2386	3300033180	Ga0307510_10000429	Ga0307510_1000042932	197
2387	3300035691	Ga0373931_0042353	Ga0373931_0042353_1141_1755	197
2388	3300035695	Ga0373927_0105123	Ga0373927_0105123_752_1399	197
2389	3300037068	Ga0373925_0011775	Ga0373925_0011775_3854_4501	197
2390	3300037471	Ga0395905_0000728	Ga0395905_0000728_20507_21130	197
2391	3300041404	Ga0439436_0022164	Ga0439436_0022164_975_1610	197
2392	3300041406	Ga0439439_0020853	Ga0439439_0020853_432_1061	197
2393	3300041407	Ga0439447_016801	Ga0439447_016801_573_1202	197
2394	3300041410	Ga0439461_0026532	Ga0439461_0026532_169_792	197
2395	3300041411	Ga0439466_0063858	Ga0439466_0063858_452_1087	197
2396	3300041413	Ga0439465_0004991	Ga0439465_0004991_2701_3330	197
2397	3300041486	Ga0451807_0802435	Ga0451807_0802435_587_1195	197
2398	3300041997	Ga0439431_0002005	Ga0439431_0002005_2578_3207	197
2399	3300041999	Ga0439433_0002498	Ga0439433_0002498_3149_3778	197
2400	3300042002	Ga0439442_002272	Ga0439442_002272_982_1605	197
2401	3300042002	Ga0439442_029546	Ga0439442_029546_482_1111	197
2402	3300042004	Ga0439445_0000954	Ga0439445_0000954_1832_2461	197
2403	3300042004	Ga0439445_0007049	Ga0439445_0007049_1962_2585	197
2404	3300042006	Ga0439432_001040	Ga0439432_001040_1408_2037	197
2405	3300042006	Ga0439432_015392	Ga0439432_015392_1093_1728	197
2406	3300042006	Ga0439432_044439	Ga0439432_044439_729_1358	197
2407	3300042007	Ga0439449_0004240	Ga0439449_0004240_2259_2894	197
2408	3300042007	Ga0439449_0011935	Ga0439449_0011935_1396_2025	197
2409	3300042010	Ga0439452_003432	Ga0439452_003432_4437_5066	197
2410	3300042014	Ga0439457_015663	Ga0439457_015663_1045_1674	197
2411	3300042014	Ga0439457_023056	Ga0439457_023056_206_841	197
2412	3300042015	Ga0439462_0006257	Ga0439462_0006257_1249_1878	197
2413	3300042015	Ga0439462_0008185	Ga0439462_0008185_1070_1705	197
2414	3300042115	Ga0450911_001866	Ga0450911_001866_1533_2156	197
2415	3300042125	Ga0450923_012936	Ga0450923_012936_276_911	197
2416	3300042125	Ga0450923_019439	Ga0450923_019439_412_1035	197
2417	3300042131	Ga0450894_005235	Ga0450894_005235_247_879	197
2418	3300042133	Ga0450896_003697	Ga0450896_003697_273_896	197
2419	3300042133	Ga0450896_009390	Ga0450896_009390_496_1131	197
2420	3300042145	Ga0450906_005957	Ga0450906_005957_101_724	197
2421	3300042156	Ga0439446_0070720	Ga0439446_0070720_294_923	197
2422	3300042435	Ga0439434_0007314	Ga0439434_0007314_1423_2052	197
2423	3300042531	Ga0450918_002840	Ga0450918_002840_1412_2035	197
2424	3300042532	Ga0450893_0010637	Ga0450893_0010637_605_1237	197
2425	3300042533	Ga0450901_010414	Ga0450901_010414_269_901	197
2426	3300042876	Ga0451577_0046474	Ga0451577_0046474_3085_3705	197
2427	3300044673	Ga0453683_0249432	Ga0453683_0249432_175_813	197
2428	3300044712	Ga0453684_0061027	Ga0453684_0061027_2497_3135	197
2429	3300045051	Ga0451576_0040585	Ga0451576_0040585_3784_4422	197
2430	3300045051	Ga0451576_0063511	Ga0451576_0063511_1986_2615	197
2431	3300045051	Ga0451576_0190340	Ga0451576_0190340_1326_1928	197
2432	3300046453	Ga0495627_025534	Ga0495627_025534_880_1488	197
2433	3300046457	Ga0495590_0012513	Ga0495590_0012513_1201_1803	197
2434	3300046472	Ga0495580_0071593	Ga0495580_0071593_1555_2196	197
2435	3300046475	Ga0495639_0009801	Ga0495639_0009801_1293_1922	197
2436	3300046512	Ga0495610_0059491	Ga0495610_0059491_377_994	197
2437	3300046513	Ga0495616_0008804	Ga0495616_0008804_901_1518	197
2438	3300046515	Ga0495620_0002466	Ga0495620_0002466_372_980	197
2439	3300046516	Ga0495628_0293891	Ga0495628_0293891_459_1088	197
2440	3300046518	Ga0495631_0004715	Ga0495631_0004715_2635_3252	197
2441	3300046520	Ga0495637_0036167	Ga0495637_0036167_580_1188	197
2442	3300046528	Ga0495642_0138920	Ga0495642_0138920_35_664	197
2443	3300046660	Ga0495625_0000950	Ga0495625_0000950_33054_33677	197
2444	3300046665	Ga0495661_0074994	Ga0495661_0074994_1190_1798	197
2445	3300046674	Ga0495588_0020755	Ga0495588_0020755_1265_1894	197
2446	3300046674	Ga0495588_0074528	Ga0495588_0074528_762_1379	197
2447	3300046675	Ga0495657_0189302	Ga0495657_0189302_160_789	197
2448	3300046692	Ga0495671_0005567	Ga0495671_0005567_3795_4403	197
2449	3300046809	Ga0495600_0090954	Ga0495600_0090954_1078_1707	197
2450	3300046810	Ga0495660_0026319	Ga0495660_0026319_557_1159	197
2451	3300046810	Ga0495660_0131374	Ga0495660_0131374_142_750	197
2452	3300047321	Ga0495676_0073681	Ga0495676_0073681_1879_2496	197
2453	3300047470	Ga0495681_0087430	Ga0495681_0087430_286_894	197
2454	3300047673	Ga0495593_0028693	Ga0495593_0028693_1375_1992	197
2455	3300048089	Ga0495614_0035030	Ga0495614_0035030_251_868	197
2456	3300048089	Ga0495614_0087107	Ga0495614_0087107_242_883	197
2457	3300048904	Ga0496101_0082422	Ga0496101_0082422_1349_1978	197
2458	3300048905	Ga0496102_0166776	Ga0496102_0166776_1330_1959	197
2459	3300048905	Ga0496102_0187708	Ga0496102_0187708_281_889	197
2460	3300048906	Ga0496103_0036090	Ga0496103_0036090_659_1288	197
2461	3300048907	Ga0496104_0108684	Ga0496104_0108684_859_1488	197
2462	3300048908	Ga0496105_0004053	Ga0496105_0004053_4503_5132	197
2463	3300048909	Ga0496106_0009081	Ga0496106_0009081_5683_6312	197
2464	3300048910	Ga0496107_0425478	Ga0496107_0425478_202_831	197
2465	3300048910	Ga0496107_0463229	Ga0496107_0463229_178_807	197
2466	3300048912	Ga0496109_0309046	Ga0496109_0309046_106_735	197
2467	3300048913	Ga0496110_0318517	Ga0496110_0318517_682_1311	197
2468	3300048914	Ga0496111_0017568	Ga0496111_0017568_229_858	197
2469	3300048917	Ga0496114_0481194	Ga0496114_0481194_382_1011	197
2470	3300048919	Ga0496116_0025714	Ga0496116_0025714_2689_3297	197
2471	3300048919	Ga0496116_0045013	Ga0496116_0045013_1288_1905	197
2472	3300048920	Ga0496117_0015225	Ga0496117_0015225_3359_3967	197
2473	3300048921	Ga0496118_0025618	Ga0496118_0025618_1153_1761	197
2474	3300048922	Ga0496119_0063738	Ga0496119_0063738_615_1232	197
2475	3300048924	Ga0496121_0350396	Ga0496121_0350396_10_627	197
2476	3300048926	Ga0496123_0070033	Ga0496123_0070033_1206_1823	197
2477	3300048927	Ga0496124_0021958	Ga0496124_0021958_2421_3038	197
2478	3300048928	Ga0496125_0068640	Ga0496125_0068640_1086_1709	197
2479	3300048928	Ga0496125_0100067	Ga0496125_0100067_1510_2127	197
2480	3300049655	Ga0501208_032322	Ga0501208_032322_169_801	197
2481	3300049679	Ga0501249_005254	Ga0501249_005254_844_1467	197
2482	3300049705	Ga0501225_0009291	Ga0501225_0009291_1219_1842	197
2483	3300050489	nmdc:mga03683_113214_c1	nmdc:mga03683_113214_c1_307_936	197
2484	3300050489	nmdc:mga03683_24118_c1	nmdc:mga03683_24118_c1_1539_2147	197
2485	3300050489	nmdc:mga03683_3463_c1	nmdc:mga03683_3463_c1_3018_3641	197
2486	3300050489	nmdc:mga03683_3784_c1	nmdc:mga03683_3784_c1_3266_3898	197
2487	3300050490	nmdc:mga03n38_192656_c1	nmdc:mga03n38_192656_c1_41_670	197
2488	3300050490	nmdc:mga03n38_29675_c1	nmdc:mga03n38_29675_c1_1109_1732	197
2489	3300050491	nmdc:mga00v17_161866_c1	nmdc:mga00v17_161866_c1_281_904	197
2490	3300050491	nmdc:mga00v17_8095_c2	nmdc:mga00v17_8095_c2_1296_1919	197
2491	3300050492	nmdc:mga0yw44_25142_c1	nmdc:mga0yw44_25142_c1_1412_2035	197
2492	3300050493	nmdc:mga0k408_2586_c1	nmdc:mga0k408_2586_c1_689_1312	197
2493	3300050493	nmdc:mga0k408_2741_c1	nmdc:mga0k408_2741_c1_4365_4994	197
2494	3300050493	nmdc:mga0k408_314404_c1	nmdc:mga0k408_314404_c1_44_658	197
2495	3300050493	nmdc:mga0k408_32697_c1	nmdc:mga0k408_32697_c1_491_1108	197
2496	3300050494	nmdc:mga06z11_199198_c1	nmdc:mga06z11_199198_c1_21_650	197
2497	3300050494	nmdc:mga06z11_208695_c1	nmdc:mga06z11_208695_c1_205_813	197
2498	3300050496	nmdc:mga07m45_26799_c1	nmdc:mga07m45_26799_c1_2071_2700	197
2499	3300050496	nmdc:mga07m45_4636_c1	nmdc:mga07m45_4636_c1_2882_3505	197
2500	3300050496	nmdc:mga07m45_54758_c1	nmdc:mga07m45_54758_c1_127_735	197
2501	3300050496	nmdc:mga07m45_6363_c1	nmdc:mga07m45_6363_c1_2830_3462	197
2502	3300050508	nmdc:mga09592_161914_c1	nmdc:mga09592_161914_c1_680_1309	197
2503	3300050511	nmdc:mga08y16_892651_c1	nmdc:mga08y16_892651_c1_103_726	197
2504	3300053079	Ga0500610_0038379	Ga0500610_0038379_670_1278	197
2505	3300053079	Ga0500610_0163456	Ga0500610_0163456_106_723	197
2506	3300053087	Ga0500643_025592	Ga0500643_025592_177_785	197
2507	3300053093	Ga0500651_0000347	Ga0500651_0000347_7808_8425	197
2508	3300053093	Ga0500651_0007319	Ga0500651_0007319_2114_2719	197
2509	3300053096	Ga0500641_0076517	Ga0500641_0076517_360_977	197
2510	3300053110	Ga0500571_013161	Ga0500571_013161_2949_3566	197
2511	3300053117	Ga0500593_001062	Ga0500593_001062_3923_4531	197
2512	3300053117	Ga0500593_001145	Ga0500593_001145_2432_3058	197
2513	3300053121	Ga0500607_017870	Ga0500607_017870_2504_3121	197
2514	3300053121	Ga0500607_150388	Ga0500607_150388_371_985	197
2515	3300053122	Ga0500608_008119	Ga0500608_008119_496_1113	197
2516	3300053122	Ga0500608_050703	Ga0500608_050703_864_1490	197
2517	3300053131	Ga0500652_015172	Ga0500652_015172_535_1149	197
2518	3300053133	Ga0500655_006394	Ga0500655_006394_1322_1939	197
2519	3300053134	Ga0500658_0000560	Ga0500658_0000560_250_867	197
2520	3300053136	Ga0500559_0045153	Ga0500559_0045153_1214_1831	197
2521	3300053139	Ga0500568_0038908	Ga0500568_0038908_918_1538	197
2522	3300053139	Ga0500568_0061262	Ga0500568_0061262_10_627	197
2523	3300053141	Ga0500574_002285	Ga0500574_002285_1174_1791	197
2524	3300053153	Ga0500616_0018646	Ga0500616_0018646_3019_3636	197
2525	3300053161	Ga0500634_0024759	Ga0500634_0024759_785_1393	197
2526	3300053730	Ga0500645_001112	Ga0500645_001112_959_1567	197
2527	3300053730	Ga0500645_005684	Ga0500645_005684_2136_2753	197
2528	3300053730	Ga0500645_019096	Ga0500645_019096_583_1200	197
2529	iso_pu_bacteria	2721755523	2722881949	197
2530	iso_pu_bacteria	2839138175	2839144898	197
2531	3300005467	Ga0070706_100000700	Ga0070706_10000070030	198
2532	3300005468	Ga0070707_100075753	Ga0070707_1000757535	198
2533	3300006042	Ga0075368_10070471	Ga0075368_100704711	198
2534	3300006178	Ga0075367_10001893	Ga0075367_100018935	198
2535	3300006186	Ga0075369_10235873	Ga0075369_102358732	198
2536	3300006353	Ga0075370_10032528	Ga0075370_100325283	198
2537	3300025910	Ga0207684_10004795	Ga0207684_100047959	198
2538	3300025922	Ga0207646_10090557	Ga0207646_100905572	198
2539	3300031649	Ga0307514_10000560	Ga0307514_1000056011	198
2540	3300050493	nmdc:mga0k408_344377_c1	nmdc:mga0k408_344377_c1_92_712	198
2541	3300050496	nmdc:mga07m45_6318_c1	nmdc:mga07m45_6318_c1_4481_5101	198
2542	3300053158	Ga0500627_0019181	Ga0500627_0019181_122_730	198
2543	iso_pu_bacteria	2894023352	2894024285	198
2544	3300009036	Ga0105244_10018946	Ga0105244_100189463	199
2545	3300025924	Ga0207694_10390583	Ga0207694_103905831	199
2546	3300028381	Ga0268264_10339836	Ga0268264_103398362	199
2547	3300042137	Ga0450902_004098	Ga0450902_004098_1119_1751	199
2548	3300042142	Ga0450905_001349	Ga0450905_001349_109_741	199
2549	3300048911	Ga0496108_0071225	Ga0496108_0071225_1498_2121	199
2550	3300048912	Ga0496109_0096150	Ga0496109_0096150_257_880	199
2551	3300048913	Ga0496110_0270221	Ga0496110_0270221_317_949	199
2552	3300048914	Ga0496111_0386493	Ga0496111_0386493_196_828	199
2553	3300048920	Ga0496117_0013061	Ga0496117_0013061_5780_6412	199
2554	3300048921	Ga0496118_0007283	Ga0496118_0007283_1164_1796	199
2555	3300048924	Ga0496121_0331363	Ga0496121_0331363_289_921	199
2556	3300048927	Ga0496124_0000073	Ga0496124_0000073_40330_40962	199
2557	3300048927	Ga0496124_0082415	Ga0496124_0082415_78_710	199
2558	3300048927	Ga0496124_0151527	Ga0496124_0151527_939_1544	199
2559	3300048928	Ga0496125_0005865	Ga0496125_0005865_7976_8608	199
2560	iso_pu_bacteria	2643221609	2644062247	199
2561	iso_pu_bacteria	2643221611	2644071434	199
2562	iso_pu_bacteria	2643221717	2644648529	199
2563	iso_pu_bacteria	2738543012	2739245857	199
2564	iso_pu_bacteria	2816332133	2816470551	199
2565	iso_pu_bacteria	2990710928	2990713967	199
2566	2162886007	SwRhRL2b_contig_3690358	SwRhRL2b_0074.00006530	201
2567	3300005289	Ga0065704_10097382	Ga0065704_100973823	201
2568	3300005344	Ga0070661_100274651	Ga0070661_1002746512	201
2569	3300006946	Ga0079104_1002711	Ga0079104_10027117	201
2570	3300009092	Ga0105250_10013912	Ga0105250_100139122	201
2571	3300009148	Ga0105243_10021082	Ga0105243_100210824	201
2572	3300025711	Ga0207696_1020394	Ga0207696_10203942	201
2573	3300025935	Ga0207709_10000111	Ga0207709_1000011150	201
2574	3300027111	Ga0209281_1000017	Ga0209281_10000177	201
2575	3300031548	Ga0307408_100000557	Ga0307408_1000005573	201
2576	3300031901	Ga0307406_10029832	Ga0307406_100298323	201
2577	3300042876	Ga0451577_0000152	Ga0451577_0000152_51150_51764	201
2578	3300044712	Ga0453684_0000122	Ga0453684_0000122_250679_251293	201
2579	3300045051	Ga0451576_0000559	Ga0451576_0000559_51036_51650	201
2580	3300046542	Ga0495597_0000516	Ga0495597_0000516_12999_13625	201
2581	3300046558	Ga0495633_0003997	Ga0495633_0003997_3660_4289	201
2582	3300048925	Ga0496122_0183788	Ga0496122_0183788_136_765	201
2583	3300048928	Ga0496125_0140767	Ga0496125_0140767_113_742	201

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00475

IGPD

Imidazoleglycerol-phosphate dehydratase

62

205

1 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
2f1d-assembly1.cif.gz_D	x-ray structure of imidazoleglycerol-phosphate dehydratase	0.9912	8	189
7oj5-assembly1.cif.gz_A	cryo-em structure of medicago truncatula hisn5 protein	0.9843	7	189
2f1d-assembly1.cif.gz_D	x-ray structure of imidazoleglycerol-phosphate dehydratase	0.9805	8	189
7oj5-assembly1.cif.gz_A	cryo-em structure of medicago truncatula hisn5 protein	0.9738	7	189
4mu4-assembly1.cif.gz_A	the form b structure of an e21q catalytic mutant of a. thaliana igpd2 in complex with mn2+ and its substrate, 2r3s-igp, to 1.41 a resolution	0.972	7	201

ID	Description	Score	Start	End	Superfamily
2f1dA02	Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1	0.9858	96	189	3.30.230.40
2ae8A02	Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1	0.9815	96	187	3.30.230.40
1rhyA02	Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1	0.9809	96	186	3.30.230.40
af_Q58109_93_196_3.30.230.40	Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1	0.9763	96	189	3.30.230.40
2f1dA02	Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1	0.9755	96	189	3.30.230.40

ID	Description	Score	Start	End	GO Terms
AF-A0A3D0LTM6-F1-model_v4	Imidazoleglycerol-phosphate dehydratase	1.004	9	76	GO:0000105 GO:0004424
AF-A0A850D107-F1-model_v4	deleted	1.003	7	66
AF-A0A3D0SPU2-F1-model_v4	Imidazoleglycerol-phosphate dehydratase	1.002	7	86	GO:0000105 GO:0004424
AF-A0A1Z9GWE8-F1-model_v4	Imidazoleglycerol-phosphate dehydratase	1.002	8	89	GO:0000105 GO:0004424
AF-A0A522GSK4-F1-model_v4	Imidazoleglycerol-phosphate dehydratase	1.002	9	83	GO:0000105 GO:0004424

Feature Viewer

pLDDT	pTM	Quality
94.69	0.91	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F496928

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00475

IGPD

Imidazoleglycerol-phosphate dehydratase

62

205

1

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map