F496933
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 2586 | 490 | 5156 | 109 |
Family's Representative Sequence
| Representative Sequence | 3300031731|Ga0307405_11364608|Ga0307405_113646082 |
| Length | 122 |
| Sequence | MKLIKCIIRPNKVDEVKDALAKLNIAGMTVTEVRGHGKQKGHTAIYRGKEYNVSLLPKMEVEVVVADNMVDDVVKAVVQAARTGEIGDGRVFVYPVEESIRIRTGEFGEDSVRHEEPVGWGH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 2 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 3 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 4 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 5 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 6 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 7 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 8 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 9 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 10 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 11 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 12 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 13 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 14 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 17 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 26 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 30 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 43 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 61 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 67 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 70 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 72 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 79 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 80 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 82 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 83 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 84 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 85 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 86 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 87 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 88 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 89 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 90 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 91 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 92 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 93 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 94 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 95 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 97 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 98 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 99 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 100 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 101 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 102 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 103 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 104 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 105 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 106 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 108 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 109 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 110 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 111 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 112 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 113 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 114 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 115 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 116 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 117 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 119 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 120 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 121 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 136 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300012478 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 | Metagenome | Rhizosphere |
| 139 | 3300012485 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 | Metagenome | Rhizosphere |
| 140 | 3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Metagenome | Rhizosphere |
| 141 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 142 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 154 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 158 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 160 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 236 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 238 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 242 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 243 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 244 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 245 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 246 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 247 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 248 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 249 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 250 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 251 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 252 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 253 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 254 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 255 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 256 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 257 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 258 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 259 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 260 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 261 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 262 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 263 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 264 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 265 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 266 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 267 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 268 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 269 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 270 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 271 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 272 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 273 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 274 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 275 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 276 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 277 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 278 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 279 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 280 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 281 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 282 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 283 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 284 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 285 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 286 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 287 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 288 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 289 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 290 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 291 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 292 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 293 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 294 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 295 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 296 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 297 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 298 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 299 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 300 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 301 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 302 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 303 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 304 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 305 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 306 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 307 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 308 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 309 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 310 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 311 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 312 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 313 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 314 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 315 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 316 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 317 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 318 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 319 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 320 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 321 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 322 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 323 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 324 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 325 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 326 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 327 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 328 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 329 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 330 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 331 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 332 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 333 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 334 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 335 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 336 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 394 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 395 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 396 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 397 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 398 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 399 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 400 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 401 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 402 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 403 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 404 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 405 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 406 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 407 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 408 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 409 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 410 | 3300049518 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control | Metagenome | Rhizosphere |
| 411 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 412 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 413 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 414 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 415 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 416 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 417 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 418 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 419 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 420 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 421 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 422 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 423 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 424 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 425 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 426 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 427 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 428 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 429 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 430 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 431 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 432 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 433 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 434 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 435 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 436 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 437 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 438 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 439 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 440 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 441 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 442 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 443 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 444 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 445 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 446 | 3300049678 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought | Metagenome | Rhizosphere |
| 447 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 448 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 449 | 3300049685 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control | Metagenome | Rhizosphere |
| 450 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 451 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 452 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 453 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 454 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 455 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 456 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 457 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 458 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 459 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 460 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 461 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 462 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 463 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 464 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 465 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 466 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 467 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 468 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 469 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 470 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 471 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 472 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 473 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 474 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 475 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 476 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 477 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 478 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 479 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 480 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 481 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 482 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 483 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 487 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 488 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 489 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 490 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.81 |
| Metatranscriptomes | 0.19 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.47 |
| Nodule | 0 |
| Rhizoplane | 2.59 |
| Rhizosphere | 95.32 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 16.09 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0307405_11364608 | 3300031731 | Bacteria | 619 |
| 2 | ARSoilOldRDRAFT_c015219 | 3300000044 | Unclassified | 658 |
| 3 | JGI24746J21847_1001104 | 3300001977 | Bacteria | 4245 |
| 4 | JGI24743J22301_10152721 | 3300001991 | Unclassified | 518 |
| 5 | JGI24745J21846_1035581 | 3300002073 | Unclassified | 608 |
| 6 | JGI24035J26624_1018769 | 3300002126 | Bacteria | 722 |
| 7 | JGI24033J26618_1014535 | 3300002155 | Unclassified | 964 |
| 8 | JGI24751J29686_10039997 | 3300002459 | Bacteria | 971 |
| 9 | JGI24751J29686_10092875 | 3300002459 | Unclassified | 628 |
| 10 | JGI25406J46586_10001848 | 3300003203 | Bacteria | 9938 |
| 11 | JGI25406J46586_10015761 | 3300003203 | Unclassified | 3176 |
| 12 | Ga0007409J51694_1094330 | 3300003575 | Unclassified | 591 |
| 13 | Ga0007429J51699_1091030 | 3300003579 | Unclassified | 603 |
| 14 | Ga0058859_11801951 | 3300004798 | Bacteria | 599 |
| 15 | Ga0058860_11976869 | 3300004801 | Bacteria | 572 |
| 16 | Ga0058860_11990331 | 3300004801 | Bacteria | 585 |
| 17 | Ga0065714_10076628 | 3300005288 | Bacteria | 2771 |
| 18 | Ga0065714_10083759 | 3300005288 | Bacteria | 2233 |
| 19 | Ga0065714_10127161 | 3300005288 | Bacteria | 1284 |
| 20 | Ga0065714_10314071 | 3300005288 | Bacteria | 677 |
| 21 | Ga0065704_10073095 | 3300005289 | Bacteria | 7590 |
| 22 | Ga0065704_10414867 | 3300005289 | Unclassified | 738 |
| 23 | Ga0065704_10580918 | 3300005289 | Bacteria | 618 |
| 24 | Ga0065704_10585035 | 3300005289 | Bacteria | 615 |
| 25 | Ga0065704_10655043 | 3300005289 | Unclassified | 581 |
| 26 | Ga0065712_10000606 | 3300005290 | Bacteria | 17755 |
| 27 | Ga0065712_10001610 | 3300005290 | Bacteria | 15557 |
| 28 | Ga0065712_10003904 | 3300005290 | Bacteria | 4284 |
| 29 | Ga0065712_10031832 | 3300005290 | Unclassified | 1049 |
| 30 | Ga0065712_10068769 | 3300005290 | Bacteria | 9072 |
| 31 | Ga0065712_10091814 | 3300005290 | Bacteria | 2356 |
| 32 | Ga0065712_10094945 | 3300005290 | Bacteria | 2235 |
| 33 | Ga0065712_10141090 | 3300005290 | Bacteria | 1449 |
| 34 | Ga0065712_10158009 | 3300005290 | Bacteria | 1322 |
| 35 | Ga0065712_10159214 | 3300005290 | Bacteria | 1314 |
| 36 | Ga0065712_10338388 | 3300005290 | Bacteria | 804 |
| 37 | Ga0065712_10605506 | 3300005290 | Bacteria | 588 |
| 38 | Ga0065712_10668066 | 3300005290 | Unclassified | 560 |
| 39 | Ga0065715_10000608 | 3300005293 | Bacteria | 11704 |
| 40 | Ga0065715_10103698 | 3300005293 | Bacteria | 3013 |
| 41 | Ga0065715_10134926 | 3300005293 | Bacteria | 1946 |
| 42 | Ga0065715_10171014 | 3300005293 | Bacteria | 1547 |
| 43 | Ga0065715_10371651 | 3300005293 | Bacteria | 920 |
| 44 | Ga0065715_10484167 | 3300005293 | Unclassified | 754 |
| 45 | Ga0065715_10502292 | 3300005293 | Unclassified | 778 |
| 46 | Ga0065715_10588216 | 3300005293 | Unclassified | 715 |
| 47 | Ga0065715_10634163 | 3300005293 | Bacteria | 688 |
| 48 | Ga0065715_10719491 | 3300005293 | Bacteria | 644 |
| 49 | Ga0065715_10764053 | 3300005293 | Bacteria | 624 |
| 50 | Ga0065715_10874796 | 3300005293 | Bacteria | 583 |
| 51 | Ga0065715_10959652 | 3300005293 | Unclassified | 557 |
| 52 | Ga0065715_10995081 | 3300005293 | Bacteria | 546 |
| 53 | Ga0065707_10001625 | 3300005295 | Bacteria | 10772 |
| 54 | Ga0065707_10025113 | 3300005295 | Bacteria | 1414 |
| 55 | Ga0065707_10052146 | 3300005295 | Unclassified | 704 |
| 56 | Ga0065707_10113954 | 3300005295 | Unclassified | 2311 |
| 57 | Ga0065707_10115210 | 3300005295 | Bacteria | 2274 |
| 58 | Ga0065707_10117763 | 3300005295 | Bacteria | 2204 |
| 59 | Ga0065707_10121036 | 3300005295 | Unclassified | 2119 |
| 60 | Ga0065707_10143401 | 3300005295 | Bacteria | 1743 |
| 61 | Ga0065707_10427017 | 3300005295 | Bacteria | 824 |
| 62 | Ga0065707_10437955 | 3300005295 | Bacteria | 801 |
| 63 | Ga0065707_10500829 | 3300005295 | Bacteria | 750 |
| 64 | Ga0065707_10774695 | 3300005295 | Bacteria | 609 |
| 65 | Ga0065707_10913582 | 3300005295 | Bacteria | 563 |
| 66 | Ga0070658_10024349 | 3300005327 | Bacteria | 4857 |
| 67 | Ga0070676_10017097 | 3300005328 | Bacteria | 4011 |
| 68 | Ga0070676_10044432 | 3300005328 | Bacteria | 2585 |
| 69 | Ga0070676_10053805 | 3300005328 | Unclassified | 2372 |
| 70 | Ga0070676_10105547 | 3300005328 | Bacteria | 1747 |
| 71 | Ga0070676_10127756 | 3300005328 | Bacteria | 1604 |
| 72 | Ga0070676_10310803 | 3300005328 | Bacteria | 1071 |
| 73 | Ga0070676_10478139 | 3300005328 | Bacteria | 881 |
| 74 | Ga0070676_10498232 | 3300005328 | Unclassified | 864 |
| 75 | Ga0070676_11177469 | 3300005328 | Bacteria | 582 |
| 76 | Ga0070683_100028120 | 3300005329 | Bacteria | 5079 |
| 77 | Ga0070683_100032991 | 3300005329 | Bacteria | 4718 |
| 78 | Ga0070683_100413841 | 3300005329 | Unclassified | 1286 |
| 79 | Ga0070683_101239933 | 3300005329 | Unclassified | 717 |
| 80 | Ga0070683_101310690 | 3300005329 | Unclassified | 696 |
| 81 | Ga0070690_100029489 | 3300005330 | Bacteria | 3404 |
| 82 | Ga0070690_100029519 | 3300005330 | Bacteria | 3402 |
| 83 | Ga0070690_100031442 | 3300005330 | Bacteria | 3307 |
| 84 | Ga0070690_100072866 | 3300005330 | Bacteria | 2234 |
| 85 | Ga0070690_100204853 | 3300005330 | Unclassified | 1374 |
| 86 | Ga0070690_100242064 | 3300005330 | Bacteria | 1272 |
| 87 | Ga0070670_100005242 | 3300005331 | Bacteria | 10913 |
| 88 | Ga0070670_100016095 | 3300005331 | Bacteria | 6419 |
| 89 | Ga0070670_100026591 | 3300005331 | Bacteria | 4978 |
| 90 | Ga0070670_100080922 | 3300005331 | Bacteria | 2791 |
| 91 | Ga0070670_100128918 | 3300005331 | Bacteria | 2184 |
| 92 | Ga0070670_100134769 | 3300005331 | Bacteria | 2134 |
| 93 | Ga0070670_100268650 | 3300005331 | Bacteria | 1488 |
| 94 | Ga0070670_100433912 | 3300005331 | Bacteria | 1163 |
| 95 | Ga0070670_100492261 | 3300005331 | Bacteria | 1090 |
| 96 | Ga0070670_100532565 | 3300005331 | Bacteria | 1047 |
| 97 | Ga0070670_100723340 | 3300005331 | Bacteria | 896 |
| 98 | Ga0070670_101025573 | 3300005331 | Bacteria | 751 |
| 99 | Ga0070670_101787004 | 3300005331 | Unclassified | 566 |
| 100 | Ga0070677_10016037 | 3300005333 | Bacteria | 2663 |
| 101 | Ga0070677_10026731 | 3300005333 | Bacteria | 2166 |
| 102 | Ga0070677_10520465 | 3300005333 | Bacteria | 647 |
| 103 | Ga0070677_10528286 | 3300005333 | Bacteria | 643 |
| 104 | Ga0070677_10898464 | 3300005333 | Bacteria | 512 |
| 105 | Ga0068869_100061574 | 3300005334 | Bacteria | 2753 |
| 106 | Ga0068869_100070719 | 3300005334 | Bacteria | 2582 |
| 107 | Ga0068869_100115629 | 3300005334 | Bacteria | 2046 |
| 108 | Ga0068869_100285361 | 3300005334 | Bacteria | 1329 |
| 109 | Ga0068869_100304936 | 3300005334 | Unclassified | 1287 |
| 110 | Ga0068869_100405883 | 3300005334 | Bacteria | 1122 |
| 111 | Ga0068869_100587127 | 3300005334 | Bacteria | 940 |
| 112 | Ga0068869_100619234 | 3300005334 | Bacteria | 916 |
| 113 | Ga0068869_101161982 | 3300005334 | Bacteria | 677 |
| 114 | Ga0068869_101245466 | 3300005334 | Unclassified | 655 |
| 115 | Ga0068869_101275269 | 3300005334 | Bacteria | 647 |
| 116 | Ga0068869_101649782 | 3300005334 | Bacteria | 571 |
| 117 | Ga0070666_10015435 | 3300005335 | Bacteria | 4873 |
| 118 | Ga0070666_10025573 | 3300005335 | Bacteria | 3849 |
| 119 | Ga0070666_10063003 | 3300005335 | Bacteria | 2512 |
| 120 | Ga0070666_10141298 | 3300005335 | Bacteria | 1677 |
| 121 | Ga0070666_10249856 | 3300005335 | Bacteria | 1255 |
| 122 | Ga0070666_10363174 | 3300005335 | Bacteria | 1037 |
| 123 | Ga0070666_10462801 | 3300005335 | Bacteria | 917 |
| 124 | Ga0070666_10509488 | 3300005335 | Unclassified | 873 |
| 125 | Ga0070666_11107230 | 3300005335 | Unclassified | 589 |
| 126 | Ga0070680_100081806 | 3300005336 | Bacteria | 2664 |
| 127 | Ga0070680_100274873 | 3300005336 | Bacteria | 1427 |
| 128 | Ga0070682_100177524 | 3300005337 | Bacteria | 1485 |
| 129 | Ga0070682_100393341 | 3300005337 | Bacteria | 1046 |
| 130 | Ga0070682_100408628 | 3300005337 | Bacteria | 1029 |
| 131 | Ga0068868_100002613 | 3300005338 | Bacteria | 12492 |
| 132 | Ga0068868_100125325 | 3300005338 | Bacteria | 2098 |
| 133 | Ga0068868_100168029 | 3300005338 | Bacteria | 1815 |
| 134 | Ga0068868_100181016 | 3300005338 | Bacteria | 1748 |
| 135 | Ga0068868_100406504 | 3300005338 | Bacteria | 1176 |
| 136 | Ga0068868_100474576 | 3300005338 | Bacteria | 1092 |
| 137 | Ga0068868_100753819 | 3300005338 | Bacteria | 875 |
| 138 | Ga0068868_100896550 | 3300005338 | Bacteria | 806 |
| 139 | Ga0068868_101754862 | 3300005338 | Bacteria | 586 |
| 140 | Ga0070660_100790408 | 3300005339 | Bacteria | 798 |
| 141 | Ga0070689_100004747 | 3300005340 | Bacteria | 9220 |
| 142 | Ga0070689_100008229 | 3300005340 | Bacteria | 7335 |
| 143 | Ga0070689_100014545 | 3300005340 | Bacteria | 5719 |
| 144 | Ga0070689_100017434 | 3300005340 | Bacteria | 5274 |
| 145 | Ga0070689_100020726 | 3300005340 | Bacteria | 4882 |
| 146 | Ga0070689_100046423 | 3300005340 | Bacteria | 3348 |
| 147 | Ga0070689_100633346 | 3300005340 | Bacteria | 929 |
| 148 | Ga0070689_101011754 | 3300005340 | Bacteria | 740 |
| 149 | Ga0070691_10034977 | 3300005341 | Bacteria | 2365 |
| 150 | Ga0070691_10133947 | 3300005341 | Bacteria | 1258 |
| 151 | Ga0070691_10247625 | 3300005341 | Bacteria | 955 |
| 152 | Ga0070691_10440904 | 3300005341 | Bacteria | 742 |
| 153 | Ga0070691_10521898 | 3300005341 | Bacteria | 690 |
| 154 | Ga0070691_10650128 | 3300005341 | Unclassified | 628 |
| 155 | Ga0070687_100002751 | 3300005343 | Bacteria | 6675 |
| 156 | Ga0070687_100071459 | 3300005343 | Bacteria | 1865 |
| 157 | Ga0070687_100091341 | 3300005343 | Bacteria | 1685 |
| 158 | Ga0070687_100141709 | 3300005343 | Bacteria | 1401 |
| 159 | Ga0070687_100403390 | 3300005343 | Bacteria | 897 |
| 160 | Ga0070687_100426936 | 3300005343 | Bacteria | 876 |
| 161 | Ga0070687_100581574 | 3300005343 | Unclassified | 766 |
| 162 | Ga0070687_100619469 | 3300005343 | Bacteria | 746 |
| 163 | Ga0070687_100876420 | 3300005343 | Bacteria | 642 |
| 164 | Ga0070661_100073736 | 3300005344 | Bacteria | 2513 |
| 165 | Ga0070661_100154837 | 3300005344 | Bacteria | 1734 |
| 166 | Ga0070661_100158947 | 3300005344 | Bacteria | 1711 |
| 167 | Ga0070661_100360176 | 3300005344 | Bacteria | 1143 |
| 168 | Ga0070661_100425917 | 3300005344 | Bacteria | 1052 |
| 169 | Ga0070661_100527358 | 3300005344 | Unclassified | 948 |
| 170 | Ga0070661_101075215 | 3300005344 | Bacteria | 669 |
| 171 | Ga0070661_101303844 | 3300005344 | Bacteria | 609 |
| 172 | Ga0070661_101891011 | 3300005344 | Bacteria | 507 |
| 173 | Ga0070692_10026150 | 3300005345 | Bacteria | 2882 |
| 174 | Ga0070692_10053127 | 3300005345 | Bacteria | 2112 |
| 175 | Ga0070692_10107616 | 3300005345 | Bacteria | 1538 |
| 176 | Ga0070692_10112288 | 3300005345 | Bacteria | 1509 |
| 177 | Ga0070692_10163313 | 3300005345 | Bacteria | 1278 |
| 178 | Ga0070692_10348102 | 3300005345 | Bacteria | 920 |
| 179 | Ga0070668_100011207 | 3300005347 | Bacteria | 6675 |
| 180 | Ga0070668_100034459 | 3300005347 | Bacteria | 3857 |
| 181 | Ga0070668_100236894 | 3300005347 | Bacteria | 1510 |
| 182 | Ga0070668_100308244 | 3300005347 | Unclassified | 1329 |
| 183 | Ga0070668_100793733 | 3300005347 | Bacteria | 841 |
| 184 | Ga0070668_100825367 | 3300005347 | Bacteria | 825 |
| 185 | Ga0070668_101633597 | 3300005347 | Bacteria | 591 |
| 186 | Ga0070668_101740917 | 3300005347 | Unclassified | 572 |
| 187 | Ga0070668_102005199 | 3300005347 | Bacteria | 534 |
| 188 | Ga0070669_100003660 | 3300005353 | Bacteria | 11085 |
| 189 | Ga0070669_100023915 | 3300005353 | Bacteria | 4377 |
| 190 | Ga0070669_100027137 | 3300005353 | Bacteria | 4122 |
| 191 | Ga0070669_100068139 | 3300005353 | Unclassified | 2626 |
| 192 | Ga0070669_100139991 | 3300005353 | Bacteria | 1865 |
| 193 | Ga0070669_100167787 | 3300005353 | Bacteria | 1710 |
| 194 | Ga0070669_100190989 | 3300005353 | Bacteria | 1607 |
| 195 | Ga0070669_100306614 | 3300005353 | Unclassified | 1278 |
| 196 | Ga0070669_100328516 | 3300005353 | Bacteria | 1236 |
| 197 | Ga0070669_100482997 | 3300005353 | Bacteria | 1025 |
| 198 | Ga0070669_100572812 | 3300005353 | Bacteria | 943 |
| 199 | Ga0070669_100803504 | 3300005353 | Bacteria | 799 |
| 200 | Ga0070669_100974136 | 3300005353 | Bacteria | 727 |
| 201 | Ga0070669_101036047 | 3300005353 | Bacteria | 705 |
| 202 | Ga0070669_101391786 | 3300005353 | Bacteria | 609 |
| 203 | Ga0070675_100012940 | 3300005354 | Bacteria | 6548 |
| 204 | Ga0070675_100016195 | 3300005354 | Bacteria | 5913 |
| 205 | Ga0070675_100023187 | 3300005354 | Bacteria | 4959 |
| 206 | Ga0070675_100028016 | 3300005354 | Bacteria | 4530 |
| 207 | Ga0070675_100032799 | 3300005354 | Bacteria | 4205 |
| 208 | Ga0070675_100043086 | 3300005354 | Bacteria | 3687 |
| 209 | Ga0070675_100043190 | 3300005354 | Bacteria | 3683 |
| 210 | Ga0070675_100054777 | 3300005354 | Bacteria | 3282 |
| 211 | Ga0070675_100092883 | 3300005354 | Bacteria | 2530 |
| 212 | Ga0070675_100094360 | 3300005354 | Bacteria | 2510 |
| 213 | Ga0070675_100106368 | 3300005354 | Bacteria | 2368 |
| 214 | Ga0070675_100124332 | 3300005354 | Unclassified | 2194 |
| 215 | Ga0070675_100140257 | 3300005354 | Bacteria | 2066 |
| 216 | Ga0070675_100140848 | 3300005354 | Bacteria | 2062 |
| 217 | Ga0070675_100161639 | 3300005354 | Bacteria | 1926 |
| 218 | Ga0070675_100252931 | 3300005354 | Bacteria | 1543 |
| 219 | Ga0070675_100348204 | 3300005354 | Bacteria | 1313 |
| 220 | Ga0070675_100898481 | 3300005354 | Unclassified | 812 |
| 221 | Ga0070675_100953523 | 3300005354 | Bacteria | 787 |
| 222 | Ga0070675_101025816 | 3300005354 | Bacteria | 758 |
| 223 | Ga0070675_101082920 | 3300005354 | Bacteria | 737 |
| 224 | Ga0070675_101148262 | 3300005354 | Bacteria | 715 |
| 225 | Ga0070671_100018697 | 3300005355 | Bacteria | 5630 |
| 226 | Ga0070671_100027473 | 3300005355 | Bacteria | 4684 |
| 227 | Ga0070671_100037768 | 3300005355 | Bacteria | 4007 |
| 228 | Ga0070671_100226603 | 3300005355 | Bacteria | 1586 |
| 229 | Ga0070671_100239244 | 3300005355 | Bacteria | 1541 |
| 230 | Ga0070671_100268189 | 3300005355 | Bacteria | 1451 |
| 231 | Ga0070671_100511295 | 3300005355 | Bacteria | 1034 |
| 232 | Ga0070671_101088131 | 3300005355 | Bacteria | 702 |
| 233 | Ga0070671_101218468 | 3300005355 | Bacteria | 663 |
| 234 | Ga0070674_100023482 | 3300005356 | Bacteria | 3992 |
| 235 | Ga0070674_100030097 | 3300005356 | Bacteria | 3584 |
| 236 | Ga0070674_100108249 | 3300005356 | Bacteria | 2036 |
| 237 | Ga0070674_100145197 | 3300005356 | Bacteria | 1785 |
| 238 | Ga0070674_100164633 | 3300005356 | Bacteria | 1685 |
| 239 | Ga0070674_100189381 | 3300005356 | Bacteria | 1581 |
| 240 | Ga0070674_100299300 | 3300005356 | Bacteria | 1282 |
| 241 | Ga0070674_100350905 | 3300005356 | Bacteria | 1192 |
| 242 | Ga0070674_100375091 | 3300005356 | Bacteria | 1156 |
| 243 | Ga0070674_100410449 | 3300005356 | Bacteria | 1109 |
| 244 | Ga0070674_100428067 | 3300005356 | Bacteria | 1087 |
| 245 | Ga0070674_100645872 | 3300005356 | Bacteria | 899 |
| 246 | Ga0070674_100694804 | 3300005356 | Bacteria | 869 |
| 247 | Ga0070674_100705686 | 3300005356 | Unclassified | 863 |
| 248 | Ga0070674_100747991 | 3300005356 | Bacteria | 840 |
| 249 | Ga0070674_100875338 | 3300005356 | Bacteria | 781 |
| 250 | Ga0070674_101028974 | 3300005356 | Unclassified | 724 |
| 251 | Ga0070674_101177315 | 3300005356 | Bacteria | 680 |
| 252 | Ga0070674_101328677 | 3300005356 | Unclassified | 642 |
| 253 | Ga0070674_101491724 | 3300005356 | Bacteria | 607 |
| 254 | Ga0070674_101505806 | 3300005356 | Unclassified | 605 |
| 255 | Ga0070674_102092931 | 3300005356 | Bacteria | 516 |
| 256 | Ga0070673_100002420 | 3300005364 | Bacteria | 11363 |
| 257 | Ga0070673_100088599 | 3300005364 | Bacteria | 2524 |
| 258 | Ga0070673_100116081 | 3300005364 | Bacteria | 2226 |
| 259 | Ga0070673_100156089 | 3300005364 | Bacteria | 1937 |
| 260 | Ga0070673_100158464 | 3300005364 | Bacteria | 1923 |
| 261 | Ga0070673_100207926 | 3300005364 | Unclassified | 1688 |
| 262 | Ga0070673_100242943 | 3300005364 | Bacteria | 1566 |
| 263 | Ga0070673_100251410 | 3300005364 | Bacteria | 1541 |
| 264 | Ga0070673_100272696 | 3300005364 | Unclassified | 1481 |
| 265 | Ga0070673_100373103 | 3300005364 | Bacteria | 1271 |
| 266 | Ga0070673_100588565 | 3300005364 | Bacteria | 1014 |
| 267 | Ga0070673_100879958 | 3300005364 | Bacteria | 830 |
| 268 | Ga0070673_101084985 | 3300005364 | Bacteria | 747 |
| 269 | Ga0070673_101089057 | 3300005364 | Bacteria | 746 |
| 270 | Ga0070688_100001753 | 3300005365 | Bacteria | 10839 |
| 271 | Ga0070688_100021218 | 3300005365 | Bacteria | 3791 |
| 272 | Ga0070688_100028061 | 3300005365 | Unclassified | 3356 |
| 273 | Ga0070688_100029021 | 3300005365 | Bacteria | 3308 |
| 274 | Ga0070688_100100222 | 3300005365 | Bacteria | 1909 |
| 275 | Ga0070688_100122052 | 3300005365 | Bacteria | 1747 |
| 276 | Ga0070688_100176393 | 3300005365 | Bacteria | 1479 |
| 277 | Ga0070688_100180496 | 3300005365 | Unclassified | 1464 |
| 278 | Ga0070688_100288123 | 3300005365 | Bacteria | 1182 |
| 279 | Ga0070688_100565502 | 3300005365 | Bacteria | 866 |
| 280 | Ga0070688_101139966 | 3300005365 | Unclassified | 625 |
| 281 | Ga0070659_100236015 | 3300005366 | Bacteria | 1512 |
| 282 | Ga0070659_100623034 | 3300005366 | Unclassified | 929 |
| 283 | Ga0070659_101214932 | 3300005366 | Bacteria | 667 |
| 284 | Ga0070667_100013896 | 3300005367 | Bacteria | 6656 |
| 285 | Ga0070667_100066891 | 3300005367 | Bacteria | 3054 |
| 286 | Ga0070667_100234216 | 3300005367 | Bacteria | 1638 |
| 287 | Ga0070667_100301068 | 3300005367 | Bacteria | 1444 |
| 288 | Ga0070667_100344106 | 3300005367 | Unclassified | 1349 |
| 289 | Ga0070667_100562263 | 3300005367 | Bacteria | 1049 |
| 290 | Ga0070667_100917851 | 3300005367 | Bacteria | 815 |
| 291 | Ga0070667_101392029 | 3300005367 | Unclassified | 658 |
| 292 | Ga0070667_102300926 | 3300005367 | Bacteria | 507 |
| 293 | Ga0070703_10009612 | 3300005406 | Bacteria | 2728 |
| 294 | Ga0070703_10291958 | 3300005406 | Bacteria | 677 |
| 295 | Ga0070703_10298510 | 3300005406 | Bacteria | 671 |
| 296 | Ga0070703_10300647 | 3300005406 | Bacteria | 669 |
| 297 | Ga0070703_10314820 | 3300005406 | Unclassified | 657 |
| 298 | Ga0070703_10336997 | 3300005406 | Unclassified | 640 |
| 299 | Ga0070703_10526263 | 3300005406 | Bacteria | 536 |
| 300 | Ga0070709_10005339 | 3300005434 | Bacteria | 6960 |
| 301 | Ga0070709_10050658 | 3300005434 | Bacteria | 2603 |
| 302 | Ga0070709_10210736 | 3300005434 | Bacteria | 1381 |
| 303 | Ga0070709_10714089 | 3300005434 | Bacteria | 781 |
| 304 | Ga0070714_100009036 | 3300005435 | Bacteria | 7807 |
| 305 | Ga0070713_100023853 | 3300005436 | Bacteria | 4755 |
| 306 | Ga0070713_100027285 | 3300005436 | Bacteria | 4494 |
| 307 | Ga0070713_100080898 | 3300005436 | Bacteria | 2771 |
| 308 | Ga0070713_100406747 | 3300005436 | Bacteria | 1272 |
| 309 | Ga0070713_100463062 | 3300005436 | Unclassified | 1192 |
| 310 | Ga0070710_10769953 | 3300005437 | Bacteria | 685 |
| 311 | Ga0070701_10012529 | 3300005438 | Bacteria | 3828 |
| 312 | Ga0070701_10016470 | 3300005438 | Bacteria | 3437 |
| 313 | Ga0070701_10125174 | 3300005438 | Bacteria | 1453 |
| 314 | Ga0070701_10169327 | 3300005438 | Bacteria | 1271 |
| 315 | Ga0070701_10194546 | 3300005438 | Bacteria | 1195 |
| 316 | Ga0070701_10248957 | 3300005438 | Bacteria | 1072 |
| 317 | Ga0070701_10289216 | 3300005438 | Bacteria | 1003 |
| 318 | Ga0070701_10758140 | 3300005438 | Bacteria | 658 |
| 319 | Ga0070701_11208803 | 3300005438 | Bacteria | 536 |
| 320 | Ga0070711_100295535 | 3300005439 | Bacteria | 1286 |
| 321 | Ga0070711_100457063 | 3300005439 | Bacteria | 1046 |
| 322 | Ga0070711_101395811 | 3300005439 | Bacteria | 609 |
| 323 | Ga0070705_100000897 | 3300005440 | Bacteria | 16613 |
| 324 | Ga0070705_100006850 | 3300005440 | Bacteria | 5599 |
| 325 | Ga0070705_100124191 | 3300005440 | Bacteria | 1672 |
| 326 | Ga0070705_100205457 | 3300005440 | Bacteria | 1354 |
| 327 | Ga0070705_100242684 | 3300005440 | Bacteria | 1260 |
| 328 | Ga0070705_100246944 | 3300005440 | Bacteria | 1250 |
| 329 | Ga0070705_100367941 | 3300005440 | Bacteria | 1054 |
| 330 | Ga0070705_100571827 | 3300005440 | Bacteria | 870 |
| 331 | Ga0070705_100662030 | 3300005440 | Bacteria | 815 |
| 332 | Ga0070705_100666645 | 3300005440 | Bacteria | 813 |
| 333 | Ga0070705_100739537 | 3300005440 | Bacteria | 776 |
| 334 | Ga0070705_100813033 | 3300005440 | Bacteria | 745 |
| 335 | Ga0070705_100894032 | 3300005440 | Bacteria | 714 |
| 336 | Ga0070700_100007200 | 3300005441 | Bacteria | 5992 |
| 337 | Ga0070700_100022411 | 3300005441 | Bacteria | 3683 |
| 338 | Ga0070700_100037500 | 3300005441 | Bacteria | 2949 |
| 339 | Ga0070700_100053729 | 3300005441 | Bacteria | 2515 |
| 340 | Ga0070700_100088454 | 3300005441 | Bacteria | 2016 |
| 341 | Ga0070700_100104342 | 3300005441 | Bacteria | 1873 |
| 342 | Ga0070700_100270299 | 3300005441 | Bacteria | 1228 |
| 343 | Ga0070700_100312355 | 3300005441 | Bacteria | 1151 |
| 344 | Ga0070700_100400437 | 3300005441 | Bacteria | 1032 |
| 345 | Ga0070700_100559901 | 3300005441 | Bacteria | 889 |
| 346 | Ga0070700_101053215 | 3300005441 | Bacteria | 672 |
| 347 | Ga0070700_101325125 | 3300005441 | Unclassified | 606 |
| 348 | Ga0070700_101525443 | 3300005441 | Bacteria | 569 |
| 349 | Ga0070700_101982619 | 3300005441 | Bacteria | 505 |
| 350 | Ga0070694_100001253 | 3300005444 | Bacteria | 14731 |
| 351 | Ga0070694_100001998 | 3300005444 | Bacteria | 12113 |
| 352 | Ga0070694_100115736 | 3300005444 | Bacteria | 1917 |
| 353 | Ga0070694_100128153 | 3300005444 | Bacteria | 1830 |
| 354 | Ga0070694_100131235 | 3300005444 | Unclassified | 1810 |
| 355 | Ga0070694_100167894 | 3300005444 | Bacteria | 1615 |
| 356 | Ga0070694_100177663 | 3300005444 | Bacteria | 1573 |
| 357 | Ga0070694_100237418 | 3300005444 | Bacteria | 1374 |
| 358 | Ga0070694_100328764 | 3300005444 | Unclassified | 1178 |
| 359 | Ga0070694_100376892 | 3300005444 | Bacteria | 1105 |
| 360 | Ga0070694_100395988 | 3300005444 | Unclassified | 1080 |
| 361 | Ga0070694_100932338 | 3300005444 | Unclassified | 718 |
| 362 | Ga0070708_100370669 | 3300005445 | Bacteria | 1350 |
| 363 | Ga0070708_100469016 | 3300005445 | Bacteria | 1188 |
| 364 | Ga0070708_100860041 | 3300005445 | Unclassified | 852 |
| 365 | Ga0070708_100960275 | 3300005445 | Bacteria | 802 |
| 366 | Ga0070663_100074691 | 3300005455 | Bacteria | 2476 |
| 367 | Ga0070663_101513983 | 3300005455 | Bacteria | 596 |
| 368 | Ga0070678_100038726 | 3300005456 | Bacteria | 3358 |
| 369 | Ga0070678_100041676 | 3300005456 | Bacteria | 3257 |
| 370 | Ga0070678_100069671 | 3300005456 | Bacteria | 2627 |
| 371 | Ga0070678_100091538 | 3300005456 | Bacteria | 2334 |
| 372 | Ga0070678_100139864 | 3300005456 | Bacteria | 1936 |
| 373 | Ga0070678_100169062 | 3300005456 | Bacteria | 1779 |
| 374 | Ga0070678_100179023 | 3300005456 | Bacteria | 1734 |
| 375 | Ga0070678_100295380 | 3300005456 | Unclassified | 1375 |
| 376 | Ga0070678_100418905 | 3300005456 | Bacteria | 1167 |
| 377 | Ga0070678_100554615 | 3300005456 | Bacteria | 1020 |
| 378 | Ga0070678_100657645 | 3300005456 | Bacteria | 940 |
| 379 | Ga0070678_100742766 | 3300005456 | Bacteria | 887 |
| 380 | Ga0070678_100835535 | 3300005456 | Bacteria | 838 |
| 381 | Ga0070678_100845601 | 3300005456 | Bacteria | 833 |
| 382 | Ga0070678_100862061 | 3300005456 | Unclassified | 826 |
| 383 | Ga0070678_101094782 | 3300005456 | Bacteria | 735 |
| 384 | Ga0070678_101521889 | 3300005456 | Unclassified | 627 |
| 385 | Ga0070662_100043913 | 3300005457 | Bacteria | 3200 |
| 386 | Ga0070662_100083192 | 3300005457 | Unclassified | 2388 |
| 387 | Ga0070662_100160289 | 3300005457 | Unclassified | 1759 |
| 388 | Ga0070662_100189813 | 3300005457 | Bacteria | 1624 |
| 389 | Ga0070662_100354017 | 3300005457 | Bacteria | 1203 |
| 390 | Ga0070662_100473685 | 3300005457 | Bacteria | 1042 |
| 391 | Ga0070662_100501443 | 3300005457 | Bacteria | 1012 |
| 392 | Ga0070662_100655831 | 3300005457 | Bacteria | 885 |
| 393 | Ga0070662_100739496 | 3300005457 | Bacteria | 834 |
| 394 | Ga0070662_100958487 | 3300005457 | Bacteria | 731 |
| 395 | Ga0070662_101139730 | 3300005457 | Bacteria | 670 |
| 396 | Ga0070662_101201037 | 3300005457 | Bacteria | 652 |
| 397 | Ga0070662_101341898 | 3300005457 | Bacteria | 616 |
| 398 | Ga0070681_10036359 | 3300005458 | Bacteria | 4945 |
| 399 | Ga0070681_10234728 | 3300005458 | Unclassified | 1748 |
| 400 | Ga0070681_10245415 | 3300005458 | Bacteria | 1704 |
| 401 | Ga0070681_10315070 | 3300005458 | Bacteria | 1474 |
| 402 | Ga0070681_10353760 | 3300005458 | Bacteria | 1379 |
| 403 | Ga0070681_10544930 | 3300005458 | Bacteria | 1074 |
| 404 | Ga0070681_11123333 | 3300005458 | Unclassified | 707 |
| 405 | Ga0068867_100007393 | 3300005459 | Bacteria | 7771 |
| 406 | Ga0068867_100008654 | 3300005459 | Bacteria | 7186 |
| 407 | Ga0068867_100012752 | 3300005459 | Bacteria | 5948 |
| 408 | Ga0068867_100016089 | 3300005459 | Bacteria | 5311 |
| 409 | Ga0068867_100145700 | 3300005459 | Bacteria | 1856 |
| 410 | Ga0068867_100286851 | 3300005459 | Bacteria | 1352 |
| 411 | Ga0068867_100311441 | 3300005459 | Bacteria | 1301 |
| 412 | Ga0068867_100521265 | 3300005459 | Bacteria | 1025 |
| 413 | Ga0068867_101345790 | 3300005459 | Bacteria | 660 |
| 414 | Ga0068867_101365680 | 3300005459 | Bacteria | 656 |
| 415 | Ga0068867_101520011 | 3300005459 | Bacteria | 624 |
| 416 | Ga0068867_101754969 | 3300005459 | Unclassified | 583 |
| 417 | Ga0068867_101761317 | 3300005459 | Unclassified | 582 |
| 418 | Ga0068867_102056289 | 3300005459 | Bacteria | 540 |
| 419 | Ga0070685_10000947 | 3300005466 | Bacteria | 15612 |
| 420 | Ga0070685_10202006 | 3300005466 | Bacteria | 1292 |
| 421 | Ga0070685_10214530 | 3300005466 | Bacteria | 1258 |
| 422 | Ga0070685_10309048 | 3300005466 | Bacteria | 1068 |
| 423 | Ga0070685_10360382 | 3300005466 | Bacteria | 996 |
| 424 | Ga0070685_10374420 | 3300005466 | Bacteria | 979 |
| 425 | Ga0070685_10425666 | 3300005466 | Bacteria | 925 |
| 426 | Ga0070685_10561825 | 3300005466 | Bacteria | 816 |
| 427 | Ga0070685_11007625 | 3300005466 | Unclassified | 625 |
| 428 | Ga0070685_11579551 | 3300005466 | Bacteria | 507 |
| 429 | Ga0070706_100313699 | 3300005467 | Bacteria | 1463 |
| 430 | Ga0070706_100433779 | 3300005467 | Bacteria | 1223 |
| 431 | Ga0070706_100501160 | 3300005467 | Bacteria | 1130 |
| 432 | Ga0070706_100581790 | 3300005467 | Bacteria | 1041 |
| 433 | Ga0070706_100983878 | 3300005467 | Unclassified | 778 |
| 434 | Ga0070706_101123123 | 3300005467 | Bacteria | 723 |
| 435 | Ga0070706_101271203 | 3300005467 | Unclassified | 675 |
| 436 | Ga0070706_101283085 | 3300005467 | Bacteria | 672 |
| 437 | Ga0070707_100106563 | 3300005468 | Bacteria | 2718 |
| 438 | Ga0070707_100116361 | 3300005468 | Bacteria | 2595 |
| 439 | Ga0070707_100118656 | 3300005468 | Bacteria | 2568 |
| 440 | Ga0070707_100176549 | 3300005468 | Unclassified | 2082 |
| 441 | Ga0070707_100676427 | 3300005468 | Bacteria | 995 |
| 442 | Ga0070707_100737860 | 3300005468 | Bacteria | 948 |
| 443 | Ga0070707_101767055 | 3300005468 | Bacteria | 586 |
| 444 | Ga0070707_102271565 | 3300005468 | Bacteria | 510 |
| 445 | Ga0070698_100036634 | 3300005471 | Bacteria | 5065 |
| 446 | Ga0070698_100077203 | 3300005471 | Bacteria | 3331 |
| 447 | Ga0070698_100084104 | 3300005471 | Bacteria | 3170 |
| 448 | Ga0070698_100141206 | 3300005471 | Bacteria | 2359 |
| 449 | Ga0070698_100292134 | 3300005471 | Unclassified | 1561 |
| 450 | Ga0070698_100392553 | 3300005471 | Bacteria | 1321 |
| 451 | Ga0070698_100572122 | 3300005471 | Bacteria | 1070 |
| 452 | Ga0070698_100623826 | 3300005471 | Bacteria | 1019 |
| 453 | Ga0070698_100627389 | 3300005471 | Unclassified | 1016 |
| 454 | Ga0070698_100765102 | 3300005471 | Bacteria | 909 |
| 455 | Ga0070698_100919765 | 3300005471 | Bacteria | 821 |
| 456 | Ga0070698_100927033 | 3300005471 | Bacteria | 817 |
| 457 | Ga0070698_101139025 | 3300005471 | Bacteria | 729 |
| 458 | Ga0070698_102055084 | 3300005471 | Bacteria | 525 |
| 459 | Ga0070699_100000410 | 3300005518 | Bacteria | 41278 |
| 460 | Ga0070699_100000753 | 3300005518 | Bacteria | 29961 |
| 461 | Ga0070699_100017510 | 3300005518 | Bacteria | 6150 |
| 462 | Ga0070699_100032358 | 3300005518 | Unclassified | 4515 |
| 463 | Ga0070699_100072950 | 3300005518 | Bacteria | 2986 |
| 464 | Ga0070699_100091280 | 3300005518 | Bacteria | 2663 |
| 465 | Ga0070699_100135537 | 3300005518 | Unclassified | 2172 |
| 466 | Ga0070699_100245741 | 3300005518 | Bacteria | 1598 |
| 467 | Ga0070699_100390198 | 3300005518 | Bacteria | 1258 |
| 468 | Ga0070699_100489514 | 3300005518 | Bacteria | 1117 |
| 469 | Ga0070699_100847762 | 3300005518 | Bacteria | 837 |
| 470 | Ga0070699_101095718 | 3300005518 | Unclassified | 730 |
| 471 | Ga0070699_101172278 | 3300005518 | Bacteria | 705 |
| 472 | Ga0070699_101389000 | 3300005518 | Bacteria | 644 |
| 473 | Ga0070699_101479520 | 3300005518 | Bacteria | 623 |
| 474 | Ga0070679_100059093 | 3300005530 | Bacteria | 3822 |
| 475 | Ga0070679_100179646 | 3300005530 | Bacteria | 2089 |
| 476 | Ga0070679_101106211 | 3300005530 | Bacteria | 737 |
| 477 | Ga0070679_101360741 | 3300005530 | Bacteria | 656 |
| 478 | Ga0070684_100098813 | 3300005535 | Bacteria | 2604 |
| 479 | Ga0070684_100646836 | 3300005535 | Unclassified | 984 |
| 480 | Ga0070684_100763403 | 3300005535 | Unclassified | 903 |
| 481 | Ga0070684_101290966 | 3300005535 | Bacteria | 687 |
| 482 | Ga0070684_101347554 | 3300005535 | Bacteria | 672 |
| 483 | Ga0070684_101497389 | 3300005535 | Bacteria | 636 |
| 484 | Ga0070697_100033368 | 3300005536 | Bacteria | 4145 |
| 485 | Ga0070697_100240185 | 3300005536 | Bacteria | 1547 |
| 486 | Ga0070697_100349499 | 3300005536 | Bacteria | 1277 |
| 487 | Ga0070697_100590548 | 3300005536 | Bacteria | 976 |
| 488 | Ga0070697_100691193 | 3300005536 | Bacteria | 900 |
| 489 | Ga0070697_100835451 | 3300005536 | Bacteria | 816 |
| 490 | Ga0070697_102022129 | 3300005536 | Bacteria | 516 |
| 491 | Ga0068853_100300755 | 3300005539 | Bacteria | 1483 |
| 492 | Ga0068853_100491875 | 3300005539 | Bacteria | 1157 |
| 493 | Ga0070672_100005033 | 3300005543 | Bacteria | 8713 |
| 494 | Ga0070672_100018161 | 3300005543 | Bacteria | 5079 |
| 495 | Ga0070672_100018273 | 3300005543 | Bacteria | 5063 |
| 496 | Ga0070672_100028636 | 3300005543 | Bacteria | 4169 |
| 497 | Ga0070672_100057910 | 3300005543 | Bacteria | 3043 |
| 498 | Ga0070672_100091670 | 3300005543 | Bacteria | 2452 |
| 499 | Ga0070672_100132620 | 3300005543 | Bacteria | 2049 |
| 500 | Ga0070672_100137378 | 3300005543 | Bacteria | 2014 |
| 501 | Ga0070672_100138059 | 3300005543 | Bacteria | 2009 |
| 502 | Ga0070672_100154028 | 3300005543 | Bacteria | 1903 |
| 503 | Ga0070672_100218002 | 3300005543 | Bacteria | 1600 |
| 504 | Ga0070672_100400931 | 3300005543 | Bacteria | 1176 |
| 505 | Ga0070672_100428513 | 3300005543 | Unclassified | 1137 |
| 506 | Ga0070672_100522166 | 3300005543 | Bacteria | 1029 |
| 507 | Ga0070672_100590641 | 3300005543 | Bacteria | 966 |
| 508 | Ga0070672_101133921 | 3300005543 | Bacteria | 695 |
| 509 | Ga0070672_101149525 | 3300005543 | Bacteria | 691 |
| 510 | Ga0070672_101465441 | 3300005543 | Bacteria | 611 |
| 511 | Ga0070686_100001410 | 3300005544 | Bacteria | 13562 |
| 512 | Ga0070686_100018367 | 3300005544 | Bacteria | 4102 |
| 513 | Ga0070686_100066401 | 3300005544 | Bacteria | 2346 |
| 514 | Ga0070686_100073995 | 3300005544 | Unclassified | 2238 |
| 515 | Ga0070686_100096363 | 3300005544 | Bacteria | 1989 |
| 516 | Ga0070686_100182542 | 3300005544 | Bacteria | 1492 |
| 517 | Ga0070686_100322083 | 3300005544 | Bacteria | 1153 |
| 518 | Ga0070686_100455187 | 3300005544 | Unclassified | 985 |
| 519 | Ga0070686_100473925 | 3300005544 | Unclassified | 967 |
| 520 | Ga0070686_100473950 | 3300005544 | Bacteria | 967 |
| 521 | Ga0070686_100548966 | 3300005544 | Bacteria | 903 |
| 522 | Ga0070686_101240827 | 3300005544 | Unclassified | 620 |
| 523 | Ga0070686_101788966 | 3300005544 | Unclassified | 523 |
| 524 | Ga0070686_101918884 | 3300005544 | Unclassified | 506 |
| 525 | Ga0070686_101952522 | 3300005544 | Bacteria | 501 |
| 526 | Ga0070695_100000939 | 3300005545 | Bacteria | 15776 |
| 527 | Ga0070695_100041621 | 3300005545 | Bacteria | 2913 |
| 528 | Ga0070695_100058755 | 3300005545 | Bacteria | 2488 |
| 529 | Ga0070695_100088445 | 3300005545 | Bacteria | 2062 |
| 530 | Ga0070695_100141576 | 3300005545 | Bacteria | 1668 |
| 531 | Ga0070695_100191216 | 3300005545 | Bacteria | 1457 |
| 532 | Ga0070695_100723857 | 3300005545 | Unclassified | 791 |
| 533 | Ga0070695_101281754 | 3300005545 | Bacteria | 605 |
| 534 | Ga0070696_100001074 | 3300005546 | Bacteria | 17644 |
| 535 | Ga0070696_100008820 | 3300005546 | Bacteria | 6746 |
| 536 | Ga0070696_100038629 | 3300005546 | Bacteria | 3295 |
| 537 | Ga0070696_100103211 | 3300005546 | Bacteria | 2046 |
| 538 | Ga0070696_100107749 | 3300005546 | Bacteria | 2004 |
| 539 | Ga0070696_100251895 | 3300005546 | Bacteria | 1336 |
| 540 | Ga0070696_100456033 | 3300005546 | Bacteria | 1010 |
| 541 | Ga0070696_100681800 | 3300005546 | Bacteria | 836 |
| 542 | Ga0070693_100261677 | 3300005547 | Bacteria | 1151 |
| 543 | Ga0070693_100897588 | 3300005547 | Bacteria | 664 |
| 544 | Ga0070665_100012666 | 3300005548 | Bacteria | 8491 |
| 545 | Ga0070665_100029781 | 3300005548 | Bacteria | 5493 |
| 546 | Ga0070665_100034631 | 3300005548 | Bacteria | 5078 |
| 547 | Ga0070665_101007899 | 3300005548 | Bacteria | 845 |
| 548 | Ga0070704_100001249 | 3300005549 | Bacteria | 13402 |
| 549 | Ga0070704_100004940 | 3300005549 | Bacteria | 7741 |
| 550 | Ga0070704_100025590 | 3300005549 | Unclassified | 3887 |
| 551 | Ga0070704_100102200 | 3300005549 | Unclassified | 2162 |
| 552 | Ga0070704_100111026 | 3300005549 | Unclassified | 2086 |
| 553 | Ga0070704_100122788 | 3300005549 | Bacteria | 1999 |
| 554 | Ga0070704_100184666 | 3300005549 | Bacteria | 1671 |
| 555 | Ga0070704_100251466 | 3300005549 | Bacteria | 1452 |
| 556 | Ga0070704_100525243 | 3300005549 | Bacteria | 1031 |
| 557 | Ga0070704_100627521 | 3300005549 | Bacteria | 947 |
| 558 | Ga0070704_100685322 | 3300005549 | Bacteria | 908 |
| 559 | Ga0070704_100994962 | 3300005549 | Unclassified | 758 |
| 560 | Ga0070704_101019325 | 3300005549 | Bacteria | 749 |
| 561 | Ga0070704_101100846 | 3300005549 | Bacteria | 721 |
| 562 | Ga0070704_101386655 | 3300005549 | Bacteria | 644 |
| 563 | Ga0070704_101397212 | 3300005549 | Unclassified | 642 |
| 564 | Ga0070704_101598784 | 3300005549 | Bacteria | 601 |
| 565 | Ga0070664_100006618 | 3300005564 | Bacteria | 9344 |
| 566 | Ga0070664_100023419 | 3300005564 | Bacteria | 5100 |
| 567 | Ga0070664_100041208 | 3300005564 | Unclassified | 3895 |
| 568 | Ga0070664_100101236 | 3300005564 | Bacteria | 2505 |
| 569 | Ga0070664_100149280 | 3300005564 | Bacteria | 2063 |
| 570 | Ga0070664_100432279 | 3300005564 | Bacteria | 1207 |
| 571 | Ga0070664_100451037 | 3300005564 | Bacteria | 1181 |
| 572 | Ga0070664_100658297 | 3300005564 | Bacteria | 974 |
| 573 | Ga0070664_100722954 | 3300005564 | Unclassified | 928 |
| 574 | Ga0070664_100733423 | 3300005564 | Bacteria | 922 |
| 575 | Ga0070664_101076178 | 3300005564 | Unclassified | 757 |
| 576 | Ga0070664_101357864 | 3300005564 | Bacteria | 671 |
| 577 | Ga0070664_101380279 | 3300005564 | Bacteria | 666 |
| 578 | Ga0068857_100079371 | 3300005577 | Bacteria | 2929 |
| 579 | Ga0068857_100150832 | 3300005577 | Bacteria | 2106 |
| 580 | Ga0068857_100174209 | 3300005577 | Bacteria | 1956 |
| 581 | Ga0068857_100452499 | 3300005577 | Bacteria | 1200 |
| 582 | Ga0068857_100535693 | 3300005577 | Bacteria | 1102 |
| 583 | Ga0068857_101610488 | 3300005577 | Bacteria | 634 |
| 584 | Ga0068857_101959580 | 3300005577 | Bacteria | 574 |
| 585 | Ga0068854_100010562 | 3300005578 | Bacteria | 5990 |
| 586 | Ga0068854_100076351 | 3300005578 | Unclassified | 2462 |
| 587 | Ga0068854_100077452 | 3300005578 | Bacteria | 2447 |
| 588 | Ga0068854_100450182 | 3300005578 | Unclassified | 1075 |
| 589 | Ga0068854_100749467 | 3300005578 | Unclassified | 847 |
| 590 | Ga0068854_101176832 | 3300005578 | Bacteria | 686 |
| 591 | Ga0070702_100015349 | 3300005615 | Bacteria | 3910 |
| 592 | Ga0070702_100031935 | 3300005615 | Bacteria | 2885 |
| 593 | Ga0070702_100201913 | 3300005615 | Bacteria | 1317 |
| 594 | Ga0070702_100273570 | 3300005615 | Bacteria | 1156 |
| 595 | Ga0070702_100436024 | 3300005615 | Bacteria | 947 |
| 596 | Ga0070702_100555985 | 3300005615 | Unclassified | 853 |
| 597 | Ga0070702_100825978 | 3300005615 | Bacteria | 719 |
| 598 | Ga0068852_100075870 | 3300005616 | Bacteria | 2967 |
| 599 | Ga0068852_101016662 | 3300005616 | Bacteria | 848 |
| 600 | Ga0068859_100023275 | 3300005617 | Bacteria | 6217 |
| 601 | Ga0068859_100033707 | 3300005617 | Bacteria | 5141 |
| 602 | Ga0068859_100048146 | 3300005617 | Bacteria | 4282 |
| 603 | Ga0068859_100055252 | 3300005617 | Bacteria | 3995 |
| 604 | Ga0068859_100061540 | 3300005617 | Bacteria | 3782 |
| 605 | Ga0068859_100066190 | 3300005617 | Bacteria | 3648 |
| 606 | Ga0068859_100111753 | 3300005617 | Bacteria | 2795 |
| 607 | Ga0068859_100113988 | 3300005617 | Bacteria | 2767 |
| 608 | Ga0068859_100140184 | 3300005617 | Bacteria | 2492 |
| 609 | Ga0068859_100187875 | 3300005617 | Bacteria | 2150 |
| 610 | Ga0068859_100235859 | 3300005617 | Bacteria | 1918 |
| 611 | Ga0068859_100256618 | 3300005617 | Bacteria | 1839 |
| 612 | Ga0068859_100521796 | 3300005617 | Bacteria | 1283 |
| 613 | Ga0068859_100880755 | 3300005617 | Unclassified | 981 |
| 614 | Ga0068859_101321780 | 3300005617 | Bacteria | 795 |
| 615 | Ga0068859_101337837 | 3300005617 | Unclassified | 790 |
| 616 | Ga0068859_101920698 | 3300005617 | Unclassified | 654 |
| 617 | Ga0068859_102254685 | 3300005617 | Unclassified | 601 |
| 618 | Ga0068864_100001449 | 3300005618 | Bacteria | 19557 |
| 619 | Ga0068864_100033085 | 3300005618 | Bacteria | 4394 |
| 620 | Ga0068864_100116552 | 3300005618 | Bacteria | 2383 |
| 621 | Ga0068864_100119189 | 3300005618 | Unclassified | 2358 |
| 622 | Ga0068864_100171845 | 3300005618 | Bacteria | 1976 |
| 623 | Ga0068864_100653142 | 3300005618 | Bacteria | 1024 |
| 624 | Ga0068864_100784206 | 3300005618 | Bacteria | 936 |
| 625 | Ga0068864_100938612 | 3300005618 | Unclassified | 856 |
| 626 | Ga0068864_100980107 | 3300005618 | Bacteria | 838 |
| 627 | Ga0068864_101330219 | 3300005618 | Bacteria | 719 |
| 628 | Ga0068864_101429478 | 3300005618 | Unclassified | 694 |
| 629 | Ga0068864_101907656 | 3300005618 | Bacteria | 600 |
| 630 | Ga0068864_102055217 | 3300005618 | Unclassified | 578 |
| 631 | Ga0068866_10031836 | 3300005718 | Bacteria | 2544 |
| 632 | Ga0068866_10094288 | 3300005718 | Bacteria | 1637 |
| 633 | Ga0068866_10368368 | 3300005718 | Bacteria | 918 |
| 634 | Ga0068866_10409648 | 3300005718 | Bacteria | 877 |
| 635 | Ga0068866_10537328 | 3300005718 | Bacteria | 779 |
| 636 | Ga0068866_10785301 | 3300005718 | Bacteria | 661 |
| 637 | Ga0068866_11140695 | 3300005718 | Bacteria | 560 |
| 638 | Ga0068861_100016299 | 3300005719 | Bacteria | 5255 |
| 639 | Ga0068861_100016649 | 3300005719 | Bacteria | 5205 |
| 640 | Ga0068861_100016863 | 3300005719 | Bacteria | 5175 |
| 641 | Ga0068861_100053065 | 3300005719 | Bacteria | 3083 |
| 642 | Ga0068861_100062481 | 3300005719 | Bacteria | 2861 |
| 643 | Ga0068861_100071472 | 3300005719 | Unclassified | 2690 |
| 644 | Ga0068861_100084971 | 3300005719 | Bacteria | 2485 |
| 645 | Ga0068861_100135619 | 3300005719 | Bacteria | 2002 |
| 646 | Ga0068861_100209677 | 3300005719 | Bacteria | 1640 |
| 647 | Ga0068861_100331464 | 3300005719 | Bacteria | 1329 |
| 648 | Ga0068861_100388542 | 3300005719 | Bacteria | 1235 |
| 649 | Ga0068861_100450132 | 3300005719 | Bacteria | 1154 |
| 650 | Ga0068861_100506764 | 3300005719 | Bacteria | 1092 |
| 651 | Ga0068861_100547697 | 3300005719 | Bacteria | 1054 |
| 652 | Ga0068861_102233858 | 3300005719 | Unclassified | 548 |
| 653 | Ga0068861_102532428 | 3300005719 | Bacteria | 517 |
| 654 | Ga0068851_10101840 | 3300005834 | Bacteria | 1525 |
| 655 | Ga0068870_10007356 | 3300005840 | Bacteria | 4903 |
| 656 | Ga0068870_10012486 | 3300005840 | Bacteria | 3971 |
| 657 | Ga0068870_10052341 | 3300005840 | Bacteria | 2165 |
| 658 | Ga0068870_10055842 | 3300005840 | Unclassified | 2105 |
| 659 | Ga0068870_10099479 | 3300005840 | Bacteria | 1641 |
| 660 | Ga0068870_10112032 | 3300005840 | Bacteria | 1560 |
| 661 | Ga0068870_10396432 | 3300005840 | Bacteria | 897 |
| 662 | Ga0068870_10539540 | 3300005840 | Unclassified | 784 |
| 663 | Ga0068870_10673927 | 3300005840 | Bacteria | 711 |
| 664 | Ga0068870_11317444 | 3300005840 | Bacteria | 527 |
| 665 | Ga0068863_100001998 | 3300005841 | Bacteria | 20231 |
| 666 | Ga0068863_100003338 | 3300005841 | Bacteria | 15848 |
| 667 | Ga0068863_100010691 | 3300005841 | Bacteria | 8913 |
| 668 | Ga0068863_100296914 | 3300005841 | Bacteria | 1567 |
| 669 | Ga0068863_100351308 | 3300005841 | Bacteria | 1436 |
| 670 | Ga0068863_100394671 | 3300005841 | Bacteria | 1352 |
| 671 | Ga0068863_100553528 | 3300005841 | Bacteria | 1136 |
| 672 | Ga0068863_100731439 | 3300005841 | Bacteria | 985 |
| 673 | Ga0068863_101208102 | 3300005841 | Bacteria | 762 |
| 674 | Ga0068863_101499439 | 3300005841 | Unclassified | 683 |
| 675 | Ga0068863_101657212 | 3300005841 | Bacteria | 649 |
| 676 | Ga0068858_100017315 | 3300005842 | Bacteria | 6759 |
| 677 | Ga0068858_100018057 | 3300005842 | Bacteria | 6606 |
| 678 | Ga0068858_100041117 | 3300005842 | Bacteria | 4288 |
| 679 | Ga0068858_100052285 | 3300005842 | Bacteria | 3779 |
| 680 | Ga0068858_100055021 | 3300005842 | Bacteria | 3678 |
| 681 | Ga0068858_100078536 | 3300005842 | Bacteria | 3067 |
| 682 | Ga0068858_100085768 | 3300005842 | Unclassified | 2930 |
| 683 | Ga0068858_100150435 | 3300005842 | Bacteria | 2189 |
| 684 | Ga0068858_100155455 | 3300005842 | Unclassified | 2152 |
| 685 | Ga0068858_100226785 | 3300005842 | Bacteria | 1770 |
| 686 | Ga0068858_100248451 | 3300005842 | Bacteria | 1689 |
| 687 | Ga0068858_100297298 | 3300005842 | Bacteria | 1540 |
| 688 | Ga0068858_100618020 | 3300005842 | Unclassified | 1052 |
| 689 | Ga0068858_100637000 | 3300005842 | Bacteria | 1035 |
| 690 | Ga0068858_100830798 | 3300005842 | Bacteria | 902 |
| 691 | Ga0068858_101200908 | 3300005842 | Bacteria | 746 |
| 692 | Ga0068858_101300602 | 3300005842 | Bacteria | 716 |
| 693 | Ga0068858_101399910 | 3300005842 | Bacteria | 689 |
| 694 | Ga0068858_101578364 | 3300005842 | Unclassified | 647 |
| 695 | Ga0068858_101836407 | 3300005842 | Bacteria | 599 |
| 696 | Ga0068858_101873047 | 3300005842 | Bacteria | 593 |
| 697 | Ga0068860_100038835 | 3300005843 | Bacteria | 4555 |
| 698 | Ga0068860_100076543 | 3300005843 | Bacteria | 3182 |
| 699 | Ga0068860_100087884 | 3300005843 | Bacteria | 2959 |
| 700 | Ga0068860_100132440 | 3300005843 | Bacteria | 2393 |
| 701 | Ga0068860_100193257 | 3300005843 | Bacteria | 1970 |
| 702 | Ga0068860_100391717 | 3300005843 | Bacteria | 1373 |
| 703 | Ga0068860_100502177 | 3300005843 | Bacteria | 1211 |
| 704 | Ga0068860_100566985 | 3300005843 | Bacteria | 1138 |
| 705 | Ga0068860_100623495 | 3300005843 | Bacteria | 1085 |
| 706 | Ga0068860_100629188 | 3300005843 | Bacteria | 1080 |
| 707 | Ga0068860_100733962 | 3300005843 | Bacteria | 999 |
| 708 | Ga0068860_101417381 | 3300005843 | Bacteria | 716 |
| 709 | Ga0068860_102266689 | 3300005843 | Bacteria | 564 |
| 710 | Ga0068862_100002296 | 3300005844 | Bacteria | 17092 |
| 711 | Ga0068862_100006007 | 3300005844 | Bacteria | 10111 |
| 712 | Ga0068862_100021571 | 3300005844 | Bacteria | 5384 |
| 713 | Ga0068862_100066542 | 3300005844 | Bacteria | 3105 |
| 714 | Ga0068862_100344154 | 3300005844 | Bacteria | 1382 |
| 715 | Ga0068862_100441079 | 3300005844 | Bacteria | 1225 |
| 716 | Ga0068862_100689126 | 3300005844 | Unclassified | 989 |
| 717 | Ga0068862_100826185 | 3300005844 | Unclassified | 906 |
| 718 | Ga0068862_100894987 | 3300005844 | Bacteria | 872 |
| 719 | Ga0068862_101399557 | 3300005844 | Bacteria | 703 |
| 720 | Ga0068862_102081918 | 3300005844 | Unclassified | 578 |
| 721 | Ga0068862_102300737 | 3300005844 | Bacteria | 551 |
| 722 | Ga0068862_102300860 | 3300005844 | Eukaryota | 551 |
| 723 | Ga0081455_10140765 | 3300005937 | Bacteria | 1874 |
| 724 | Ga0081455_10589558 | 3300005937 | Bacteria | 727 |
| 725 | Ga0081538_10206388 | 3300005981 | Bacteria | 799 |
| 726 | Ga0081539_10000142 | 3300005985 | Bacteria | 165444 |
| 727 | Ga0081539_10000215 | 3300005985 | Bacteria | 135054 |
| 728 | Ga0081539_10003297 | 3300005985 | Bacteria | 20197 |
| 729 | Ga0081539_10059468 | 3300005985 | Bacteria | 2104 |
| 730 | Ga0081539_10260238 | 3300005985 | Bacteria | 766 |
| 731 | Ga0070717_10403199 | 3300006028 | Bacteria | 1229 |
| 732 | Ga0070717_11255778 | 3300006028 | Bacteria | 674 |
| 733 | Ga0075365_10032125 | 3300006038 | Bacteria | 3372 |
| 734 | Ga0075365_11343602 | 3300006038 | Bacteria | 502 |
| 735 | Ga0075368_10018816 | 3300006042 | Bacteria | 2601 |
| 736 | Ga0075368_10034977 | 3300006042 | Bacteria | 1959 |
| 737 | Ga0075364_10005699 | 3300006051 | Bacteria | 7263 |
| 738 | Ga0075364_10071778 | 3300006051 | Bacteria | 2281 |
| 739 | Ga0075432_10144842 | 3300006058 | Bacteria | 909 |
| 740 | Ga0075432_10323013 | 3300006058 | Bacteria | 647 |
| 741 | Ga0075432_10403306 | 3300006058 | Bacteria | 591 |
| 742 | Ga0070715_10009391 | 3300006163 | Bacteria | 3446 |
| 743 | Ga0070715_10564482 | 3300006163 | Unclassified | 662 |
| 744 | Ga0070716_100613314 | 3300006173 | Unclassified | 820 |
| 745 | Ga0070716_100741513 | 3300006173 | Bacteria | 755 |
| 746 | Ga0070712_100253943 | 3300006175 | Bacteria | 1406 |
| 747 | Ga0075362_10070036 | 3300006177 | Bacteria | 1600 |
| 748 | Ga0075367_10024774 | 3300006178 | Bacteria | 3385 |
| 749 | Ga0075367_10145935 | 3300006178 | Bacteria | 1467 |
| 750 | Ga0075367_10271666 | 3300006178 | Bacteria | 1065 |
| 751 | Ga0075366_10005878 | 3300006195 | Bacteria | 6672 |
| 752 | Ga0075366_10009758 | 3300006195 | Bacteria | 5367 |
| 753 | Ga0075366_10130555 | 3300006195 | Unclassified | 1516 |
| 754 | Ga0075366_10168442 | 3300006195 | Bacteria | 1329 |
| 755 | Ga0097621_100000865 | 3300006237 | Bacteria | 21270 |
| 756 | Ga0097621_100007424 | 3300006237 | Bacteria | 7841 |
| 757 | Ga0097621_100017573 | 3300006237 | Bacteria | 5435 |
| 758 | Ga0097621_100028797 | 3300006237 | Bacteria | 4381 |
| 759 | Ga0097621_100033597 | 3300006237 | Bacteria | 4086 |
| 760 | Ga0097621_100052497 | 3300006237 | Bacteria | 3321 |
| 761 | Ga0097621_100057308 | 3300006237 | Bacteria | 3185 |
| 762 | Ga0097621_100068357 | 3300006237 | Bacteria | 2930 |
| 763 | Ga0097621_100070983 | 3300006237 | Bacteria | 2877 |
| 764 | Ga0097621_100116424 | 3300006237 | Bacteria | 2263 |
| 765 | Ga0097621_100187025 | 3300006237 | Bacteria | 1792 |
| 766 | Ga0097621_100246149 | 3300006237 | Bacteria | 1564 |
| 767 | Ga0097621_100255643 | 3300006237 | Bacteria | 1535 |
| 768 | Ga0097621_100419571 | 3300006237 | Bacteria | 1201 |
| 769 | Ga0097621_100504670 | 3300006237 | Bacteria | 1096 |
| 770 | Ga0097621_100522573 | 3300006237 | Archaea | 1077 |
| 771 | Ga0097621_100571254 | 3300006237 | Bacteria | 1031 |
| 772 | Ga0097621_100866837 | 3300006237 | Bacteria | 839 |
| 773 | Ga0097621_101266095 | 3300006237 | Bacteria | 696 |
| 774 | Ga0075370_10008938 | 3300006353 | Bacteria | 5178 |
| 775 | Ga0075370_10490814 | 3300006353 | Bacteria | 741 |
| 776 | Ga0068871_100000059 | 3300006358 | Bacteria | 59353 |
| 777 | Ga0068871_100002585 | 3300006358 | Bacteria | 12357 |
| 778 | Ga0068871_100002961 | 3300006358 | Bacteria | 11654 |
| 779 | Ga0068871_100016611 | 3300006358 | Bacteria | 5550 |
| 780 | Ga0068871_100052496 | 3300006358 | Bacteria | 3301 |
| 781 | Ga0068871_100081776 | 3300006358 | Bacteria | 2677 |
| 782 | Ga0068871_100133827 | 3300006358 | Bacteria | 2104 |
| 783 | Ga0068871_100144872 | 3300006358 | Bacteria | 2022 |
| 784 | Ga0068871_100166908 | 3300006358 | Bacteria | 1885 |
| 785 | Ga0068871_100390354 | 3300006358 | Bacteria | 1238 |
| 786 | Ga0068871_100395821 | 3300006358 | Unclassified | 1229 |
| 787 | Ga0068871_100609372 | 3300006358 | Bacteria | 993 |
| 788 | Ga0068871_100757814 | 3300006358 | Bacteria | 893 |
| 789 | Ga0068871_100857766 | 3300006358 | Unclassified | 840 |
| 790 | Ga0068871_101221149 | 3300006358 | Bacteria | 705 |
| 791 | Ga0068871_101275118 | 3300006358 | Bacteria | 690 |
| 792 | Ga0068871_101543558 | 3300006358 | Bacteria | 628 |
| 793 | Ga0075428_100000008 | 3300006844 | Bacteria | 271300 |
| 794 | Ga0075428_100000566 | 3300006844 | Bacteria | 37713 |
| 795 | Ga0075428_100007672 | 3300006844 | Bacteria | 11961 |
| 796 | Ga0075428_100009392 | 3300006844 | Bacteria | 10849 |
| 797 | Ga0075428_100020179 | 3300006844 | Bacteria | 7381 |
| 798 | Ga0075428_100020584 | 3300006844 | Bacteria | 7305 |
| 799 | Ga0075428_100032218 | 3300006844 | Bacteria | 5789 |
| 800 | Ga0075428_100035640 | 3300006844 | Bacteria | 5484 |
| 801 | Ga0075428_100048480 | 3300006844 | Bacteria | 4662 |
| 802 | Ga0075428_100075003 | 3300006844 | Bacteria | 3695 |
| 803 | Ga0075428_100298362 | 3300006844 | Unclassified | 1733 |
| 804 | Ga0075428_100666966 | 3300006844 | Unclassified | 1109 |
| 805 | Ga0075428_101236637 | 3300006844 | Bacteria | 786 |
| 806 | Ga0075430_100002270 | 3300006846 | Bacteria | 15920 |
| 807 | Ga0075430_100005144 | 3300006846 | Bacteria | 11013 |
| 808 | Ga0075430_100008641 | 3300006846 | Bacteria | 8591 |
| 809 | Ga0075430_100013718 | 3300006846 | Bacteria | 6906 |
| 810 | Ga0075430_100031566 | 3300006846 | Bacteria | 4496 |
| 811 | Ga0075430_100073946 | 3300006846 | Bacteria | 2857 |
| 812 | Ga0075430_100200512 | 3300006846 | Bacteria | 1657 |
| 813 | Ga0075430_100204815 | 3300006846 | Bacteria | 1638 |
| 814 | Ga0075430_100231480 | 3300006846 | Bacteria | 1532 |
| 815 | Ga0075430_100232505 | 3300006846 | Bacteria | 1528 |
| 816 | Ga0075430_100298359 | 3300006846 | Bacteria | 1333 |
| 817 | Ga0075430_101119123 | 3300006846 | Unclassified | 648 |
| 818 | Ga0075430_101284695 | 3300006846 | Unclassified | 602 |
| 819 | Ga0075431_100002134 | 3300006847 | Bacteria | 18908 |
| 820 | Ga0075431_100010616 | 3300006847 | Bacteria | 9262 |
| 821 | Ga0075431_100052863 | 3300006847 | Bacteria | 4188 |
| 822 | Ga0075431_100070686 | 3300006847 | Bacteria | 3602 |
| 823 | Ga0075431_100155262 | 3300006847 | Bacteria | 2355 |
| 824 | Ga0075431_100216098 | 3300006847 | Bacteria | 1957 |
| 825 | Ga0075431_100382412 | 3300006847 | Bacteria | 1411 |
| 826 | Ga0075431_100382706 | 3300006847 | Bacteria | 1411 |
| 827 | Ga0075431_100389377 | 3300006847 | Bacteria | 1396 |
| 828 | Ga0075431_101123518 | 3300006847 | Bacteria | 750 |
| 829 | Ga0075431_101251114 | 3300006847 | Unclassified | 704 |
| 830 | Ga0075433_10000724 | 3300006852 | Bacteria | 22572 |
| 831 | Ga0075433_10010506 | 3300006852 | Bacteria | 7433 |
| 832 | Ga0075433_10018386 | 3300006852 | Bacteria | 5809 |
| 833 | Ga0075433_10037380 | 3300006852 | Bacteria | 4189 |
| 834 | Ga0075433_10047241 | 3300006852 | Bacteria | 3744 |
| 835 | Ga0075433_10062491 | 3300006852 | Bacteria | 3261 |
| 836 | Ga0075433_10195949 | 3300006852 | Bacteria | 1797 |
| 837 | Ga0075433_10207482 | 3300006852 | Bacteria | 1742 |
| 838 | Ga0075433_10302351 | 3300006852 | Bacteria | 1417 |
| 839 | Ga0075433_10362658 | 3300006852 | Bacteria | 1280 |
| 840 | Ga0075433_10425523 | 3300006852 | Bacteria | 1171 |
| 841 | Ga0075433_10535697 | 3300006852 | Bacteria | 1030 |
| 842 | Ga0075433_10650558 | 3300006852 | Bacteria | 924 |
| 843 | Ga0075433_10656242 | 3300006852 | Unclassified | 920 |
| 844 | Ga0075433_10919154 | 3300006852 | Bacteria | 763 |
| 845 | Ga0075433_11257987 | 3300006852 | Bacteria | 642 |
| 846 | Ga0075434_100000793 | 3300006871 | Bacteria | 24957 |
| 847 | Ga0075434_100002391 | 3300006871 | Bacteria | 16475 |
| 848 | Ga0075434_100002842 | 3300006871 | Bacteria | 15346 |
| 849 | Ga0075434_100019631 | 3300006871 | Bacteria | 6541 |
| 850 | Ga0075434_100044204 | 3300006871 | Bacteria | 4419 |
| 851 | Ga0075434_100048758 | 3300006871 | Unclassified | 4202 |
| 852 | Ga0075434_100057737 | 3300006871 | Bacteria | 3857 |
| 853 | Ga0075434_100069185 | 3300006871 | Bacteria | 3519 |
| 854 | Ga0075434_100075740 | 3300006871 | Bacteria | 3359 |
| 855 | Ga0075434_100214320 | 3300006871 | Bacteria | 1946 |
| 856 | Ga0075434_100404055 | 3300006871 | Bacteria | 1387 |
| 857 | Ga0075434_100472009 | 3300006871 | Bacteria | 1276 |
| 858 | Ga0075434_100501634 | 3300006871 | Bacteria | 1234 |
| 859 | Ga0075434_100683762 | 3300006871 | Bacteria | 1044 |
| 860 | Ga0075434_100905748 | 3300006871 | Unclassified | 897 |
| 861 | Ga0075434_101215138 | 3300006871 | Unclassified | 766 |
| 862 | Ga0075434_101279279 | 3300006871 | Bacteria | 744 |
| 863 | Ga0075429_100002891 | 3300006880 | Bacteria | 14555 |
| 864 | Ga0075429_100006250 | 3300006880 | Bacteria | 10311 |
| 865 | Ga0075429_100032448 | 3300006880 | Bacteria | 4539 |
| 866 | Ga0075429_100060972 | 3300006880 | Bacteria | 3285 |
| 867 | Ga0075429_100061831 | 3300006880 | Bacteria | 3263 |
| 868 | Ga0075429_100162057 | 3300006880 | Bacteria | 1959 |
| 869 | Ga0075429_100191132 | 3300006880 | Bacteria | 1794 |
| 870 | Ga0075429_100250088 | 3300006880 | Bacteria | 1552 |
| 871 | Ga0075429_100363290 | 3300006880 | Bacteria | 1267 |
| 872 | Ga0075429_100492723 | 3300006880 | Unclassified | 1074 |
| 873 | Ga0075429_100519075 | 3300006880 | Bacteria | 1044 |
| 874 | Ga0075429_100864569 | 3300006880 | Unclassified | 791 |
| 875 | Ga0075429_101226394 | 3300006880 | Bacteria | 655 |
| 876 | Ga0075429_101454530 | 3300006880 | Bacteria | 596 |
| 877 | Ga0068865_100002965 | 3300006881 | Bacteria | 10123 |
| 878 | Ga0068865_100008261 | 3300006881 | Bacteria | 6427 |
| 879 | Ga0068865_100008264 | 3300006881 | Bacteria | 6426 |
| 880 | Ga0068865_100069535 | 3300006881 | Bacteria | 2491 |
| 881 | Ga0068865_100095345 | 3300006881 | Bacteria | 2167 |
| 882 | Ga0068865_100238053 | 3300006881 | Bacteria | 1431 |
| 883 | Ga0068865_100261227 | 3300006881 | Unclassified | 1371 |
| 884 | Ga0068865_100426217 | 3300006881 | Bacteria | 1092 |
| 885 | Ga0068865_100457464 | 3300006881 | Bacteria | 1056 |
| 886 | Ga0068865_100550692 | 3300006881 | Bacteria | 969 |
| 887 | Ga0068865_100784408 | 3300006881 | Bacteria | 821 |
| 888 | Ga0068865_100940680 | 3300006881 | Bacteria | 754 |
| 889 | Ga0068865_101138237 | 3300006881 | Bacteria | 689 |
| 890 | Ga0068865_101233901 | 3300006881 | Bacteria | 663 |
| 891 | Ga0068865_101287967 | 3300006881 | Bacteria | 649 |
| 892 | Ga0068865_101556149 | 3300006881 | Bacteria | 593 |
| 893 | Ga0075436_100004571 | 3300006914 | Bacteria | 9473 |
| 894 | Ga0075436_100026299 | 3300006914 | Bacteria | 4006 |
| 895 | Ga0075436_100113306 | 3300006914 | Bacteria | 1894 |
| 896 | Ga0075436_100960028 | 3300006914 | Unclassified | 641 |
| 897 | Ga0097620_100023274 | 3300006931 | Bacteria | 6217 |
| 898 | Ga0097620_100033707 | 3300006931 | Bacteria | 5141 |
| 899 | Ga0097620_100048149 | 3300006931 | Bacteria | 4282 |
| 900 | Ga0097620_100055251 | 3300006931 | Bacteria | 3995 |
| 901 | Ga0097620_100061552 | 3300006931 | Bacteria | 3782 |
| 902 | Ga0097620_100066188 | 3300006931 | Bacteria | 3648 |
| 903 | Ga0097620_100111746 | 3300006931 | Bacteria | 2795 |
| 904 | Ga0097620_100113990 | 3300006931 | Bacteria | 2767 |
| 905 | Ga0097620_100140172 | 3300006931 | Bacteria | 2492 |
| 906 | Ga0097620_100187872 | 3300006931 | Bacteria | 2150 |
| 907 | Ga0097620_100235869 | 3300006931 | Bacteria | 1918 |
| 908 | Ga0097620_100256622 | 3300006931 | Bacteria | 1839 |
| 909 | Ga0097620_100521712 | 3300006931 | Bacteria | 1283 |
| 910 | Ga0097620_100880742 | 3300006931 | Unclassified | 981 |
| 911 | Ga0097620_101321761 | 3300006931 | Bacteria | 795 |
| 912 | Ga0097620_101337752 | 3300006931 | Unclassified | 790 |
| 913 | Ga0097620_101920535 | 3300006931 | Unclassified | 654 |
| 914 | Ga0097620_102254837 | 3300006931 | Unclassified | 601 |
| 915 | Ga0075435_100010153 | 3300007076 | Bacteria | 6875 |
| 916 | Ga0075435_100015456 | 3300007076 | Bacteria | 5738 |
| 917 | Ga0075435_100031693 | 3300007076 | Bacteria | 4168 |
| 918 | Ga0075435_100035634 | 3300007076 | Unclassified | 3949 |
| 919 | Ga0075435_100049414 | 3300007076 | Bacteria | 3383 |
| 920 | Ga0075435_100054740 | 3300007076 | Bacteria | 3221 |
| 921 | Ga0075435_100073632 | 3300007076 | Bacteria | 2793 |
| 922 | Ga0075435_100086353 | 3300007076 | Bacteria | 2583 |
| 923 | Ga0075435_100174587 | 3300007076 | Bacteria | 1814 |
| 924 | Ga0075435_100283680 | 3300007076 | Bacteria | 1414 |
| 925 | Ga0075435_100405717 | 3300007076 | Unclassified | 1172 |
| 926 | Ga0075435_100893542 | 3300007076 | Bacteria | 775 |
| 927 | Ga0075435_101891585 | 3300007076 | Bacteria | 524 |
| 928 | Ga0099794_10434603 | 3300007265 | Bacteria | 687 |
| 929 | Ga0099795_10190345 | 3300007788 | Unclassified | 861 |
| 930 | Ga0105251_10129608 | 3300009011 | Unclassified | 1143 |
| 931 | Ga0105250_10346198 | 3300009092 | Bacteria | 650 |
| 932 | Ga0105250_10523649 | 3300009092 | Bacteria | 541 |
| 933 | Ga0105240_10288130 | 3300009093 | Bacteria | 1884 |
| 934 | Ga0105240_12214746 | 3300009093 | Bacteria | 570 |
| 935 | Ga0111539_10000015 | 3300009094 | Bacteria | 296576 |
| 936 | Ga0111539_10000614 | 3300009094 | Bacteria | 46152 |
| 937 | Ga0111539_10001499 | 3300009094 | Bacteria | 31175 |
| 938 | Ga0111539_10008113 | 3300009094 | Bacteria | 13378 |
| 939 | Ga0111539_10026203 | 3300009094 | Bacteria | 7133 |
| 940 | Ga0111539_10032217 | 3300009094 | Bacteria | 6367 |
| 941 | Ga0111539_10046019 | 3300009094 | Bacteria | 5222 |
| 942 | Ga0111539_10055675 | 3300009094 | Bacteria | 4702 |
| 943 | Ga0111539_10060965 | 3300009094 | Bacteria | 4470 |
| 944 | Ga0111539_10258932 | 3300009094 | Bacteria | 2025 |
| 945 | Ga0111539_10281546 | 3300009094 | Bacteria | 1935 |
| 946 | Ga0111539_10294241 | 3300009094 | Bacteria | 1889 |
| 947 | Ga0111539_10682624 | 3300009094 | Bacteria | 1196 |
| 948 | Ga0111539_10742142 | 3300009094 | Bacteria | 1143 |
| 949 | Ga0111539_10779300 | 3300009094 | Bacteria | 1113 |
| 950 | Ga0111539_10883858 | 3300009094 | Bacteria | 1039 |
| 951 | Ga0111539_10990243 | 3300009094 | Bacteria | 977 |
| 952 | Ga0111539_10999903 | 3300009094 | Bacteria | 972 |
| 953 | Ga0111539_11095186 | 3300009094 | Unclassified | 926 |
| 954 | Ga0111539_11114285 | 3300009094 | Bacteria | 917 |
| 955 | Ga0111539_11348489 | 3300009094 | Bacteria | 828 |
| 956 | Ga0111539_11388806 | 3300009094 | Bacteria | 815 |
| 957 | Ga0111539_11648623 | 3300009094 | Bacteria | 744 |
| 958 | Ga0111539_11744952 | 3300009094 | Bacteria | 722 |
| 959 | Ga0111539_12481063 | 3300009094 | Bacteria | 601 |
| 960 | Ga0111539_12737730 | 3300009094 | Bacteria | 571 |
| 961 | Ga0111539_12847257 | 3300009094 | Bacteria | 560 |
| 962 | Ga0105245_10055993 | 3300009098 | Bacteria | 3543 |
| 963 | Ga0105245_10065038 | 3300009098 | Bacteria | 3297 |
| 964 | Ga0105245_10083644 | 3300009098 | Unclassified | 2922 |
| 965 | Ga0105245_10148512 | 3300009098 | Bacteria | 2214 |
| 966 | Ga0105245_11402745 | 3300009098 | Bacteria | 749 |
| 967 | Ga0105245_12335310 | 3300009098 | Unclassified | 588 |
| 968 | Ga0105245_12421108 | 3300009098 | Bacteria | 578 |
| 969 | Ga0105245_13265724 | 3300009098 | Unclassified | 502 |
| 970 | Ga0105247_10001718 | 3300009101 | Bacteria | 15435 |
| 971 | Ga0105247_10023026 | 3300009101 | Bacteria | 3751 |
| 972 | Ga0105247_10085979 | 3300009101 | Bacteria | 1989 |
| 973 | Ga0105247_10160572 | 3300009101 | Bacteria | 1488 |
| 974 | Ga0105247_10837386 | 3300009101 | Bacteria | 705 |
| 975 | Ga0114129_10005721 | 3300009147 | Bacteria | 17612 |
| 976 | Ga0114129_10019565 | 3300009147 | Bacteria | 9638 |
| 977 | Ga0114129_10031894 | 3300009147 | Bacteria | 7449 |
| 978 | Ga0114129_10035574 | 3300009147 | Bacteria | 7036 |
| 979 | Ga0114129_10040259 | 3300009147 | Bacteria | 6588 |
| 980 | Ga0114129_10051572 | 3300009147 | Bacteria | 5775 |
| 981 | Ga0114129_10087222 | 3300009147 | Bacteria | 4328 |
| 982 | Ga0114129_10102117 | 3300009147 | Bacteria | 3966 |
| 983 | Ga0114129_10130531 | 3300009147 | Bacteria | 3451 |
| 984 | Ga0114129_10147174 | 3300009147 | Bacteria | 3226 |
| 985 | Ga0114129_10191711 | 3300009147 | Bacteria | 2775 |
| 986 | Ga0114129_10216144 | 3300009147 | Bacteria | 2589 |
| 987 | Ga0114129_10217395 | 3300009147 | Bacteria | 2580 |
| 988 | Ga0114129_10250077 | 3300009147 | Bacteria | 2380 |
| 989 | Ga0114129_10290917 | 3300009147 | Bacteria | 2180 |
| 990 | Ga0114129_10671763 | 3300009147 | Bacteria | 1335 |
| 991 | Ga0114129_10913818 | 3300009147 | Archaea | 1111 |
| 992 | Ga0114129_11418320 | 3300009147 | Bacteria | 856 |
| 993 | Ga0114129_11504330 | 3300009147 | Bacteria | 827 |
| 994 | Ga0114129_11669653 | 3300009147 | Unclassified | 778 |
| 995 | Ga0114129_11873210 | 3300009147 | Bacteria | 728 |
| 996 | Ga0114129_12147865 | 3300009147 | Bacteria | 673 |
| 997 | Ga0114129_12304585 | 3300009147 | Bacteria | 646 |
| 998 | Ga0114129_13390892 | 3300009147 | Unclassified | 513 |
| 999 | Ga0105243_10049256 | 3300009148 | Bacteria | 3323 |
| 1000 | Ga0105243_10065794 | 3300009148 | Bacteria | 2913 |
| 1001 | Ga0105243_10068538 | 3300009148 | Bacteria | 2859 |
| 1002 | Ga0105243_10070835 | 3300009148 | Bacteria | 2817 |
| 1003 | Ga0105243_10436594 | 3300009148 | Bacteria | 1225 |
| 1004 | Ga0105243_10688698 | 3300009148 | Bacteria | 995 |
| 1005 | Ga0105243_10905728 | 3300009148 | Bacteria | 878 |
| 1006 | Ga0105243_10906855 | 3300009148 | Bacteria | 877 |
| 1007 | Ga0105243_11930934 | 3300009148 | Unclassified | 624 |
| 1008 | Ga0105243_11975873 | 3300009148 | Bacteria | 617 |
| 1009 | Ga0105243_12085271 | 3300009148 | Eukaryota | 602 |
| 1010 | Ga0105243_12484706 | 3300009148 | Bacteria | 557 |
| 1011 | Ga0105241_10113334 | 3300009174 | Bacteria | 2174 |
| 1012 | Ga0105241_10968288 | 3300009174 | Bacteria | 794 |
| 1013 | Ga0105241_10974497 | 3300009174 | Bacteria | 792 |
| 1014 | Ga0105242_10012357 | 3300009176 | Bacteria | 6572 |
| 1015 | Ga0105242_10016561 | 3300009176 | Bacteria | 5732 |
| 1016 | Ga0105242_10017161 | 3300009176 | Bacteria | 5637 |
| 1017 | Ga0105242_10017753 | 3300009176 | Bacteria | 5551 |
| 1018 | Ga0105242_10018186 | 3300009176 | Bacteria | 5492 |
| 1019 | Ga0105242_10076151 | 3300009176 | Bacteria | 2796 |
| 1020 | Ga0105242_10098074 | 3300009176 | Bacteria | 2478 |
| 1021 | Ga0105242_10276600 | 3300009176 | Bacteria | 1523 |
| 1022 | Ga0105242_10365403 | 3300009176 | Bacteria | 1337 |
| 1023 | Ga0105242_10576818 | 3300009176 | Bacteria | 1083 |
| 1024 | Ga0105242_10748397 | 3300009176 | Bacteria | 962 |
| 1025 | Ga0105242_10760264 | 3300009176 | Bacteria | 955 |
| 1026 | Ga0105242_10952459 | 3300009176 | Bacteria | 863 |
| 1027 | Ga0105242_11322920 | 3300009176 | Unclassified | 745 |
| 1028 | Ga0105242_11733222 | 3300009176 | Unclassified | 662 |
| 1029 | Ga0105242_12805022 | 3300009176 | Unclassified | 538 |
| 1030 | Ga0105242_13075752 | 3300009176 | Bacteria | 517 |
| 1031 | Ga0105248_10001370 | 3300009177 | Bacteria | 27206 |
| 1032 | Ga0105248_10031364 | 3300009177 | Bacteria | 5941 |
| 1033 | Ga0105248_10050366 | 3300009177 | Bacteria | 4670 |
| 1034 | Ga0105248_10100829 | 3300009177 | Bacteria | 3254 |
| 1035 | Ga0105248_10111207 | 3300009177 | Bacteria | 3089 |
| 1036 | Ga0105248_10115869 | 3300009177 | Bacteria | 3022 |
| 1037 | Ga0105248_10133137 | 3300009177 | Bacteria | 2805 |
| 1038 | Ga0105248_10236464 | 3300009177 | Unclassified | 2056 |
| 1039 | Ga0105248_10509054 | 3300009177 | Bacteria | 1357 |
| 1040 | Ga0105248_10587885 | 3300009177 | Bacteria | 1256 |
| 1041 | Ga0105248_10615351 | 3300009177 | Bacteria | 1225 |
| 1042 | Ga0105248_10689302 | 3300009177 | Unclassified | 1153 |
| 1043 | Ga0105248_10762898 | 3300009177 | Archaea | 1092 |
| 1044 | Ga0105248_10765905 | 3300009177 | Bacteria | 1089 |
| 1045 | Ga0105248_10777537 | 3300009177 | Bacteria | 1080 |
| 1046 | Ga0105248_10852570 | 3300009177 | Bacteria | 1028 |
| 1047 | Ga0105248_10906759 | 3300009177 | Bacteria | 995 |
| 1048 | Ga0105248_11245928 | 3300009177 | Unclassified | 841 |
| 1049 | Ga0105248_11425742 | 3300009177 | Bacteria | 784 |
| 1050 | Ga0105248_11917719 | 3300009177 | Bacteria | 672 |
| 1051 | Ga0105248_12782256 | 3300009177 | Bacteria | 558 |
| 1052 | Ga0105248_13416828 | 3300009177 | Bacteria | 504 |
| 1053 | Ga0105248_13438476 | 3300009177 | Unclassified | 503 |
| 1054 | Ga0105237_11385511 | 3300009545 | Unclassified | 709 |
| 1055 | Ga0105238_10005196 | 3300009551 | Bacteria | 12866 |
| 1056 | Ga0105238_10238192 | 3300009551 | Bacteria | 1797 |
| 1057 | Ga0105238_10494359 | 3300009551 | Bacteria | 1223 |
| 1058 | Ga0105238_12564432 | 3300009551 | Bacteria | 546 |
| 1059 | Ga0105249_10000649 | 3300009553 | Bacteria | 31693 |
| 1060 | Ga0105249_10009366 | 3300009553 | Bacteria | 8568 |
| 1061 | Ga0105249_10029742 | 3300009553 | Bacteria | 4935 |
| 1062 | Ga0105249_10284787 | 3300009553 | Bacteria | 1652 |
| 1063 | Ga0105249_10449552 | 3300009553 | Bacteria | 1327 |
| 1064 | Ga0105249_10508561 | 3300009553 | Bacteria | 1251 |
| 1065 | Ga0105249_10697434 | 3300009553 | Unclassified | 1075 |
| 1066 | Ga0105249_10723204 | 3300009553 | Bacteria | 1057 |
| 1067 | Ga0105249_11014393 | 3300009553 | Bacteria | 899 |
| 1068 | Ga0105249_11267996 | 3300009553 | Bacteria | 808 |
| 1069 | Ga0105249_11628161 | 3300009553 | Bacteria | 718 |
| 1070 | Ga0099796_10574844 | 3300010159 | Unclassified | 507 |
| 1071 | Ga0105239_10032758 | 3300010375 | Bacteria | 5711 |
| 1072 | Ga0105239_10928638 | 3300010375 | Bacteria | 999 |
| 1073 | Ga0105239_11221616 | 3300010375 | Bacteria | 866 |
| 1074 | Ga0105239_13188317 | 3300010375 | Bacteria | 534 |
| 1075 | Ga0105239_13456811 | 3300010375 | Bacteria | 513 |
| 1076 | Ga0105246_10192154 | 3300011119 | Bacteria | 1581 |
| 1077 | Ga0105246_11120484 | 3300011119 | Unclassified | 720 |
| 1078 | Ga0105246_11219835 | 3300011119 | Bacteria | 693 |
| 1079 | Ga0105246_11297646 | 3300011119 | Unclassified | 674 |
| 1080 | Ga0157328_1022269 | 3300012478 | Unclassified | 544 |
| 1081 | Ga0157328_1023021 | 3300012478 | Unclassified | 540 |
| 1082 | Ga0157325_1038831 | 3300012485 | Bacteria | 510 |
| 1083 | Ga0157323_1034993 | 3300012495 | Bacteria | 551 |
| 1084 | Ga0157339_1072190 | 3300012505 | Unclassified | 500 |
| 1085 | Ga0157373_10959965 | 3300013100 | Unclassified | 636 |
| 1086 | Ga0157371_10188614 | 3300013102 | Unclassified | 1476 |
| 1087 | Ga0157371_10482124 | 3300013102 | Unclassified | 914 |
| 1088 | Ga0157371_10890394 | 3300013102 | Bacteria | 674 |
| 1089 | Ga0157370_10620678 | 3300013104 | Unclassified | 989 |
| 1090 | Ga0157370_11235337 | 3300013104 | Bacteria | 674 |
| 1091 | Ga0157369_12220078 | 3300013105 | Bacteria | 556 |
| 1092 | Ga0157369_12522979 | 3300013105 | Bacteria | 520 |
| 1093 | Ga0157374_10197987 | 3300013296 | Bacteria | 1967 |
| 1094 | Ga0157374_10209676 | 3300013296 | Bacteria | 1910 |
| 1095 | Ga0157374_10681886 | 3300013296 | Bacteria | 1040 |
| 1096 | Ga0157374_10819470 | 3300013296 | Unclassified | 947 |
| 1097 | Ga0157374_10908549 | 3300013296 | Bacteria | 898 |
| 1098 | Ga0157378_10001288 | 3300013297 | Bacteria | 22567 |
| 1099 | Ga0157378_10013431 | 3300013297 | Bacteria | 7159 |
| 1100 | Ga0157378_10022222 | 3300013297 | Bacteria | 5583 |
| 1101 | Ga0157378_10190523 | 3300013297 | Bacteria | 1934 |
| 1102 | Ga0157378_10290680 | 3300013297 | Bacteria | 1579 |
| 1103 | Ga0157378_10340369 | 3300013297 | Unclassified | 1463 |
| 1104 | Ga0157378_10691402 | 3300013297 | Bacteria | 1039 |
| 1105 | Ga0157378_10788647 | 3300013297 | Bacteria | 975 |
| 1106 | Ga0157378_10969956 | 3300013297 | Bacteria | 883 |
| 1107 | Ga0157378_11056683 | 3300013297 | Bacteria | 848 |
| 1108 | Ga0157378_11374119 | 3300013297 | Bacteria | 749 |
| 1109 | Ga0157378_11404491 | 3300013297 | Bacteria | 741 |
| 1110 | Ga0157378_11898156 | 3300013297 | Bacteria | 645 |
| 1111 | Ga0157378_12523049 | 3300013297 | Bacteria | 566 |
| 1112 | Ga0163162_10020439 | 3300013306 | Bacteria | 6507 |
| 1113 | Ga0163162_10106674 | 3300013306 | Bacteria | 2896 |
| 1114 | Ga0163162_10276266 | 3300013306 | Unclassified | 1812 |
| 1115 | Ga0163162_10333100 | 3300013306 | Bacteria | 1650 |
| 1116 | Ga0163162_10372383 | 3300013306 | Bacteria | 1561 |
| 1117 | Ga0163162_11285172 | 3300013306 | Unclassified | 831 |
| 1118 | Ga0163162_11535983 | 3300013306 | Unclassified | 759 |
| 1119 | Ga0163162_11690372 | 3300013306 | Bacteria | 723 |
| 1120 | Ga0163162_12065647 | 3300013306 | Bacteria | 653 |
| 1121 | Ga0163162_12107423 | 3300013306 | Unclassified | 647 |
| 1122 | Ga0163162_12698906 | 3300013306 | Unclassified | 572 |
| 1123 | Ga0157372_10131584 | 3300013307 | Bacteria | 2879 |
| 1124 | Ga0157372_12564209 | 3300013307 | Bacteria | 585 |
| 1125 | Ga0157375_10022924 | 3300013308 | Bacteria | 5753 |
| 1126 | Ga0157375_10024718 | 3300013308 | Bacteria | 5565 |
| 1127 | Ga0157375_10169053 | 3300013308 | Bacteria | 2333 |
| 1128 | Ga0157375_10232019 | 3300013308 | Bacteria | 2004 |
| 1129 | Ga0157375_10241579 | 3300013308 | Bacteria | 1966 |
| 1130 | Ga0157375_10251020 | 3300013308 | Bacteria | 1930 |
| 1131 | Ga0157375_10637308 | 3300013308 | Bacteria | 1223 |
| 1132 | Ga0157375_10786672 | 3300013308 | Bacteria | 1101 |
| 1133 | Ga0157375_10888477 | 3300013308 | Bacteria | 1036 |
| 1134 | Ga0157375_10904311 | 3300013308 | Bacteria | 1026 |
| 1135 | Ga0157375_11121992 | 3300013308 | Unclassified | 921 |
| 1136 | Ga0157375_11131371 | 3300013308 | Bacteria | 917 |
| 1137 | Ga0157375_11370078 | 3300013308 | Bacteria | 833 |
| 1138 | Ga0157375_11454239 | 3300013308 | Unclassified | 808 |
| 1139 | Ga0157375_11860980 | 3300013308 | Bacteria | 714 |
| 1140 | Ga0157375_12372732 | 3300013308 | Bacteria | 633 |
| 1141 | Ga0157375_13014863 | 3300013308 | Bacteria | 562 |
| 1142 | Ga0163163_10000717 | 3300014325 | Bacteria | 28089 |
| 1143 | Ga0163163_10009403 | 3300014325 | Bacteria | 8727 |
| 1144 | Ga0163163_10074861 | 3300014325 | Bacteria | 3379 |
| 1145 | Ga0163163_10250007 | 3300014325 | Bacteria | 1823 |
| 1146 | Ga0163163_10553369 | 3300014325 | Bacteria | 1213 |
| 1147 | Ga0163163_10704694 | 3300014325 | Bacteria | 1073 |
| 1148 | Ga0163163_10778547 | 3300014325 | Bacteria | 1020 |
| 1149 | Ga0163163_11256238 | 3300014325 | Bacteria | 803 |
| 1150 | Ga0157380_10006726 | 3300014326 | Bacteria | 8123 |
| 1151 | Ga0157380_10007218 | 3300014326 | Bacteria | 7876 |
| 1152 | Ga0157380_10023279 | 3300014326 | Bacteria | 4671 |
| 1153 | Ga0157380_10046654 | 3300014326 | Bacteria | 3404 |
| 1154 | Ga0157380_10085336 | 3300014326 | Bacteria | 2591 |
| 1155 | Ga0157380_10279374 | 3300014326 | Bacteria | 1527 |
| 1156 | Ga0157380_10301850 | 3300014326 | Bacteria | 1475 |
| 1157 | Ga0157380_10328315 | 3300014326 | Bacteria | 1421 |
| 1158 | Ga0157380_10470602 | 3300014326 | Bacteria | 1212 |
| 1159 | Ga0157380_10611936 | 3300014326 | Bacteria | 1080 |
| 1160 | Ga0157380_10779636 | 3300014326 | Bacteria | 971 |
| 1161 | Ga0157380_10979954 | 3300014326 | Bacteria | 877 |
| 1162 | Ga0157380_11813429 | 3300014326 | Bacteria | 669 |
| 1163 | Ga0157380_12258795 | 3300014326 | Unclassified | 608 |
| 1164 | Ga0157380_12264878 | 3300014326 | Bacteria | 608 |
| 1165 | Ga0157380_12919959 | 3300014326 | Bacteria | 544 |
| 1166 | Ga0182008_10814496 | 3300014497 | Unclassified | 543 |
| 1167 | Ga0157377_10025400 | 3300014745 | Bacteria | 3160 |
| 1168 | Ga0157377_10166001 | 3300014745 | Unclassified | 1377 |
| 1169 | Ga0157377_10301950 | 3300014745 | Bacteria | 1057 |
| 1170 | Ga0157377_10339280 | 3300014745 | Bacteria | 1004 |
| 1171 | Ga0157377_10399472 | 3300014745 | Bacteria | 936 |
| 1172 | Ga0157377_10669131 | 3300014745 | Bacteria | 750 |
| 1173 | Ga0157377_11029621 | 3300014745 | Bacteria | 626 |
| 1174 | Ga0157379_10003113 | 3300014968 | Bacteria | 14032 |
| 1175 | Ga0157379_10054418 | 3300014968 | Bacteria | 3575 |
| 1176 | Ga0157379_10059336 | 3300014968 | Bacteria | 3421 |
| 1177 | Ga0157379_10087318 | 3300014968 | Unclassified | 2797 |
| 1178 | Ga0157379_10323502 | 3300014968 | Bacteria | 1408 |
| 1179 | Ga0157379_10382130 | 3300014968 | Bacteria | 1292 |
| 1180 | Ga0157379_10957081 | 3300014968 | Unclassified | 814 |
| 1181 | Ga0157376_10016289 | 3300014969 | Bacteria | 5639 |
| 1182 | Ga0157376_10030353 | 3300014969 | Bacteria | 4316 |
| 1183 | Ga0157376_10040405 | 3300014969 | Bacteria | 3812 |
| 1184 | Ga0157376_10049730 | 3300014969 | Bacteria | 3474 |
| 1185 | Ga0157376_10060290 | 3300014969 | Bacteria | 3186 |
| 1186 | Ga0157376_10076563 | 3300014969 | Bacteria | 2859 |
| 1187 | Ga0157376_10088434 | 3300014969 | Bacteria | 2676 |
| 1188 | Ga0157376_10216296 | 3300014969 | Bacteria | 1772 |
| 1189 | Ga0157376_10277547 | 3300014969 | Bacteria | 1577 |
| 1190 | Ga0157376_10540816 | 3300014969 | Bacteria | 1151 |
| 1191 | Ga0157376_10568706 | 3300014969 | Bacteria | 1124 |
| 1192 | Ga0157376_10616443 | 3300014969 | Bacteria | 1082 |
| 1193 | Ga0157376_10667238 | 3300014969 | Bacteria | 1042 |
| 1194 | Ga0157376_10734995 | 3300014969 | Bacteria | 995 |
| 1195 | Ga0157376_10832661 | 3300014969 | Bacteria | 937 |
| 1196 | Ga0157376_10885766 | 3300014969 | Unclassified | 910 |
| 1197 | Ga0157376_12023276 | 3300014969 | Unclassified | 614 |
| 1198 | Ga0182007_10401862 | 3300015262 | Bacteria | 522 |
| 1199 | Ga0163161_10091292 | 3300017792 | Bacteria | 2254 |
| 1200 | Ga0163161_10185396 | 3300017792 | Bacteria | 1597 |
| 1201 | Ga0163161_10451381 | 3300017792 | Bacteria | 1039 |
| 1202 | Ga0163161_10576695 | 3300017792 | Bacteria | 925 |
| 1203 | Ga0163161_11963672 | 3300017792 | Unclassified | 521 |
| 1204 | Ga0213876_10032805 | 3300021384 | Bacteria | 2738 |
| 1205 | Ga0213876_10244367 | 3300021384 | Bacteria | 954 |
| 1206 | Ga0213876_10333909 | 3300021384 | Bacteria | 806 |
| 1207 | Ga0207666_1051100 | 3300025271 | Bacteria | 655 |
| 1208 | Ga0207697_10003624 | 3300025315 | Bacteria | 7575 |
| 1209 | Ga0207697_10015956 | 3300025315 | Bacteria | 3098 |
| 1210 | Ga0207697_10103317 | 3300025315 | Unclassified | 1216 |
| 1211 | Ga0207697_10141949 | 3300025315 | Bacteria | 1042 |
| 1212 | Ga0207697_10150675 | 3300025315 | Bacteria | 1012 |
| 1213 | Ga0207697_10159818 | 3300025315 | Bacteria | 983 |
| 1214 | Ga0207697_10468761 | 3300025315 | Bacteria | 558 |
| 1215 | Ga0207697_10503975 | 3300025315 | Bacteria | 534 |
| 1216 | Ga0207713_1246112 | 3300025735 | Bacteria | 529 |
| 1217 | Ga0207653_10012866 | 3300025885 | Bacteria | 2616 |
| 1218 | Ga0207653_10149889 | 3300025885 | Bacteria | 858 |
| 1219 | Ga0207653_10277309 | 3300025885 | Bacteria | 647 |
| 1220 | Ga0207653_10416724 | 3300025885 | Bacteria | 527 |
| 1221 | Ga0207682_10003849 | 3300025893 | Bacteria | 6441 |
| 1222 | Ga0207682_10005690 | 3300025893 | Bacteria | 5057 |
| 1223 | Ga0207682_10075178 | 3300025893 | Bacteria | 1438 |
| 1224 | Ga0207682_10118542 | 3300025893 | Bacteria | 1172 |
| 1225 | Ga0207682_10307391 | 3300025893 | Bacteria | 744 |
| 1226 | Ga0207642_10073914 | 3300025899 | Bacteria | 1632 |
| 1227 | Ga0207642_10138506 | 3300025899 | Bacteria | 1280 |
| 1228 | Ga0207642_10145099 | 3300025899 | Bacteria | 1256 |
| 1229 | Ga0207642_10237490 | 3300025899 | Bacteria | 1027 |
| 1230 | Ga0207642_10255923 | 3300025899 | Unclassified | 996 |
| 1231 | Ga0207642_10430994 | 3300025899 | Bacteria | 795 |
| 1232 | Ga0207642_10498589 | 3300025899 | Bacteria | 745 |
| 1233 | Ga0207642_10914506 | 3300025899 | Bacteria | 562 |
| 1234 | Ga0207710_10003072 | 3300025900 | Bacteria | 7494 |
| 1235 | Ga0207710_10095348 | 3300025900 | Bacteria | 1398 |
| 1236 | Ga0207710_10129893 | 3300025900 | Bacteria | 1209 |
| 1237 | Ga0207688_10000138 | 3300025901 | Bacteria | 30845 |
| 1238 | Ga0207688_10022145 | 3300025901 | Unclassified | 3476 |
| 1239 | Ga0207688_10085188 | 3300025901 | Bacteria | 1810 |
| 1240 | Ga0207688_10088352 | 3300025901 | Bacteria | 1777 |
| 1241 | Ga0207688_10470832 | 3300025901 | Bacteria | 785 |
| 1242 | Ga0207688_10977919 | 3300025901 | Bacteria | 535 |
| 1243 | Ga0207680_10030593 | 3300025903 | Bacteria | 3038 |
| 1244 | Ga0207680_10035103 | 3300025903 | Bacteria | 2875 |
| 1245 | Ga0207680_10062044 | 3300025903 | Bacteria | 2282 |
| 1246 | Ga0207680_10094028 | 3300025903 | Bacteria | 1913 |
| 1247 | Ga0207680_10099123 | 3300025903 | Bacteria | 1869 |
| 1248 | Ga0207680_10106106 | 3300025903 | Bacteria | 1813 |
| 1249 | Ga0207680_10816205 | 3300025903 | Bacteria | 669 |
| 1250 | Ga0207680_10997002 | 3300025903 | Bacteria | 600 |
| 1251 | Ga0207647_10033238 | 3300025904 | Unclassified | 3304 |
| 1252 | Ga0207647_10347698 | 3300025904 | Bacteria | 840 |
| 1253 | Ga0207647_10700986 | 3300025904 | Bacteria | 552 |
| 1254 | Ga0207685_10153284 | 3300025905 | Bacteria | 1045 |
| 1255 | Ga0207685_10288607 | 3300025905 | Bacteria | 808 |
| 1256 | Ga0207685_10293698 | 3300025905 | Unclassified | 802 |
| 1257 | Ga0207685_10320980 | 3300025905 | Bacteria | 772 |
| 1258 | Ga0207685_10605475 | 3300025905 | Unclassified | 588 |
| 1259 | Ga0207699_10089374 | 3300025906 | Bacteria | 1930 |
| 1260 | Ga0207699_10146666 | 3300025906 | Bacteria | 1557 |
| 1261 | Ga0207699_10590096 | 3300025906 | Bacteria | 808 |
| 1262 | Ga0207699_10639111 | 3300025906 | Bacteria | 777 |
| 1263 | Ga0207645_10003300 | 3300025907 | Bacteria | 12310 |
| 1264 | Ga0207645_10007441 | 3300025907 | Bacteria | 7733 |
| 1265 | Ga0207645_10056725 | 3300025907 | Bacteria | 2500 |
| 1266 | Ga0207645_10076430 | 3300025907 | Bacteria | 2145 |
| 1267 | Ga0207645_10081928 | 3300025907 | Bacteria | 2068 |
| 1268 | Ga0207645_10100278 | 3300025907 | Bacteria | 1868 |
| 1269 | Ga0207645_10205645 | 3300025907 | Bacteria | 1296 |
| 1270 | Ga0207645_10222233 | 3300025907 | Bacteria | 1245 |
| 1271 | Ga0207645_10269401 | 3300025907 | Bacteria | 1129 |
| 1272 | Ga0207645_10414452 | 3300025907 | Bacteria | 907 |
| 1273 | Ga0207645_11171025 | 3300025907 | Bacteria | 517 |
| 1274 | Ga0207643_10001065 | 3300025908 | Bacteria | 16221 |
| 1275 | Ga0207643_10013253 | 3300025908 | Bacteria | 4463 |
| 1276 | Ga0207643_10018749 | 3300025908 | Bacteria | 3790 |
| 1277 | Ga0207643_10019547 | 3300025908 | Unclassified | 3713 |
| 1278 | Ga0207643_10049257 | 3300025908 | Bacteria | 2387 |
| 1279 | Ga0207643_10076123 | 3300025908 | Bacteria | 1938 |
| 1280 | Ga0207643_10281452 | 3300025908 | Bacteria | 1031 |
| 1281 | Ga0207643_10546201 | 3300025908 | Unclassified | 743 |
| 1282 | Ga0207643_10687684 | 3300025908 | Bacteria | 661 |
| 1283 | Ga0207643_11045347 | 3300025908 | Bacteria | 528 |
| 1284 | Ga0207684_10103122 | 3300025910 | Bacteria | 2439 |
| 1285 | Ga0207684_10323689 | 3300025910 | Bacteria | 1329 |
| 1286 | Ga0207684_10333968 | 3300025910 | Bacteria | 1306 |
| 1287 | Ga0207684_10383542 | 3300025910 | Bacteria | 1209 |
| 1288 | Ga0207684_10945882 | 3300025910 | Bacteria | 723 |
| 1289 | Ga0207684_11524171 | 3300025910 | Bacteria | 543 |
| 1290 | Ga0207654_10665156 | 3300025911 | Bacteria | 747 |
| 1291 | Ga0207707_10209114 | 3300025912 | Unclassified | 1700 |
| 1292 | Ga0207707_10333195 | 3300025912 | Bacteria | 1309 |
| 1293 | Ga0207707_10333301 | 3300025912 | Unclassified | 1309 |
| 1294 | Ga0207707_10336137 | 3300025912 | Unclassified | 1303 |
| 1295 | Ga0207707_10829370 | 3300025912 | Bacteria | 769 |
| 1296 | Ga0207707_11539035 | 3300025912 | Bacteria | 526 |
| 1297 | Ga0207695_10163026 | 3300025913 | Unclassified | 2159 |
| 1298 | Ga0207671_10756877 | 3300025914 | Unclassified | 771 |
| 1299 | Ga0207693_11245594 | 3300025915 | Bacteria | 559 |
| 1300 | Ga0207663_10134805 | 3300025916 | Bacteria | 1712 |
| 1301 | Ga0207663_10644152 | 3300025916 | Bacteria | 836 |
| 1302 | Ga0207663_11644426 | 3300025916 | Unclassified | 517 |
| 1303 | Ga0207660_10385855 | 3300025917 | Bacteria | 1126 |
| 1304 | Ga0207660_10548516 | 3300025917 | Bacteria | 940 |
| 1305 | Ga0207662_10005102 | 3300025918 | Bacteria | 6966 |
| 1306 | Ga0207662_10007755 | 3300025918 | Bacteria | 5848 |
| 1307 | Ga0207662_10038839 | 3300025918 | Unclassified | 2790 |
| 1308 | Ga0207662_10099683 | 3300025918 | Unclassified | 1799 |
| 1309 | Ga0207662_10159667 | 3300025918 | Bacteria | 1439 |
| 1310 | Ga0207662_10275010 | 3300025918 | Unclassified | 1112 |
| 1311 | Ga0207662_10381153 | 3300025918 | Unclassified | 953 |
| 1312 | Ga0207662_10419290 | 3300025918 | Bacteria | 911 |
| 1313 | Ga0207657_10385960 | 3300025919 | Bacteria | 1102 |
| 1314 | Ga0207649_10095844 | 3300025920 | Bacteria | 1953 |
| 1315 | Ga0207649_10097718 | 3300025920 | Bacteria | 1937 |
| 1316 | Ga0207649_10123245 | 3300025920 | Bacteria | 1750 |
| 1317 | Ga0207649_10174316 | 3300025920 | Bacteria | 1501 |
| 1318 | Ga0207649_10192368 | 3300025920 | Bacteria | 1436 |
| 1319 | Ga0207649_10269776 | 3300025920 | Bacteria | 1233 |
| 1320 | Ga0207649_10713769 | 3300025920 | Unclassified | 778 |
| 1321 | Ga0207649_11304461 | 3300025920 | Unclassified | 574 |
| 1322 | Ga0207649_11404144 | 3300025920 | Unclassified | 552 |
| 1323 | Ga0207652_10296057 | 3300025921 | Unclassified | 1460 |
| 1324 | Ga0207652_10760477 | 3300025921 | Bacteria | 862 |
| 1325 | Ga0207652_11205393 | 3300025921 | Unclassified | 659 |
| 1326 | Ga0207646_10033194 | 3300025922 | Bacteria | 4670 |
| 1327 | Ga0207646_10065518 | 3300025922 | Bacteria | 3244 |
| 1328 | Ga0207646_10099463 | 3300025922 | Bacteria | 2606 |
| 1329 | Ga0207646_10246298 | 3300025922 | Unclassified | 1614 |
| 1330 | Ga0207646_10443266 | 3300025922 | Bacteria | 1172 |
| 1331 | Ga0207646_10537205 | 3300025922 | Bacteria | 1052 |
| 1332 | Ga0207646_10583901 | 3300025922 | Bacteria | 1004 |
| 1333 | Ga0207646_11231025 | 3300025922 | Bacteria | 655 |
| 1334 | Ga0207646_11651277 | 3300025922 | Bacteria | 552 |
| 1335 | Ga0207681_10004036 | 3300025923 | Bacteria | 9105 |
| 1336 | Ga0207681_10006880 | 3300025923 | Bacteria | 6978 |
| 1337 | Ga0207681_10020465 | 3300025923 | Bacteria | 4193 |
| 1338 | Ga0207681_10030036 | 3300025923 | Bacteria | 3539 |
| 1339 | Ga0207681_10053433 | 3300025923 | Unclassified | 2742 |
| 1340 | Ga0207681_10053942 | 3300025923 | Unclassified | 2731 |
| 1341 | Ga0207681_10122808 | 3300025923 | Bacteria | 1907 |
| 1342 | Ga0207681_10217227 | 3300025923 | Bacteria | 1477 |
| 1343 | Ga0207681_10228419 | 3300025923 | Bacteria | 1443 |
| 1344 | Ga0207681_10394227 | 3300025923 | Bacteria | 1117 |
| 1345 | Ga0207681_10531861 | 3300025923 | Bacteria | 966 |
| 1346 | Ga0207681_10719588 | 3300025923 | Bacteria | 831 |
| 1347 | Ga0207681_10810290 | 3300025923 | Bacteria | 782 |
| 1348 | Ga0207681_11005697 | 3300025923 | Bacteria | 699 |
| 1349 | Ga0207681_11475921 | 3300025923 | Bacteria | 570 |
| 1350 | Ga0207681_11803993 | 3300025923 | Unclassified | 510 |
| 1351 | Ga0207694_10325114 | 3300025924 | Bacteria | 1270 |
| 1352 | Ga0207694_10986457 | 3300025924 | Bacteria | 713 |
| 1353 | Ga0207694_11013191 | 3300025924 | Bacteria | 703 |
| 1354 | Ga0207650_10006789 | 3300025925 | Bacteria | 7806 |
| 1355 | Ga0207650_10015336 | 3300025925 | Bacteria | 5335 |
| 1356 | Ga0207650_10021331 | 3300025925 | Bacteria | 4577 |
| 1357 | Ga0207650_10071813 | 3300025925 | Bacteria | 2605 |
| 1358 | Ga0207650_10132328 | 3300025925 | Bacteria | 1953 |
| 1359 | Ga0207650_10254798 | 3300025925 | Bacteria | 1422 |
| 1360 | Ga0207650_10358597 | 3300025925 | Bacteria | 1201 |
| 1361 | Ga0207650_11111867 | 3300025925 | Bacteria | 673 |
| 1362 | Ga0207650_11759335 | 3300025925 | Unclassified | 525 |
| 1363 | Ga0207650_11853003 | 3300025925 | Bacteria | 510 |
| 1364 | Ga0207659_10000672 | 3300025926 | Bacteria | 20255 |
| 1365 | Ga0207659_10008654 | 3300025926 | Bacteria | 6331 |
| 1366 | Ga0207659_10010072 | 3300025926 | Bacteria | 5923 |
| 1367 | Ga0207659_10015560 | 3300025926 | Bacteria | 4932 |
| 1368 | Ga0207659_10017439 | 3300025926 | Bacteria | 4691 |
| 1369 | Ga0207659_10054978 | 3300025926 | Bacteria | 2845 |
| 1370 | Ga0207659_10072338 | 3300025926 | Bacteria | 2520 |
| 1371 | Ga0207659_10103444 | 3300025926 | Bacteria | 2152 |
| 1372 | Ga0207659_10167391 | 3300025926 | Bacteria | 1731 |
| 1373 | Ga0207659_10167769 | 3300025926 | Bacteria | 1729 |
| 1374 | Ga0207659_10219285 | 3300025926 | Bacteria | 1528 |
| 1375 | Ga0207659_10264111 | 3300025926 | Bacteria | 1402 |
| 1376 | Ga0207659_10453843 | 3300025926 | Bacteria | 1080 |
| 1377 | Ga0207659_10463913 | 3300025926 | Bacteria | 1068 |
| 1378 | Ga0207659_10644819 | 3300025926 | Bacteria | 905 |
| 1379 | Ga0207659_10651802 | 3300025926 | Bacteria | 900 |
| 1380 | Ga0207659_10686407 | 3300025926 | Bacteria | 876 |
| 1381 | Ga0207659_11386650 | 3300025926 | Bacteria | 603 |
| 1382 | Ga0207659_11557642 | 3300025926 | Bacteria | 565 |
| 1383 | Ga0207687_10006511 | 3300025927 | Bacteria | 7714 |
| 1384 | Ga0207687_10009381 | 3300025927 | Bacteria | 6400 |
| 1385 | Ga0207687_10184806 | 3300025927 | Bacteria | 1617 |
| 1386 | Ga0207687_10301438 | 3300025927 | Bacteria | 1291 |
| 1387 | Ga0207687_10457319 | 3300025927 | Bacteria | 1059 |
| 1388 | Ga0207687_11279774 | 3300025927 | Bacteria | 630 |
| 1389 | Ga0207687_11938657 | 3300025927 | Unclassified | 503 |
| 1390 | Ga0207700_10020337 | 3300025928 | Bacteria | 4506 |
| 1391 | Ga0207700_10062152 | 3300025928 | Bacteria | 2836 |
| 1392 | Ga0207700_10366714 | 3300025928 | Unclassified | 1257 |
| 1393 | Ga0207700_10600523 | 3300025928 | Unclassified | 979 |
| 1394 | Ga0207664_10085341 | 3300025929 | Bacteria | 2576 |
| 1395 | Ga0207644_10021145 | 3300025931 | Bacteria | 4429 |
| 1396 | Ga0207644_10043339 | 3300025931 | Bacteria | 3193 |
| 1397 | Ga0207644_10113896 | 3300025931 | Bacteria | 2049 |
| 1398 | Ga0207644_10164275 | 3300025931 | Unclassified | 1728 |
| 1399 | Ga0207644_10164678 | 3300025931 | Bacteria | 1726 |
| 1400 | Ga0207644_10165731 | 3300025931 | Unclassified | 1721 |
| 1401 | Ga0207644_10349082 | 3300025931 | Bacteria | 1201 |
| 1402 | Ga0207644_10500380 | 3300025931 | Bacteria | 1002 |
| 1403 | Ga0207644_10540586 | 3300025931 | Bacteria | 964 |
| 1404 | Ga0207644_10838566 | 3300025931 | Bacteria | 769 |
| 1405 | Ga0207644_10965457 | 3300025931 | Bacteria | 715 |
| 1406 | Ga0207644_11414446 | 3300025931 | Bacteria | 584 |
| 1407 | Ga0207690_10016531 | 3300025932 | Bacteria | 4491 |
| 1408 | Ga0207690_10212124 | 3300025932 | Bacteria | 1477 |
| 1409 | Ga0207690_11162905 | 3300025932 | Unclassified | 644 |
| 1410 | Ga0207706_10042039 | 3300025933 | Bacteria | 4050 |
| 1411 | Ga0207706_10050955 | 3300025933 | Bacteria | 3657 |
| 1412 | Ga0207706_10060055 | 3300025933 | Bacteria | 3348 |
| 1413 | Ga0207706_10091400 | 3300025933 | Bacteria | 2676 |
| 1414 | Ga0207706_10259045 | 3300025933 | Bacteria | 1519 |
| 1415 | Ga0207706_10274350 | 3300025933 | Bacteria | 1471 |
| 1416 | Ga0207706_10304118 | 3300025933 | Bacteria | 1389 |
| 1417 | Ga0207706_10328216 | 3300025933 | Unclassified | 1331 |
| 1418 | Ga0207706_10432479 | 3300025933 | Unclassified | 1140 |
| 1419 | Ga0207706_10525004 | 3300025933 | Unclassified | 1021 |
| 1420 | Ga0207706_10535898 | 3300025933 | Bacteria | 1009 |
| 1421 | Ga0207706_10600299 | 3300025933 | Bacteria | 945 |
| 1422 | Ga0207706_10644987 | 3300025933 | Bacteria | 907 |
| 1423 | Ga0207706_11058489 | 3300025933 | Unclassified | 679 |
| 1424 | Ga0207706_11472716 | 3300025933 | Bacteria | 556 |
| 1425 | Ga0207706_11490082 | 3300025933 | Bacteria | 552 |
| 1426 | Ga0207686_10018666 | 3300025934 | Bacteria | 3929 |
| 1427 | Ga0207686_10053530 | 3300025934 | Bacteria | 2523 |
| 1428 | Ga0207686_10065868 | 3300025934 | Bacteria | 2312 |
| 1429 | Ga0207686_10109154 | 3300025934 | Bacteria | 1863 |
| 1430 | Ga0207686_10208191 | 3300025934 | Bacteria | 1405 |
| 1431 | Ga0207686_10321130 | 3300025934 | Bacteria | 1157 |
| 1432 | Ga0207686_10358057 | 3300025934 | Unclassified | 1100 |
| 1433 | Ga0207686_10376195 | 3300025934 | Bacteria | 1076 |
| 1434 | Ga0207686_10472911 | 3300025934 | Bacteria | 968 |
| 1435 | Ga0207686_10697933 | 3300025934 | Bacteria | 806 |
| 1436 | Ga0207686_11043457 | 3300025934 | Bacteria | 665 |
| 1437 | Ga0207686_11072455 | 3300025934 | Bacteria | 656 |
| 1438 | Ga0207709_10069120 | 3300025935 | Bacteria | 2235 |
| 1439 | Ga0207709_10431503 | 3300025935 | Bacteria | 1014 |
| 1440 | Ga0207709_10524697 | 3300025935 | Unclassified | 928 |
| 1441 | Ga0207709_10857114 | 3300025935 | Unclassified | 736 |
| 1442 | Ga0207709_11206299 | 3300025935 | Bacteria | 624 |
| 1443 | Ga0207670_10033694 | 3300025936 | Unclassified | 3303 |
| 1444 | Ga0207670_10037527 | 3300025936 | Bacteria | 3158 |
| 1445 | Ga0207670_10106275 | 3300025936 | Bacteria | 2013 |
| 1446 | Ga0207670_10148138 | 3300025936 | Bacteria | 1738 |
| 1447 | Ga0207670_10183068 | 3300025936 | Unclassified | 1579 |
| 1448 | Ga0207670_10222550 | 3300025936 | Bacteria | 1445 |
| 1449 | Ga0207670_10320101 | 3300025936 | Bacteria | 1220 |
| 1450 | Ga0207670_11015506 | 3300025936 | Bacteria | 698 |
| 1451 | Ga0207670_11774043 | 3300025936 | Bacteria | 525 |
| 1452 | Ga0207669_10016305 | 3300025937 | Bacteria | 3771 |
| 1453 | Ga0207669_10028238 | 3300025937 | Bacteria | 3084 |
| 1454 | Ga0207669_10085976 | 3300025937 | Unclassified | 2032 |
| 1455 | Ga0207669_10139534 | 3300025937 | Bacteria | 1680 |
| 1456 | Ga0207669_10206774 | 3300025937 | Bacteria | 1429 |
| 1457 | Ga0207669_10645182 | 3300025937 | Unclassified | 865 |
| 1458 | Ga0207669_10843816 | 3300025937 | Bacteria | 762 |
| 1459 | Ga0207669_10855969 | 3300025937 | Bacteria | 757 |
| 1460 | Ga0207669_10912435 | 3300025937 | Bacteria | 734 |
| 1461 | Ga0207669_10942726 | 3300025937 | Unclassified | 723 |
| 1462 | Ga0207669_11189810 | 3300025937 | Unclassified | 645 |
| 1463 | Ga0207669_11367815 | 3300025937 | Bacteria | 602 |
| 1464 | Ga0207669_11381538 | 3300025937 | Unclassified | 599 |
| 1465 | Ga0207669_11550686 | 3300025937 | Bacteria | 565 |
| 1466 | Ga0207669_11627250 | 3300025937 | Unclassified | 551 |
| 1467 | Ga0207704_10010227 | 3300025938 | Bacteria | 4566 |
| 1468 | Ga0207704_10018686 | 3300025938 | Bacteria | 3625 |
| 1469 | Ga0207704_10023158 | 3300025938 | Bacteria | 3342 |
| 1470 | Ga0207704_10202896 | 3300025938 | Bacteria | 1453 |
| 1471 | Ga0207704_10273011 | 3300025938 | Unclassified | 1281 |
| 1472 | Ga0207704_10384581 | 3300025938 | Unclassified | 1102 |
| 1473 | Ga0207704_10430039 | 3300025938 | Bacteria | 1049 |
| 1474 | Ga0207704_10794668 | 3300025938 | Bacteria | 790 |
| 1475 | Ga0207665_10249914 | 3300025939 | Bacteria | 1310 |
| 1476 | Ga0207665_10325536 | 3300025939 | Unclassified | 1154 |
| 1477 | Ga0207665_10494538 | 3300025939 | Unclassified | 944 |
| 1478 | Ga0207691_10002430 | 3300025940 | Bacteria | 18233 |
| 1479 | Ga0207691_10015439 | 3300025940 | Bacteria | 7263 |
| 1480 | Ga0207691_10022904 | 3300025940 | Bacteria | 5887 |
| 1481 | Ga0207691_10045686 | 3300025940 | Bacteria | 4025 |
| 1482 | Ga0207691_10049327 | 3300025940 | Bacteria | 3857 |
| 1483 | Ga0207691_10049665 | 3300025940 | Bacteria | 3844 |
| 1484 | Ga0207691_10067339 | 3300025940 | Bacteria | 3238 |
| 1485 | Ga0207691_10077940 | 3300025940 | Bacteria | 2984 |
| 1486 | Ga0207691_10096948 | 3300025940 | Unclassified | 2636 |
| 1487 | Ga0207691_10133173 | 3300025940 | Bacteria | 2194 |
| 1488 | Ga0207691_10143538 | 3300025940 | Bacteria | 2102 |
| 1489 | Ga0207691_10160333 | 3300025940 | Bacteria | 1974 |
| 1490 | Ga0207691_10172093 | 3300025940 | Bacteria | 1896 |
| 1491 | Ga0207691_10206339 | 3300025940 | Bacteria | 1709 |
| 1492 | Ga0207691_10307619 | 3300025940 | Bacteria | 1361 |
| 1493 | Ga0207691_10492705 | 3300025940 | Bacteria | 1041 |
| 1494 | Ga0207691_11144227 | 3300025940 | Bacteria | 646 |
| 1495 | Ga0207691_11241134 | 3300025940 | Bacteria | 617 |
| 1496 | Ga0207711_10003652 | 3300025941 | Bacteria | 13302 |
| 1497 | Ga0207711_10017668 | 3300025941 | Bacteria | 5925 |
| 1498 | Ga0207711_10035423 | 3300025941 | Bacteria | 4230 |
| 1499 | Ga0207711_10058711 | 3300025941 | Unclassified | 3312 |
| 1500 | Ga0207711_10137829 | 3300025941 | Bacteria | 2193 |
| 1501 | Ga0207711_10146665 | 3300025941 | Bacteria | 2126 |
| 1502 | Ga0207711_10153463 | 3300025941 | Bacteria | 2080 |
| 1503 | Ga0207711_10177045 | 3300025941 | Bacteria | 1938 |
| 1504 | Ga0207711_10306585 | 3300025941 | Archaea | 1465 |
| 1505 | Ga0207711_10316594 | 3300025941 | Bacteria | 1441 |
| 1506 | Ga0207711_10337125 | 3300025941 | Bacteria | 1395 |
| 1507 | Ga0207711_10410826 | 3300025941 | Bacteria | 1258 |
| 1508 | Ga0207711_10443133 | 3300025941 | Unclassified | 1209 |
| 1509 | Ga0207711_10579202 | 3300025941 | Unclassified | 1047 |
| 1510 | Ga0207711_11010000 | 3300025941 | Unclassified | 771 |
| 1511 | Ga0207711_11123835 | 3300025941 | Unclassified | 727 |
| 1512 | Ga0207711_11185624 | 3300025941 | Bacteria | 705 |
| 1513 | Ga0207689_10001000 | 3300025942 | Bacteria | 27148 |
| 1514 | Ga0207689_10028090 | 3300025942 | Bacteria | 4706 |
| 1515 | Ga0207689_10032206 | 3300025942 | Bacteria | 4361 |
| 1516 | Ga0207689_10068729 | 3300025942 | Bacteria | 2911 |
| 1517 | Ga0207689_10069921 | 3300025942 | Bacteria | 2884 |
| 1518 | Ga0207689_10118743 | 3300025942 | Unclassified | 2175 |
| 1519 | Ga0207689_10151265 | 3300025942 | Bacteria | 1913 |
| 1520 | Ga0207689_10263808 | 3300025942 | Bacteria | 1425 |
| 1521 | Ga0207689_10351134 | 3300025942 | Bacteria | 1226 |
| 1522 | Ga0207689_10380565 | 3300025942 | Bacteria | 1175 |
| 1523 | Ga0207689_10626298 | 3300025942 | Unclassified | 906 |
| 1524 | Ga0207689_11233095 | 3300025942 | Unclassified | 629 |
| 1525 | Ga0207689_11292475 | 3300025942 | Bacteria | 613 |
| 1526 | Ga0207689_11389403 | 3300025942 | Unclassified | 589 |
| 1527 | Ga0207689_11502209 | 3300025942 | Bacteria | 563 |
| 1528 | Ga0207661_10009993 | 3300025944 | Bacteria | 6819 |
| 1529 | Ga0207661_10023250 | 3300025944 | Bacteria | 4682 |
| 1530 | Ga0207661_10046602 | 3300025944 | Bacteria | 3438 |
| 1531 | Ga0207661_10349138 | 3300025944 | Unclassified | 1334 |
| 1532 | Ga0207661_10438972 | 3300025944 | Bacteria | 1188 |
| 1533 | Ga0207679_10006536 | 3300025945 | Bacteria | 7367 |
| 1534 | Ga0207679_10054236 | 3300025945 | Bacteria | 2950 |
| 1535 | Ga0207679_10118006 | 3300025945 | Bacteria | 2106 |
| 1536 | Ga0207679_10126652 | 3300025945 | Bacteria | 2042 |
| 1537 | Ga0207679_10159218 | 3300025945 | Unclassified | 1847 |
| 1538 | Ga0207679_10252783 | 3300025945 | Bacteria | 1499 |
| 1539 | Ga0207679_10583326 | 3300025945 | Bacteria | 1006 |
| 1540 | Ga0207679_10681929 | 3300025945 | Bacteria | 931 |
| 1541 | Ga0207679_10690130 | 3300025945 | Bacteria | 926 |
| 1542 | Ga0207679_10739279 | 3300025945 | Bacteria | 894 |
| 1543 | Ga0207679_10818092 | 3300025945 | Bacteria | 850 |
| 1544 | Ga0207679_10847664 | 3300025945 | Unclassified | 835 |
| 1545 | Ga0207679_11192485 | 3300025945 | Bacteria | 699 |
| 1546 | Ga0207651_10011075 | 3300025960 | Bacteria | 5030 |
| 1547 | Ga0207651_10039513 | 3300025960 | Unclassified | 3112 |
| 1548 | Ga0207651_10078681 | 3300025960 | Bacteria | 2366 |
| 1549 | Ga0207651_10140852 | 3300025960 | Bacteria | 1862 |
| 1550 | Ga0207651_10142985 | 3300025960 | Bacteria | 1851 |
| 1551 | Ga0207651_10150586 | 3300025960 | Bacteria | 1810 |
| 1552 | Ga0207651_10315301 | 3300025960 | Bacteria | 1305 |
| 1553 | Ga0207651_10481926 | 3300025960 | Bacteria | 1069 |
| 1554 | Ga0207651_10502655 | 3300025960 | Bacteria | 1048 |
| 1555 | Ga0207651_10525405 | 3300025960 | Unclassified | 1026 |
| 1556 | Ga0207651_10529595 | 3300025960 | Unclassified | 1022 |
| 1557 | Ga0207651_10648648 | 3300025960 | Bacteria | 927 |
| 1558 | Ga0207651_10927179 | 3300025960 | Bacteria | 776 |
| 1559 | Ga0207651_10953364 | 3300025960 | Bacteria | 765 |
| 1560 | Ga0207651_11768869 | 3300025960 | Bacteria | 556 |
| 1561 | Ga0207651_11822847 | 3300025960 | Bacteria | 547 |
| 1562 | Ga0207712_10037308 | 3300025961 | Bacteria | 3315 |
| 1563 | Ga0207712_10040684 | 3300025961 | Bacteria | 3192 |
| 1564 | Ga0207712_10306760 | 3300025961 | Bacteria | 1305 |
| 1565 | Ga0207712_10374776 | 3300025961 | Bacteria | 1189 |
| 1566 | Ga0207712_10539496 | 3300025961 | Bacteria | 1002 |
| 1567 | Ga0207712_11093036 | 3300025961 | Bacteria | 710 |
| 1568 | Ga0207712_11207684 | 3300025961 | Unclassified | 675 |
| 1569 | Ga0207712_11438514 | 3300025961 | Archaea | 617 |
| 1570 | Ga0207668_10022797 | 3300025972 | Bacteria | 4013 |
| 1571 | Ga0207668_10038106 | 3300025972 | Bacteria | 3223 |
| 1572 | Ga0207668_10492228 | 3300025972 | Unclassified | 1053 |
| 1573 | Ga0207668_10548055 | 3300025972 | Bacteria | 1001 |
| 1574 | Ga0207668_10633182 | 3300025972 | Bacteria | 934 |
| 1575 | Ga0207668_10689759 | 3300025972 | Bacteria | 897 |
| 1576 | Ga0207668_10718906 | 3300025972 | Bacteria | 879 |
| 1577 | Ga0207668_10736437 | 3300025972 | Unclassified | 869 |
| 1578 | Ga0207668_11039742 | 3300025972 | Unclassified | 733 |
| 1579 | Ga0207668_11376203 | 3300025972 | Bacteria | 636 |
| 1580 | Ga0207668_11887601 | 3300025972 | Unclassified | 539 |
| 1581 | Ga0207640_10027866 | 3300025981 | Bacteria | 3446 |
| 1582 | Ga0207640_10075286 | 3300025981 | Bacteria | 2287 |
| 1583 | Ga0207640_10098175 | 3300025981 | Bacteria | 2047 |
| 1584 | Ga0207640_10243564 | 3300025981 | Bacteria | 1391 |
| 1585 | Ga0207640_10390288 | 3300025981 | Bacteria | 1131 |
| 1586 | Ga0207640_10574245 | 3300025981 | Bacteria | 951 |
| 1587 | Ga0207640_10587309 | 3300025981 | Bacteria | 941 |
| 1588 | Ga0207640_11055036 | 3300025981 | Bacteria | 717 |
| 1589 | Ga0207658_10017346 | 3300025986 | Bacteria | 4960 |
| 1590 | Ga0207658_10074841 | 3300025986 | Bacteria | 2574 |
| 1591 | Ga0207658_10209960 | 3300025986 | Unclassified | 1631 |
| 1592 | Ga0207658_10230252 | 3300025986 | Bacteria | 1564 |
| 1593 | Ga0207658_10257965 | 3300025986 | Bacteria | 1485 |
| 1594 | Ga0207658_11288645 | 3300025986 | Unclassified | 668 |
| 1595 | Ga0207677_10048110 | 3300026023 | Bacteria | 2869 |
| 1596 | Ga0207677_10123145 | 3300026023 | Bacteria | 1955 |
| 1597 | Ga0207677_10306432 | 3300026023 | Unclassified | 1314 |
| 1598 | Ga0207677_10326873 | 3300026023 | Unclassified | 1277 |
| 1599 | Ga0207677_10386697 | 3300026023 | Bacteria | 1182 |
| 1600 | Ga0207677_10515191 | 3300026023 | Unclassified | 1037 |
| 1601 | Ga0207677_10600600 | 3300026023 | Bacteria | 966 |
| 1602 | Ga0207677_11227454 | 3300026023 | Bacteria | 687 |
| 1603 | Ga0207677_11505298 | 3300026023 | Bacteria | 622 |
| 1604 | Ga0207677_11514961 | 3300026023 | Unclassified | 620 |
| 1605 | Ga0207703_10005589 | 3300026035 | Bacteria | 10093 |
| 1606 | Ga0207703_10016696 | 3300026035 | Bacteria | 5726 |
| 1607 | Ga0207703_10100105 | 3300026035 | Bacteria | 2455 |
| 1608 | Ga0207703_10113572 | 3300026035 | Bacteria | 2315 |
| 1609 | Ga0207703_10147228 | 3300026035 | Bacteria | 2050 |
| 1610 | Ga0207703_10173421 | 3300026035 | Unclassified | 1899 |
| 1611 | Ga0207703_10276641 | 3300026035 | Unclassified | 1523 |
| 1612 | Ga0207703_10434473 | 3300026035 | Unclassified | 1224 |
| 1613 | Ga0207703_10470293 | 3300026035 | Bacteria | 1177 |
| 1614 | Ga0207703_10598333 | 3300026035 | Unclassified | 1043 |
| 1615 | Ga0207703_10685251 | 3300026035 | Bacteria | 974 |
| 1616 | Ga0207703_10763630 | 3300026035 | Bacteria | 922 |
| 1617 | Ga0207703_10798883 | 3300026035 | Bacteria | 901 |
| 1618 | Ga0207703_10918443 | 3300026035 | Bacteria | 838 |
| 1619 | Ga0207703_11007670 | 3300026035 | Bacteria | 799 |
| 1620 | Ga0207703_11159674 | 3300026035 | Bacteria | 743 |
| 1621 | Ga0207703_11422016 | 3300026035 | Unclassified | 667 |
| 1622 | Ga0207639_10575364 | 3300026041 | Bacteria | 1036 |
| 1623 | Ga0207639_12129813 | 3300026041 | Unclassified | 522 |
| 1624 | Ga0207678_10085429 | 3300026067 | Bacteria | 2697 |
| 1625 | Ga0207678_10104793 | 3300026067 | Bacteria | 2413 |
| 1626 | Ga0207678_10839561 | 3300026067 | Bacteria | 811 |
| 1627 | Ga0207708_10002731 | 3300026075 | Bacteria | 12963 |
| 1628 | Ga0207708_10005707 | 3300026075 | Bacteria | 9201 |
| 1629 | Ga0207708_10007575 | 3300026075 | Bacteria | 8030 |
| 1630 | Ga0207708_10013366 | 3300026075 | Bacteria | 6134 |
| 1631 | Ga0207708_10035110 | 3300026075 | Bacteria | 3815 |
| 1632 | Ga0207708_10054645 | 3300026075 | Bacteria | 3045 |
| 1633 | Ga0207708_10109917 | 3300026075 | Bacteria | 2139 |
| 1634 | Ga0207708_10120429 | 3300026075 | Bacteria | 2044 |
| 1635 | Ga0207708_10127761 | 3300026075 | Bacteria | 1985 |
| 1636 | Ga0207708_10137445 | 3300026075 | Bacteria | 1915 |
| 1637 | Ga0207708_10153019 | 3300026075 | Bacteria | 1817 |
| 1638 | Ga0207708_10210968 | 3300026075 | Bacteria | 1552 |
| 1639 | Ga0207708_10321015 | 3300026075 | Bacteria | 1264 |
| 1640 | Ga0207708_10431706 | 3300026075 | Bacteria | 1094 |
| 1641 | Ga0207708_10556027 | 3300026075 | Bacteria | 968 |
| 1642 | Ga0207708_10592636 | 3300026075 | Bacteria | 938 |
| 1643 | Ga0207708_10805529 | 3300026075 | Bacteria | 809 |
| 1644 | Ga0207708_10889935 | 3300026075 | Bacteria | 770 |
| 1645 | Ga0207708_10915256 | 3300026075 | Bacteria | 759 |
| 1646 | Ga0207641_10008046 | 3300026088 | Bacteria | 8737 |
| 1647 | Ga0207641_10008049 | 3300026088 | Bacteria | 8736 |
| 1648 | Ga0207641_10087545 | 3300026088 | Bacteria | 2718 |
| 1649 | Ga0207641_10304766 | 3300026088 | Bacteria | 1506 |
| 1650 | Ga0207641_10595367 | 3300026088 | Bacteria | 1082 |
| 1651 | Ga0207641_10761492 | 3300026088 | Bacteria | 956 |
| 1652 | Ga0207641_11888600 | 3300026088 | Bacteria | 599 |
| 1653 | Ga0207648_10001325 | 3300026089 | Bacteria | 27526 |
| 1654 | Ga0207648_10006823 | 3300026089 | Bacteria | 11313 |
| 1655 | Ga0207648_10018936 | 3300026089 | Bacteria | 6219 |
| 1656 | Ga0207648_10030419 | 3300026089 | Bacteria | 4782 |
| 1657 | Ga0207648_10047057 | 3300026089 | Bacteria | 3781 |
| 1658 | Ga0207648_10048298 | 3300026089 | Bacteria | 3727 |
| 1659 | Ga0207648_10109680 | 3300026089 | Bacteria | 2422 |
| 1660 | Ga0207648_10115701 | 3300026089 | Bacteria | 2357 |
| 1661 | Ga0207648_10138127 | 3300026089 | Bacteria | 2147 |
| 1662 | Ga0207648_10246557 | 3300026089 | Bacteria | 1592 |
| 1663 | Ga0207648_10493009 | 3300026089 | Bacteria | 1120 |
| 1664 | Ga0207648_10541641 | 3300026089 | Bacteria | 1068 |
| 1665 | Ga0207648_10565675 | 3300026089 | Bacteria | 1045 |
| 1666 | Ga0207648_11161057 | 3300026089 | Bacteria | 725 |
| 1667 | Ga0207648_11538807 | 3300026089 | Bacteria | 625 |
| 1668 | Ga0207648_11584263 | 3300026089 | Unclassified | 616 |
| 1669 | Ga0207648_12042267 | 3300026089 | Bacteria | 534 |
| 1670 | Ga0207676_10001537 | 3300026095 | Bacteria | 17026 |
| 1671 | Ga0207676_10023862 | 3300026095 | Bacteria | 4520 |
| 1672 | Ga0207676_10046642 | 3300026095 | Unclassified | 3354 |
| 1673 | Ga0207676_10092743 | 3300026095 | Bacteria | 2484 |
| 1674 | Ga0207676_10133256 | 3300026095 | Bacteria | 2116 |
| 1675 | Ga0207676_10461946 | 3300026095 | Bacteria | 1199 |
| 1676 | Ga0207676_10464106 | 3300026095 | Unclassified | 1196 |
| 1677 | Ga0207676_10674318 | 3300026095 | Unclassified | 999 |
| 1678 | Ga0207676_10819143 | 3300026095 | Bacteria | 909 |
| 1679 | Ga0207676_11212175 | 3300026095 | Bacteria | 748 |
| 1680 | Ga0207676_11665964 | 3300026095 | Bacteria | 636 |
| 1681 | Ga0207676_11671255 | 3300026095 | Unclassified | 635 |
| 1682 | Ga0207676_11718994 | 3300026095 | Bacteria | 626 |
| 1683 | Ga0207674_10118190 | 3300026116 | Bacteria | 2621 |
| 1684 | Ga0207674_10172028 | 3300026116 | Bacteria | 2119 |
| 1685 | Ga0207674_10193818 | 3300026116 | Bacteria | 1982 |
| 1686 | Ga0207674_10307778 | 3300026116 | Unclassified | 1533 |
| 1687 | Ga0207674_10438068 | 3300026116 | Bacteria | 1263 |
| 1688 | Ga0207674_10513188 | 3300026116 | Bacteria | 1158 |
| 1689 | Ga0207674_10707408 | 3300026116 | Bacteria | 973 |
| 1690 | Ga0207675_100004079 | 3300026118 | Bacteria | 14140 |
| 1691 | Ga0207675_100012575 | 3300026118 | Bacteria | 7905 |
| 1692 | Ga0207675_100014601 | 3300026118 | Bacteria | 7320 |
| 1693 | Ga0207675_100030677 | 3300026118 | Bacteria | 5007 |
| 1694 | Ga0207675_100081005 | 3300026118 | Unclassified | 3044 |
| 1695 | Ga0207675_100109920 | 3300026118 | Bacteria | 2601 |
| 1696 | Ga0207675_100213260 | 3300026118 | Bacteria | 1858 |
| 1697 | Ga0207675_100224020 | 3300026118 | Bacteria | 1813 |
| 1698 | Ga0207675_100283219 | 3300026118 | Bacteria | 1611 |
| 1699 | Ga0207675_100286799 | 3300026118 | Bacteria | 1601 |
| 1700 | Ga0207675_100470460 | 3300026118 | Bacteria | 1248 |
| 1701 | Ga0207675_100479652 | 3300026118 | Bacteria | 1236 |
| 1702 | Ga0207675_100483409 | 3300026118 | Bacteria | 1231 |
| 1703 | Ga0207675_100567556 | 3300026118 | Bacteria | 1135 |
| 1704 | Ga0207675_100770175 | 3300026118 | Bacteria | 974 |
| 1705 | Ga0207675_101238383 | 3300026118 | Bacteria | 767 |
| 1706 | Ga0207675_101663206 | 3300026118 | Bacteria | 658 |
| 1707 | Ga0207675_101757296 | 3300026118 | Unclassified | 640 |
| 1708 | Ga0207675_102334870 | 3300026118 | Bacteria | 548 |
| 1709 | Ga0207683_10012729 | 3300026121 | Bacteria | 7179 |
| 1710 | Ga0207683_10029222 | 3300026121 | Bacteria | 4772 |
| 1711 | Ga0207683_10031846 | 3300026121 | Bacteria | 4579 |
| 1712 | Ga0207683_10093176 | 3300026121 | Bacteria | 2684 |
| 1713 | Ga0207683_10159271 | 3300026121 | Archaea | 2040 |
| 1714 | Ga0207683_10179696 | 3300026121 | Bacteria | 1918 |
| 1715 | Ga0207683_10205737 | 3300026121 | Bacteria | 1790 |
| 1716 | Ga0207683_10212113 | 3300026121 | Bacteria | 1763 |
| 1717 | Ga0207683_10218940 | 3300026121 | Bacteria | 1734 |
| 1718 | Ga0207683_10258646 | 3300026121 | Bacteria | 1589 |
| 1719 | Ga0207683_10305059 | 3300026121 | Bacteria | 1457 |
| 1720 | Ga0207683_10490854 | 3300026121 | Unclassified | 1134 |
| 1721 | Ga0207683_10625158 | 3300026121 | Unclassified | 997 |
| 1722 | Ga0207683_11283663 | 3300026121 | Bacteria | 678 |
| 1723 | Ga0207698_10425606 | 3300026142 | Bacteria | 1275 |
| 1724 | Ga0207698_10506212 | 3300026142 | Unclassified | 1176 |
| 1725 | Ga0207698_11730492 | 3300026142 | Bacteria | 640 |
| 1726 | Ga0209996_1029540 | 3300027395 | Bacteria | 794 |
| 1727 | Ga0210000_1067597 | 3300027462 | Bacteria | 581 |
| 1728 | Ga0209995_1028618 | 3300027471 | Unclassified | 931 |
| 1729 | Ga0209999_1075118 | 3300027543 | Bacteria | 650 |
| 1730 | Ga0209982_1055281 | 3300027552 | Unclassified | 643 |
| 1731 | Ga0209970_1120198 | 3300027614 | Bacteria | 508 |
| 1732 | Ga0209983_1034620 | 3300027665 | Unclassified | 1082 |
| 1733 | Ga0209971_1016674 | 3300027682 | Bacteria | 1742 |
| 1734 | Ga0209966_1116233 | 3300027695 | Unclassified | 612 |
| 1735 | Ga0209998_10007303 | 3300027717 | Bacteria | 2292 |
| 1736 | Ga0209998_10158681 | 3300027717 | Bacteria | 583 |
| 1737 | Ga0209813_10004311 | 3300027866 | Bacteria | 3389 |
| 1738 | Ga0209813_10494613 | 3300027866 | Unclassified | 507 |
| 1739 | Ga0209974_10076524 | 3300027876 | Bacteria | 1146 |
| 1740 | Ga0209974_10163228 | 3300027876 | Unclassified | 809 |
| 1741 | Ga0209974_10268258 | 3300027876 | Bacteria | 646 |
| 1742 | Ga0207428_10000021 | 3300027907 | Bacteria | 276436 |
| 1743 | Ga0207428_10000570 | 3300027907 | Bacteria | 43701 |
| 1744 | Ga0207428_10002263 | 3300027907 | Bacteria | 19336 |
| 1745 | Ga0207428_10007451 | 3300027907 | Bacteria | 9977 |
| 1746 | Ga0207428_10008429 | 3300027907 | Bacteria | 9307 |
| 1747 | Ga0207428_10016510 | 3300027907 | Bacteria | 6348 |
| 1748 | Ga0207428_10016885 | 3300027907 | Bacteria | 6272 |
| 1749 | Ga0207428_10019436 | 3300027907 | Bacteria | 5792 |
| 1750 | Ga0207428_10087851 | 3300027907 | Bacteria | 2418 |
| 1751 | Ga0207428_10349987 | 3300027907 | Bacteria | 1087 |
| 1752 | Ga0207428_10358488 | 3300027907 | Bacteria | 1072 |
| 1753 | Ga0207428_10435356 | 3300027907 | Unclassified | 957 |
| 1754 | Ga0207428_10495763 | 3300027907 | Bacteria | 887 |
| 1755 | Ga0207428_10777708 | 3300027907 | Bacteria | 681 |
| 1756 | Ga0207428_10917062 | 3300027907 | Bacteria | 618 |
| 1757 | Ga0207428_11169181 | 3300027907 | Unclassified | 536 |
| 1758 | Ga0268266_10011773 | 3300028379 | Bacteria | 7585 |
| 1759 | Ga0268266_10040785 | 3300028379 | Bacteria | 3958 |
| 1760 | Ga0268266_10804402 | 3300028379 | Unclassified | 908 |
| 1761 | Ga0268266_10878377 | 3300028379 | Bacteria | 867 |
| 1762 | Ga0268266_11403540 | 3300028379 | Bacteria | 674 |
| 1763 | Ga0268266_12028874 | 3300028379 | Unclassified | 548 |
| 1764 | Ga0268265_10000772 | 3300028380 | Bacteria | 30842 |
| 1765 | Ga0268265_10018529 | 3300028380 | Unclassified | 4826 |
| 1766 | Ga0268265_10033837 | 3300028380 | Bacteria | 3719 |
| 1767 | Ga0268265_10123477 | 3300028380 | Bacteria | 2138 |
| 1768 | Ga0268265_10130989 | 3300028380 | Bacteria | 2084 |
| 1769 | Ga0268265_10188052 | 3300028380 | Bacteria | 1781 |
| 1770 | Ga0268265_10322738 | 3300028380 | Bacteria | 1399 |
| 1771 | Ga0268265_10329180 | 3300028380 | Bacteria | 1387 |
| 1772 | Ga0268265_10352155 | 3300028380 | Bacteria | 1345 |
| 1773 | Ga0268265_10652778 | 3300028380 | Unclassified | 1011 |
| 1774 | Ga0268265_10804695 | 3300028380 | Bacteria | 916 |
| 1775 | Ga0268265_10847077 | 3300028380 | Bacteria | 894 |
| 1776 | Ga0268265_10868268 | 3300028380 | Bacteria | 884 |
| 1777 | Ga0268265_10959005 | 3300028380 | Bacteria | 843 |
| 1778 | Ga0268265_11285477 | 3300028380 | Bacteria | 731 |
| 1779 | Ga0268265_11376551 | 3300028380 | Bacteria | 707 |
| 1780 | Ga0268265_11690639 | 3300028380 | Unclassified | 639 |
| 1781 | Ga0268265_11983264 | 3300028380 | Bacteria | 589 |
| 1782 | Ga0268264_10019123 | 3300028381 | Bacteria | 5599 |
| 1783 | Ga0268264_10064145 | 3300028381 | Bacteria | 3091 |
| 1784 | Ga0268264_10158419 | 3300028381 | Bacteria | 2037 |
| 1785 | Ga0268264_10205224 | 3300028381 | Bacteria | 1806 |
| 1786 | Ga0268264_10205815 | 3300028381 | Bacteria | 1803 |
| 1787 | Ga0268264_10217007 | 3300028381 | Bacteria | 1759 |
| 1788 | Ga0268264_10340537 | 3300028381 | Bacteria | 1424 |
| 1789 | Ga0268264_10406879 | 3300028381 | Bacteria | 1309 |
| 1790 | Ga0268264_10445480 | 3300028381 | Bacteria | 1253 |
| 1791 | Ga0268264_10480293 | 3300028381 | Bacteria | 1209 |
| 1792 | Ga0268264_10710632 | 3300028381 | Bacteria | 999 |
| 1793 | Ga0268264_11159878 | 3300028381 | Bacteria | 782 |
| 1794 | Ga0268264_11689620 | 3300028381 | Unclassified | 644 |
| 1795 | Ga0265337_1034006 | 3300028556 | Bacteria | 1502 |
| 1796 | Ga0265326_10000028 | 3300028558 | Bacteria | 107913 |
| 1797 | Ga0265319_1000746 | 3300028563 | Bacteria | 21215 |
| 1798 | Ga0265334_10000040 | 3300028573 | Bacteria | 100264 |
| 1799 | Ga0265336_10003949 | 3300028666 | Bacteria | 5678 |
| 1800 | Ga0265338_10000661 | 3300028800 | Bacteria | 59507 |
| 1801 | Ga0265324_10006868 | 3300029957 | Bacteria | 4689 |
| 1802 | Ga0316177_1137045 | 3300030731 | Bacteria | 684 |
| 1803 | Ga0265332_10078791 | 3300031238 | Bacteria | 1399 |
| 1804 | Ga0265332_10147374 | 3300031238 | Bacteria | 985 |
| 1805 | Ga0265320_10357648 | 3300031240 | Bacteria | 645 |
| 1806 | Ga0265327_10016019 | 3300031251 | Bacteria | 4795 |
| 1807 | Ga0307408_100014431 | 3300031548 | Bacteria | 5248 |
| 1808 | Ga0307408_100020494 | 3300031548 | Bacteria | 4465 |
| 1809 | Ga0307408_100062075 | 3300031548 | Bacteria | 2730 |
| 1810 | Ga0307408_100137514 | 3300031548 | Bacteria | 1913 |
| 1811 | Ga0307408_100327910 | 3300031548 | Bacteria | 1292 |
| 1812 | Ga0307408_100339708 | 3300031548 | Unclassified | 1270 |
| 1813 | Ga0307408_100466204 | 3300031548 | Bacteria | 1099 |
| 1814 | Ga0307408_100603019 | 3300031548 | Bacteria | 976 |
| 1815 | Ga0307408_100853082 | 3300031548 | Bacteria | 830 |
| 1816 | Ga0265314_10029252 | 3300031711 | Bacteria | 4097 |
| 1817 | Ga0265314_10537246 | 3300031711 | Bacteria | 610 |
| 1818 | Ga0307405_10000803 | 3300031731 | Bacteria | 12343 |
| 1819 | Ga0307405_10060325 | 3300031731 | Bacteria | 2393 |
| 1820 | Ga0307405_10951617 | 3300031731 | Bacteria | 730 |
| 1821 | Ga0307405_10965234 | 3300031731 | Bacteria | 725 |
| 1822 | Ga0307405_11969757 | 3300031731 | Bacteria | 522 |
| 1823 | Ga0307413_10215764 | 3300031824 | Bacteria | 1397 |
| 1824 | Ga0307413_10758069 | 3300031824 | Bacteria | 812 |
| 1825 | Ga0307413_10764832 | 3300031824 | Bacteria | 809 |
| 1826 | Ga0307410_10004314 | 3300031852 | Bacteria | 7330 |
| 1827 | Ga0307410_10267810 | 3300031852 | Bacteria | 1335 |
| 1828 | Ga0307410_11081766 | 3300031852 | Bacteria | 694 |
| 1829 | Ga0307406_10078819 | 3300031901 | Bacteria | 2183 |
| 1830 | Ga0307406_10171833 | 3300031901 | Bacteria | 1569 |
| 1831 | Ga0307406_11116729 | 3300031901 | Bacteria | 681 |
| 1832 | Ga0307407_10044651 | 3300031903 | Bacteria | 2499 |
| 1833 | Ga0307407_10257974 | 3300031903 | Bacteria | 1198 |
| 1834 | Ga0307412_10001225 | 3300031911 | Bacteria | 14566 |
| 1835 | Ga0307412_10074987 | 3300031911 | Bacteria | 2319 |
| 1836 | Ga0307412_10105275 | 3300031911 | Bacteria | 2004 |
| 1837 | Ga0307412_10132924 | 3300031911 | Bacteria | 1810 |
| 1838 | Ga0307412_10335921 | 3300031911 | Unclassified | 1207 |
| 1839 | Ga0307412_10726732 | 3300031911 | Bacteria | 855 |
| 1840 | Ga0307412_10895248 | 3300031911 | Bacteria | 777 |
| 1841 | Ga0307412_11093811 | 3300031911 | Bacteria | 709 |
| 1842 | Ga0307412_12045292 | 3300031911 | Unclassified | 531 |
| 1843 | Ga0307409_100008674 | 3300031995 | Bacteria | 6187 |
| 1844 | Ga0307409_100036598 | 3300031995 | Bacteria | 3610 |
| 1845 | Ga0307409_100080632 | 3300031995 | Bacteria | 2627 |
| 1846 | Ga0307409_100539846 | 3300031995 | Unclassified | 1143 |
| 1847 | Ga0307409_100576721 | 3300031995 | Bacteria | 1108 |
| 1848 | Ga0307409_100660716 | 3300031995 | Unclassified | 1040 |
| 1849 | Ga0307409_100889896 | 3300031995 | Bacteria | 903 |
| 1850 | Ga0307409_102884186 | 3300031995 | Bacteria | 508 |
| 1851 | Ga0307416_100000919 | 3300032002 | Bacteria | 15561 |
| 1852 | Ga0307416_100002964 | 3300032002 | Bacteria | 9893 |
| 1853 | Ga0307416_100006245 | 3300032002 | Bacteria | 7440 |
| 1854 | Ga0307416_100022703 | 3300032002 | Bacteria | 4535 |
| 1855 | Ga0307416_100025464 | 3300032002 | Unclassified | 4337 |
| 1856 | Ga0307416_100105363 | 3300032002 | Bacteria | 2468 |
| 1857 | Ga0307416_100118856 | 3300032002 | Bacteria | 2350 |
| 1858 | Ga0307416_100173710 | 3300032002 | Bacteria | 2010 |
| 1859 | Ga0307416_100927198 | 3300032002 | Bacteria | 972 |
| 1860 | Ga0307416_102515037 | 3300032002 | Bacteria | 613 |
| 1861 | Ga0307416_103572395 | 3300032002 | Bacteria | 520 |
| 1862 | Ga0307414_10173577 | 3300032004 | Bacteria | 1726 |
| 1863 | Ga0307414_10321544 | 3300032004 | Bacteria | 1317 |
| 1864 | Ga0307414_10650436 | 3300032004 | Bacteria | 950 |
| 1865 | Ga0307414_11243203 | 3300032004 | Bacteria | 690 |
| 1866 | Ga0307414_11459936 | 3300032004 | Unclassified | 636 |
| 1867 | Ga0307414_11947080 | 3300032004 | Unclassified | 549 |
| 1868 | Ga0307411_10006469 | 3300032005 | Bacteria | 5868 |
| 1869 | Ga0307411_10009191 | 3300032005 | Bacteria | 5178 |
| 1870 | Ga0307411_10014918 | 3300032005 | Bacteria | 4342 |
| 1871 | Ga0307411_10023178 | 3300032005 | Bacteria | 3672 |
| 1872 | Ga0307411_10119110 | 3300032005 | Bacteria | 1906 |
| 1873 | Ga0307411_10334776 | 3300032005 | Bacteria | 1228 |
| 1874 | Ga0307411_10337440 | 3300032005 | Bacteria | 1223 |
| 1875 | Ga0307411_10466817 | 3300032005 | Bacteria | 1060 |
| 1876 | Ga0307411_10610904 | 3300032005 | Unclassified | 939 |
| 1877 | Ga0307411_12021575 | 3300032005 | Unclassified | 538 |
| 1878 | Ga0307415_100006180 | 3300032126 | Bacteria | 6431 |
| 1879 | Ga0307415_100055869 | 3300032126 | Bacteria | 2704 |
| 1880 | Ga0307415_100856750 | 3300032126 | Bacteria | 834 |
| 1881 | Ga0373948_0023401 | 3300034817 | Bacteria | 1198 |
| 1882 | Ga0373950_0029714 | 3300034818 | Bacteria | 1006 |
| 1883 | Ga0373958_0001904 | 3300034819 | Bacteria | 2865 |
| 1884 | Ga0373959_0000856 | 3300034820 | Bacteria | 5157 |
| 1885 | Ga0373938_0000270 | 3300034957 | Bacteria | 8216 |
| 1886 | Ga0373934_0230471 | 3300035086 | Unclassified | 765 |
| 1887 | Ga0373934_0407305 | 3300035086 | Bacteria | 569 |
| 1888 | Ga0373940_0019908 | 3300035088 | Bacteria | 1700 |
| 1889 | Ga0373940_0022988 | 3300035088 | Bacteria | 1606 |
| 1890 | Ga0373940_0048984 | 3300035088 | Bacteria | 1182 |
| 1891 | Ga0373944_0044793 | 3300035089 | Bacteria | 1379 |
| 1892 | Ga0373944_0146027 | 3300035089 | Bacteria | 831 |
| 1893 | Ga0373949_0004159 | 3300035090 | Bacteria | 3343 |
| 1894 | Ga0373949_0018737 | 3300035090 | Bacteria | 1571 |
| 1895 | Ga0373949_0136530 | 3300035090 | Bacteria | 700 |
| 1896 | Ga0373951_0000705 | 3300035091 | Bacteria | 9181 |
| 1897 | Ga0373951_0047441 | 3300035091 | Bacteria | 1050 |
| 1898 | Ga0373952_0001064 | 3300035092 | Bacteria | 5017 |
| 1899 | Ga0373952_0097357 | 3300035092 | Bacteria | 772 |
| 1900 | Ga0373923_0052689 | 3300035111 | Bacteria | 1710 |
| 1901 | Ga0373923_0323984 | 3300035111 | Bacteria | 732 |
| 1902 | Ga0373932_0006011 | 3300035112 | Bacteria | 2863 |
| 1903 | Ga0373932_0097400 | 3300035112 | Unclassified | 953 |
| 1904 | Ga0373939_0000661 | 3300035114 | Bacteria | 8564 |
| 1905 | Ga0373939_0036301 | 3300035114 | Bacteria | 1457 |
| 1906 | Ga0373939_0184345 | 3300035114 | Bacteria | 780 |
| 1907 | Ga0373941_0020023 | 3300035115 | Bacteria | 1871 |
| 1908 | Ga0373941_0114268 | 3300035115 | Bacteria | 955 |
| 1909 | Ga0373945_0181381 | 3300035116 | Unclassified | 867 |
| 1910 | Ga0373953_0161933 | 3300035117 | Unclassified | 962 |
| 1911 | Ga0373954_0031135 | 3300035118 | Bacteria | 2462 |
| 1912 | Ga0373954_0450666 | 3300035118 | Unclassified | 637 |
| 1913 | Ga0373954_0618249 | 3300035118 | Bacteria | 537 |
| 1914 | Ga0373957_0144635 | 3300035120 | Bacteria | 974 |
| 1915 | Ga0373957_0278127 | 3300035120 | Bacteria | 707 |
| 1916 | Ga0373957_0468043 | 3300035120 | Unclassified | 547 |
| 1917 | Ga0373960_0000054 | 3300035121 | Bacteria | 15902 |
| 1918 | Ga0373960_0080966 | 3300035121 | Bacteria | 1022 |
| 1919 | Ga0373960_0081951 | 3300035121 | Unclassified | 1017 |
| 1920 | Ga0373960_0220995 | 3300035121 | Bacteria | 678 |
| 1921 | Ga0373960_0323604 | 3300035121 | Unclassified | 579 |
| 1922 | Ga0373943_0000751 | 3300035170 | Bacteria | 14122 |
| 1923 | Ga0373943_0165126 | 3300035170 | Bacteria | 1208 |
| 1924 | Ga0373943_0478673 | 3300035170 | Bacteria | 726 |
| 1925 | Ga0373943_0581069 | 3300035170 | Bacteria | 659 |
| 1926 | Ga0373943_0807040 | 3300035170 | Bacteria | 559 |
| 1927 | Ga0373946_0005914 | 3300035171 | Bacteria | 4433 |
| 1928 | Ga0373946_0072757 | 3300035171 | Bacteria | 1489 |
| 1929 | Ga0373955_0006664 | 3300035172 | Bacteria | 5269 |
| 1930 | Ga0373955_0081966 | 3300035172 | Bacteria | 1825 |
| 1931 | Ga0373955_0083243 | 3300035172 | Bacteria | 1812 |
| 1932 | Ga0373955_0388909 | 3300035172 | Unclassified | 847 |
| 1933 | Ga0373955_0595114 | 3300035172 | Bacteria | 677 |
| 1934 | Ga0373961_0000488 | 3300035241 | Bacteria | 15485 |
| 1935 | Ga0373962_0004765 | 3300035242 | Bacteria | 3274 |
| 1936 | Ga0373962_0087955 | 3300035242 | Unclassified | 953 |
| 1937 | Ga0373962_0126547 | 3300035242 | Bacteria | 819 |
| 1938 | Ga0373962_0239607 | 3300035242 | Unclassified | 626 |
| 1939 | Ga0373962_0245360 | 3300035242 | Unclassified | 620 |
| 1940 | Ga0373924_0005158 | 3300035410 | Bacteria | 4612 |
| 1941 | Ga0373924_0192621 | 3300035410 | Bacteria | 898 |
| 1942 | Ga0373924_0590334 | 3300035410 | Unclassified | 501 |
| 1943 | Ga0373931_0000668 | 3300035691 | Bacteria | 14188 |
| 1944 | Ga0373931_0034126 | 3300035691 | Bacteria | 2640 |
| 1945 | Ga0373931_0057882 | 3300035691 | Bacteria | 2080 |
| 1946 | Ga0373931_0515849 | 3300035691 | Bacteria | 773 |
| 1947 | Ga0373931_0761353 | 3300035691 | Unclassified | 643 |
| 1948 | Ga0373935_0213435 | 3300035692 | Bacteria | 1338 |
| 1949 | Ga0373935_0259403 | 3300035692 | Unclassified | 1219 |
| 1950 | Ga0373935_0446138 | 3300035692 | Bacteria | 934 |
| 1951 | Ga0373935_0763068 | 3300035692 | Bacteria | 713 |
| 1952 | Ga0373935_1296175 | 3300035692 | Bacteria | 544 |
| 1953 | Ga0373927_0538799 | 3300035695 | Bacteria | 772 |
| 1954 | Ga0373933_0041252 | 3300035724 | Bacteria | 2724 |
| 1955 | Ga0373933_0426713 | 3300035724 | Bacteria | 866 |
| 1956 | Ga0373933_0743378 | 3300035724 | Unclassified | 645 |
| 1957 | Ga0373933_0916064 | 3300035724 | Bacteria | 577 |
| 1958 | Ga0373947_0266336 | 3300035725 | Bacteria | 1136 |
| 1959 | Ga0373947_0309340 | 3300035725 | Bacteria | 1055 |
| 1960 | Ga0373947_0578678 | 3300035725 | Bacteria | 765 |
| 1961 | Ga0373947_0987376 | 3300035725 | Unclassified | 574 |
| 1962 | Ga0373937_0006676 | 3300036401 | Bacteria | 9964 |
| 1963 | Ga0373937_0013739 | 3300036401 | Bacteria | 7134 |
| 1964 | Ga0373937_0041357 | 3300036401 | Bacteria | 4204 |
| 1965 | Ga0373937_0209941 | 3300036401 | Bacteria | 1832 |
| 1966 | Ga0373937_1531527 | 3300036401 | Unclassified | 614 |
| 1967 | Ga0373937_1981210 | 3300036401 | Bacteria | 528 |
| 1968 | Ga0373937_1988862 | 3300036401 | Unclassified | 527 |
| 1969 | Ga0373925_0006947 | 3300037068 | Bacteria | 8279 |
| 1970 | Ga0373925_0013472 | 3300037068 | Bacteria | 5918 |
| 1971 | Ga0373925_0069270 | 3300037068 | Bacteria | 2665 |
| 1972 | Ga0373925_0098923 | 3300037068 | Bacteria | 2240 |
| 1973 | Ga0373925_0445265 | 3300037068 | Bacteria | 1060 |
| 1974 | Ga0373925_0477981 | 3300037068 | Bacteria | 1022 |
| 1975 | Ga0373925_0913899 | 3300037068 | Bacteria | 723 |
| 1976 | Ga0395905_0700986 | 3300037471 | Bacteria | 915 |
| 1977 | Ga0242420_070702 | 3300038996 | Unclassified | 709 |
| 1978 | Ga0436365_0499271 | 3300039437 | Bacteria | 2444 |
| 1979 | Ga0436365_1017954 | 3300039437 | Bacteria | 695 |
| 1980 | Ga0436365_1174797 | 3300039437 | Bacteria | 881 |
| 1981 | Ga0436365_1696168 | 3300039437 | Bacteria | 3421 |
| 1982 | Ga0439453_0006334 | 3300041408 | Bacteria | 1839 |
| 1983 | Ga0439453_0041454 | 3300041408 | Bacteria | 904 |
| 1984 | Ga0439453_0145113 | 3300041408 | Bacteria | 560 |
| 1985 | Ga0439461_0082133 | 3300041410 | Bacteria | 762 |
| 1986 | Ga0439461_0196797 | 3300041410 | Unclassified | 540 |
| 1987 | Ga0451787_290358 | 3300041441 | Bacteria | 625 |
| 1988 | Ga0451791_0128859 | 3300041451 | Bacteria | 629 |
| 1989 | Ga0451793_1779034 | 3300041452 | Bacteria | 696 |
| 1990 | Ga0451800_0189637 | 3300041459 | Bacteria | 793 |
| 1991 | Ga0451802_0167054 | 3300041460 | Bacteria | 597 |
| 1992 | Ga0451804_0849585 | 3300041463 | Bacteria | 716 |
| 1993 | Ga0451851_1374125 | 3300041507 | Bacteria | 652 |
| 1994 | Ga0451853_0622843 | 3300041512 | Unclassified | 583 |
| 1995 | Ga0451853_0708216 | 3300041512 | Bacteria | 715 |
| 1996 | Ga0451853_1516782 | 3300041512 | Bacteria | 1431 |
| 1997 | Ga0451853_2606140 | 3300041512 | Bacteria | 692 |
| 1998 | Ga0451853_3132910 | 3300041512 | Bacteria | 541 |
| 1999 | Ga0439441_033213 | 3300042001 | Bacteria | 1009 |
| 2000 | Ga0439443_011355 | 3300042003 | Bacteria | 1304 |
| 2001 | Ga0439445_0090707 | 3300042004 | Bacteria | 860 |
| 2002 | Ga0439450_003267 | 3300042008 | Bacteria | 2660 |
| 2003 | Ga0439450_048025 | 3300042008 | Bacteria | 1007 |
| 2004 | Ga0439451_052533 | 3300042009 | Bacteria | 816 |
| 2005 | Ga0439455_0177556 | 3300042012 | Bacteria | 613 |
| 2006 | Ga0439457_111164 | 3300042014 | Unclassified | 643 |
| 2007 | Ga0439462_0056990 | 3300042015 | Bacteria | 1055 |
| 2008 | Ga0439462_0192520 | 3300042015 | Bacteria | 580 |
| 2009 | Ga0450890_085205 | 3300042127 | Bacteria | 519 |
| 2010 | Ga0450896_021212 | 3300042133 | Bacteria | 954 |
| 2011 | Ga0439446_0048404 | 3300042156 | Bacteria | 1266 |
| 2012 | Ga0439446_0157179 | 3300042156 | Bacteria | 750 |
| 2013 | Ga0439446_0181987 | 3300042156 | Unclassified | 703 |
| 2014 | Ga0439435_0038565 | 3300042436 | Bacteria | 1328 |
| 2015 | Ga0439435_0089022 | 3300042436 | Bacteria | 935 |
| 2016 | Ga0439435_0118490 | 3300042436 | Bacteria | 827 |
| 2017 | Ga0439444_0083482 | 3300042437 | Bacteria | 703 |
| 2018 | Ga0439459_0107466 | 3300042438 | Bacteria | 690 |
| 2019 | Ga0439464_0000501 | 3300042439 | Bacteria | 7978 |
| 2020 | Ga0439464_0070641 | 3300042439 | Bacteria | 1033 |
| 2021 | Ga0439464_0104743 | 3300042439 | Bacteria | 862 |
| 2022 | Ga0439464_0119202 | 3300042439 | Bacteria | 812 |
| 2023 | Ga0439464_0212745 | 3300042439 | Unclassified | 619 |
| 2024 | Ga0439464_0242667 | 3300042439 | Bacteria | 581 |
| 2025 | Ga0439460_0051717 | 3300042461 | Bacteria | 1233 |
| 2026 | Ga0439460_0066950 | 3300042461 | Unclassified | 1106 |
| 2027 | Ga0439460_0175085 | 3300042461 | Bacteria | 724 |
| 2028 | Ga0439460_0251812 | 3300042461 | Bacteria | 610 |
| 2029 | Ga0439460_0252503 | 3300042461 | Unclassified | 610 |
| 2030 | Ga0450916_086684 | 3300042530 | Bacteria | 541 |
| 2031 | Ga0450893_0095625 | 3300042532 | Bacteria | 601 |
| 2032 | Ga0450893_0129696 | 3300042532 | Bacteria | 532 |
| 2033 | Ga0451577_0734245 | 3300042876 | Unclassified | 894 |
| 2034 | Ga0439440_0029623 | 3300042993 | Bacteria | 1285 |
| 2035 | Ga0439440_0076260 | 3300042993 | Bacteria | 880 |
| 2036 | Ga0439440_0083429 | 3300042993 | Bacteria | 848 |
| 2037 | Ga0439440_0119709 | 3300042993 | Bacteria | 732 |
| 2038 | Ga0453683_0933121 | 3300044673 | Bacteria | 575 |
| 2039 | Ga0466966_0787118 | 3300044684 | Bacteria | 573 |
| 2040 | Ga0466960_0582000 | 3300044901 | Unclassified | 663 |
| 2041 | Ga0466959_0418768 | 3300045049 | Bacteria | 909 |
| 2042 | Ga0451576_0002764 | 3300045051 | Bacteria | 25371 |
| 2043 | Ga0451576_0008567 | 3300045051 | Bacteria | 11995 |
| 2044 | Ga0451576_0026133 | 3300045051 | Bacteria | 6280 |
| 2045 | Ga0451576_0205304 | 3300045051 | Bacteria | 2057 |
| 2046 | Ga0451576_0213190 | 3300045051 | Bacteria | 2017 |
| 2047 | Ga0451576_0348088 | 3300045051 | Bacteria | 1551 |
| 2048 | Ga0451576_0454491 | 3300045051 | Bacteria | 1345 |
| 2049 | Ga0466967_1739665 | 3300045976 | Bacteria | 621 |
| 2050 | Ga0495592_0419846 | 3300046454 | Bacteria | 844 |
| 2051 | Ga0495603_0035445 | 3300046455 | Bacteria | 2997 |
| 2052 | Ga0495603_0069824 | 3300046455 | Bacteria | 2066 |
| 2053 | Ga0495603_0142734 | 3300046455 | Bacteria | 1393 |
| 2054 | Ga0495603_0376659 | 3300046455 | Bacteria | 814 |
| 2055 | Ga0495590_0318104 | 3300046457 | Unclassified | 588 |
| 2056 | Ga0495590_0319212 | 3300046457 | Bacteria | 587 |
| 2057 | Ga0495629_0080403 | 3300046459 | Bacteria | 2276 |
| 2058 | Ga0495629_0460021 | 3300046459 | Bacteria | 861 |
| 2059 | Ga0495580_0070724 | 3300046472 | Bacteria | 2438 |
| 2060 | Ga0495580_0421106 | 3300046472 | Bacteria | 898 |
| 2061 | Ga0495582_0096328 | 3300046473 | Bacteria | 1654 |
| 2062 | Ga0495582_0219881 | 3300046473 | Bacteria | 1086 |
| 2063 | Ga0495582_0251163 | 3300046473 | Bacteria | 1014 |
| 2064 | Ga0495582_0787471 | 3300046473 | Bacteria | 550 |
| 2065 | Ga0495639_0078014 | 3300046475 | Bacteria | 1539 |
| 2066 | Ga0495639_0156778 | 3300046475 | Bacteria | 1100 |
| 2067 | Ga0495639_0249892 | 3300046475 | Bacteria | 877 |
| 2068 | Ga0495585_0032001 | 3300046492 | Bacteria | 2983 |
| 2069 | Ga0495594_0095743 | 3300046499 | Bacteria | 1667 |
| 2070 | Ga0495594_0114950 | 3300046499 | Bacteria | 1519 |
| 2071 | Ga0495594_0175647 | 3300046499 | Bacteria | 1219 |
| 2072 | Ga0495608_0041215 | 3300046511 | Bacteria | 3091 |
| 2073 | Ga0495608_0580857 | 3300046511 | Bacteria | 674 |
| 2074 | Ga0495618_0457688 | 3300046514 | Bacteria | 774 |
| 2075 | Ga0495618_0668754 | 3300046514 | Unclassified | 613 |
| 2076 | Ga0495620_0235087 | 3300046515 | Bacteria | 700 |
| 2077 | Ga0495628_0061096 | 3300046516 | Bacteria | 2955 |
| 2078 | Ga0495628_0131053 | 3300046516 | Bacteria | 1918 |
| 2079 | Ga0495630_0010405 | 3300046517 | Bacteria | 6717 |
| 2080 | Ga0495630_1196449 | 3300046517 | Unclassified | 575 |
| 2081 | Ga0495637_0069931 | 3300046520 | Bacteria | 1419 |
| 2082 | Ga0495643_0021226 | 3300046522 | Bacteria | 3729 |
| 2083 | Ga0495663_0006839 | 3300046525 | Bacteria | 3146 |
| 2084 | Ga0495663_0046692 | 3300046525 | Bacteria | 1331 |
| 2085 | Ga0495663_0050992 | 3300046525 | Unclassified | 1281 |
| 2086 | Ga0495663_0316575 | 3300046525 | Unclassified | 564 |
| 2087 | Ga0495666_0448962 | 3300046526 | Bacteria | 578 |
| 2088 | Ga0495642_0003038 | 3300046528 | Bacteria | 6683 |
| 2089 | Ga0495642_0164566 | 3300046528 | Bacteria | 962 |
| 2090 | Ga0495652_0961907 | 3300046529 | Unclassified | 560 |
| 2091 | Ga0495665_0583293 | 3300046531 | Bacteria | 560 |
| 2092 | Ga0495640_0067995 | 3300046533 | Bacteria | 2399 |
| 2093 | Ga0495640_0209736 | 3300046533 | Bacteria | 1232 |
| 2094 | Ga0495640_0277619 | 3300046533 | Unclassified | 1044 |
| 2095 | Ga0495640_0360213 | 3300046533 | Bacteria | 897 |
| 2096 | Ga0495640_0920854 | 3300046533 | Bacteria | 517 |
| 2097 | Ga0495598_0005013 | 3300046537 | Bacteria | 2907 |
| 2098 | Ga0495598_0025930 | 3300046537 | Unclassified | 1603 |
| 2099 | Ga0495598_0032705 | 3300046537 | Bacteria | 1471 |
| 2100 | Ga0495598_0292375 | 3300046537 | Unclassified | 614 |
| 2101 | Ga0495609_0014640 | 3300046538 | Bacteria | 3684 |
| 2102 | Ga0495621_0000555 | 3300046539 | Bacteria | 9291 |
| 2103 | Ga0495621_0006303 | 3300046539 | Unclassified | 3455 |
| 2104 | Ga0495621_0011543 | 3300046539 | Bacteria | 2737 |
| 2105 | Ga0495621_0030639 | 3300046539 | Bacteria | 1840 |
| 2106 | Ga0495621_0085787 | 3300046539 | Bacteria | 1180 |
| 2107 | Ga0495621_0216521 | 3300046539 | Bacteria | 774 |
| 2108 | Ga0495621_0517898 | 3300046539 | Bacteria | 516 |
| 2109 | Ga0495597_0197535 | 3300046542 | Bacteria | 807 |
| 2110 | Ga0495597_0387189 | 3300046542 | Bacteria | 533 |
| 2111 | Ga0495645_0171096 | 3300046543 | Bacteria | 1495 |
| 2112 | Ga0495645_0544181 | 3300046543 | Bacteria | 720 |
| 2113 | Ga0495633_0004066 | 3300046558 | Bacteria | 9443 |
| 2114 | Ga0495667_0181985 | 3300046559 | Bacteria | 1348 |
| 2115 | Ga0495667_0198685 | 3300046559 | Bacteria | 1284 |
| 2116 | Ga0495667_0533786 | 3300046559 | Unclassified | 734 |
| 2117 | Ga0495656_0003551 | 3300046615 | Viruses | 5281 |
| 2118 | Ga0495656_0067661 | 3300046615 | Bacteria | 1577 |
| 2119 | Ga0495656_0299122 | 3300046615 | Bacteria | 824 |
| 2120 | Ga0495656_0477808 | 3300046615 | Bacteria | 659 |
| 2121 | Ga0495656_0653390 | 3300046615 | Bacteria | 564 |
| 2122 | Ga0495668_0543035 | 3300046616 | Bacteria | 641 |
| 2123 | Ga0495668_0806823 | 3300046616 | Bacteria | 520 |
| 2124 | Ga0495634_0222999 | 3300046642 | Bacteria | 1163 |
| 2125 | Ga0495634_0672076 | 3300046642 | Bacteria | 597 |
| 2126 | Ga0495635_0438619 | 3300046663 | Bacteria | 864 |
| 2127 | Ga0495635_0571795 | 3300046663 | Bacteria | 740 |
| 2128 | Ga0495659_0001873 | 3300046664 | Bacteria | 6943 |
| 2129 | Ga0495659_0018971 | 3300046664 | Bacteria | 2297 |
| 2130 | Ga0495659_0028277 | 3300046664 | Unclassified | 1940 |
| 2131 | Ga0495659_0084531 | 3300046664 | Bacteria | 1209 |
| 2132 | Ga0495659_0160208 | 3300046664 | Bacteria | 908 |
| 2133 | Ga0495659_0164863 | 3300046664 | Bacteria | 896 |
| 2134 | Ga0495659_0235102 | 3300046664 | Bacteria | 760 |
| 2135 | Ga0495661_0583225 | 3300046665 | Unclassified | 527 |
| 2136 | Ga0495588_0006275 | 3300046674 | Bacteria | 5348 |
| 2137 | Ga0495588_0657634 | 3300046674 | Unclassified | 548 |
| 2138 | Ga0495657_0168432 | 3300046675 | Bacteria | 1351 |
| 2139 | Ga0495657_0507789 | 3300046675 | Bacteria | 703 |
| 2140 | Ga0495623_0168828 | 3300046679 | Bacteria | 1280 |
| 2141 | Ga0495647_0065623 | 3300046681 | Bacteria | 1442 |
| 2142 | Ga0495647_0566169 | 3300046681 | Bacteria | 532 |
| 2143 | Ga0495647_0587810 | 3300046681 | Unclassified | 522 |
| 2144 | Ga0495647_0616088 | 3300046681 | Unclassified | 510 |
| 2145 | Ga0495658_0041345 | 3300046683 | Bacteria | 2568 |
| 2146 | Ga0495658_0044093 | 3300046683 | Bacteria | 2498 |
| 2147 | Ga0495658_0061713 | 3300046683 | Bacteria | 2153 |
| 2148 | Ga0495658_0068362 | 3300046683 | Bacteria | 2057 |
| 2149 | Ga0495658_0150052 | 3300046683 | Bacteria | 1431 |
| 2150 | Ga0495658_0351132 | 3300046683 | Bacteria | 937 |
| 2151 | Ga0495669_0004530 | 3300046684 | Bacteria | 5748 |
| 2152 | Ga0495669_0095986 | 3300046684 | Bacteria | 1373 |
| 2153 | Ga0495669_0145343 | 3300046684 | Bacteria | 1121 |
| 2154 | Ga0495613_0004058 | 3300046689 | Bacteria | 10955 |
| 2155 | Ga0495670_0049911 | 3300046691 | Bacteria | 2094 |
| 2156 | Ga0495670_0157390 | 3300046691 | Bacteria | 1193 |
| 2157 | Ga0495670_0226684 | 3300046691 | Bacteria | 993 |
| 2158 | Ga0495670_0700124 | 3300046691 | Bacteria | 553 |
| 2159 | Ga0495671_0476794 | 3300046692 | Bacteria | 596 |
| 2160 | Ga0495589_0534644 | 3300046794 | Unclassified | 535 |
| 2161 | Ga0495600_0093642 | 3300046809 | Bacteria | 1959 |
| 2162 | Ga0495600_0871425 | 3300046809 | Bacteria | 533 |
| 2163 | Ga0495581_0102584 | 3300047315 | Bacteria | 1662 |
| 2164 | Ga0495581_0480343 | 3300047315 | Unclassified | 723 |
| 2165 | Ga0495604_0049008 | 3300047317 | Bacteria | 3284 |
| 2166 | Ga0495636_0021335 | 3300047318 | Bacteria | 2615 |
| 2167 | Ga0495674_0033229 | 3300047319 | Bacteria | 4674 |
| 2168 | Ga0495674_0705808 | 3300047319 | Bacteria | 791 |
| 2169 | Ga0495672_0101037 | 3300047320 | Bacteria | 1564 |
| 2170 | Ga0495680_0031953 | 3300047322 | Bacteria | 4279 |
| 2171 | Ga0495675_0178139 | 3300047444 | Bacteria | 1303 |
| 2172 | Ga0495677_0084304 | 3300047445 | Bacteria | 1193 |
| 2173 | Ga0495685_009919 | 3300047447 | Bacteria | 3189 |
| 2174 | Ga0495684_0001164 | 3300047471 | Bacteria | 21155 |
| 2175 | Ga0495684_0273660 | 3300047471 | Bacteria | 1221 |
| 2176 | Ga0495684_0422463 | 3300047471 | Bacteria | 932 |
| 2177 | Ga0495684_0801730 | 3300047471 | Bacteria | 615 |
| 2178 | Ga0495602_0154005 | 3300048088 | Unclassified | 1803 |
| 2179 | Ga0496100_0003686 | 3300048903 | Bacteria | 8019 |
| 2180 | Ga0496100_0102699 | 3300048903 | Bacteria | 1973 |
| 2181 | Ga0496100_0826070 | 3300048903 | Bacteria | 726 |
| 2182 | Ga0496100_1225913 | 3300048903 | Bacteria | 592 |
| 2183 | Ga0496100_1583278 | 3300048903 | Bacteria | 518 |
| 2184 | Ga0496101_0001362 | 3300048904 | Bacteria | 14635 |
| 2185 | Ga0496101_0002308 | 3300048904 | Bacteria | 11669 |
| 2186 | Ga0496102_0092641 | 3300048905 | Bacteria | 2799 |
| 2187 | Ga0496102_0805157 | 3300048905 | Bacteria | 862 |
| 2188 | Ga0496102_0852176 | 3300048905 | Bacteria | 833 |
| 2189 | Ga0496103_0938875 | 3300048906 | Bacteria | 541 |
| 2190 | Ga0496104_0011626 | 3300048907 | Bacteria | 7890 |
| 2191 | Ga0496104_0016660 | 3300048907 | Bacteria | 6679 |
| 2192 | Ga0496104_0033356 | 3300048907 | Bacteria | 4795 |
| 2193 | Ga0496104_0142420 | 3300048907 | Bacteria | 2303 |
| 2194 | Ga0496104_0172673 | 3300048907 | Unclassified | 2072 |
| 2195 | Ga0496104_0451856 | 3300048907 | Bacteria | 1197 |
| 2196 | Ga0496104_0708884 | 3300048907 | Bacteria | 914 |
| 2197 | Ga0496104_0760922 | 3300048907 | Unclassified | 875 |
| 2198 | Ga0496104_0870710 | 3300048907 | Unclassified | 806 |
| 2199 | Ga0496105_0033301 | 3300048908 | Unclassified | 4230 |
| 2200 | Ga0496105_0103401 | 3300048908 | Bacteria | 2352 |
| 2201 | Ga0496105_0882718 | 3300048908 | Bacteria | 675 |
| 2202 | Ga0496105_1036711 | 3300048908 | Bacteria | 612 |
| 2203 | Ga0496106_0082789 | 3300048909 | Bacteria | 2467 |
| 2204 | Ga0496106_0133640 | 3300048909 | Unclassified | 1947 |
| 2205 | Ga0496106_0136165 | 3300048909 | Bacteria | 1929 |
| 2206 | Ga0496106_0248477 | 3300048909 | Bacteria | 1422 |
| 2207 | Ga0496106_0281622 | 3300048909 | Bacteria | 1332 |
| 2208 | Ga0496107_0024689 | 3300048910 | Bacteria | 4253 |
| 2209 | Ga0496107_0170039 | 3300048910 | Bacteria | 1617 |
| 2210 | Ga0496107_0687660 | 3300048910 | Bacteria | 753 |
| 2211 | Ga0496107_0726140 | 3300048910 | Bacteria | 730 |
| 2212 | Ga0496108_0008524 | 3300048911 | Bacteria | 8315 |
| 2213 | Ga0496108_1257625 | 3300048911 | Bacteria | 624 |
| 2214 | Ga0496109_0234194 | 3300048912 | Bacteria | 1728 |
| 2215 | Ga0496109_0379850 | 3300048912 | Bacteria | 1335 |
| 2216 | Ga0496109_0550524 | 3300048912 | Bacteria | 1088 |
| 2217 | Ga0496109_1328589 | 3300048912 | Bacteria | 655 |
| 2218 | Ga0496109_1901726 | 3300048912 | Bacteria | 527 |
| 2219 | Ga0496110_0880488 | 3300048913 | Unclassified | 801 |
| 2220 | Ga0496111_0931386 | 3300048914 | Unclassified | 625 |
| 2221 | Ga0496111_1311404 | 3300048914 | Unclassified | 510 |
| 2222 | Ga0496112_0000350 | 3300048915 | Bacteria | 30081 |
| 2223 | Ga0496112_0557811 | 3300048915 | Bacteria | 1079 |
| 2224 | Ga0496112_0914284 | 3300048915 | Bacteria | 799 |
| 2225 | Ga0496112_0920911 | 3300048915 | Unclassified | 796 |
| 2226 | Ga0496112_1081565 | 3300048915 | Bacteria | 720 |
| 2227 | Ga0496113_0015351 | 3300048916 | Bacteria | 5261 |
| 2228 | Ga0496113_0309179 | 3300048916 | Bacteria | 1266 |
| 2229 | Ga0496113_0422096 | 3300048916 | Bacteria | 1071 |
| 2230 | Ga0496114_0000376 | 3300048917 | Bacteria | 32945 |
| 2231 | Ga0496114_0000743 | 3300048917 | Bacteria | 24334 |
| 2232 | Ga0496114_0233463 | 3300048917 | Bacteria | 1616 |
| 2233 | Ga0496114_0278028 | 3300048917 | Bacteria | 1476 |
| 2234 | Ga0496114_0428586 | 3300048917 | Bacteria | 1172 |
| 2235 | Ga0496114_0617754 | 3300048917 | Bacteria | 955 |
| 2236 | Ga0496114_0804382 | 3300048917 | Bacteria | 819 |
| 2237 | Ga0496115_0316972 | 3300048918 | Bacteria | 1276 |
| 2238 | Ga0496115_1026720 | 3300048918 | Bacteria | 629 |
| 2239 | Ga0496115_1032700 | 3300048918 | Unclassified | 627 |
| 2240 | Ga0501294_015730 | 3300049517 | Bacteria | 783 |
| 2241 | Ga0501295_122921 | 3300049518 | Bacteria | 624 |
| 2242 | Ga0501296_048296 | 3300049519 | Bacteria | 617 |
| 2243 | Ga0501298_006410 | 3300049521 | Bacteria | 1924 |
| 2244 | Ga0501298_060304 | 3300049521 | Bacteria | 803 |
| 2245 | Ga0501298_098553 | 3300049521 | Bacteria | 664 |
| 2246 | Ga0501299_009585 | 3300049522 | Bacteria | 1600 |
| 2247 | Ga0501299_042497 | 3300049522 | Bacteria | 917 |
| 2248 | Ga0501300_035172 | 3300049523 | Bacteria | 745 |
| 2249 | Ga0501031_0022156 | 3300049568 | Bacteria | 4139 |
| 2250 | Ga0501031_0270690 | 3300049568 | Bacteria | 1103 |
| 2251 | Ga0501031_0553555 | 3300049568 | Unclassified | 741 |
| 2252 | Ga0501032_0006589 | 3300049569 | Bacteria | 8526 |
| 2253 | Ga0501032_0401009 | 3300049569 | Bacteria | 881 |
| 2254 | Ga0501032_0491969 | 3300049569 | Bacteria | 784 |
| 2255 | Ga0501032_1019488 | 3300049569 | Bacteria | 520 |
| 2256 | Ga0501033_0000802 | 3300049570 | Bacteria | 28770 |
| 2257 | Ga0501033_0620244 | 3300049570 | Bacteria | 740 |
| 2258 | Ga0501034_0007961 | 3300049571 | Bacteria | 11257 |
| 2259 | Ga0501034_0061855 | 3300049571 | Bacteria | 3759 |
| 2260 | Ga0501034_0604594 | 3300049571 | Bacteria | 1002 |
| 2261 | Ga0501036_0001038 | 3300049572 | Bacteria | 20959 |
| 2262 | Ga0501036_0137981 | 3300049572 | Bacteria | 2058 |
| 2263 | Ga0501036_0229783 | 3300049572 | Unclassified | 1557 |
| 2264 | Ga0501036_0804211 | 3300049572 | Bacteria | 774 |
| 2265 | Ga0501037_0007964 | 3300049573 | Bacteria | 7766 |
| 2266 | Ga0501038_0002085 | 3300049574 | Bacteria | 18536 |
| 2267 | Ga0501038_0063914 | 3300049574 | Unclassified | 3140 |
| 2268 | Ga0501038_0070553 | 3300049574 | Bacteria | 2966 |
| 2269 | Ga0501038_0134455 | 3300049574 | Bacteria | 2027 |
| 2270 | Ga0501039_0035250 | 3300049575 | Bacteria | 3861 |
| 2271 | Ga0501039_0079870 | 3300049575 | Bacteria | 2545 |
| 2272 | Ga0501039_0097161 | 3300049575 | Bacteria | 2297 |
| 2273 | Ga0501039_0823994 | 3300049575 | Bacteria | 724 |
| 2274 | Ga0501040_0004120 | 3300049576 | Bacteria | 9457 |
| 2275 | Ga0501040_0009388 | 3300049576 | Bacteria | 6374 |
| 2276 | Ga0501040_0235900 | 3300049576 | Bacteria | 1303 |
| 2277 | Ga0501040_0435656 | 3300049576 | Bacteria | 943 |
| 2278 | Ga0501041_0002267 | 3300049577 | Bacteria | 10877 |
| 2279 | Ga0501041_0025316 | 3300049577 | Bacteria | 3566 |
| 2280 | Ga0501041_0030740 | 3300049577 | Bacteria | 3242 |
| 2281 | Ga0501041_0106125 | 3300049577 | Unclassified | 1741 |
| 2282 | Ga0501041_0309291 | 3300049577 | Bacteria | 996 |
| 2283 | Ga0501042_0026471 | 3300049578 | Bacteria | 4075 |
| 2284 | Ga0501042_0052000 | 3300049578 | Bacteria | 2922 |
| 2285 | Ga0501042_0136359 | 3300049578 | Bacteria | 1769 |
| 2286 | Ga0501042_0150442 | 3300049578 | Bacteria | 1678 |
| 2287 | Ga0501042_0193951 | 3300049578 | Bacteria | 1465 |
| 2288 | Ga0501043_0008493 | 3300049579 | Bacteria | 8082 |
| 2289 | Ga0501043_0069357 | 3300049579 | Bacteria | 2769 |
| 2290 | Ga0501043_0074908 | 3300049579 | Bacteria | 2659 |
| 2291 | Ga0501043_0141733 | 3300049579 | Bacteria | 1882 |
| 2292 | Ga0501043_1059325 | 3300049579 | Bacteria | 575 |
| 2293 | Ga0501046_0004140 | 3300049580 | Bacteria | 13215 |
| 2294 | Ga0501046_0026545 | 3300049580 | Bacteria | 4730 |
| 2295 | Ga0501046_0074986 | 3300049580 | Bacteria | 2624 |
| 2296 | Ga0501046_0088257 | 3300049580 | Unclassified | 2388 |
| 2297 | Ga0501047_0006398 | 3300049581 | Bacteria | 11078 |
| 2298 | Ga0501048_0003752 | 3300049582 | Bacteria | 11592 |
| 2299 | Ga0501048_0015163 | 3300049582 | Bacteria | 5695 |
| 2300 | Ga0501048_0024903 | 3300049582 | Bacteria | 4366 |
| 2301 | Ga0501067_0025800 | 3300049583 | Bacteria | 3257 |
| 2302 | Ga0501068_0003166 | 3300049584 | Bacteria | 8808 |
| 2303 | Ga0501068_0062493 | 3300049584 | Bacteria | 2265 |
| 2304 | Ga0501069_0005034 | 3300049585 | Bacteria | 6851 |
| 2305 | Ga0501069_0179471 | 3300049585 | Unclassified | 1224 |
| 2306 | Ga0501070_0002294 | 3300049586 | Bacteria | 16800 |
| 2307 | Ga0501070_0404783 | 3300049586 | Bacteria | 1103 |
| 2308 | Ga0501070_0985862 | 3300049586 | Unclassified | 654 |
| 2309 | Ga0501071_0027676 | 3300049587 | Bacteria | 3991 |
| 2310 | Ga0501071_0055478 | 3300049587 | Bacteria | 2860 |
| 2311 | Ga0501071_0464889 | 3300049587 | Bacteria | 969 |
| 2312 | Ga0501071_0607286 | 3300049587 | Unclassified | 841 |
| 2313 | Ga0501071_0610052 | 3300049587 | Bacteria | 839 |
| 2314 | Ga0501072_0012349 | 3300049588 | Bacteria | 6528 |
| 2315 | Ga0501072_0148143 | 3300049588 | Unclassified | 1871 |
| 2316 | Ga0501072_0351458 | 3300049588 | Bacteria | 1170 |
| 2317 | Ga0501072_0674836 | 3300049588 | Bacteria | 813 |
| 2318 | Ga0501073_0002819 | 3300049589 | Bacteria | 13014 |
| 2319 | Ga0501073_0878987 | 3300049589 | Bacteria | 617 |
| 2320 | Ga0501074_0048687 | 3300049590 | Bacteria | 3062 |
| 2321 | Ga0501074_0079466 | 3300049590 | Bacteria | 2353 |
| 2322 | Ga0501074_0454250 | 3300049590 | Bacteria | 908 |
| 2323 | Ga0501074_0632510 | 3300049590 | Unclassified | 756 |
| 2324 | Ga0501075_0029245 | 3300049591 | Bacteria | 4073 |
| 2325 | Ga0501075_0033782 | 3300049591 | Bacteria | 3806 |
| 2326 | Ga0501075_0068028 | 3300049591 | Bacteria | 2690 |
| 2327 | Ga0501075_0123538 | 3300049591 | Bacteria | 1970 |
| 2328 | Ga0501075_1088631 | 3300049591 | Unclassified | 607 |
| 2329 | Ga0501075_1142775 | 3300049591 | Unclassified | 591 |
| 2330 | Ga0501075_1375406 | 3300049591 | Bacteria | 535 |
| 2331 | Ga0501076_0000493 | 3300049592 | Bacteria | 24909 |
| 2332 | Ga0501076_0018244 | 3300049592 | Bacteria | 5346 |
| 2333 | Ga0501076_0034055 | 3300049592 | Bacteria | 3979 |
| 2334 | Ga0501076_0191927 | 3300049592 | Bacteria | 1667 |
| 2335 | Ga0501076_0746321 | 3300049592 | Bacteria | 808 |
| 2336 | Ga0501076_0878551 | 3300049592 | Bacteria | 739 |
| 2337 | Ga0501076_1369137 | 3300049592 | Bacteria | 581 |
| 2338 | Ga0501077_0008502 | 3300049593 | Bacteria | 6362 |
| 2339 | Ga0501077_0064473 | 3300049593 | Bacteria | 2324 |
| 2340 | Ga0501077_0077760 | 3300049593 | Bacteria | 2102 |
| 2341 | Ga0501202_027623 | 3300049652 | Bacteria | 1167 |
| 2342 | Ga0501217_007594 | 3300049661 | Bacteria | 2328 |
| 2343 | Ga0501230_169971 | 3300049667 | Unclassified | 500 |
| 2344 | Ga0501235_186940 | 3300049669 | Unclassified | 555 |
| 2345 | Ga0501235_239476 | 3300049669 | Bacteria | 504 |
| 2346 | Ga0501247_036380 | 3300049677 | Bacteria | 690 |
| 2347 | Ga0501248_061256 | 3300049678 | Bacteria | 502 |
| 2348 | Ga0501249_096994 | 3300049679 | Bacteria | 703 |
| 2349 | Ga0501249_174100 | 3300049679 | Bacteria | 553 |
| 2350 | Ga0501253_125808 | 3300049683 | Bacteria | 625 |
| 2351 | Ga0501256_048461 | 3300049685 | Bacteria | 519 |
| 2352 | Ga0501259_136001 | 3300049688 | Bacteria | 597 |
| 2353 | Ga0501225_0046156 | 3300049705 | Bacteria | 1207 |
| 2354 | Ga0501234_055758 | 3300049707 | Bacteria | 664 |
| 2355 | Ga0501245_132744 | 3300049708 | Bacteria | 535 |
| 2356 | Ga0501079_0001320 | 3300049741 | Bacteria | 17436 |
| 2357 | Ga0501079_0055787 | 3300049741 | Bacteria | 3048 |
| 2358 | Ga0501079_0148052 | 3300049741 | Bacteria | 1830 |
| 2359 | Ga0501079_0269800 | 3300049741 | Bacteria | 1330 |
| 2360 | Ga0501079_0843882 | 3300049741 | Bacteria | 721 |
| 2361 | Ga0501079_1279896 | 3300049741 | Bacteria | 577 |
| 2362 | Ga0501080_0001598 | 3300049742 | Bacteria | 19227 |
| 2363 | Ga0501080_0156057 | 3300049742 | Unclassified | 2108 |
| 2364 | Ga0501080_0484605 | 3300049742 | Bacteria | 1106 |
| 2365 | Ga0501081_0002590 | 3300049743 | Bacteria | 11428 |
| 2366 | Ga0501081_0017136 | 3300049743 | Bacteria | 4792 |
| 2367 | Ga0501081_0033945 | 3300049743 | Bacteria | 3470 |
| 2368 | Ga0501081_0130592 | 3300049743 | Unclassified | 1794 |
| 2369 | Ga0501081_0515372 | 3300049743 | Bacteria | 892 |
| 2370 | Ga0501081_1120041 | 3300049743 | Unclassified | 596 |
| 2371 | Ga0501081_1405057 | 3300049743 | Bacteria | 530 |
| 2372 | Ga0501083_0006060 | 3300049744 | Bacteria | 8565 |
| 2373 | Ga0501268_006552 | 3300049765 | Unclassified | 1714 |
| 2374 | Ga0501271_028894 | 3300049768 | Bacteria | 677 |
| 2375 | Ga0501271_066076 | 3300049768 | Unclassified | 515 |
| 2376 | Ga0501273_015205 | 3300049770 | Bacteria | 997 |
| 2377 | Ga0501279_015216 | 3300049775 | Bacteria | 1064 |
| 2378 | Ga0501283_057921 | 3300049779 | Bacteria | 696 |
| 2379 | Ga0501283_084731 | 3300049779 | Unclassified | 600 |
| 2380 | Ga0501035_0006651 | 3300049822 | Bacteria | 10811 |
| 2381 | Ga0501035_0661742 | 3300049822 | Bacteria | 846 |
| 2382 | Ga0501035_1277481 | 3300049822 | Unclassified | 567 |
| 2383 | Ga0501044_0023195 | 3300049823 | Bacteria | 6603 |
| 2384 | Ga0501044_0956189 | 3300049823 | Bacteria | 730 |
| 2385 | Ga0501045_0000838 | 3300049824 | Bacteria | 19920 |
| 2386 | Ga0501045_0010775 | 3300049824 | Bacteria | 6407 |
| 2387 | Ga0501045_0057390 | 3300049824 | Bacteria | 2849 |
| 2388 | Ga0501045_0089985 | 3300049824 | Bacteria | 2267 |
| 2389 | Ga0501045_0454641 | 3300049824 | Bacteria | 952 |
| 2390 | nmdc:mga03683_9150_c1 | 3300050489 | Bacteria | 3511 |
| 2391 | nmdc:mga03n38_427625_c1 | 3300050490 | Bacteria | 733 |
| 2392 | nmdc:mga00v17_162147_c1 | 3300050491 | Bacteria | 1440 |
| 2393 | nmdc:mga00v17_16776_c1 | 3300050491 | Bacteria | 4132 |
| 2394 | nmdc:mga00v17_19858_c1 | 3300050491 | Bacteria | 3842 |
| 2395 | nmdc:mga00v17_266992_c1 | 3300050491 | Bacteria | 1110 |
| 2396 | nmdc:mga0yw44_422286_c1 | 3300050492 | Unclassified | 903 |
| 2397 | nmdc:mga0k408_163490_c1 | 3300050493 | Unclassified | 1326 |
| 2398 | nmdc:mga0k408_319758_c1 | 3300050493 | Bacteria | 926 |
| 2399 | nmdc:mga0k408_3476_c1 | 3300050493 | Bacteria | 8340 |
| 2400 | nmdc:mga0k408_4351_c1 | 3300050493 | Bacteria | 7520 |
| 2401 | nmdc:mga06z11_33122_c1 | 3300050494 | Bacteria | 2525 |
| 2402 | nmdc:mga06z11_416539_c1 | 3300050494 | Unclassified | 810 |
| 2403 | nmdc:mga06z11_469824_c1 | 3300050494 | Bacteria | 761 |
| 2404 | nmdc:mga06z11_486849_c1 | 3300050494 | Bacteria | 747 |
| 2405 | nmdc:mga04h51_15198_c1 | 3300050495 | Bacteria | 2214 |
| 2406 | nmdc:mga04h51_23724_c1 | 3300050495 | Bacteria | 1871 |
| 2407 | nmdc:mga07m45_10008_c1 | 3300050496 | Bacteria | 4937 |
| 2408 | nmdc:mga07m45_456377_c1 | 3300050496 | Bacteria | 741 |
| 2409 | nmdc:mga05p37_138725_c1 | 3300050507 | Bacteria | 2980 |
| 2410 | nmdc:mga05p37_1423837_c1 | 3300050507 | Bacteria | 696 |
| 2411 | nmdc:mga05p37_1570052_c1 | 3300050507 | Unclassified | 650 |
| 2412 | nmdc:mga05p37_1585653_c1 | 3300050507 | Bacteria | 646 |
| 2413 | nmdc:mga05p37_1586392_c1 | 3300050507 | Unclassified | 646 |
| 2414 | nmdc:mga05p37_19535_c1 | 3300050507 | Bacteria | 8196 |
| 2415 | nmdc:mga05p37_200946_c1 | 3300050507 | Bacteria | 2414 |
| 2416 | nmdc:mga05p37_204194_c1 | 3300050507 | Bacteria | 2391 |
| 2417 | nmdc:mga05p37_208332_c1 | 3300050507 | Bacteria | 2364 |
| 2418 | nmdc:mga05p37_2097507_c1 | 3300050507 | Unclassified | 530 |
| 2419 | nmdc:mga05p37_2242885_c1 | 3300050507 | Archaea | 505 |
| 2420 | nmdc:mga05p37_2269157_c1 | 3300050507 | Bacteria | 501 |
| 2421 | nmdc:mga05p37_257923_c1 | 3300050507 | Bacteria | 2088 |
| 2422 | nmdc:mga05p37_312284_c1 | 3300050507 | Bacteria | 1863 |
| 2423 | nmdc:mga05p37_324316_c1 | 3300050507 | Bacteria | 1822 |
| 2424 | nmdc:mga05p37_348950_c1 | 3300050507 | Bacteria | 1743 |
| 2425 | nmdc:mga05p37_398084_c1 | 3300050507 | Bacteria | 1608 |
| 2426 | nmdc:mga05p37_417181_c1 | 3300050507 | Bacteria | 1563 |
| 2427 | nmdc:mga05p37_4344_c1 | 3300050507 | Bacteria | 16546 |
| 2428 | nmdc:mga05p37_52776_c1 | 3300050507 | Bacteria | 4999 |
| 2429 | nmdc:mga05p37_650323_c1 | 3300050507 | Bacteria | 1181 |
| 2430 | nmdc:mga05p37_66851_c1 | 3300050507 | Bacteria | 4421 |
| 2431 | nmdc:mga05p37_77505_c1 | 3300050507 | Bacteria | 4092 |
| 2432 | nmdc:mga05p37_78145_c1 | 3300050507 | Bacteria | 4075 |
| 2433 | nmdc:mga05p37_8727_c1 | 3300050507 | Bacteria | 11971 |
| 2434 | nmdc:mga05p37_9255_c1 | 3300050507 | Bacteria | 11642 |
| 2435 | nmdc:mga05p37_973053_c1 | 3300050507 | Bacteria | 905 |
| 2436 | nmdc:mga09592_1148594_c1 | 3300050508 | Bacteria | 644 |
| 2437 | nmdc:mga09592_1195442_c1 | 3300050508 | Bacteria | 629 |
| 2438 | nmdc:mga09592_123163_c1 | 3300050508 | Bacteria | 2228 |
| 2439 | nmdc:mga09592_1334367_c1 | 3300050508 | Bacteria | 588 |
| 2440 | nmdc:mga09592_14861_c1 | 3300050508 | Bacteria | 6357 |
| 2441 | nmdc:mga09592_1705_c1 | 3300050508 | Bacteria | 17709 |
| 2442 | nmdc:mga09592_366636_c1 | 3300050508 | Bacteria | 1246 |
| 2443 | nmdc:mga09592_37667_c1 | 3300050508 | Bacteria | 4057 |
| 2444 | nmdc:mga09592_446367_c1 | 3300050508 | Bacteria | 1116 |
| 2445 | nmdc:mga09592_456736_c1 | 3300050508 | Bacteria | 1102 |
| 2446 | nmdc:mga09592_4599_c1 | 3300050508 | Bacteria | 5578 |
| 2447 | nmdc:mga09592_48621_c1 | 3300050508 | Bacteria | 3576 |
| 2448 | nmdc:mga09592_5442_c1 | 3300050508 | Bacteria | 10353 |
| 2449 | nmdc:mga09592_610037_c1 | 3300050508 | Bacteria | 934 |
| 2450 | nmdc:mga09592_772917_c1 | 3300050508 | Unclassified | 814 |
| 2451 | nmdc:mga09592_822086_c1 | 3300050508 | Unclassified | 785 |
| 2452 | nmdc:mga09592_90639_c1 | 3300050508 | Bacteria | 2612 |
| 2453 | nmdc:mga0qj67_110252_c1 | 3300050509 | Bacteria | 2221 |
| 2454 | nmdc:mga0qj67_110759_c1 | 3300050509 | Bacteria | 2216 |
| 2455 | nmdc:mga0qj67_14964_c1 | 3300050509 | Bacteria | 5870 |
| 2456 | nmdc:mga0qj67_15370_c1 | 3300050509 | Bacteria | 5796 |
| 2457 | nmdc:mga0qj67_1707_c1 | 3300050509 | Bacteria | 15485 |
| 2458 | nmdc:mga0qj67_192504_c1 | 3300050509 | Bacteria | 1657 |
| 2459 | nmdc:mga0qj67_206936_c1 | 3300050509 | Bacteria | 1594 |
| 2460 | nmdc:mga0qj67_215063_c1 | 3300050509 | Bacteria | 1561 |
| 2461 | nmdc:mga0qj67_254175_c1 | 3300050509 | Bacteria | 1426 |
| 2462 | nmdc:mga0qj67_47063_c1 | 3300050509 | Bacteria | 3407 |
| 2463 | nmdc:mga0qj67_901546_c1 | 3300050509 | Unclassified | 697 |
| 2464 | nmdc:mga06r32_1294905_c1 | 3300050510 | Unclassified | 673 |
| 2465 | nmdc:mga06r32_145316_c1 | 3300050510 | Bacteria | 2349 |
| 2466 | nmdc:mga06r32_300681_c1 | 3300050510 | Bacteria | 1591 |
| 2467 | nmdc:mga06r32_3088_c1 | 3300050510 | Bacteria | 14903 |
| 2468 | nmdc:mga06r32_326778_c1 | 3300050510 | Bacteria | 1519 |
| 2469 | nmdc:mga06r32_376982_c1 | 3300050510 | Bacteria | 1402 |
| 2470 | nmdc:mga06r32_465149_c1 | 3300050510 | Bacteria | 1244 |
| 2471 | nmdc:mga06r32_67915_c1 | 3300050510 | Bacteria | 3442 |
| 2472 | nmdc:mga06r32_7112_c1 | 3300050510 | Bacteria | 10081 |
| 2473 | nmdc:mga06r32_8866_c1 | 3300050510 | Bacteria | 9065 |
| 2474 | nmdc:mga06r32_962622_c1 | 3300050510 | Bacteria | 808 |
| 2475 | nmdc:mga08y16_1003061_c1 | 3300050511 | Bacteria | 815 |
| 2476 | nmdc:mga08y16_109_c1 | 3300050511 | Bacteria | 69745 |
| 2477 | nmdc:mga08y16_1187473_c1 | 3300050511 | Bacteria | 734 |
| 2478 | nmdc:mga08y16_130580_c1 | 3300050511 | Bacteria | 2613 |
| 2479 | nmdc:mga08y16_142950_c1 | 3300050511 | Bacteria | 2487 |
| 2480 | nmdc:mga08y16_143_c2 | 3300050511 | Bacteria | 54311 |
| 2481 | nmdc:mga08y16_15585_c1 | 3300050511 | Bacteria | 7993 |
| 2482 | nmdc:mga08y16_155_c1 | 3300050511 | Bacteria | 31746 |
| 2483 | nmdc:mga08y16_1975190_c1 | 3300050511 | Bacteria | 533 |
| 2484 | nmdc:mga08y16_2023008_c1 | 3300050511 | Bacteria | 525 |
| 2485 | nmdc:mga08y16_2034_c1 | 3300050511 | Bacteria | 20719 |
| 2486 | nmdc:mga08y16_2151888_c1 | 3300050511 | Unclassified | 505 |
| 2487 | nmdc:mga08y16_224915_c1 | 3300050511 | Bacteria | 1942 |
| 2488 | nmdc:mga08y16_31145_c1 | 3300050511 | Bacteria | 5613 |
| 2489 | nmdc:mga08y16_4050_c1 | 3300050511 | Bacteria | 15294 |
| 2490 | nmdc:mga08y16_418880_c1 | 3300050511 | Bacteria | 1369 |
| 2491 | nmdc:mga08y16_433296_c1 | 3300050511 | Unclassified | 1343 |
| 2492 | nmdc:mga08y16_44610_c1 | 3300050511 | Bacteria | 4645 |
| 2493 | nmdc:mga08y16_479407_c1 | 3300050511 | Unclassified | 1266 |
| 2494 | nmdc:mga08y16_480609_c1 | 3300050511 | Bacteria | 1264 |
| 2495 | nmdc:mga08y16_597730_c1 | 3300050511 | Bacteria | 1112 |
| 2496 | nmdc:mga08y16_729099_c1 | 3300050511 | Bacteria | 989 |
| 2497 | nmdc:mga08y16_740118_c1 | 3300050511 | Bacteria | 980 |
| 2498 | nmdc:mga08y16_855459_c1 | 3300050511 | Bacteria | 898 |
| 2499 | nmdc:mga08y16_87907_c1 | 3300050511 | Bacteria | 3238 |
| 2500 | nmdc:mga08y16_8_c1 | 3300050511 | Bacteria | 571177 |
| 2501 | nmdc:mga08y16_920_c1 | 3300050511 | Bacteria | 28551 |
| 2502 | nmdc:mga08y16_92356_c1 | 3300050511 | Bacteria | 3154 |
| 2503 | nmdc:mga0n895_101876_c1 | 3300050512 | Bacteria | 2882 |
| 2504 | nmdc:mga0n895_1036_c1 | 3300050512 | Bacteria | 20226 |
| 2505 | nmdc:mga0n895_109795_c1 | 3300050512 | Bacteria | 829 |
| 2506 | nmdc:mga0n895_1271911_c1 | 3300050512 | Bacteria | 707 |
| 2507 | nmdc:mga0n895_1377323_c1 | 3300050512 | Bacteria | 674 |
| 2508 | nmdc:mga0n895_148694_c1 | 3300050512 | Bacteria | 2372 |
| 2509 | nmdc:mga0n895_15184_c1 | 3300050512 | Bacteria | 7018 |
| 2510 | nmdc:mga0n895_1737421_c1 | 3300050512 | Bacteria | 586 |
| 2511 | nmdc:mga0n895_1738539_c1 | 3300050512 | Archaea | 585 |
| 2512 | nmdc:mga0n895_187108_c1 | 3300050512 | Bacteria | 2102 |
| 2513 | nmdc:mga0n895_1898733_c1 | 3300050512 | Unclassified | 555 |
| 2514 | nmdc:mga0n895_26397_c1 | 3300050512 | Bacteria | 5500 |
| 2515 | nmdc:mga0n895_3447_c1 | 3300050512 | Bacteria | 12768 |
| 2516 | nmdc:mga0n895_426783_c1 | 3300050512 | Bacteria | 1340 |
| 2517 | nmdc:mga0n895_58600_c1 | 3300050512 | Bacteria | 3797 |
| 2518 | nmdc:mga0n895_66607_c1 | 3300050512 | Bacteria | 3566 |
| 2519 | nmdc:mga0n895_686489_c1 | 3300050512 | Bacteria | 1021 |
| 2520 | nmdc:mga0n895_735164_c1 | 3300050512 | Bacteria | 981 |
| 2521 | nmdc:mga0n895_8433_c1 | 3300050512 | Bacteria | 8922 |
| 2522 | nmdc:mga0n895_889507_c1 | 3300050512 | Unclassified | 876 |
| 2523 | nmdc:mga0rr50_1137_c2 | 3300050513 | Bacteria | 12993 |
| 2524 | nmdc:mga0rr50_161849_c1 | 3300050513 | Bacteria | 1817 |
| 2525 | nmdc:mga0rr50_223652_c1 | 3300050513 | Bacteria | 1555 |
| 2526 | nmdc:mga0rr50_23467_c1 | 3300050513 | Bacteria | 4254 |
| 2527 | nmdc:mga0rr50_26163_c1 | 3300050513 | Unclassified | 4066 |
| 2528 | nmdc:mga0rr50_44277_c1 | 3300050513 | Bacteria | 3263 |
| 2529 | nmdc:mga0rr50_457787_c1 | 3300050513 | Bacteria | 1082 |
| 2530 | nmdc:mga0rr50_6472_c1 | 3300050513 | Bacteria | 7133 |
| 2531 | nmdc:mga0rr50_72784_c1 | 3300050513 | Bacteria | 2626 |
| 2532 | nmdc:mga08x19_1108514_c1 | 3300050514 | Unclassified | 562 |
| 2533 | nmdc:mga08x19_221628_c1 | 3300050514 | Bacteria | 1300 |
| 2534 | nmdc:mga08x19_29827_c1 | 3300050514 | Bacteria | 3423 |
| 2535 | nmdc:mga08x19_525248_c1 | 3300050514 | Bacteria | 837 |
| 2536 | nmdc:mga08x19_64303_c1 | 3300050514 | Bacteria | 2382 |
| 2537 | nmdc:mga0a205_119797_c1 | 3300050515 | Unclassified | 2531 |
| 2538 | nmdc:mga0a205_123144_c1 | 3300050515 | Bacteria | 2493 |
| 2539 | nmdc:mga0a205_128247_c1 | 3300050515 | Bacteria | 2437 |
| 2540 | nmdc:mga0a205_1288_c1 | 3300050515 | Bacteria | 21111 |
| 2541 | nmdc:mga0a205_1383640_c1 | 3300050515 | Unclassified | 551 |
| 2542 | nmdc:mga0a205_2131_c1 | 3300050515 | Bacteria | 17373 |
| 2543 | nmdc:mga0a205_23887_c1 | 3300050515 | Bacteria | 5802 |
| 2544 | nmdc:mga0a205_25144_c1 | 3300050515 | Bacteria | 1828 |
| 2545 | nmdc:mga0a205_255663_c1 | 3300050515 | Bacteria | 1630 |
| 2546 | nmdc:mga0a205_330526_c1 | 3300050515 | Bacteria | 1394 |
| 2547 | nmdc:mga0a205_34802_c1 | 3300050515 | Bacteria | 4833 |
| 2548 | nmdc:mga0a205_463659_c1 | 3300050515 | Bacteria | 1126 |
| 2549 | nmdc:mga0a205_495418_c1 | 3300050515 | Unclassified | 1079 |
| 2550 | nmdc:mga0a205_55369_c1 | 3300050515 | Bacteria | 3831 |
| 2551 | nmdc:mga0a205_617923_c1 | 3300050515 | Bacteria | 936 |
| 2552 | nmdc:mga0a205_658392_c1 | 3300050515 | Bacteria | 898 |
| 2553 | nmdc:mga0a205_849795_c1 | 3300050515 | Bacteria | 760 |
| 2554 | Ga0495601_0006402 | 3300053077 | Bacteria | 6886 |
| 2555 | Ga0495601_0024751 | 3300053077 | Bacteria | 3697 |
| 2556 | Ga0495601_0148695 | 3300053077 | Bacteria | 1529 |
| 2557 | Ga0495601_0345043 | 3300053077 | Bacteria | 968 |
| 2558 | Ga0495595_0233959 | 3300053084 | Bacteria | 918 |
| 2559 | Ga0495619_0009733 | 3300053085 | Bacteria | 6059 |
| 2560 | Ga0495619_0113384 | 3300053085 | Bacteria | 1854 |
| 2561 | Ga0495619_0226349 | 3300053085 | Bacteria | 1296 |
| 2562 | Ga0495619_0493149 | 3300053085 | Unclassified | 843 |
| 2563 | Ga0495619_0585239 | 3300053085 | Bacteria | 764 |
| 2564 | Ga0495619_0635129 | 3300053085 | Unclassified | 729 |
| 2565 | Ga0495619_0805831 | 3300053085 | Unclassified | 635 |
| 2566 | Ga0500628_120392 | 3300053129 | Unclassified | 712 |
| 2567 | Ga0501084_0023198 | 3300054114 | Bacteria | 5180 |
| 2568 | Ga0501084_0365658 | 3300054114 | Bacteria | 1219 |
| 2569 | Ga0501084_0459203 | 3300054114 | Bacteria | 1077 |
| 2570 | Ga0501084_0480139 | 3300054114 | Unclassified | 1051 |
| 2571 | Ga0501084_0762796 | 3300054114 | Unclassified | 815 |
| 2572 | Ga0590071_027534 | 3300059421 | Bacteria | 1350 |
| 2573 | Ga0501082_0006809 | 3300060353 | Bacteria | 9878 |
| 2574 | Ga0501082_0043983 | 3300060353 | Bacteria | 3852 |
| 2575 | Ga0501082_0205551 | 3300060353 | Bacteria | 1713 |
| 2576 | Ga0501082_0644256 | 3300060353 | Unclassified | 927 |
| 2577 | Ga0530510_0001782 | 3300061734 | Bacteria | 14686 |
| 2578 | Ga0530510_0006476 | 3300061734 | Bacteria | 8154 |
| 2579 | Ga0307405_11364608 | |||
| 2580 | ARSoilOldRDRAFT_c015219 | |||
| 2581 | JGI24746J21847_1001104 | |||
| 2582 | JGI24743J22301_10152721 | |||
| 2583 | JGI24745J21846_1035581 | |||
| 2584 | JGI24035J26624_1018769 | |||
| 2585 | JGI24033J26618_1014535 | |||
| 2586 | JGI24751J29686_10039997 | |||
| 2587 | JGI24751J29686_10092875 | |||
| 2588 | JGI25406J46586_10001848 | |||
| 2589 | JGI25406J46586_10015761 | |||
| 2590 | Ga0007409J51694_1094330 | |||
| 2591 | Ga0007429J51699_1091030 | |||
| 2592 | Ga0058859_11801951 | |||
| 2593 | Ga0058860_11976869 | |||
| 2594 | Ga0058860_11990331 | |||
| 2595 | Ga0065714_10076628 | |||
| 2596 | Ga0065714_10083759 | |||
| 2597 | Ga0065714_10127161 | |||
| 2598 | Ga0065714_10314071 | |||
| 2599 | Ga0065704_10073095 | |||
| 2600 | Ga0065704_10414867 | |||
| 2601 | Ga0065704_10580918 | |||
| 2602 | Ga0065704_10585035 | |||
| 2603 | Ga0065704_10655043 | |||
| 2604 | Ga0065712_10000606 | |||
| 2605 | Ga0065712_10001610 | |||
| 2606 | Ga0065712_10003904 | |||
| 2607 | Ga0065712_10031832 | |||
| 2608 | Ga0065712_10068769 | |||
| 2609 | Ga0065712_10091814 | |||
| 2610 | Ga0065712_10094945 | |||
| 2611 | Ga0065712_10141090 | |||
| 2612 | Ga0065712_10158009 | |||
| 2613 | Ga0065712_10159214 | |||
| 2614 | Ga0065712_10338388 | |||
| 2615 | Ga0065712_10605506 | |||
| 2616 | Ga0065712_10668066 | |||
| 2617 | Ga0065715_10000608 | |||
| 2618 | Ga0065715_10103698 | |||
| 2619 | Ga0065715_10134926 | |||
| 2620 | Ga0065715_10171014 | |||
| 2621 | Ga0065715_10371651 | |||
| 2622 | Ga0065715_10484167 | |||
| 2623 | Ga0065715_10502292 | |||
| 2624 | Ga0065715_10588216 | |||
| 2625 | Ga0065715_10634163 | |||
| 2626 | Ga0065715_10719491 | |||
| 2627 | Ga0065715_10764053 | |||
| 2628 | Ga0065715_10874796 | |||
| 2629 | Ga0065715_10959652 | |||
| 2630 | Ga0065715_10995081 | |||
| 2631 | Ga0065707_10001625 | |||
| 2632 | Ga0065707_10025113 | |||
| 2633 | Ga0065707_10052146 | |||
| 2634 | Ga0065707_10113954 | |||
| 2635 | Ga0065707_10115210 | |||
| 2636 | Ga0065707_10117763 | |||
| 2637 | Ga0065707_10121036 | |||
| 2638 | Ga0065707_10143401 | |||
| 2639 | Ga0065707_10427017 | |||
| 2640 | Ga0065707_10437955 | |||
| 2641 | Ga0065707_10500829 | |||
| 2642 | Ga0065707_10774695 | |||
| 2643 | Ga0065707_10913582 | |||
| 2644 | Ga0070658_10024349 | |||
| 2645 | Ga0070676_10017097 | |||
| 2646 | Ga0070676_10044432 | |||
| 2647 | Ga0070676_10053805 | |||
| 2648 | Ga0070676_10105547 | |||
| 2649 | Ga0070676_10127756 | |||
| 2650 | Ga0070676_10310803 | |||
| 2651 | Ga0070676_10478139 | |||
| 2652 | Ga0070676_10498232 | |||
| 2653 | Ga0070676_11177469 | |||
| 2654 | Ga0070683_100028120 | |||
| 2655 | Ga0070683_100032991 | |||
| 2656 | Ga0070683_100413841 | |||
| 2657 | Ga0070683_101239933 | |||
| 2658 | Ga0070683_101310690 | |||
| 2659 | Ga0070690_100029489 | |||
| 2660 | Ga0070690_100029519 | |||
| 2661 | Ga0070690_100031442 | |||
| 2662 | Ga0070690_100072866 | |||
| 2663 | Ga0070690_100204853 | |||
| 2664 | Ga0070690_100242064 | |||
| 2665 | Ga0070670_100005242 | |||
| 2666 | Ga0070670_100016095 | |||
| 2667 | Ga0070670_100026591 | |||
| 2668 | Ga0070670_100080922 | |||
| 2669 | Ga0070670_100128918 | |||
| 2670 | Ga0070670_100134769 | |||
| 2671 | Ga0070670_100268650 | |||
| 2672 | Ga0070670_100433912 | |||
| 2673 | Ga0070670_100492261 | |||
| 2674 | Ga0070670_100532565 | |||
| 2675 | Ga0070670_100723340 | |||
| 2676 | Ga0070670_101025573 | |||
| 2677 | Ga0070670_101787004 | |||
| 2678 | Ga0070677_10016037 | |||
| 2679 | Ga0070677_10026731 | |||
| 2680 | Ga0070677_10520465 | |||
| 2681 | Ga0070677_10528286 | |||
| 2682 | Ga0070677_10898464 | |||
| 2683 | Ga0068869_100061574 | |||
| 2684 | Ga0068869_100070719 | |||
| 2685 | Ga0068869_100115629 | |||
| 2686 | Ga0068869_100285361 | |||
| 2687 | Ga0068869_100304936 | |||
| 2688 | Ga0068869_100405883 | |||
| 2689 | Ga0068869_100587127 | |||
| 2690 | Ga0068869_100619234 | |||
| 2691 | Ga0068869_101161982 | |||
| 2692 | Ga0068869_101245466 | |||
| 2693 | Ga0068869_101275269 | |||
| 2694 | Ga0068869_101649782 | |||
| 2695 | Ga0070666_10015435 | |||
| 2696 | Ga0070666_10025573 | |||
| 2697 | Ga0070666_10063003 | |||
| 2698 | Ga0070666_10141298 | |||
| 2699 | Ga0070666_10249856 | |||
| 2700 | Ga0070666_10363174 | |||
| 2701 | Ga0070666_10462801 | |||
| 2702 | Ga0070666_10509488 | |||
| 2703 | Ga0070666_11107230 | |||
| 2704 | Ga0070680_100081806 | |||
| 2705 | Ga0070680_100274873 | |||
| 2706 | Ga0070682_100177524 | |||
| 2707 | Ga0070682_100393341 | |||
| 2708 | Ga0070682_100408628 | |||
| 2709 | Ga0068868_100002613 | |||
| 2710 | Ga0068868_100125325 | |||
| 2711 | Ga0068868_100168029 | |||
| 2712 | Ga0068868_100181016 | |||
| 2713 | Ga0068868_100406504 | |||
| 2714 | Ga0068868_100474576 | |||
| 2715 | Ga0068868_100753819 | |||
| 2716 | Ga0068868_100896550 | |||
| 2717 | Ga0068868_101754862 | |||
| 2718 | Ga0070660_100790408 | |||
| 2719 | Ga0070689_100004747 | |||
| 2720 | Ga0070689_100008229 | |||
| 2721 | Ga0070689_100014545 | |||
| 2722 | Ga0070689_100017434 | |||
| 2723 | Ga0070689_100020726 | |||
| 2724 | Ga0070689_100046423 | |||
| 2725 | Ga0070689_100633346 | |||
| 2726 | Ga0070689_101011754 | |||
| 2727 | Ga0070691_10034977 | |||
| 2728 | Ga0070691_10133947 | |||
| 2729 | Ga0070691_10247625 | |||
| 2730 | Ga0070691_10440904 | |||
| 2731 | Ga0070691_10521898 | |||
| 2732 | Ga0070691_10650128 | |||
| 2733 | Ga0070687_100002751 | |||
| 2734 | Ga0070687_100071459 | |||
| 2735 | Ga0070687_100091341 | |||
| 2736 | Ga0070687_100141709 | |||
| 2737 | Ga0070687_100403390 | |||
| 2738 | Ga0070687_100426936 | |||
| 2739 | Ga0070687_100581574 | |||
| 2740 | Ga0070687_100619469 | |||
| 2741 | Ga0070687_100876420 | |||
| 2742 | Ga0070661_100073736 | |||
| 2743 | Ga0070661_100154837 | |||
| 2744 | Ga0070661_100158947 | |||
| 2745 | Ga0070661_100360176 | |||
| 2746 | Ga0070661_100425917 | |||
| 2747 | Ga0070661_100527358 | |||
| 2748 | Ga0070661_101075215 | |||
| 2749 | Ga0070661_101303844 | |||
| 2750 | Ga0070661_101891011 | |||
| 2751 | Ga0070692_10026150 | |||
| 2752 | Ga0070692_10053127 | |||
| 2753 | Ga0070692_10107616 | |||
| 2754 | Ga0070692_10112288 | |||
| 2755 | Ga0070692_10163313 | |||
| 2756 | Ga0070692_10348102 | |||
| 2757 | Ga0070668_100011207 | |||
| 2758 | Ga0070668_100034459 | |||
| 2759 | Ga0070668_100236894 | |||
| 2760 | Ga0070668_100308244 | |||
| 2761 | Ga0070668_100793733 | |||
| 2762 | Ga0070668_100825367 | |||
| 2763 | Ga0070668_101633597 | |||
| 2764 | Ga0070668_101740917 | |||
| 2765 | Ga0070668_102005199 | |||
| 2766 | Ga0070669_100003660 | |||
| 2767 | Ga0070669_100023915 | |||
| 2768 | Ga0070669_100027137 | |||
| 2769 | Ga0070669_100068139 | |||
| 2770 | Ga0070669_100139991 | |||
| 2771 | Ga0070669_100167787 | |||
| 2772 | Ga0070669_100190989 | |||
| 2773 | Ga0070669_100306614 | |||
| 2774 | Ga0070669_100328516 | |||
| 2775 | Ga0070669_100482997 | |||
| 2776 | Ga0070669_100572812 | |||
| 2777 | Ga0070669_100803504 | |||
| 2778 | Ga0070669_100974136 | |||
| 2779 | Ga0070669_101036047 | |||
| 2780 | Ga0070669_101391786 | |||
| 2781 | Ga0070675_100012940 | |||
| 2782 | Ga0070675_100016195 | |||
| 2783 | Ga0070675_100023187 | |||
| 2784 | Ga0070675_100028016 | |||
| 2785 | Ga0070675_100032799 | |||
| 2786 | Ga0070675_100043086 | |||
| 2787 | Ga0070675_100043190 | |||
| 2788 | Ga0070675_100054777 | |||
| 2789 | Ga0070675_100092883 | |||
| 2790 | Ga0070675_100094360 | |||
| 2791 | Ga0070675_100106368 | |||
| 2792 | Ga0070675_100124332 | |||
| 2793 | Ga0070675_100140257 | |||
| 2794 | Ga0070675_100140848 | |||
| 2795 | Ga0070675_100161639 | |||
| 2796 | Ga0070675_100252931 | |||
| 2797 | Ga0070675_100348204 | |||
| 2798 | Ga0070675_100898481 | |||
| 2799 | Ga0070675_100953523 | |||
| 2800 | Ga0070675_101025816 | |||
| 2801 | Ga0070675_101082920 | |||
| 2802 | Ga0070675_101148262 | |||
| 2803 | Ga0070671_100018697 | |||
| 2804 | Ga0070671_100027473 | |||
| 2805 | Ga0070671_100037768 | |||
| 2806 | Ga0070671_100226603 | |||
| 2807 | Ga0070671_100239244 | |||
| 2808 | Ga0070671_100268189 | |||
| 2809 | Ga0070671_100511295 | |||
| 2810 | Ga0070671_101088131 | |||
| 2811 | Ga0070671_101218468 | |||
| 2812 | Ga0070674_100023482 | |||
| 2813 | Ga0070674_100030097 | |||
| 2814 | Ga0070674_100108249 | |||
| 2815 | Ga0070674_100145197 | |||
| 2816 | Ga0070674_100164633 | |||
| 2817 | Ga0070674_100189381 | |||
| 2818 | Ga0070674_100299300 | |||
| 2819 | Ga0070674_100350905 | |||
| 2820 | Ga0070674_100375091 | |||
| 2821 | Ga0070674_100410449 | |||
| 2822 | Ga0070674_100428067 | |||
| 2823 | Ga0070674_100645872 | |||
| 2824 | Ga0070674_100694804 | |||
| 2825 | Ga0070674_100705686 | |||
| 2826 | Ga0070674_100747991 | |||
| 2827 | Ga0070674_100875338 | |||
| 2828 | Ga0070674_101028974 | |||
| 2829 | Ga0070674_101177315 | |||
| 2830 | Ga0070674_101328677 | |||
| 2831 | Ga0070674_101491724 | |||
| 2832 | Ga0070674_101505806 | |||
| 2833 | Ga0070674_102092931 | |||
| 2834 | Ga0070673_100002420 | |||
| 2835 | Ga0070673_100088599 | |||
| 2836 | Ga0070673_100116081 | |||
| 2837 | Ga0070673_100156089 | |||
| 2838 | Ga0070673_100158464 | |||
| 2839 | Ga0070673_100207926 | |||
| 2840 | Ga0070673_100242943 | |||
| 2841 | Ga0070673_100251410 | |||
| 2842 | Ga0070673_100272696 | |||
| 2843 | Ga0070673_100373103 | |||
| 2844 | Ga0070673_100588565 | |||
| 2845 | Ga0070673_100879958 | |||
| 2846 | Ga0070673_101084985 | |||
| 2847 | Ga0070673_101089057 | |||
| 2848 | Ga0070688_100001753 | |||
| 2849 | Ga0070688_100021218 | |||
| 2850 | Ga0070688_100028061 | |||
| 2851 | Ga0070688_100029021 | |||
| 2852 | Ga0070688_100100222 | |||
| 2853 | Ga0070688_100122052 | |||
| 2854 | Ga0070688_100176393 | |||
| 2855 | Ga0070688_100180496 | |||
| 2856 | Ga0070688_100288123 | |||
| 2857 | Ga0070688_100565502 | |||
| 2858 | Ga0070688_101139966 | |||
| 2859 | Ga0070659_100236015 | |||
| 2860 | Ga0070659_100623034 | |||
| 2861 | Ga0070659_101214932 | |||
| 2862 | Ga0070667_100013896 | |||
| 2863 | Ga0070667_100066891 | |||
| 2864 | Ga0070667_100234216 | |||
| 2865 | Ga0070667_100301068 | |||
| 2866 | Ga0070667_100344106 | |||
| 2867 | Ga0070667_100562263 | |||
| 2868 | Ga0070667_100917851 | |||
| 2869 | Ga0070667_101392029 | |||
| 2870 | Ga0070667_102300926 | |||
| 2871 | Ga0070703_10009612 | |||
| 2872 | Ga0070703_10291958 | |||
| 2873 | Ga0070703_10298510 | |||
| 2874 | Ga0070703_10300647 | |||
| 2875 | Ga0070703_10314820 | |||
| 2876 | Ga0070703_10336997 | |||
| 2877 | Ga0070703_10526263 | |||
| 2878 | Ga0070709_10005339 | |||
| 2879 | Ga0070709_10050658 | |||
| 2880 | Ga0070709_10210736 | |||
| 2881 | Ga0070709_10714089 | |||
| 2882 | Ga0070714_100009036 | |||
| 2883 | Ga0070713_100023853 | |||
| 2884 | Ga0070713_100027285 | |||
| 2885 | Ga0070713_100080898 | |||
| 2886 | Ga0070713_100406747 | |||
| 2887 | Ga0070713_100463062 | |||
| 2888 | Ga0070710_10769953 | |||
| 2889 | Ga0070701_10012529 | |||
| 2890 | Ga0070701_10016470 | |||
| 2891 | Ga0070701_10125174 | |||
| 2892 | Ga0070701_10169327 | |||
| 2893 | Ga0070701_10194546 | |||
| 2894 | Ga0070701_10248957 | |||
| 2895 | Ga0070701_10289216 | |||
| 2896 | Ga0070701_10758140 | |||
| 2897 | Ga0070701_11208803 | |||
| 2898 | Ga0070711_100295535 | |||
| 2899 | Ga0070711_100457063 | |||
| 2900 | Ga0070711_101395811 | |||
| 2901 | Ga0070705_100000897 | |||
| 2902 | Ga0070705_100006850 | |||
| 2903 | Ga0070705_100124191 | |||
| 2904 | Ga0070705_100205457 | |||
| 2905 | Ga0070705_100242684 | |||
| 2906 | Ga0070705_100246944 | |||
| 2907 | Ga0070705_100367941 | |||
| 2908 | Ga0070705_100571827 | |||
| 2909 | Ga0070705_100662030 | |||
| 2910 | Ga0070705_100666645 | |||
| 2911 | Ga0070705_100739537 | |||
| 2912 | Ga0070705_100813033 | |||
| 2913 | Ga0070705_100894032 | |||
| 2914 | Ga0070700_100007200 | |||
| 2915 | Ga0070700_100022411 | |||
| 2916 | Ga0070700_100037500 | |||
| 2917 | Ga0070700_100053729 | |||
| 2918 | Ga0070700_100088454 | |||
| 2919 | Ga0070700_100104342 | |||
| 2920 | Ga0070700_100270299 | |||
| 2921 | Ga0070700_100312355 | |||
| 2922 | Ga0070700_100400437 | |||
| 2923 | Ga0070700_100559901 | |||
| 2924 | Ga0070700_101053215 | |||
| 2925 | Ga0070700_101325125 | |||
| 2926 | Ga0070700_101525443 | |||
| 2927 | Ga0070700_101982619 | |||
| 2928 | Ga0070694_100001253 | |||
| 2929 | Ga0070694_100001998 | |||
| 2930 | Ga0070694_100115736 | |||
| 2931 | Ga0070694_100128153 | |||
| 2932 | Ga0070694_100131235 | |||
| 2933 | Ga0070694_100167894 | |||
| 2934 | Ga0070694_100177663 | |||
| 2935 | Ga0070694_100237418 | |||
| 2936 | Ga0070694_100328764 | |||
| 2937 | Ga0070694_100376892 | |||
| 2938 | Ga0070694_100395988 | |||
| 2939 | Ga0070694_100932338 | |||
| 2940 | Ga0070708_100370669 | |||
| 2941 | Ga0070708_100469016 | |||
| 2942 | Ga0070708_100860041 | |||
| 2943 | Ga0070708_100960275 | |||
| 2944 | Ga0070663_100074691 | |||
| 2945 | Ga0070663_101513983 | |||
| 2946 | Ga0070678_100038726 | |||
| 2947 | Ga0070678_100041676 | |||
| 2948 | Ga0070678_100069671 | |||
| 2949 | Ga0070678_100091538 | |||
| 2950 | Ga0070678_100139864 | |||
| 2951 | Ga0070678_100169062 | |||
| 2952 | Ga0070678_100179023 | |||
| 2953 | Ga0070678_100295380 | |||
| 2954 | Ga0070678_100418905 | |||
| 2955 | Ga0070678_100554615 | |||
| 2956 | Ga0070678_100657645 | |||
| 2957 | Ga0070678_100742766 | |||
| 2958 | Ga0070678_100835535 | |||
| 2959 | Ga0070678_100845601 | |||
| 2960 | Ga0070678_100862061 | |||
| 2961 | Ga0070678_101094782 | |||
| 2962 | Ga0070678_101521889 | |||
| 2963 | Ga0070662_100043913 | |||
| 2964 | Ga0070662_100083192 | |||
| 2965 | Ga0070662_100160289 | |||
| 2966 | Ga0070662_100189813 | |||
| 2967 | Ga0070662_100354017 | |||
| 2968 | Ga0070662_100473685 | |||
| 2969 | Ga0070662_100501443 | |||
| 2970 | Ga0070662_100655831 | |||
| 2971 | Ga0070662_100739496 | |||
| 2972 | Ga0070662_100958487 | |||
| 2973 | Ga0070662_101139730 | |||
| 2974 | Ga0070662_101201037 | |||
| 2975 | Ga0070662_101341898 | |||
| 2976 | Ga0070681_10036359 | |||
| 2977 | Ga0070681_10234728 | |||
| 2978 | Ga0070681_10245415 | |||
| 2979 | Ga0070681_10315070 | |||
| 2980 | Ga0070681_10353760 | |||
| 2981 | Ga0070681_10544930 | |||
| 2982 | Ga0070681_11123333 | |||
| 2983 | Ga0068867_100007393 | |||
| 2984 | Ga0068867_100008654 | |||
| 2985 | Ga0068867_100012752 | |||
| 2986 | Ga0068867_100016089 | |||
| 2987 | Ga0068867_100145700 | |||
| 2988 | Ga0068867_100286851 | |||
| 2989 | Ga0068867_100311441 | |||
| 2990 | Ga0068867_100521265 | |||
| 2991 | Ga0068867_101345790 | |||
| 2992 | Ga0068867_101365680 | |||
| 2993 | Ga0068867_101520011 | |||
| 2994 | Ga0068867_101754969 | |||
| 2995 | Ga0068867_101761317 | |||
| 2996 | Ga0068867_102056289 | |||
| 2997 | Ga0070685_10000947 | |||
| 2998 | Ga0070685_10202006 | |||
| 2999 | Ga0070685_10214530 | |||
| 3000 | Ga0070685_10309048 | |||
| 3001 | Ga0070685_10360382 | |||
| 3002 | Ga0070685_10374420 | |||
| 3003 | Ga0070685_10425666 | |||
| 3004 | Ga0070685_10561825 | |||
| 3005 | Ga0070685_11007625 | |||
| 3006 | Ga0070685_11579551 | |||
| 3007 | Ga0070706_100313699 | |||
| 3008 | Ga0070706_100433779 | |||
| 3009 | Ga0070706_100501160 | |||
| 3010 | Ga0070706_100581790 | |||
| 3011 | Ga0070706_100983878 | |||
| 3012 | Ga0070706_101123123 | |||
| 3013 | Ga0070706_101271203 | |||
| 3014 | Ga0070706_101283085 | |||
| 3015 | Ga0070707_100106563 | |||
| 3016 | Ga0070707_100116361 | |||
| 3017 | Ga0070707_100118656 | |||
| 3018 | Ga0070707_100176549 | |||
| 3019 | Ga0070707_100676427 | |||
| 3020 | Ga0070707_100737860 | |||
| 3021 | Ga0070707_101767055 | |||
| 3022 | Ga0070707_102271565 | |||
| 3023 | Ga0070698_100036634 | |||
| 3024 | Ga0070698_100077203 | |||
| 3025 | Ga0070698_100084104 | |||
| 3026 | Ga0070698_100141206 | |||
| 3027 | Ga0070698_100292134 | |||
| 3028 | Ga0070698_100392553 | |||
| 3029 | Ga0070698_100572122 | |||
| 3030 | Ga0070698_100623826 | |||
| 3031 | Ga0070698_100627389 | |||
| 3032 | Ga0070698_100765102 | |||
| 3033 | Ga0070698_100919765 | |||
| 3034 | Ga0070698_100927033 | |||
| 3035 | Ga0070698_101139025 | |||
| 3036 | Ga0070698_102055084 | |||
| 3037 | Ga0070699_100000410 | |||
| 3038 | Ga0070699_100000753 | |||
| 3039 | Ga0070699_100017510 | |||
| 3040 | Ga0070699_100032358 | |||
| 3041 | Ga0070699_100072950 | |||
| 3042 | Ga0070699_100091280 | |||
| 3043 | Ga0070699_100135537 | |||
| 3044 | Ga0070699_100245741 | |||
| 3045 | Ga0070699_100390198 | |||
| 3046 | Ga0070699_100489514 | |||
| 3047 | Ga0070699_100847762 | |||
| 3048 | Ga0070699_101095718 | |||
| 3049 | Ga0070699_101172278 | |||
| 3050 | Ga0070699_101389000 | |||
| 3051 | Ga0070699_101479520 | |||
| 3052 | Ga0070679_100059093 | |||
| 3053 | Ga0070679_100179646 | |||
| 3054 | Ga0070679_101106211 | |||
| 3055 | Ga0070679_101360741 | |||
| 3056 | Ga0070684_100098813 | |||
| 3057 | Ga0070684_100646836 | |||
| 3058 | Ga0070684_100763403 | |||
| 3059 | Ga0070684_101290966 | |||
| 3060 | Ga0070684_101347554 | |||
| 3061 | Ga0070684_101497389 | |||
| 3062 | Ga0070697_100033368 | |||
| 3063 | Ga0070697_100240185 | |||
| 3064 | Ga0070697_100349499 | |||
| 3065 | Ga0070697_100590548 | |||
| 3066 | Ga0070697_100691193 | |||
| 3067 | Ga0070697_100835451 | |||
| 3068 | Ga0070697_102022129 | |||
| 3069 | Ga0068853_100300755 | |||
| 3070 | Ga0068853_100491875 | |||
| 3071 | Ga0070672_100005033 | |||
| 3072 | Ga0070672_100018161 | |||
| 3073 | Ga0070672_100018273 | |||
| 3074 | Ga0070672_100028636 | |||
| 3075 | Ga0070672_100057910 | |||
| 3076 | Ga0070672_100091670 | |||
| 3077 | Ga0070672_100132620 | |||
| 3078 | Ga0070672_100137378 | |||
| 3079 | Ga0070672_100138059 | |||
| 3080 | Ga0070672_100154028 | |||
| 3081 | Ga0070672_100218002 | |||
| 3082 | Ga0070672_100400931 | |||
| 3083 | Ga0070672_100428513 | |||
| 3084 | Ga0070672_100522166 | |||
| 3085 | Ga0070672_100590641 | |||
| 3086 | Ga0070672_101133921 | |||
| 3087 | Ga0070672_101149525 | |||
| 3088 | Ga0070672_101465441 | |||
| 3089 | Ga0070686_100001410 | |||
| 3090 | Ga0070686_100018367 | |||
| 3091 | Ga0070686_100066401 | |||
| 3092 | Ga0070686_100073995 | |||
| 3093 | Ga0070686_100096363 | |||
| 3094 | Ga0070686_100182542 | |||
| 3095 | Ga0070686_100322083 | |||
| 3096 | Ga0070686_100455187 | |||
| 3097 | Ga0070686_100473925 | |||
| 3098 | Ga0070686_100473950 | |||
| 3099 | Ga0070686_100548966 | |||
| 3100 | Ga0070686_101240827 | |||
| 3101 | Ga0070686_101788966 | |||
| 3102 | Ga0070686_101918884 | |||
| 3103 | Ga0070686_101952522 | |||
| 3104 | Ga0070695_100000939 | |||
| 3105 | Ga0070695_100041621 | |||
| 3106 | Ga0070695_100058755 | |||
| 3107 | Ga0070695_100088445 | |||
| 3108 | Ga0070695_100141576 | |||
| 3109 | Ga0070695_100191216 | |||
| 3110 | Ga0070695_100723857 | |||
| 3111 | Ga0070695_101281754 | |||
| 3112 | Ga0070696_100001074 | |||
| 3113 | Ga0070696_100008820 | |||
| 3114 | Ga0070696_100038629 | |||
| 3115 | Ga0070696_100103211 | |||
| 3116 | Ga0070696_100107749 | |||
| 3117 | Ga0070696_100251895 | |||
| 3118 | Ga0070696_100456033 | |||
| 3119 | Ga0070696_100681800 | |||
| 3120 | Ga0070693_100261677 | |||
| 3121 | Ga0070693_100897588 | |||
| 3122 | Ga0070665_100012666 | |||
| 3123 | Ga0070665_100029781 | |||
| 3124 | Ga0070665_100034631 | |||
| 3125 | Ga0070665_101007899 | |||
| 3126 | Ga0070704_100001249 | |||
| 3127 | Ga0070704_100004940 | |||
| 3128 | Ga0070704_100025590 | |||
| 3129 | Ga0070704_100102200 | |||
| 3130 | Ga0070704_100111026 | |||
| 3131 | Ga0070704_100122788 | |||
| 3132 | Ga0070704_100184666 | |||
| 3133 | Ga0070704_100251466 | |||
| 3134 | Ga0070704_100525243 | |||
| 3135 | Ga0070704_100627521 | |||
| 3136 | Ga0070704_100685322 | |||
| 3137 | Ga0070704_100994962 | |||
| 3138 | Ga0070704_101019325 | |||
| 3139 | Ga0070704_101100846 | |||
| 3140 | Ga0070704_101386655 | |||
| 3141 | Ga0070704_101397212 | |||
| 3142 | Ga0070704_101598784 | |||
| 3143 | Ga0070664_100006618 | |||
| 3144 | Ga0070664_100023419 | |||
| 3145 | Ga0070664_100041208 | |||
| 3146 | Ga0070664_100101236 | |||
| 3147 | Ga0070664_100149280 | |||
| 3148 | Ga0070664_100432279 | |||
| 3149 | Ga0070664_100451037 | |||
| 3150 | Ga0070664_100658297 | |||
| 3151 | Ga0070664_100722954 | |||
| 3152 | Ga0070664_100733423 | |||
| 3153 | Ga0070664_101076178 | |||
| 3154 | Ga0070664_101357864 | |||
| 3155 | Ga0070664_101380279 | |||
| 3156 | Ga0068857_100079371 | |||
| 3157 | Ga0068857_100150832 | |||
| 3158 | Ga0068857_100174209 | |||
| 3159 | Ga0068857_100452499 | |||
| 3160 | Ga0068857_100535693 | |||
| 3161 | Ga0068857_101610488 | |||
| 3162 | Ga0068857_101959580 | |||
| 3163 | Ga0068854_100010562 | |||
| 3164 | Ga0068854_100076351 | |||
| 3165 | Ga0068854_100077452 | |||
| 3166 | Ga0068854_100450182 | |||
| 3167 | Ga0068854_100749467 | |||
| 3168 | Ga0068854_101176832 | |||
| 3169 | Ga0070702_100015349 | |||
| 3170 | Ga0070702_100031935 | |||
| 3171 | Ga0070702_100201913 | |||
| 3172 | Ga0070702_100273570 | |||
| 3173 | Ga0070702_100436024 | |||
| 3174 | Ga0070702_100555985 | |||
| 3175 | Ga0070702_100825978 | |||
| 3176 | Ga0068852_100075870 | |||
| 3177 | Ga0068852_101016662 | |||
| 3178 | Ga0068859_100023275 | |||
| 3179 | Ga0068859_100033707 | |||
| 3180 | Ga0068859_100048146 | |||
| 3181 | Ga0068859_100055252 | |||
| 3182 | Ga0068859_100061540 | |||
| 3183 | Ga0068859_100066190 | |||
| 3184 | Ga0068859_100111753 | |||
| 3185 | Ga0068859_100113988 | |||
| 3186 | Ga0068859_100140184 | |||
| 3187 | Ga0068859_100187875 | |||
| 3188 | Ga0068859_100235859 | |||
| 3189 | Ga0068859_100256618 | |||
| 3190 | Ga0068859_100521796 | |||
| 3191 | Ga0068859_100880755 | |||
| 3192 | Ga0068859_101321780 | |||
| 3193 | Ga0068859_101337837 | |||
| 3194 | Ga0068859_101920698 | |||
| 3195 | Ga0068859_102254685 | |||
| 3196 | Ga0068864_100001449 | |||
| 3197 | Ga0068864_100033085 | |||
| 3198 | Ga0068864_100116552 | |||
| 3199 | Ga0068864_100119189 | |||
| 3200 | Ga0068864_100171845 | |||
| 3201 | Ga0068864_100653142 | |||
| 3202 | Ga0068864_100784206 | |||
| 3203 | Ga0068864_100938612 | |||
| 3204 | Ga0068864_100980107 | |||
| 3205 | Ga0068864_101330219 | |||
| 3206 | Ga0068864_101429478 | |||
| 3207 | Ga0068864_101907656 | |||
| 3208 | Ga0068864_102055217 | |||
| 3209 | Ga0068866_10031836 | |||
| 3210 | Ga0068866_10094288 | |||
| 3211 | Ga0068866_10368368 | |||
| 3212 | Ga0068866_10409648 | |||
| 3213 | Ga0068866_10537328 | |||
| 3214 | Ga0068866_10785301 | |||
| 3215 | Ga0068866_11140695 | |||
| 3216 | Ga0068861_100016299 | |||
| 3217 | Ga0068861_100016649 | |||
| 3218 | Ga0068861_100016863 | |||
| 3219 | Ga0068861_100053065 | |||
| 3220 | Ga0068861_100062481 | |||
| 3221 | Ga0068861_100071472 | |||
| 3222 | Ga0068861_100084971 | |||
| 3223 | Ga0068861_100135619 | |||
| 3224 | Ga0068861_100209677 | |||
| 3225 | Ga0068861_100331464 | |||
| 3226 | Ga0068861_100388542 | |||
| 3227 | Ga0068861_100450132 | |||
| 3228 | Ga0068861_100506764 | |||
| 3229 | Ga0068861_100547697 | |||
| 3230 | Ga0068861_102233858 | |||
| 3231 | Ga0068861_102532428 | |||
| 3232 | Ga0068851_10101840 | |||
| 3233 | Ga0068870_10007356 | |||
| 3234 | Ga0068870_10012486 | |||
| 3235 | Ga0068870_10052341 | |||
| 3236 | Ga0068870_10055842 | |||
| 3237 | Ga0068870_10099479 | |||
| 3238 | Ga0068870_10112032 | |||
| 3239 | Ga0068870_10396432 | |||
| 3240 | Ga0068870_10539540 | |||
| 3241 | Ga0068870_10673927 | |||
| 3242 | Ga0068870_11317444 | |||
| 3243 | Ga0068863_100001998 | |||
| 3244 | Ga0068863_100003338 | |||
| 3245 | Ga0068863_100010691 | |||
| 3246 | Ga0068863_100296914 | |||
| 3247 | Ga0068863_100351308 | |||
| 3248 | Ga0068863_100394671 | |||
| 3249 | Ga0068863_100553528 | |||
| 3250 | Ga0068863_100731439 | |||
| 3251 | Ga0068863_101208102 | |||
| 3252 | Ga0068863_101499439 | |||
| 3253 | Ga0068863_101657212 | |||
| 3254 | Ga0068858_100017315 | |||
| 3255 | Ga0068858_100018057 | |||
| 3256 | Ga0068858_100041117 | |||
| 3257 | Ga0068858_100052285 | |||
| 3258 | Ga0068858_100055021 | |||
| 3259 | Ga0068858_100078536 | |||
| 3260 | Ga0068858_100085768 | |||
| 3261 | Ga0068858_100150435 | |||
| 3262 | Ga0068858_100155455 | |||
| 3263 | Ga0068858_100226785 | |||
| 3264 | Ga0068858_100248451 | |||
| 3265 | Ga0068858_100297298 | |||
| 3266 | Ga0068858_100618020 | |||
| 3267 | Ga0068858_100637000 | |||
| 3268 | Ga0068858_100830798 | |||
| 3269 | Ga0068858_101200908 | |||
| 3270 | Ga0068858_101300602 | |||
| 3271 | Ga0068858_101399910 | |||
| 3272 | Ga0068858_101578364 | |||
| 3273 | Ga0068858_101836407 | |||
| 3274 | Ga0068858_101873047 | |||
| 3275 | Ga0068860_100038835 | |||
| 3276 | Ga0068860_100076543 | |||
| 3277 | Ga0068860_100087884 | |||
| 3278 | Ga0068860_100132440 | |||
| 3279 | Ga0068860_100193257 | |||
| 3280 | Ga0068860_100391717 | |||
| 3281 | Ga0068860_100502177 | |||
| 3282 | Ga0068860_100566985 | |||
| 3283 | Ga0068860_100623495 | |||
| 3284 | Ga0068860_100629188 | |||
| 3285 | Ga0068860_100733962 | |||
| 3286 | Ga0068860_101417381 | |||
| 3287 | Ga0068860_102266689 | |||
| 3288 | Ga0068862_100002296 | |||
| 3289 | Ga0068862_100006007 | |||
| 3290 | Ga0068862_100021571 | |||
| 3291 | Ga0068862_100066542 | |||
| 3292 | Ga0068862_100344154 | |||
| 3293 | Ga0068862_100441079 | |||
| 3294 | Ga0068862_100689126 | |||
| 3295 | Ga0068862_100826185 | |||
| 3296 | Ga0068862_100894987 | |||
| 3297 | Ga0068862_101399557 | |||
| 3298 | Ga0068862_102081918 | |||
| 3299 | Ga0068862_102300737 | |||
| 3300 | Ga0068862_102300860 | |||
| 3301 | Ga0081455_10140765 | |||
| 3302 | Ga0081455_10589558 | |||
| 3303 | Ga0081538_10206388 | |||
| 3304 | Ga0081539_10000142 | |||
| 3305 | Ga0081539_10000215 | |||
| 3306 | Ga0081539_10003297 | |||
| 3307 | Ga0081539_10059468 | |||
| 3308 | Ga0081539_10260238 | |||
| 3309 | Ga0070717_10403199 | |||
| 3310 | Ga0070717_11255778 | |||
| 3311 | Ga0075365_10032125 | |||
| 3312 | Ga0075365_11343602 | |||
| 3313 | Ga0075368_10018816 | |||
| 3314 | Ga0075368_10034977 | |||
| 3315 | Ga0075364_10005699 | |||
| 3316 | Ga0075364_10071778 | |||
| 3317 | Ga0075432_10144842 | |||
| 3318 | Ga0075432_10323013 | |||
| 3319 | Ga0075432_10403306 | |||
| 3320 | Ga0070715_10009391 | |||
| 3321 | Ga0070715_10564482 | |||
| 3322 | Ga0070716_100613314 | |||
| 3323 | Ga0070716_100741513 | |||
| 3324 | Ga0070712_100253943 | |||
| 3325 | Ga0075362_10070036 | |||
| 3326 | Ga0075367_10024774 | |||
| 3327 | Ga0075367_10145935 | |||
| 3328 | Ga0075367_10271666 | |||
| 3329 | Ga0075366_10005878 | |||
| 3330 | Ga0075366_10009758 | |||
| 3331 | Ga0075366_10130555 | |||
| 3332 | Ga0075366_10168442 | |||
| 3333 | Ga0097621_100000865 | |||
| 3334 | Ga0097621_100007424 | |||
| 3335 | Ga0097621_100017573 | |||
| 3336 | Ga0097621_100028797 | |||
| 3337 | Ga0097621_100033597 | |||
| 3338 | Ga0097621_100052497 | |||
| 3339 | Ga0097621_100057308 | |||
| 3340 | Ga0097621_100068357 | |||
| 3341 | Ga0097621_100070983 | |||
| 3342 | Ga0097621_100116424 | |||
| 3343 | Ga0097621_100187025 | |||
| 3344 | Ga0097621_100246149 | |||
| 3345 | Ga0097621_100255643 | |||
| 3346 | Ga0097621_100419571 | |||
| 3347 | Ga0097621_100504670 | |||
| 3348 | Ga0097621_100522573 | |||
| 3349 | Ga0097621_100571254 | |||
| 3350 | Ga0097621_100866837 | |||
| 3351 | Ga0097621_101266095 | |||
| 3352 | Ga0075370_10008938 | |||
| 3353 | Ga0075370_10490814 | |||
| 3354 | Ga0068871_100000059 | |||
| 3355 | Ga0068871_100002585 | |||
| 3356 | Ga0068871_100002961 | |||
| 3357 | Ga0068871_100016611 | |||
| 3358 | Ga0068871_100052496 | |||
| 3359 | Ga0068871_100081776 | |||
| 3360 | Ga0068871_100133827 | |||
| 3361 | Ga0068871_100144872 | |||
| 3362 | Ga0068871_100166908 | |||
| 3363 | Ga0068871_100390354 | |||
| 3364 | Ga0068871_100395821 | |||
| 3365 | Ga0068871_100609372 | |||
| 3366 | Ga0068871_100757814 | |||
| 3367 | Ga0068871_100857766 | |||
| 3368 | Ga0068871_101221149 | |||
| 3369 | Ga0068871_101275118 | |||
| 3370 | Ga0068871_101543558 | |||
| 3371 | Ga0075428_100000008 | |||
| 3372 | Ga0075428_100000566 | |||
| 3373 | Ga0075428_100007672 | |||
| 3374 | Ga0075428_100009392 | |||
| 3375 | Ga0075428_100020179 | |||
| 3376 | Ga0075428_100020584 | |||
| 3377 | Ga0075428_100032218 | |||
| 3378 | Ga0075428_100035640 | |||
| 3379 | Ga0075428_100048480 | |||
| 3380 | Ga0075428_100075003 | |||
| 3381 | Ga0075428_100298362 | |||
| 3382 | Ga0075428_100666966 | |||
| 3383 | Ga0075428_101236637 | |||
| 3384 | Ga0075430_100002270 | |||
| 3385 | Ga0075430_100005144 | |||
| 3386 | Ga0075430_100008641 | |||
| 3387 | Ga0075430_100013718 | |||
| 3388 | Ga0075430_100031566 | |||
| 3389 | Ga0075430_100073946 | |||
| 3390 | Ga0075430_100200512 | |||
| 3391 | Ga0075430_100204815 | |||
| 3392 | Ga0075430_100231480 | |||
| 3393 | Ga0075430_100232505 | |||
| 3394 | Ga0075430_100298359 | |||
| 3395 | Ga0075430_101119123 | |||
| 3396 | Ga0075430_101284695 | |||
| 3397 | Ga0075431_100002134 | |||
| 3398 | Ga0075431_100010616 | |||
| 3399 | Ga0075431_100052863 | |||
| 3400 | Ga0075431_100070686 | |||
| 3401 | Ga0075431_100155262 | |||
| 3402 | Ga0075431_100216098 | |||
| 3403 | Ga0075431_100382412 | |||
| 3404 | Ga0075431_100382706 | |||
| 3405 | Ga0075431_100389377 | |||
| 3406 | Ga0075431_101123518 | |||
| 3407 | Ga0075431_101251114 | |||
| 3408 | Ga0075433_10000724 | |||
| 3409 | Ga0075433_10010506 | |||
| 3410 | Ga0075433_10018386 | |||
| 3411 | Ga0075433_10037380 | |||
| 3412 | Ga0075433_10047241 | |||
| 3413 | Ga0075433_10062491 | |||
| 3414 | Ga0075433_10195949 | |||
| 3415 | Ga0075433_10207482 | |||
| 3416 | Ga0075433_10302351 | |||
| 3417 | Ga0075433_10362658 | |||
| 3418 | Ga0075433_10425523 | |||
| 3419 | Ga0075433_10535697 | |||
| 3420 | Ga0075433_10650558 | |||
| 3421 | Ga0075433_10656242 | |||
| 3422 | Ga0075433_10919154 | |||
| 3423 | Ga0075433_11257987 | |||
| 3424 | Ga0075434_100000793 | |||
| 3425 | Ga0075434_100002391 | |||
| 3426 | Ga0075434_100002842 | |||
| 3427 | Ga0075434_100019631 | |||
| 3428 | Ga0075434_100044204 | |||
| 3429 | Ga0075434_100048758 | |||
| 3430 | Ga0075434_100057737 | |||
| 3431 | Ga0075434_100069185 | |||
| 3432 | Ga0075434_100075740 | |||
| 3433 | Ga0075434_100214320 | |||
| 3434 | Ga0075434_100404055 | |||
| 3435 | Ga0075434_100472009 | |||
| 3436 | Ga0075434_100501634 | |||
| 3437 | Ga0075434_100683762 | |||
| 3438 | Ga0075434_100905748 | |||
| 3439 | Ga0075434_101215138 | |||
| 3440 | Ga0075434_101279279 | |||
| 3441 | Ga0075429_100002891 | |||
| 3442 | Ga0075429_100006250 | |||
| 3443 | Ga0075429_100032448 | |||
| 3444 | Ga0075429_100060972 | |||
| 3445 | Ga0075429_100061831 | |||
| 3446 | Ga0075429_100162057 | |||
| 3447 | Ga0075429_100191132 | |||
| 3448 | Ga0075429_100250088 | |||
| 3449 | Ga0075429_100363290 | |||
| 3450 | Ga0075429_100492723 | |||
| 3451 | Ga0075429_100519075 | |||
| 3452 | Ga0075429_100864569 | |||
| 3453 | Ga0075429_101226394 | |||
| 3454 | Ga0075429_101454530 | |||
| 3455 | Ga0068865_100002965 | |||
| 3456 | Ga0068865_100008261 | |||
| 3457 | Ga0068865_100008264 | |||
| 3458 | Ga0068865_100069535 | |||
| 3459 | Ga0068865_100095345 | |||
| 3460 | Ga0068865_100238053 | |||
| 3461 | Ga0068865_100261227 | |||
| 3462 | Ga0068865_100426217 | |||
| 3463 | Ga0068865_100457464 | |||
| 3464 | Ga0068865_100550692 | |||
| 3465 | Ga0068865_100784408 | |||
| 3466 | Ga0068865_100940680 | |||
| 3467 | Ga0068865_101138237 | |||
| 3468 | Ga0068865_101233901 | |||
| 3469 | Ga0068865_101287967 | |||
| 3470 | Ga0068865_101556149 | |||
| 3471 | Ga0075436_100004571 | |||
| 3472 | Ga0075436_100026299 | |||
| 3473 | Ga0075436_100113306 | |||
| 3474 | Ga0075436_100960028 | |||
| 3475 | Ga0097620_100023274 | |||
| 3476 | Ga0097620_100033707 | |||
| 3477 | Ga0097620_100048149 | |||
| 3478 | Ga0097620_100055251 | |||
| 3479 | Ga0097620_100061552 | |||
| 3480 | Ga0097620_100066188 | |||
| 3481 | Ga0097620_100111746 | |||
| 3482 | Ga0097620_100113990 | |||
| 3483 | Ga0097620_100140172 | |||
| 3484 | Ga0097620_100187872 | |||
| 3485 | Ga0097620_100235869 | |||
| 3486 | Ga0097620_100256622 | |||
| 3487 | Ga0097620_100521712 | |||
| 3488 | Ga0097620_100880742 | |||
| 3489 | Ga0097620_101321761 | |||
| 3490 | Ga0097620_101337752 | |||
| 3491 | Ga0097620_101920535 | |||
| 3492 | Ga0097620_102254837 | |||
| 3493 | Ga0075435_100010153 | |||
| 3494 | Ga0075435_100015456 | |||
| 3495 | Ga0075435_100031693 | |||
| 3496 | Ga0075435_100035634 | |||
| 3497 | Ga0075435_100049414 | |||
| 3498 | Ga0075435_100054740 | |||
| 3499 | Ga0075435_100073632 | |||
| 3500 | Ga0075435_100086353 | |||
| 3501 | Ga0075435_100174587 | |||
| 3502 | Ga0075435_100283680 | |||
| 3503 | Ga0075435_100405717 | |||
| 3504 | Ga0075435_100893542 | |||
| 3505 | Ga0075435_101891585 | |||
| 3506 | Ga0099794_10434603 | |||
| 3507 | Ga0099795_10190345 | |||
| 3508 | Ga0105251_10129608 | |||
| 3509 | Ga0105250_10346198 | |||
| 3510 | Ga0105250_10523649 | |||
| 3511 | Ga0105240_10288130 | |||
| 3512 | Ga0105240_12214746 | |||
| 3513 | Ga0111539_10000015 | |||
| 3514 | Ga0111539_10000614 | |||
| 3515 | Ga0111539_10001499 | |||
| 3516 | Ga0111539_10008113 | |||
| 3517 | Ga0111539_10026203 | |||
| 3518 | Ga0111539_10032217 | |||
| 3519 | Ga0111539_10046019 | |||
| 3520 | Ga0111539_10055675 | |||
| 3521 | Ga0111539_10060965 | |||
| 3522 | Ga0111539_10258932 | |||
| 3523 | Ga0111539_10281546 | |||
| 3524 | Ga0111539_10294241 | |||
| 3525 | Ga0111539_10682624 | |||
| 3526 | Ga0111539_10742142 | |||
| 3527 | Ga0111539_10779300 | |||
| 3528 | Ga0111539_10883858 | |||
| 3529 | Ga0111539_10990243 | |||
| 3530 | Ga0111539_10999903 | |||
| 3531 | Ga0111539_11095186 | |||
| 3532 | Ga0111539_11114285 | |||
| 3533 | Ga0111539_11348489 | |||
| 3534 | Ga0111539_11388806 | |||
| 3535 | Ga0111539_11648623 | |||
| 3536 | Ga0111539_11744952 | |||
| 3537 | Ga0111539_12481063 | |||
| 3538 | Ga0111539_12737730 | |||
| 3539 | Ga0111539_12847257 | |||
| 3540 | Ga0105245_10055993 | |||
| 3541 | Ga0105245_10065038 | |||
| 3542 | Ga0105245_10083644 | |||
| 3543 | Ga0105245_10148512 | |||
| 3544 | Ga0105245_11402745 | |||
| 3545 | Ga0105245_12335310 | |||
| 3546 | Ga0105245_12421108 | |||
| 3547 | Ga0105245_13265724 | |||
| 3548 | Ga0105247_10001718 | |||
| 3549 | Ga0105247_10023026 | |||
| 3550 | Ga0105247_10085979 | |||
| 3551 | Ga0105247_10160572 | |||
| 3552 | Ga0105247_10837386 | |||
| 3553 | Ga0114129_10005721 | |||
| 3554 | Ga0114129_10019565 | |||
| 3555 | Ga0114129_10031894 | |||
| 3556 | Ga0114129_10035574 | |||
| 3557 | Ga0114129_10040259 | |||
| 3558 | Ga0114129_10051572 | |||
| 3559 | Ga0114129_10087222 | |||
| 3560 | Ga0114129_10102117 | |||
| 3561 | Ga0114129_10130531 | |||
| 3562 | Ga0114129_10147174 | |||
| 3563 | Ga0114129_10191711 | |||
| 3564 | Ga0114129_10216144 | |||
| 3565 | Ga0114129_10217395 | |||
| 3566 | Ga0114129_10250077 | |||
| 3567 | Ga0114129_10290917 | |||
| 3568 | Ga0114129_10671763 | |||
| 3569 | Ga0114129_10913818 | |||
| 3570 | Ga0114129_11418320 | |||
| 3571 | Ga0114129_11504330 | |||
| 3572 | Ga0114129_11669653 | |||
| 3573 | Ga0114129_11873210 | |||
| 3574 | Ga0114129_12147865 | |||
| 3575 | Ga0114129_12304585 | |||
| 3576 | Ga0114129_13390892 | |||
| 3577 | Ga0105243_10049256 | |||
| 3578 | Ga0105243_10065794 | |||
| 3579 | Ga0105243_10068538 | |||
| 3580 | Ga0105243_10070835 | |||
| 3581 | Ga0105243_10436594 | |||
| 3582 | Ga0105243_10688698 | |||
| 3583 | Ga0105243_10905728 | |||
| 3584 | Ga0105243_10906855 | |||
| 3585 | Ga0105243_11930934 | |||
| 3586 | Ga0105243_11975873 | |||
| 3587 | Ga0105243_12085271 | |||
| 3588 | Ga0105243_12484706 | |||
| 3589 | Ga0105241_10113334 | |||
| 3590 | Ga0105241_10968288 | |||
| 3591 | Ga0105241_10974497 | |||
| 3592 | Ga0105242_10012357 | |||
| 3593 | Ga0105242_10016561 | |||
| 3594 | Ga0105242_10017161 | |||
| 3595 | Ga0105242_10017753 | |||
| 3596 | Ga0105242_10018186 | |||
| 3597 | Ga0105242_10076151 | |||
| 3598 | Ga0105242_10098074 | |||
| 3599 | Ga0105242_10276600 | |||
| 3600 | Ga0105242_10365403 | |||
| 3601 | Ga0105242_10576818 | |||
| 3602 | Ga0105242_10748397 | |||
| 3603 | Ga0105242_10760264 | |||
| 3604 | Ga0105242_10952459 | |||
| 3605 | Ga0105242_11322920 | |||
| 3606 | Ga0105242_11733222 | |||
| 3607 | Ga0105242_12805022 | |||
| 3608 | Ga0105242_13075752 | |||
| 3609 | Ga0105248_10001370 | |||
| 3610 | Ga0105248_10031364 | |||
| 3611 | Ga0105248_10050366 | |||
| 3612 | Ga0105248_10100829 | |||
| 3613 | Ga0105248_10111207 | |||
| 3614 | Ga0105248_10115869 | |||
| 3615 | Ga0105248_10133137 | |||
| 3616 | Ga0105248_10236464 | |||
| 3617 | Ga0105248_10509054 | |||
| 3618 | Ga0105248_10587885 | |||
| 3619 | Ga0105248_10615351 | |||
| 3620 | Ga0105248_10689302 | |||
| 3621 | Ga0105248_10762898 | |||
| 3622 | Ga0105248_10765905 | |||
| 3623 | Ga0105248_10777537 | |||
| 3624 | Ga0105248_10852570 | |||
| 3625 | Ga0105248_10906759 | |||
| 3626 | Ga0105248_11245928 | |||
| 3627 | Ga0105248_11425742 | |||
| 3628 | Ga0105248_11917719 | |||
| 3629 | Ga0105248_12782256 | |||
| 3630 | Ga0105248_13416828 | |||
| 3631 | Ga0105248_13438476 | |||
| 3632 | Ga0105237_11385511 | |||
| 3633 | Ga0105238_10005196 | |||
| 3634 | Ga0105238_10238192 | |||
| 3635 | Ga0105238_10494359 | |||
| 3636 | Ga0105238_12564432 | |||
| 3637 | Ga0105249_10000649 | |||
| 3638 | Ga0105249_10009366 | |||
| 3639 | Ga0105249_10029742 | |||
| 3640 | Ga0105249_10284787 | |||
| 3641 | Ga0105249_10449552 | |||
| 3642 | Ga0105249_10508561 | |||
| 3643 | Ga0105249_10697434 | |||
| 3644 | Ga0105249_10723204 | |||
| 3645 | Ga0105249_11014393 | |||
| 3646 | Ga0105249_11267996 | |||
| 3647 | Ga0105249_11628161 | |||
| 3648 | Ga0099796_10574844 | |||
| 3649 | Ga0105239_10032758 | |||
| 3650 | Ga0105239_10928638 | |||
| 3651 | Ga0105239_11221616 | |||
| 3652 | Ga0105239_13188317 | |||
| 3653 | Ga0105239_13456811 | |||
| 3654 | Ga0105246_10192154 | |||
| 3655 | Ga0105246_11120484 | |||
| 3656 | Ga0105246_11219835 | |||
| 3657 | Ga0105246_11297646 | |||
| 3658 | Ga0157328_1022269 | |||
| 3659 | Ga0157328_1023021 | |||
| 3660 | Ga0157325_1038831 | |||
| 3661 | Ga0157323_1034993 | |||
| 3662 | Ga0157339_1072190 | |||
| 3663 | Ga0157373_10959965 | |||
| 3664 | Ga0157371_10188614 | |||
| 3665 | Ga0157371_10482124 | |||
| 3666 | Ga0157371_10890394 | |||
| 3667 | Ga0157370_10620678 | |||
| 3668 | Ga0157370_11235337 | |||
| 3669 | Ga0157369_12220078 | |||
| 3670 | Ga0157369_12522979 | |||
| 3671 | Ga0157374_10197987 | |||
| 3672 | Ga0157374_10209676 | |||
| 3673 | Ga0157374_10681886 | |||
| 3674 | Ga0157374_10819470 | |||
| 3675 | Ga0157374_10908549 | |||
| 3676 | Ga0157378_10001288 | |||
| 3677 | Ga0157378_10013431 | |||
| 3678 | Ga0157378_10022222 | |||
| 3679 | Ga0157378_10190523 | |||
| 3680 | Ga0157378_10290680 | |||
| 3681 | Ga0157378_10340369 | |||
| 3682 | Ga0157378_10691402 | |||
| 3683 | Ga0157378_10788647 | |||
| 3684 | Ga0157378_10969956 | |||
| 3685 | Ga0157378_11056683 | |||
| 3686 | Ga0157378_11374119 | |||
| 3687 | Ga0157378_11404491 | |||
| 3688 | Ga0157378_11898156 | |||
| 3689 | Ga0157378_12523049 | |||
| 3690 | Ga0163162_10020439 | |||
| 3691 | Ga0163162_10106674 | |||
| 3692 | Ga0163162_10276266 | |||
| 3693 | Ga0163162_10333100 | |||
| 3694 | Ga0163162_10372383 | |||
| 3695 | Ga0163162_11285172 | |||
| 3696 | Ga0163162_11535983 | |||
| 3697 | Ga0163162_11690372 | |||
| 3698 | Ga0163162_12065647 | |||
| 3699 | Ga0163162_12107423 | |||
| 3700 | Ga0163162_12698906 | |||
| 3701 | Ga0157372_10131584 | |||
| 3702 | Ga0157372_12564209 | |||
| 3703 | Ga0157375_10022924 | |||
| 3704 | Ga0157375_10024718 | |||
| 3705 | Ga0157375_10169053 | |||
| 3706 | Ga0157375_10232019 | |||
| 3707 | Ga0157375_10241579 | |||
| 3708 | Ga0157375_10251020 | |||
| 3709 | Ga0157375_10637308 | |||
| 3710 | Ga0157375_10786672 | |||
| 3711 | Ga0157375_10888477 | |||
| 3712 | Ga0157375_10904311 | |||
| 3713 | Ga0157375_11121992 | |||
| 3714 | Ga0157375_11131371 | |||
| 3715 | Ga0157375_11370078 | |||
| 3716 | Ga0157375_11454239 | |||
| 3717 | Ga0157375_11860980 | |||
| 3718 | Ga0157375_12372732 | |||
| 3719 | Ga0157375_13014863 | |||
| 3720 | Ga0163163_10000717 | |||
| 3721 | Ga0163163_10009403 | |||
| 3722 | Ga0163163_10074861 | |||
| 3723 | Ga0163163_10250007 | |||
| 3724 | Ga0163163_10553369 | |||
| 3725 | Ga0163163_10704694 | |||
| 3726 | Ga0163163_10778547 | |||
| 3727 | Ga0163163_11256238 | |||
| 3728 | Ga0157380_10006726 | |||
| 3729 | Ga0157380_10007218 | |||
| 3730 | Ga0157380_10023279 | |||
| 3731 | Ga0157380_10046654 | |||
| 3732 | Ga0157380_10085336 | |||
| 3733 | Ga0157380_10279374 | |||
| 3734 | Ga0157380_10301850 | |||
| 3735 | Ga0157380_10328315 | |||
| 3736 | Ga0157380_10470602 | |||
| 3737 | Ga0157380_10611936 | |||
| 3738 | Ga0157380_10779636 | |||
| 3739 | Ga0157380_10979954 | |||
| 3740 | Ga0157380_11813429 | |||
| 3741 | Ga0157380_12258795 | |||
| 3742 | Ga0157380_12264878 | |||
| 3743 | Ga0157380_12919959 | |||
| 3744 | Ga0182008_10814496 | |||
| 3745 | Ga0157377_10025400 | |||
| 3746 | Ga0157377_10166001 | |||
| 3747 | Ga0157377_10301950 | |||
| 3748 | Ga0157377_10339280 | |||
| 3749 | Ga0157377_10399472 | |||
| 3750 | Ga0157377_10669131 | |||
| 3751 | Ga0157377_11029621 | |||
| 3752 | Ga0157379_10003113 | |||
| 3753 | Ga0157379_10054418 | |||
| 3754 | Ga0157379_10059336 | |||
| 3755 | Ga0157379_10087318 | |||
| 3756 | Ga0157379_10323502 | |||
| 3757 | Ga0157379_10382130 | |||
| 3758 | Ga0157379_10957081 | |||
| 3759 | Ga0157376_10016289 | |||
| 3760 | Ga0157376_10030353 | |||
| 3761 | Ga0157376_10040405 | |||
| 3762 | Ga0157376_10049730 | |||
| 3763 | Ga0157376_10060290 | |||
| 3764 | Ga0157376_10076563 | |||
| 3765 | Ga0157376_10088434 | |||
| 3766 | Ga0157376_10216296 | |||
| 3767 | Ga0157376_10277547 | |||
| 3768 | Ga0157376_10540816 | |||
| 3769 | Ga0157376_10568706 | |||
| 3770 | Ga0157376_10616443 | |||
| 3771 | Ga0157376_10667238 | |||
| 3772 | Ga0157376_10734995 | |||
| 3773 | Ga0157376_10832661 | |||
| 3774 | Ga0157376_10885766 | |||
| 3775 | Ga0157376_12023276 | |||
| 3776 | Ga0182007_10401862 | |||
| 3777 | Ga0163161_10091292 | |||
| 3778 | Ga0163161_10185396 | |||
| 3779 | Ga0163161_10451381 | |||
| 3780 | Ga0163161_10576695 | |||
| 3781 | Ga0163161_11963672 | |||
| 3782 | Ga0213876_10032805 | |||
| 3783 | Ga0213876_10244367 | |||
| 3784 | Ga0213876_10333909 | |||
| 3785 | Ga0207666_1051100 | |||
| 3786 | Ga0207697_10003624 | |||
| 3787 | Ga0207697_10015956 | |||
| 3788 | Ga0207697_10103317 | |||
| 3789 | Ga0207697_10141949 | |||
| 3790 | Ga0207697_10150675 | |||
| 3791 | Ga0207697_10159818 | |||
| 3792 | Ga0207697_10468761 | |||
| 3793 | Ga0207697_10503975 | |||
| 3794 | Ga0207713_1246112 | |||
| 3795 | Ga0207653_10012866 | |||
| 3796 | Ga0207653_10149889 | |||
| 3797 | Ga0207653_10277309 | |||
| 3798 | Ga0207653_10416724 | |||
| 3799 | Ga0207682_10003849 | |||
| 3800 | Ga0207682_10005690 | |||
| 3801 | Ga0207682_10075178 | |||
| 3802 | Ga0207682_10118542 | |||
| 3803 | Ga0207682_10307391 | |||
| 3804 | Ga0207642_10073914 | |||
| 3805 | Ga0207642_10138506 | |||
| 3806 | Ga0207642_10145099 | |||
| 3807 | Ga0207642_10237490 | |||
| 3808 | Ga0207642_10255923 | |||
| 3809 | Ga0207642_10430994 | |||
| 3810 | Ga0207642_10498589 | |||
| 3811 | Ga0207642_10914506 | |||
| 3812 | Ga0207710_10003072 | |||
| 3813 | Ga0207710_10095348 | |||
| 3814 | Ga0207710_10129893 | |||
| 3815 | Ga0207688_10000138 | |||
| 3816 | Ga0207688_10022145 | |||
| 3817 | Ga0207688_10085188 | |||
| 3818 | Ga0207688_10088352 | |||
| 3819 | Ga0207688_10470832 | |||
| 3820 | Ga0207688_10977919 | |||
| 3821 | Ga0207680_10030593 | |||
| 3822 | Ga0207680_10035103 | |||
| 3823 | Ga0207680_10062044 | |||
| 3824 | Ga0207680_10094028 | |||
| 3825 | Ga0207680_10099123 | |||
| 3826 | Ga0207680_10106106 | |||
| 3827 | Ga0207680_10816205 | |||
| 3828 | Ga0207680_10997002 | |||
| 3829 | Ga0207647_10033238 | |||
| 3830 | Ga0207647_10347698 | |||
| 3831 | Ga0207647_10700986 | |||
| 3832 | Ga0207685_10153284 | |||
| 3833 | Ga0207685_10288607 | |||
| 3834 | Ga0207685_10293698 | |||
| 3835 | Ga0207685_10320980 | |||
| 3836 | Ga0207685_10605475 | |||
| 3837 | Ga0207699_10089374 | |||
| 3838 | Ga0207699_10146666 | |||
| 3839 | Ga0207699_10590096 | |||
| 3840 | Ga0207699_10639111 | |||
| 3841 | Ga0207645_10003300 | |||
| 3842 | Ga0207645_10007441 | |||
| 3843 | Ga0207645_10056725 | |||
| 3844 | Ga0207645_10076430 | |||
| 3845 | Ga0207645_10081928 | |||
| 3846 | Ga0207645_10100278 | |||
| 3847 | Ga0207645_10205645 | |||
| 3848 | Ga0207645_10222233 | |||
| 3849 | Ga0207645_10269401 | |||
| 3850 | Ga0207645_10414452 | |||
| 3851 | Ga0207645_11171025 | |||
| 3852 | Ga0207643_10001065 | |||
| 3853 | Ga0207643_10013253 | |||
| 3854 | Ga0207643_10018749 | |||
| 3855 | Ga0207643_10019547 | |||
| 3856 | Ga0207643_10049257 | |||
| 3857 | Ga0207643_10076123 | |||
| 3858 | Ga0207643_10281452 | |||
| 3859 | Ga0207643_10546201 | |||
| 3860 | Ga0207643_10687684 | |||
| 3861 | Ga0207643_11045347 | |||
| 3862 | Ga0207684_10103122 | |||
| 3863 | Ga0207684_10323689 | |||
| 3864 | Ga0207684_10333968 | |||
| 3865 | Ga0207684_10383542 | |||
| 3866 | Ga0207684_10945882 | |||
| 3867 | Ga0207684_11524171 | |||
| 3868 | Ga0207654_10665156 | |||
| 3869 | Ga0207707_10209114 | |||
| 3870 | Ga0207707_10333195 | |||
| 3871 | Ga0207707_10333301 | |||
| 3872 | Ga0207707_10336137 | |||
| 3873 | Ga0207707_10829370 | |||
| 3874 | Ga0207707_11539035 | |||
| 3875 | Ga0207695_10163026 | |||
| 3876 | Ga0207671_10756877 | |||
| 3877 | Ga0207693_11245594 | |||
| 3878 | Ga0207663_10134805 | |||
| 3879 | Ga0207663_10644152 | |||
| 3880 | Ga0207663_11644426 | |||
| 3881 | Ga0207660_10385855 | |||
| 3882 | Ga0207660_10548516 | |||
| 3883 | Ga0207662_10005102 | |||
| 3884 | Ga0207662_10007755 | |||
| 3885 | Ga0207662_10038839 | |||
| 3886 | Ga0207662_10099683 | |||
| 3887 | Ga0207662_10159667 | |||
| 3888 | Ga0207662_10275010 | |||
| 3889 | Ga0207662_10381153 | |||
| 3890 | Ga0207662_10419290 | |||
| 3891 | Ga0207657_10385960 | |||
| 3892 | Ga0207649_10095844 | |||
| 3893 | Ga0207649_10097718 | |||
| 3894 | Ga0207649_10123245 | |||
| 3895 | Ga0207649_10174316 | |||
| 3896 | Ga0207649_10192368 | |||
| 3897 | Ga0207649_10269776 | |||
| 3898 | Ga0207649_10713769 | |||
| 3899 | Ga0207649_11304461 | |||
| 3900 | Ga0207649_11404144 | |||
| 3901 | Ga0207652_10296057 | |||
| 3902 | Ga0207652_10760477 | |||
| 3903 | Ga0207652_11205393 | |||
| 3904 | Ga0207646_10033194 | |||
| 3905 | Ga0207646_10065518 | |||
| 3906 | Ga0207646_10099463 | |||
| 3907 | Ga0207646_10246298 | |||
| 3908 | Ga0207646_10443266 | |||
| 3909 | Ga0207646_10537205 | |||
| 3910 | Ga0207646_10583901 | |||
| 3911 | Ga0207646_11231025 | |||
| 3912 | Ga0207646_11651277 | |||
| 3913 | Ga0207681_10004036 | |||
| 3914 | Ga0207681_10006880 | |||
| 3915 | Ga0207681_10020465 | |||
| 3916 | Ga0207681_10030036 | |||
| 3917 | Ga0207681_10053433 | |||
| 3918 | Ga0207681_10053942 | |||
| 3919 | Ga0207681_10122808 | |||
| 3920 | Ga0207681_10217227 | |||
| 3921 | Ga0207681_10228419 | |||
| 3922 | Ga0207681_10394227 | |||
| 3923 | Ga0207681_10531861 | |||
| 3924 | Ga0207681_10719588 | |||
| 3925 | Ga0207681_10810290 | |||
| 3926 | Ga0207681_11005697 | |||
| 3927 | Ga0207681_11475921 | |||
| 3928 | Ga0207681_11803993 | |||
| 3929 | Ga0207694_10325114 | |||
| 3930 | Ga0207694_10986457 | |||
| 3931 | Ga0207694_11013191 | |||
| 3932 | Ga0207650_10006789 | |||
| 3933 | Ga0207650_10015336 | |||
| 3934 | Ga0207650_10021331 | |||
| 3935 | Ga0207650_10071813 | |||
| 3936 | Ga0207650_10132328 | |||
| 3937 | Ga0207650_10254798 | |||
| 3938 | Ga0207650_10358597 | |||
| 3939 | Ga0207650_11111867 | |||
| 3940 | Ga0207650_11759335 | |||
| 3941 | Ga0207650_11853003 | |||
| 3942 | Ga0207659_10000672 | |||
| 3943 | Ga0207659_10008654 | |||
| 3944 | Ga0207659_10010072 | |||
| 3945 | Ga0207659_10015560 | |||
| 3946 | Ga0207659_10017439 | |||
| 3947 | Ga0207659_10054978 | |||
| 3948 | Ga0207659_10072338 | |||
| 3949 | Ga0207659_10103444 | |||
| 3950 | Ga0207659_10167391 | |||
| 3951 | Ga0207659_10167769 | |||
| 3952 | Ga0207659_10219285 | |||
| 3953 | Ga0207659_10264111 | |||
| 3954 | Ga0207659_10453843 | |||
| 3955 | Ga0207659_10463913 | |||
| 3956 | Ga0207659_10644819 | |||
| 3957 | Ga0207659_10651802 | |||
| 3958 | Ga0207659_10686407 | |||
| 3959 | Ga0207659_11386650 | |||
| 3960 | Ga0207659_11557642 | |||
| 3961 | Ga0207687_10006511 | |||
| 3962 | Ga0207687_10009381 | |||
| 3963 | Ga0207687_10184806 | |||
| 3964 | Ga0207687_10301438 | |||
| 3965 | Ga0207687_10457319 | |||
| 3966 | Ga0207687_11279774 | |||
| 3967 | Ga0207687_11938657 | |||
| 3968 | Ga0207700_10020337 | |||
| 3969 | Ga0207700_10062152 | |||
| 3970 | Ga0207700_10366714 | |||
| 3971 | Ga0207700_10600523 | |||
| 3972 | Ga0207664_10085341 | |||
| 3973 | Ga0207644_10021145 | |||
| 3974 | Ga0207644_10043339 | |||
| 3975 | Ga0207644_10113896 | |||
| 3976 | Ga0207644_10164275 | |||
| 3977 | Ga0207644_10164678 | |||
| 3978 | Ga0207644_10165731 | |||
| 3979 | Ga0207644_10349082 | |||
| 3980 | Ga0207644_10500380 | |||
| 3981 | Ga0207644_10540586 | |||
| 3982 | Ga0207644_10838566 | |||
| 3983 | Ga0207644_10965457 | |||
| 3984 | Ga0207644_11414446 | |||
| 3985 | Ga0207690_10016531 | |||
| 3986 | Ga0207690_10212124 | |||
| 3987 | Ga0207690_11162905 | |||
| 3988 | Ga0207706_10042039 | |||
| 3989 | Ga0207706_10050955 | |||
| 3990 | Ga0207706_10060055 | |||
| 3991 | Ga0207706_10091400 | |||
| 3992 | Ga0207706_10259045 | |||
| 3993 | Ga0207706_10274350 | |||
| 3994 | Ga0207706_10304118 | |||
| 3995 | Ga0207706_10328216 | |||
| 3996 | Ga0207706_10432479 | |||
| 3997 | Ga0207706_10525004 | |||
| 3998 | Ga0207706_10535898 | |||
| 3999 | Ga0207706_10600299 | |||
| 4000 | Ga0207706_10644987 | |||
| 4001 | Ga0207706_11058489 | |||
| 4002 | Ga0207706_11472716 | |||
| 4003 | Ga0207706_11490082 | |||
| 4004 | Ga0207686_10018666 | |||
| 4005 | Ga0207686_10053530 | |||
| 4006 | Ga0207686_10065868 | |||
| 4007 | Ga0207686_10109154 | |||
| 4008 | Ga0207686_10208191 | |||
| 4009 | Ga0207686_10321130 | |||
| 4010 | Ga0207686_10358057 | |||
| 4011 | Ga0207686_10376195 | |||
| 4012 | Ga0207686_10472911 | |||
| 4013 | Ga0207686_10697933 | |||
| 4014 | Ga0207686_11043457 | |||
| 4015 | Ga0207686_11072455 | |||
| 4016 | Ga0207709_10069120 | |||
| 4017 | Ga0207709_10431503 | |||
| 4018 | Ga0207709_10524697 | |||
| 4019 | Ga0207709_10857114 | |||
| 4020 | Ga0207709_11206299 | |||
| 4021 | Ga0207670_10033694 | |||
| 4022 | Ga0207670_10037527 | |||
| 4023 | Ga0207670_10106275 | |||
| 4024 | Ga0207670_10148138 | |||
| 4025 | Ga0207670_10183068 | |||
| 4026 | Ga0207670_10222550 | |||
| 4027 | Ga0207670_10320101 | |||
| 4028 | Ga0207670_11015506 | |||
| 4029 | Ga0207670_11774043 | |||
| 4030 | Ga0207669_10016305 | |||
| 4031 | Ga0207669_10028238 | |||
| 4032 | Ga0207669_10085976 | |||
| 4033 | Ga0207669_10139534 | |||
| 4034 | Ga0207669_10206774 | |||
| 4035 | Ga0207669_10645182 | |||
| 4036 | Ga0207669_10843816 | |||
| 4037 | Ga0207669_10855969 | |||
| 4038 | Ga0207669_10912435 | |||
| 4039 | Ga0207669_10942726 | |||
| 4040 | Ga0207669_11189810 | |||
| 4041 | Ga0207669_11367815 | |||
| 4042 | Ga0207669_11381538 | |||
| 4043 | Ga0207669_11550686 | |||
| 4044 | Ga0207669_11627250 | |||
| 4045 | Ga0207704_10010227 | |||
| 4046 | Ga0207704_10018686 | |||
| 4047 | Ga0207704_10023158 | |||
| 4048 | Ga0207704_10202896 | |||
| 4049 | Ga0207704_10273011 | |||
| 4050 | Ga0207704_10384581 | |||
| 4051 | Ga0207704_10430039 | |||
| 4052 | Ga0207704_10794668 | |||
| 4053 | Ga0207665_10249914 | |||
| 4054 | Ga0207665_10325536 | |||
| 4055 | Ga0207665_10494538 | |||
| 4056 | Ga0207691_10002430 | |||
| 4057 | Ga0207691_10015439 | |||
| 4058 | Ga0207691_10022904 | |||
| 4059 | Ga0207691_10045686 | |||
| 4060 | Ga0207691_10049327 | |||
| 4061 | Ga0207691_10049665 | |||
| 4062 | Ga0207691_10067339 | |||
| 4063 | Ga0207691_10077940 | |||
| 4064 | Ga0207691_10096948 | |||
| 4065 | Ga0207691_10133173 | |||
| 4066 | Ga0207691_10143538 | |||
| 4067 | Ga0207691_10160333 | |||
| 4068 | Ga0207691_10172093 | |||
| 4069 | Ga0207691_10206339 | |||
| 4070 | Ga0207691_10307619 | |||
| 4071 | Ga0207691_10492705 | |||
| 4072 | Ga0207691_11144227 | |||
| 4073 | Ga0207691_11241134 | |||
| 4074 | Ga0207711_10003652 | |||
| 4075 | Ga0207711_10017668 | |||
| 4076 | Ga0207711_10035423 | |||
| 4077 | Ga0207711_10058711 | |||
| 4078 | Ga0207711_10137829 | |||
| 4079 | Ga0207711_10146665 | |||
| 4080 | Ga0207711_10153463 | |||
| 4081 | Ga0207711_10177045 | |||
| 4082 | Ga0207711_10306585 | |||
| 4083 | Ga0207711_10316594 | |||
| 4084 | Ga0207711_10337125 | |||
| 4085 | Ga0207711_10410826 | |||
| 4086 | Ga0207711_10443133 | |||
| 4087 | Ga0207711_10579202 | |||
| 4088 | Ga0207711_11010000 | |||
| 4089 | Ga0207711_11123835 | |||
| 4090 | Ga0207711_11185624 | |||
| 4091 | Ga0207689_10001000 | |||
| 4092 | Ga0207689_10028090 | |||
| 4093 | Ga0207689_10032206 | |||
| 4094 | Ga0207689_10068729 | |||
| 4095 | Ga0207689_10069921 | |||
| 4096 | Ga0207689_10118743 | |||
| 4097 | Ga0207689_10151265 | |||
| 4098 | Ga0207689_10263808 | |||
| 4099 | Ga0207689_10351134 | |||
| 4100 | Ga0207689_10380565 | |||
| 4101 | Ga0207689_10626298 | |||
| 4102 | Ga0207689_11233095 | |||
| 4103 | Ga0207689_11292475 | |||
| 4104 | Ga0207689_11389403 | |||
| 4105 | Ga0207689_11502209 | |||
| 4106 | Ga0207661_10009993 | |||
| 4107 | Ga0207661_10023250 | |||
| 4108 | Ga0207661_10046602 | |||
| 4109 | Ga0207661_10349138 | |||
| 4110 | Ga0207661_10438972 | |||
| 4111 | Ga0207679_10006536 | |||
| 4112 | Ga0207679_10054236 | |||
| 4113 | Ga0207679_10118006 | |||
| 4114 | Ga0207679_10126652 | |||
| 4115 | Ga0207679_10159218 | |||
| 4116 | Ga0207679_10252783 | |||
| 4117 | Ga0207679_10583326 | |||
| 4118 | Ga0207679_10681929 | |||
| 4119 | Ga0207679_10690130 | |||
| 4120 | Ga0207679_10739279 | |||
| 4121 | Ga0207679_10818092 | |||
| 4122 | Ga0207679_10847664 | |||
| 4123 | Ga0207679_11192485 | |||
| 4124 | Ga0207651_10011075 | |||
| 4125 | Ga0207651_10039513 | |||
| 4126 | Ga0207651_10078681 | |||
| 4127 | Ga0207651_10140852 | |||
| 4128 | Ga0207651_10142985 | |||
| 4129 | Ga0207651_10150586 | |||
| 4130 | Ga0207651_10315301 | |||
| 4131 | Ga0207651_10481926 | |||
| 4132 | Ga0207651_10502655 | |||
| 4133 | Ga0207651_10525405 | |||
| 4134 | Ga0207651_10529595 | |||
| 4135 | Ga0207651_10648648 | |||
| 4136 | Ga0207651_10927179 | |||
| 4137 | Ga0207651_10953364 | |||
| 4138 | Ga0207651_11768869 | |||
| 4139 | Ga0207651_11822847 | |||
| 4140 | Ga0207712_10037308 | |||
| 4141 | Ga0207712_10040684 | |||
| 4142 | Ga0207712_10306760 | |||
| 4143 | Ga0207712_10374776 | |||
| 4144 | Ga0207712_10539496 | |||
| 4145 | Ga0207712_11093036 | |||
| 4146 | Ga0207712_11207684 | |||
| 4147 | Ga0207712_11438514 | |||
| 4148 | Ga0207668_10022797 | |||
| 4149 | Ga0207668_10038106 | |||
| 4150 | Ga0207668_10492228 | |||
| 4151 | Ga0207668_10548055 | |||
| 4152 | Ga0207668_10633182 | |||
| 4153 | Ga0207668_10689759 | |||
| 4154 | Ga0207668_10718906 | |||
| 4155 | Ga0207668_10736437 | |||
| 4156 | Ga0207668_11039742 | |||
| 4157 | Ga0207668_11376203 | |||
| 4158 | Ga0207668_11887601 | |||
| 4159 | Ga0207640_10027866 | |||
| 4160 | Ga0207640_10075286 | |||
| 4161 | Ga0207640_10098175 | |||
| 4162 | Ga0207640_10243564 | |||
| 4163 | Ga0207640_10390288 | |||
| 4164 | Ga0207640_10574245 | |||
| 4165 | Ga0207640_10587309 | |||
| 4166 | Ga0207640_11055036 | |||
| 4167 | Ga0207658_10017346 | |||
| 4168 | Ga0207658_10074841 | |||
| 4169 | Ga0207658_10209960 | |||
| 4170 | Ga0207658_10230252 | |||
| 4171 | Ga0207658_10257965 | |||
| 4172 | Ga0207658_11288645 | |||
| 4173 | Ga0207677_10048110 | |||
| 4174 | Ga0207677_10123145 | |||
| 4175 | Ga0207677_10306432 | |||
| 4176 | Ga0207677_10326873 | |||
| 4177 | Ga0207677_10386697 | |||
| 4178 | Ga0207677_10515191 | |||
| 4179 | Ga0207677_10600600 | |||
| 4180 | Ga0207677_11227454 | |||
| 4181 | Ga0207677_11505298 | |||
| 4182 | Ga0207677_11514961 | |||
| 4183 | Ga0207703_10005589 | |||
| 4184 | Ga0207703_10016696 | |||
| 4185 | Ga0207703_10100105 | |||
| 4186 | Ga0207703_10113572 | |||
| 4187 | Ga0207703_10147228 | |||
| 4188 | Ga0207703_10173421 | |||
| 4189 | Ga0207703_10276641 | |||
| 4190 | Ga0207703_10434473 | |||
| 4191 | Ga0207703_10470293 | |||
| 4192 | Ga0207703_10598333 | |||
| 4193 | Ga0207703_10685251 | |||
| 4194 | Ga0207703_10763630 | |||
| 4195 | Ga0207703_10798883 | |||
| 4196 | Ga0207703_10918443 | |||
| 4197 | Ga0207703_11007670 | |||
| 4198 | Ga0207703_11159674 | |||
| 4199 | Ga0207703_11422016 | |||
| 4200 | Ga0207639_10575364 | |||
| 4201 | Ga0207639_12129813 | |||
| 4202 | Ga0207678_10085429 | |||
| 4203 | Ga0207678_10104793 | |||
| 4204 | Ga0207678_10839561 | |||
| 4205 | Ga0207708_10002731 | |||
| 4206 | Ga0207708_10005707 | |||
| 4207 | Ga0207708_10007575 | |||
| 4208 | Ga0207708_10013366 | |||
| 4209 | Ga0207708_10035110 | |||
| 4210 | Ga0207708_10054645 | |||
| 4211 | Ga0207708_10109917 | |||
| 4212 | Ga0207708_10120429 | |||
| 4213 | Ga0207708_10127761 | |||
| 4214 | Ga0207708_10137445 | |||
| 4215 | Ga0207708_10153019 | |||
| 4216 | Ga0207708_10210968 | |||
| 4217 | Ga0207708_10321015 | |||
| 4218 | Ga0207708_10431706 | |||
| 4219 | Ga0207708_10556027 | |||
| 4220 | Ga0207708_10592636 | |||
| 4221 | Ga0207708_10805529 | |||
| 4222 | Ga0207708_10889935 | |||
| 4223 | Ga0207708_10915256 | |||
| 4224 | Ga0207641_10008046 | |||
| 4225 | Ga0207641_10008049 | |||
| 4226 | Ga0207641_10087545 | |||
| 4227 | Ga0207641_10304766 | |||
| 4228 | Ga0207641_10595367 | |||
| 4229 | Ga0207641_10761492 | |||
| 4230 | Ga0207641_11888600 | |||
| 4231 | Ga0207648_10001325 | |||
| 4232 | Ga0207648_10006823 | |||
| 4233 | Ga0207648_10018936 | |||
| 4234 | Ga0207648_10030419 | |||
| 4235 | Ga0207648_10047057 | |||
| 4236 | Ga0207648_10048298 | |||
| 4237 | Ga0207648_10109680 | |||
| 4238 | Ga0207648_10115701 | |||
| 4239 | Ga0207648_10138127 | |||
| 4240 | Ga0207648_10246557 | |||
| 4241 | Ga0207648_10493009 | |||
| 4242 | Ga0207648_10541641 | |||
| 4243 | Ga0207648_10565675 | |||
| 4244 | Ga0207648_11161057 | |||
| 4245 | Ga0207648_11538807 | |||
| 4246 | Ga0207648_11584263 | |||
| 4247 | Ga0207648_12042267 | |||
| 4248 | Ga0207676_10001537 | |||
| 4249 | Ga0207676_10023862 | |||
| 4250 | Ga0207676_10046642 | |||
| 4251 | Ga0207676_10092743 | |||
| 4252 | Ga0207676_10133256 | |||
| 4253 | Ga0207676_10461946 | |||
| 4254 | Ga0207676_10464106 | |||
| 4255 | Ga0207676_10674318 | |||
| 4256 | Ga0207676_10819143 | |||
| 4257 | Ga0207676_11212175 | |||
| 4258 | Ga0207676_11665964 | |||
| 4259 | Ga0207676_11671255 | |||
| 4260 | Ga0207676_11718994 | |||
| 4261 | Ga0207674_10118190 | |||
| 4262 | Ga0207674_10172028 | |||
| 4263 | Ga0207674_10193818 | |||
| 4264 | Ga0207674_10307778 | |||
| 4265 | Ga0207674_10438068 | |||
| 4266 | Ga0207674_10513188 | |||
| 4267 | Ga0207674_10707408 | |||
| 4268 | Ga0207675_100004079 | |||
| 4269 | Ga0207675_100012575 | |||
| 4270 | Ga0207675_100014601 | |||
| 4271 | Ga0207675_100030677 | |||
| 4272 | Ga0207675_100081005 | |||
| 4273 | Ga0207675_100109920 | |||
| 4274 | Ga0207675_100213260 | |||
| 4275 | Ga0207675_100224020 | |||
| 4276 | Ga0207675_100283219 | |||
| 4277 | Ga0207675_100286799 | |||
| 4278 | Ga0207675_100470460 | |||
| 4279 | Ga0207675_100479652 | |||
| 4280 | Ga0207675_100483409 | |||
| 4281 | Ga0207675_100567556 | |||
| 4282 | Ga0207675_100770175 | |||
| 4283 | Ga0207675_101238383 | |||
| 4284 | Ga0207675_101663206 | |||
| 4285 | Ga0207675_101757296 | |||
| 4286 | Ga0207675_102334870 | |||
| 4287 | Ga0207683_10012729 | |||
| 4288 | Ga0207683_10029222 | |||
| 4289 | Ga0207683_10031846 | |||
| 4290 | Ga0207683_10093176 | |||
| 4291 | Ga0207683_10159271 | |||
| 4292 | Ga0207683_10179696 | |||
| 4293 | Ga0207683_10205737 | |||
| 4294 | Ga0207683_10212113 | |||
| 4295 | Ga0207683_10218940 | |||
| 4296 | Ga0207683_10258646 | |||
| 4297 | Ga0207683_10305059 | |||
| 4298 | Ga0207683_10490854 | |||
| 4299 | Ga0207683_10625158 | |||
| 4300 | Ga0207683_11283663 | |||
| 4301 | Ga0207698_10425606 | |||
| 4302 | Ga0207698_10506212 | |||
| 4303 | Ga0207698_11730492 | |||
| 4304 | Ga0209996_1029540 | |||
| 4305 | Ga0210000_1067597 | |||
| 4306 | Ga0209995_1028618 | |||
| 4307 | Ga0209999_1075118 | |||
| 4308 | Ga0209982_1055281 | |||
| 4309 | Ga0209970_1120198 | |||
| 4310 | Ga0209983_1034620 | |||
| 4311 | Ga0209971_1016674 | |||
| 4312 | Ga0209966_1116233 | |||
| 4313 | Ga0209998_10007303 | |||
| 4314 | Ga0209998_10158681 | |||
| 4315 | Ga0209813_10004311 | |||
| 4316 | Ga0209813_10494613 | |||
| 4317 | Ga0209974_10076524 | |||
| 4318 | Ga0209974_10163228 | |||
| 4319 | Ga0209974_10268258 | |||
| 4320 | Ga0207428_10000021 | |||
| 4321 | Ga0207428_10000570 | |||
| 4322 | Ga0207428_10002263 | |||
| 4323 | Ga0207428_10007451 | |||
| 4324 | Ga0207428_10008429 | |||
| 4325 | Ga0207428_10016510 | |||
| 4326 | Ga0207428_10016885 | |||
| 4327 | Ga0207428_10019436 | |||
| 4328 | Ga0207428_10087851 | |||
| 4329 | Ga0207428_10349987 | |||
| 4330 | Ga0207428_10358488 | |||
| 4331 | Ga0207428_10435356 | |||
| 4332 | Ga0207428_10495763 | |||
| 4333 | Ga0207428_10777708 | |||
| 4334 | Ga0207428_10917062 | |||
| 4335 | Ga0207428_11169181 | |||
| 4336 | Ga0268266_10011773 | |||
| 4337 | Ga0268266_10040785 | |||
| 4338 | Ga0268266_10804402 | |||
| 4339 | Ga0268266_10878377 | |||
| 4340 | Ga0268266_11403540 | |||
| 4341 | Ga0268266_12028874 | |||
| 4342 | Ga0268265_10000772 | |||
| 4343 | Ga0268265_10018529 | |||
| 4344 | Ga0268265_10033837 | |||
| 4345 | Ga0268265_10123477 | |||
| 4346 | Ga0268265_10130989 | |||
| 4347 | Ga0268265_10188052 | |||
| 4348 | Ga0268265_10322738 | |||
| 4349 | Ga0268265_10329180 | |||
| 4350 | Ga0268265_10352155 | |||
| 4351 | Ga0268265_10652778 | |||
| 4352 | Ga0268265_10804695 | |||
| 4353 | Ga0268265_10847077 | |||
| 4354 | Ga0268265_10868268 | |||
| 4355 | Ga0268265_10959005 | |||
| 4356 | Ga0268265_11285477 | |||
| 4357 | Ga0268265_11376551 | |||
| 4358 | Ga0268265_11690639 | |||
| 4359 | Ga0268265_11983264 | |||
| 4360 | Ga0268264_10019123 | |||
| 4361 | Ga0268264_10064145 | |||
| 4362 | Ga0268264_10158419 | |||
| 4363 | Ga0268264_10205224 | |||
| 4364 | Ga0268264_10205815 | |||
| 4365 | Ga0268264_10217007 | |||
| 4366 | Ga0268264_10340537 | |||
| 4367 | Ga0268264_10406879 | |||
| 4368 | Ga0268264_10445480 | |||
| 4369 | Ga0268264_10480293 | |||
| 4370 | Ga0268264_10710632 | |||
| 4371 | Ga0268264_11159878 | |||
| 4372 | Ga0268264_11689620 | |||
| 4373 | Ga0265337_1034006 | |||
| 4374 | Ga0265326_10000028 | |||
| 4375 | Ga0265319_1000746 | |||
| 4376 | Ga0265334_10000040 | |||
| 4377 | Ga0265336_10003949 | |||
| 4378 | Ga0265338_10000661 | |||
| 4379 | Ga0265324_10006868 | |||
| 4380 | Ga0316177_1137045 | |||
| 4381 | Ga0265332_10078791 | |||
| 4382 | Ga0265332_10147374 | |||
| 4383 | Ga0265320_10357648 | |||
| 4384 | Ga0265327_10016019 | |||
| 4385 | Ga0307408_100014431 | |||
| 4386 | Ga0307408_100020494 | |||
| 4387 | Ga0307408_100062075 | |||
| 4388 | Ga0307408_100137514 | |||
| 4389 | Ga0307408_100327910 | |||
| 4390 | Ga0307408_100339708 | |||
| 4391 | Ga0307408_100466204 | |||
| 4392 | Ga0307408_100603019 | |||
| 4393 | Ga0307408_100853082 | |||
| 4394 | Ga0265314_10029252 | |||
| 4395 | Ga0265314_10537246 | |||
| 4396 | Ga0307405_10000803 | |||
| 4397 | Ga0307405_10060325 | |||
| 4398 | Ga0307405_10951617 | |||
| 4399 | Ga0307405_10965234 | |||
| 4400 | Ga0307405_11969757 | |||
| 4401 | Ga0307413_10215764 | |||
| 4402 | Ga0307413_10758069 | |||
| 4403 | Ga0307413_10764832 | |||
| 4404 | Ga0307410_10004314 | |||
| 4405 | Ga0307410_10267810 | |||
| 4406 | Ga0307410_11081766 | |||
| 4407 | Ga0307406_10078819 | |||
| 4408 | Ga0307406_10171833 | |||
| 4409 | Ga0307406_11116729 | |||
| 4410 | Ga0307407_10044651 | |||
| 4411 | Ga0307407_10257974 | |||
| 4412 | Ga0307412_10001225 | |||
| 4413 | Ga0307412_10074987 | |||
| 4414 | Ga0307412_10105275 | |||
| 4415 | Ga0307412_10132924 | |||
| 4416 | Ga0307412_10335921 | |||
| 4417 | Ga0307412_10726732 | |||
| 4418 | Ga0307412_10895248 | |||
| 4419 | Ga0307412_11093811 | |||
| 4420 | Ga0307412_12045292 | |||
| 4421 | Ga0307409_100008674 | |||
| 4422 | Ga0307409_100036598 | |||
| 4423 | Ga0307409_100080632 | |||
| 4424 | Ga0307409_100539846 | |||
| 4425 | Ga0307409_100576721 | |||
| 4426 | Ga0307409_100660716 | |||
| 4427 | Ga0307409_100889896 | |||
| 4428 | Ga0307409_102884186 | |||
| 4429 | Ga0307416_100000919 | |||
| 4430 | Ga0307416_100002964 | |||
| 4431 | Ga0307416_100006245 | |||
| 4432 | Ga0307416_100022703 | |||
| 4433 | Ga0307416_100025464 | |||
| 4434 | Ga0307416_100105363 | |||
| 4435 | Ga0307416_100118856 | |||
| 4436 | Ga0307416_100173710 | |||
| 4437 | Ga0307416_100927198 | |||
| 4438 | Ga0307416_102515037 | |||
| 4439 | Ga0307416_103572395 | |||
| 4440 | Ga0307414_10173577 | |||
| 4441 | Ga0307414_10321544 | |||
| 4442 | Ga0307414_10650436 | |||
| 4443 | Ga0307414_11243203 | |||
| 4444 | Ga0307414_11459936 | |||
| 4445 | Ga0307414_11947080 | |||
| 4446 | Ga0307411_10006469 | |||
| 4447 | Ga0307411_10009191 | |||
| 4448 | Ga0307411_10014918 | |||
| 4449 | Ga0307411_10023178 | |||
| 4450 | Ga0307411_10119110 | |||
| 4451 | Ga0307411_10334776 | |||
| 4452 | Ga0307411_10337440 | |||
| 4453 | Ga0307411_10466817 | |||
| 4454 | Ga0307411_10610904 | |||
| 4455 | Ga0307411_12021575 | |||
| 4456 | Ga0307415_100006180 | |||
| 4457 | Ga0307415_100055869 | |||
| 4458 | Ga0307415_100856750 | |||
| 4459 | Ga0373948_0023401 | |||
| 4460 | Ga0373950_0029714 | |||
| 4461 | Ga0373958_0001904 | |||
| 4462 | Ga0373959_0000856 | |||
| 4463 | Ga0373938_0000270 | |||
| 4464 | Ga0373934_0230471 | |||
| 4465 | Ga0373934_0407305 | |||
| 4466 | Ga0373940_0019908 | |||
| 4467 | Ga0373940_0022988 | |||
| 4468 | Ga0373940_0048984 | |||
| 4469 | Ga0373944_0044793 | |||
| 4470 | Ga0373944_0146027 | |||
| 4471 | Ga0373949_0004159 | |||
| 4472 | Ga0373949_0018737 | |||
| 4473 | Ga0373949_0136530 | |||
| 4474 | Ga0373951_0000705 | |||
| 4475 | Ga0373951_0047441 | |||
| 4476 | Ga0373952_0001064 | |||
| 4477 | Ga0373952_0097357 | |||
| 4478 | Ga0373923_0052689 | |||
| 4479 | Ga0373923_0323984 | |||
| 4480 | Ga0373932_0006011 | |||
| 4481 | Ga0373932_0097400 | |||
| 4482 | Ga0373939_0000661 | |||
| 4483 | Ga0373939_0036301 | |||
| 4484 | Ga0373939_0184345 | |||
| 4485 | Ga0373941_0020023 | |||
| 4486 | Ga0373941_0114268 | |||
| 4487 | Ga0373945_0181381 | |||
| 4488 | Ga0373953_0161933 | |||
| 4489 | Ga0373954_0031135 | |||
| 4490 | Ga0373954_0450666 | |||
| 4491 | Ga0373954_0618249 | |||
| 4492 | Ga0373957_0144635 | |||
| 4493 | Ga0373957_0278127 | |||
| 4494 | Ga0373957_0468043 | |||
| 4495 | Ga0373960_0000054 | |||
| 4496 | Ga0373960_0080966 | |||
| 4497 | Ga0373960_0081951 | |||
| 4498 | Ga0373960_0220995 | |||
| 4499 | Ga0373960_0323604 | |||
| 4500 | Ga0373943_0000751 | |||
| 4501 | Ga0373943_0165126 | |||
| 4502 | Ga0373943_0478673 | |||
| 4503 | Ga0373943_0581069 | |||
| 4504 | Ga0373943_0807040 | |||
| 4505 | Ga0373946_0005914 | |||
| 4506 | Ga0373946_0072757 | |||
| 4507 | Ga0373955_0006664 | |||
| 4508 | Ga0373955_0081966 | |||
| 4509 | Ga0373955_0083243 | |||
| 4510 | Ga0373955_0388909 | |||
| 4511 | Ga0373955_0595114 | |||
| 4512 | Ga0373961_0000488 | |||
| 4513 | Ga0373962_0004765 | |||
| 4514 | Ga0373962_0087955 | |||
| 4515 | Ga0373962_0126547 | |||
| 4516 | Ga0373962_0239607 | |||
| 4517 | Ga0373962_0245360 | |||
| 4518 | Ga0373924_0005158 | |||
| 4519 | Ga0373924_0192621 | |||
| 4520 | Ga0373924_0590334 | |||
| 4521 | Ga0373931_0000668 | |||
| 4522 | Ga0373931_0034126 | |||
| 4523 | Ga0373931_0057882 | |||
| 4524 | Ga0373931_0515849 | |||
| 4525 | Ga0373931_0761353 | |||
| 4526 | Ga0373935_0213435 | |||
| 4527 | Ga0373935_0259403 | |||
| 4528 | Ga0373935_0446138 | |||
| 4529 | Ga0373935_0763068 | |||
| 4530 | Ga0373935_1296175 | |||
| 4531 | Ga0373927_0538799 | |||
| 4532 | Ga0373933_0041252 | |||
| 4533 | Ga0373933_0426713 | |||
| 4534 | Ga0373933_0743378 | |||
| 4535 | Ga0373933_0916064 | |||
| 4536 | Ga0373947_0266336 | |||
| 4537 | Ga0373947_0309340 | |||
| 4538 | Ga0373947_0578678 | |||
| 4539 | Ga0373947_0987376 | |||
| 4540 | Ga0373937_0006676 | |||
| 4541 | Ga0373937_0013739 | |||
| 4542 | Ga0373937_0041357 | |||
| 4543 | Ga0373937_0209941 | |||
| 4544 | Ga0373937_1531527 | |||
| 4545 | Ga0373937_1981210 | |||
| 4546 | Ga0373937_1988862 | |||
| 4547 | Ga0373925_0006947 | |||
| 4548 | Ga0373925_0013472 | |||
| 4549 | Ga0373925_0069270 | |||
| 4550 | Ga0373925_0098923 | |||
| 4551 | Ga0373925_0445265 | |||
| 4552 | Ga0373925_0477981 | |||
| 4553 | Ga0373925_0913899 | |||
| 4554 | Ga0395905_0700986 | |||
| 4555 | Ga0242420_070702 | |||
| 4556 | Ga0436365_0499271 | |||
| 4557 | Ga0436365_1017954 | |||
| 4558 | Ga0436365_1174797 | |||
| 4559 | Ga0436365_1696168 | |||
| 4560 | Ga0439453_0006334 | |||
| 4561 | Ga0439453_0041454 | |||
| 4562 | Ga0439453_0145113 | |||
| 4563 | Ga0439461_0082133 | |||
| 4564 | Ga0439461_0196797 | |||
| 4565 | Ga0451787_290358 | |||
| 4566 | Ga0451791_0128859 | |||
| 4567 | Ga0451793_1779034 | |||
| 4568 | Ga0451800_0189637 | |||
| 4569 | Ga0451802_0167054 | |||
| 4570 | Ga0451804_0849585 | |||
| 4571 | Ga0451851_1374125 | |||
| 4572 | Ga0451853_0622843 | |||
| 4573 | Ga0451853_0708216 | |||
| 4574 | Ga0451853_1516782 | |||
| 4575 | Ga0451853_2606140 | |||
| 4576 | Ga0451853_3132910 | |||
| 4577 | Ga0439441_033213 | |||
| 4578 | Ga0439443_011355 | |||
| 4579 | Ga0439445_0090707 | |||
| 4580 | Ga0439450_003267 | |||
| 4581 | Ga0439450_048025 | |||
| 4582 | Ga0439451_052533 | |||
| 4583 | Ga0439455_0177556 | |||
| 4584 | Ga0439457_111164 | |||
| 4585 | Ga0439462_0056990 | |||
| 4586 | Ga0439462_0192520 | |||
| 4587 | Ga0450890_085205 | |||
| 4588 | Ga0450896_021212 | |||
| 4589 | Ga0439446_0048404 | |||
| 4590 | Ga0439446_0157179 | |||
| 4591 | Ga0439446_0181987 | |||
| 4592 | Ga0439435_0038565 | |||
| 4593 | Ga0439435_0089022 | |||
| 4594 | Ga0439435_0118490 | |||
| 4595 | Ga0439444_0083482 | |||
| 4596 | Ga0439459_0107466 | |||
| 4597 | Ga0439464_0000501 | |||
| 4598 | Ga0439464_0070641 | |||
| 4599 | Ga0439464_0104743 | |||
| 4600 | Ga0439464_0119202 | |||
| 4601 | Ga0439464_0212745 | |||
| 4602 | Ga0439464_0242667 | |||
| 4603 | Ga0439460_0051717 | |||
| 4604 | Ga0439460_0066950 | |||
| 4605 | Ga0439460_0175085 | |||
| 4606 | Ga0439460_0251812 | |||
| 4607 | Ga0439460_0252503 | |||
| 4608 | Ga0450916_086684 | |||
| 4609 | Ga0450893_0095625 | |||
| 4610 | Ga0450893_0129696 | |||
| 4611 | Ga0451577_0734245 | |||
| 4612 | Ga0439440_0029623 | |||
| 4613 | Ga0439440_0076260 | |||
| 4614 | Ga0439440_0083429 | |||
| 4615 | Ga0439440_0119709 | |||
| 4616 | Ga0453683_0933121 | |||
| 4617 | Ga0466966_0787118 | |||
| 4618 | Ga0466960_0582000 | |||
| 4619 | Ga0466959_0418768 | |||
| 4620 | Ga0451576_0002764 | |||
| 4621 | Ga0451576_0008567 | |||
| 4622 | Ga0451576_0026133 | |||
| 4623 | Ga0451576_0205304 | |||
| 4624 | Ga0451576_0213190 | |||
| 4625 | Ga0451576_0348088 | |||
| 4626 | Ga0451576_0454491 | |||
| 4627 | Ga0466967_1739665 | |||
| 4628 | Ga0495592_0419846 | |||
| 4629 | Ga0495603_0035445 | |||
| 4630 | Ga0495603_0069824 | |||
| 4631 | Ga0495603_0142734 | |||
| 4632 | Ga0495603_0376659 | |||
| 4633 | Ga0495590_0318104 | |||
| 4634 | Ga0495590_0319212 | |||
| 4635 | Ga0495629_0080403 | |||
| 4636 | Ga0495629_0460021 | |||
| 4637 | Ga0495580_0070724 | |||
| 4638 | Ga0495580_0421106 | |||
| 4639 | Ga0495582_0096328 | |||
| 4640 | Ga0495582_0219881 | |||
| 4641 | Ga0495582_0251163 | |||
| 4642 | Ga0495582_0787471 | |||
| 4643 | Ga0495639_0078014 | |||
| 4644 | Ga0495639_0156778 | |||
| 4645 | Ga0495639_0249892 | |||
| 4646 | Ga0495585_0032001 | |||
| 4647 | Ga0495594_0095743 | |||
| 4648 | Ga0495594_0114950 | |||
| 4649 | Ga0495594_0175647 | |||
| 4650 | Ga0495608_0041215 | |||
| 4651 | Ga0495608_0580857 | |||
| 4652 | Ga0495618_0457688 | |||
| 4653 | Ga0495618_0668754 | |||
| 4654 | Ga0495620_0235087 | |||
| 4655 | Ga0495628_0061096 | |||
| 4656 | Ga0495628_0131053 | |||
| 4657 | Ga0495630_0010405 | |||
| 4658 | Ga0495630_1196449 | |||
| 4659 | Ga0495637_0069931 | |||
| 4660 | Ga0495643_0021226 | |||
| 4661 | Ga0495663_0006839 | |||
| 4662 | Ga0495663_0046692 | |||
| 4663 | Ga0495663_0050992 | |||
| 4664 | Ga0495663_0316575 | |||
| 4665 | Ga0495666_0448962 | |||
| 4666 | Ga0495642_0003038 | |||
| 4667 | Ga0495642_0164566 | |||
| 4668 | Ga0495652_0961907 | |||
| 4669 | Ga0495665_0583293 | |||
| 4670 | Ga0495640_0067995 | |||
| 4671 | Ga0495640_0209736 | |||
| 4672 | Ga0495640_0277619 | |||
| 4673 | Ga0495640_0360213 | |||
| 4674 | Ga0495640_0920854 | |||
| 4675 | Ga0495598_0005013 | |||
| 4676 | Ga0495598_0025930 | |||
| 4677 | Ga0495598_0032705 | |||
| 4678 | Ga0495598_0292375 | |||
| 4679 | Ga0495609_0014640 | |||
| 4680 | Ga0495621_0000555 | |||
| 4681 | Ga0495621_0006303 | |||
| 4682 | Ga0495621_0011543 | |||
| 4683 | Ga0495621_0030639 | |||
| 4684 | Ga0495621_0085787 | |||
| 4685 | Ga0495621_0216521 | |||
| 4686 | Ga0495621_0517898 | |||
| 4687 | Ga0495597_0197535 | |||
| 4688 | Ga0495597_0387189 | |||
| 4689 | Ga0495645_0171096 | |||
| 4690 | Ga0495645_0544181 | |||
| 4691 | Ga0495633_0004066 | |||
| 4692 | Ga0495667_0181985 | |||
| 4693 | Ga0495667_0198685 | |||
| 4694 | Ga0495667_0533786 | |||
| 4695 | Ga0495656_0003551 | |||
| 4696 | Ga0495656_0067661 | |||
| 4697 | Ga0495656_0299122 | |||
| 4698 | Ga0495656_0477808 | |||
| 4699 | Ga0495656_0653390 | |||
| 4700 | Ga0495668_0543035 | |||
| 4701 | Ga0495668_0806823 | |||
| 4702 | Ga0495634_0222999 | |||
| 4703 | Ga0495634_0672076 | |||
| 4704 | Ga0495635_0438619 | |||
| 4705 | Ga0495635_0571795 | |||
| 4706 | Ga0495659_0001873 | |||
| 4707 | Ga0495659_0018971 | |||
| 4708 | Ga0495659_0028277 | |||
| 4709 | Ga0495659_0084531 | |||
| 4710 | Ga0495659_0160208 | |||
| 4711 | Ga0495659_0164863 | |||
| 4712 | Ga0495659_0235102 | |||
| 4713 | Ga0495661_0583225 | |||
| 4714 | Ga0495588_0006275 | |||
| 4715 | Ga0495588_0657634 | |||
| 4716 | Ga0495657_0168432 | |||
| 4717 | Ga0495657_0507789 | |||
| 4718 | Ga0495623_0168828 | |||
| 4719 | Ga0495647_0065623 | |||
| 4720 | Ga0495647_0566169 | |||
| 4721 | Ga0495647_0587810 | |||
| 4722 | Ga0495647_0616088 | |||
| 4723 | Ga0495658_0041345 | |||
| 4724 | Ga0495658_0044093 | |||
| 4725 | Ga0495658_0061713 | |||
| 4726 | Ga0495658_0068362 | |||
| 4727 | Ga0495658_0150052 | |||
| 4728 | Ga0495658_0351132 | |||
| 4729 | Ga0495669_0004530 | |||
| 4730 | Ga0495669_0095986 | |||
| 4731 | Ga0495669_0145343 | |||
| 4732 | Ga0495613_0004058 | |||
| 4733 | Ga0495670_0049911 | |||
| 4734 | Ga0495670_0157390 | |||
| 4735 | Ga0495670_0226684 | |||
| 4736 | Ga0495670_0700124 | |||
| 4737 | Ga0495671_0476794 | |||
| 4738 | Ga0495589_0534644 | |||
| 4739 | Ga0495600_0093642 | |||
| 4740 | Ga0495600_0871425 | |||
| 4741 | Ga0495581_0102584 | |||
| 4742 | Ga0495581_0480343 | |||
| 4743 | Ga0495604_0049008 | |||
| 4744 | Ga0495636_0021335 | |||
| 4745 | Ga0495674_0033229 | |||
| 4746 | Ga0495674_0705808 | |||
| 4747 | Ga0495672_0101037 | |||
| 4748 | Ga0495680_0031953 | |||
| 4749 | Ga0495675_0178139 | |||
| 4750 | Ga0495677_0084304 | |||
| 4751 | Ga0495685_009919 | |||
| 4752 | Ga0495684_0001164 | |||
| 4753 | Ga0495684_0273660 | |||
| 4754 | Ga0495684_0422463 | |||
| 4755 | Ga0495684_0801730 | |||
| 4756 | Ga0495602_0154005 | |||
| 4757 | Ga0496100_0003686 | |||
| 4758 | Ga0496100_0102699 | |||
| 4759 | Ga0496100_0826070 | |||
| 4760 | Ga0496100_1225913 | |||
| 4761 | Ga0496100_1583278 | |||
| 4762 | Ga0496101_0001362 | |||
| 4763 | Ga0496101_0002308 | |||
| 4764 | Ga0496102_0092641 | |||
| 4765 | Ga0496102_0805157 | |||
| 4766 | Ga0496102_0852176 | |||
| 4767 | Ga0496103_0938875 | |||
| 4768 | Ga0496104_0011626 | |||
| 4769 | Ga0496104_0016660 | |||
| 4770 | Ga0496104_0033356 | |||
| 4771 | Ga0496104_0142420 | |||
| 4772 | Ga0496104_0172673 | |||
| 4773 | Ga0496104_0451856 | |||
| 4774 | Ga0496104_0708884 | |||
| 4775 | Ga0496104_0760922 | |||
| 4776 | Ga0496104_0870710 | |||
| 4777 | Ga0496105_0033301 | |||
| 4778 | Ga0496105_0103401 | |||
| 4779 | Ga0496105_0882718 | |||
| 4780 | Ga0496105_1036711 | |||
| 4781 | Ga0496106_0082789 | |||
| 4782 | Ga0496106_0133640 | |||
| 4783 | Ga0496106_0136165 | |||
| 4784 | Ga0496106_0248477 | |||
| 4785 | Ga0496106_0281622 | |||
| 4786 | Ga0496107_0024689 | |||
| 4787 | Ga0496107_0170039 | |||
| 4788 | Ga0496107_0687660 | |||
| 4789 | Ga0496107_0726140 | |||
| 4790 | Ga0496108_0008524 | |||
| 4791 | Ga0496108_1257625 | |||
| 4792 | Ga0496109_0234194 | |||
| 4793 | Ga0496109_0379850 | |||
| 4794 | Ga0496109_0550524 | |||
| 4795 | Ga0496109_1328589 | |||
| 4796 | Ga0496109_1901726 | |||
| 4797 | Ga0496110_0880488 | |||
| 4798 | Ga0496111_0931386 | |||
| 4799 | Ga0496111_1311404 | |||
| 4800 | Ga0496112_0000350 | |||
| 4801 | Ga0496112_0557811 | |||
| 4802 | Ga0496112_0914284 | |||
| 4803 | Ga0496112_0920911 | |||
| 4804 | Ga0496112_1081565 | |||
| 4805 | Ga0496113_0015351 | |||
| 4806 | Ga0496113_0309179 | |||
| 4807 | Ga0496113_0422096 | |||
| 4808 | Ga0496114_0000376 | |||
| 4809 | Ga0496114_0000743 | |||
| 4810 | Ga0496114_0233463 | |||
| 4811 | Ga0496114_0278028 | |||
| 4812 | Ga0496114_0428586 | |||
| 4813 | Ga0496114_0617754 | |||
| 4814 | Ga0496114_0804382 | |||
| 4815 | Ga0496115_0316972 | |||
| 4816 | Ga0496115_1026720 | |||
| 4817 | Ga0496115_1032700 | |||
| 4818 | Ga0501294_015730 | |||
| 4819 | Ga0501295_122921 | |||
| 4820 | Ga0501296_048296 | |||
| 4821 | Ga0501298_006410 | |||
| 4822 | Ga0501298_060304 | |||
| 4823 | Ga0501298_098553 | |||
| 4824 | Ga0501299_009585 | |||
| 4825 | Ga0501299_042497 | |||
| 4826 | Ga0501300_035172 | |||
| 4827 | Ga0501031_0022156 | |||
| 4828 | Ga0501031_0270690 | |||
| 4829 | Ga0501031_0553555 | |||
| 4830 | Ga0501032_0006589 | |||
| 4831 | Ga0501032_0401009 | |||
| 4832 | Ga0501032_0491969 | |||
| 4833 | Ga0501032_1019488 | |||
| 4834 | Ga0501033_0000802 | |||
| 4835 | Ga0501033_0620244 | |||
| 4836 | Ga0501034_0007961 | |||
| 4837 | Ga0501034_0061855 | |||
| 4838 | Ga0501034_0604594 | |||
| 4839 | Ga0501036_0001038 | |||
| 4840 | Ga0501036_0137981 | |||
| 4841 | Ga0501036_0229783 | |||
| 4842 | Ga0501036_0804211 | |||
| 4843 | Ga0501037_0007964 | |||
| 4844 | Ga0501038_0002085 | |||
| 4845 | Ga0501038_0063914 | |||
| 4846 | Ga0501038_0070553 | |||
| 4847 | Ga0501038_0134455 | |||
| 4848 | Ga0501039_0035250 | |||
| 4849 | Ga0501039_0079870 | |||
| 4850 | Ga0501039_0097161 | |||
| 4851 | Ga0501039_0823994 | |||
| 4852 | Ga0501040_0004120 | |||
| 4853 | Ga0501040_0009388 | |||
| 4854 | Ga0501040_0235900 | |||
| 4855 | Ga0501040_0435656 | |||
| 4856 | Ga0501041_0002267 | |||
| 4857 | Ga0501041_0025316 | |||
| 4858 | Ga0501041_0030740 | |||
| 4859 | Ga0501041_0106125 | |||
| 4860 | Ga0501041_0309291 | |||
| 4861 | Ga0501042_0026471 | |||
| 4862 | Ga0501042_0052000 | |||
| 4863 | Ga0501042_0136359 | |||
| 4864 | Ga0501042_0150442 | |||
| 4865 | Ga0501042_0193951 | |||
| 4866 | Ga0501043_0008493 | |||
| 4867 | Ga0501043_0069357 | |||
| 4868 | Ga0501043_0074908 | |||
| 4869 | Ga0501043_0141733 | |||
| 4870 | Ga0501043_1059325 | |||
| 4871 | Ga0501046_0004140 | |||
| 4872 | Ga0501046_0026545 | |||
| 4873 | Ga0501046_0074986 | |||
| 4874 | Ga0501046_0088257 | |||
| 4875 | Ga0501047_0006398 | |||
| 4876 | Ga0501048_0003752 | |||
| 4877 | Ga0501048_0015163 | |||
| 4878 | Ga0501048_0024903 | |||
| 4879 | Ga0501067_0025800 | |||
| 4880 | Ga0501068_0003166 | |||
| 4881 | Ga0501068_0062493 | |||
| 4882 | Ga0501069_0005034 | |||
| 4883 | Ga0501069_0179471 | |||
| 4884 | Ga0501070_0002294 | |||
| 4885 | Ga0501070_0404783 | |||
| 4886 | Ga0501070_0985862 | |||
| 4887 | Ga0501071_0027676 | |||
| 4888 | Ga0501071_0055478 | |||
| 4889 | Ga0501071_0464889 | |||
| 4890 | Ga0501071_0607286 | |||
| 4891 | Ga0501071_0610052 | |||
| 4892 | Ga0501072_0012349 | |||
| 4893 | Ga0501072_0148143 | |||
| 4894 | Ga0501072_0351458 | |||
| 4895 | Ga0501072_0674836 | |||
| 4896 | Ga0501073_0002819 | |||
| 4897 | Ga0501073_0878987 | |||
| 4898 | Ga0501074_0048687 | |||
| 4899 | Ga0501074_0079466 | |||
| 4900 | Ga0501074_0454250 | |||
| 4901 | Ga0501074_0632510 | |||
| 4902 | Ga0501075_0029245 | |||
| 4903 | Ga0501075_0033782 | |||
| 4904 | Ga0501075_0068028 | |||
| 4905 | Ga0501075_0123538 | |||
| 4906 | Ga0501075_1088631 | |||
| 4907 | Ga0501075_1142775 | |||
| 4908 | Ga0501075_1375406 | |||
| 4909 | Ga0501076_0000493 | |||
| 4910 | Ga0501076_0018244 | |||
| 4911 | Ga0501076_0034055 | |||
| 4912 | Ga0501076_0191927 | |||
| 4913 | Ga0501076_0746321 | |||
| 4914 | Ga0501076_0878551 | |||
| 4915 | Ga0501076_1369137 | |||
| 4916 | Ga0501077_0008502 | |||
| 4917 | Ga0501077_0064473 | |||
| 4918 | Ga0501077_0077760 | |||
| 4919 | Ga0501202_027623 | |||
| 4920 | Ga0501217_007594 | |||
| 4921 | Ga0501230_169971 | |||
| 4922 | Ga0501235_186940 | |||
| 4923 | Ga0501235_239476 | |||
| 4924 | Ga0501247_036380 | |||
| 4925 | Ga0501248_061256 | |||
| 4926 | Ga0501249_096994 | |||
| 4927 | Ga0501249_174100 | |||
| 4928 | Ga0501253_125808 | |||
| 4929 | Ga0501256_048461 | |||
| 4930 | Ga0501259_136001 | |||
| 4931 | Ga0501225_0046156 | |||
| 4932 | Ga0501234_055758 | |||
| 4933 | Ga0501245_132744 | |||
| 4934 | Ga0501079_0001320 | |||
| 4935 | Ga0501079_0055787 | |||
| 4936 | Ga0501079_0148052 | |||
| 4937 | Ga0501079_0269800 | |||
| 4938 | Ga0501079_0843882 | |||
| 4939 | Ga0501079_1279896 | |||
| 4940 | Ga0501080_0001598 | |||
| 4941 | Ga0501080_0156057 | |||
| 4942 | Ga0501080_0484605 | |||
| 4943 | Ga0501081_0002590 | |||
| 4944 | Ga0501081_0017136 | |||
| 4945 | Ga0501081_0033945 | |||
| 4946 | Ga0501081_0130592 | |||
| 4947 | Ga0501081_0515372 | |||
| 4948 | Ga0501081_1120041 | |||
| 4949 | Ga0501081_1405057 | |||
| 4950 | Ga0501083_0006060 | |||
| 4951 | Ga0501268_006552 | |||
| 4952 | Ga0501271_028894 | |||
| 4953 | Ga0501271_066076 | |||
| 4954 | Ga0501273_015205 | |||
| 4955 | Ga0501279_015216 | |||
| 4956 | Ga0501283_057921 | |||
| 4957 | Ga0501283_084731 | |||
| 4958 | Ga0501035_0006651 | |||
| 4959 | Ga0501035_0661742 | |||
| 4960 | Ga0501035_1277481 | |||
| 4961 | Ga0501044_0023195 | |||
| 4962 | Ga0501044_0956189 | |||
| 4963 | Ga0501045_0000838 | |||
| 4964 | Ga0501045_0010775 | |||
| 4965 | Ga0501045_0057390 | |||
| 4966 | Ga0501045_0089985 | |||
| 4967 | Ga0501045_0454641 | |||
| 4968 | nmdc:mga03683_9150_c1 | |||
| 4969 | nmdc:mga03n38_427625_c1 | |||
| 4970 | nmdc:mga00v17_162147_c1 | |||
| 4971 | nmdc:mga00v17_16776_c1 | |||
| 4972 | nmdc:mga00v17_19858_c1 | |||
| 4973 | nmdc:mga00v17_266992_c1 | |||
| 4974 | nmdc:mga0yw44_422286_c1 | |||
| 4975 | nmdc:mga0k408_163490_c1 | |||
| 4976 | nmdc:mga0k408_319758_c1 | |||
| 4977 | nmdc:mga0k408_3476_c1 | |||
| 4978 | nmdc:mga0k408_4351_c1 | |||
| 4979 | nmdc:mga06z11_33122_c1 | |||
| 4980 | nmdc:mga06z11_416539_c1 | |||
| 4981 | nmdc:mga06z11_469824_c1 | |||
| 4982 | nmdc:mga06z11_486849_c1 | |||
| 4983 | nmdc:mga04h51_15198_c1 | |||
| 4984 | nmdc:mga04h51_23724_c1 | |||
| 4985 | nmdc:mga07m45_10008_c1 | |||
| 4986 | nmdc:mga07m45_456377_c1 | |||
| 4987 | nmdc:mga05p37_138725_c1 | |||
| 4988 | nmdc:mga05p37_1423837_c1 | |||
| 4989 | nmdc:mga05p37_1570052_c1 | |||
| 4990 | nmdc:mga05p37_1585653_c1 | |||
| 4991 | nmdc:mga05p37_1586392_c1 | |||
| 4992 | nmdc:mga05p37_19535_c1 | |||
| 4993 | nmdc:mga05p37_200946_c1 | |||
| 4994 | nmdc:mga05p37_204194_c1 | |||
| 4995 | nmdc:mga05p37_208332_c1 | |||
| 4996 | nmdc:mga05p37_2097507_c1 | |||
| 4997 | nmdc:mga05p37_2242885_c1 | |||
| 4998 | nmdc:mga05p37_2269157_c1 | |||
| 4999 | nmdc:mga05p37_257923_c1 | |||
| 5000 | nmdc:mga05p37_312284_c1 | |||
| 5001 | nmdc:mga05p37_324316_c1 | |||
| 5002 | nmdc:mga05p37_348950_c1 | |||
| 5003 | nmdc:mga05p37_398084_c1 | |||
| 5004 | nmdc:mga05p37_417181_c1 | |||
| 5005 | nmdc:mga05p37_4344_c1 | |||
| 5006 | nmdc:mga05p37_52776_c1 | |||
| 5007 | nmdc:mga05p37_650323_c1 | |||
| 5008 | nmdc:mga05p37_66851_c1 | |||
| 5009 | nmdc:mga05p37_77505_c1 | |||
| 5010 | nmdc:mga05p37_78145_c1 | |||
| 5011 | nmdc:mga05p37_8727_c1 | |||
| 5012 | nmdc:mga05p37_9255_c1 | |||
| 5013 | nmdc:mga05p37_973053_c1 | |||
| 5014 | nmdc:mga09592_1148594_c1 | |||
| 5015 | nmdc:mga09592_1195442_c1 | |||
| 5016 | nmdc:mga09592_123163_c1 | |||
| 5017 | nmdc:mga09592_1334367_c1 | |||
| 5018 | nmdc:mga09592_14861_c1 | |||
| 5019 | nmdc:mga09592_1705_c1 | |||
| 5020 | nmdc:mga09592_366636_c1 | |||
| 5021 | nmdc:mga09592_37667_c1 | |||
| 5022 | nmdc:mga09592_446367_c1 | |||
| 5023 | nmdc:mga09592_456736_c1 | |||
| 5024 | nmdc:mga09592_4599_c1 | |||
| 5025 | nmdc:mga09592_48621_c1 | |||
| 5026 | nmdc:mga09592_5442_c1 | |||
| 5027 | nmdc:mga09592_610037_c1 | |||
| 5028 | nmdc:mga09592_772917_c1 | |||
| 5029 | nmdc:mga09592_822086_c1 | |||
| 5030 | nmdc:mga09592_90639_c1 | |||
| 5031 | nmdc:mga0qj67_110252_c1 | |||
| 5032 | nmdc:mga0qj67_110759_c1 | |||
| 5033 | nmdc:mga0qj67_14964_c1 | |||
| 5034 | nmdc:mga0qj67_15370_c1 | |||
| 5035 | nmdc:mga0qj67_1707_c1 | |||
| 5036 | nmdc:mga0qj67_192504_c1 | |||
| 5037 | nmdc:mga0qj67_206936_c1 | |||
| 5038 | nmdc:mga0qj67_215063_c1 | |||
| 5039 | nmdc:mga0qj67_254175_c1 | |||
| 5040 | nmdc:mga0qj67_47063_c1 | |||
| 5041 | nmdc:mga0qj67_901546_c1 | |||
| 5042 | nmdc:mga06r32_1294905_c1 | |||
| 5043 | nmdc:mga06r32_145316_c1 | |||
| 5044 | nmdc:mga06r32_300681_c1 | |||
| 5045 | nmdc:mga06r32_3088_c1 | |||
| 5046 | nmdc:mga06r32_326778_c1 | |||
| 5047 | nmdc:mga06r32_376982_c1 | |||
| 5048 | nmdc:mga06r32_465149_c1 | |||
| 5049 | nmdc:mga06r32_67915_c1 | |||
| 5050 | nmdc:mga06r32_7112_c1 | |||
| 5051 | nmdc:mga06r32_8866_c1 | |||
| 5052 | nmdc:mga06r32_962622_c1 | |||
| 5053 | nmdc:mga08y16_1003061_c1 | |||
| 5054 | nmdc:mga08y16_109_c1 | |||
| 5055 | nmdc:mga08y16_1187473_c1 | |||
| 5056 | nmdc:mga08y16_130580_c1 | |||
| 5057 | nmdc:mga08y16_142950_c1 | |||
| 5058 | nmdc:mga08y16_143_c2 | |||
| 5059 | nmdc:mga08y16_15585_c1 | |||
| 5060 | nmdc:mga08y16_155_c1 | |||
| 5061 | nmdc:mga08y16_1975190_c1 | |||
| 5062 | nmdc:mga08y16_2023008_c1 | |||
| 5063 | nmdc:mga08y16_2034_c1 | |||
| 5064 | nmdc:mga08y16_2151888_c1 | |||
| 5065 | nmdc:mga08y16_224915_c1 | |||
| 5066 | nmdc:mga08y16_31145_c1 | |||
| 5067 | nmdc:mga08y16_4050_c1 | |||
| 5068 | nmdc:mga08y16_418880_c1 | |||
| 5069 | nmdc:mga08y16_433296_c1 | |||
| 5070 | nmdc:mga08y16_44610_c1 | |||
| 5071 | nmdc:mga08y16_479407_c1 | |||
| 5072 | nmdc:mga08y16_480609_c1 | |||
| 5073 | nmdc:mga08y16_597730_c1 | |||
| 5074 | nmdc:mga08y16_729099_c1 | |||
| 5075 | nmdc:mga08y16_740118_c1 | |||
| 5076 | nmdc:mga08y16_855459_c1 | |||
| 5077 | nmdc:mga08y16_87907_c1 | |||
| 5078 | nmdc:mga08y16_8_c1 | |||
| 5079 | nmdc:mga08y16_920_c1 | |||
| 5080 | nmdc:mga08y16_92356_c1 | |||
| 5081 | nmdc:mga0n895_101876_c1 | |||
| 5082 | nmdc:mga0n895_1036_c1 | |||
| 5083 | nmdc:mga0n895_109795_c1 | |||
| 5084 | nmdc:mga0n895_1271911_c1 | |||
| 5085 | nmdc:mga0n895_1377323_c1 | |||
| 5086 | nmdc:mga0n895_148694_c1 | |||
| 5087 | nmdc:mga0n895_15184_c1 | |||
| 5088 | nmdc:mga0n895_1737421_c1 | |||
| 5089 | nmdc:mga0n895_1738539_c1 | |||
| 5090 | nmdc:mga0n895_187108_c1 | |||
| 5091 | nmdc:mga0n895_1898733_c1 | |||
| 5092 | nmdc:mga0n895_26397_c1 | |||
| 5093 | nmdc:mga0n895_3447_c1 | |||
| 5094 | nmdc:mga0n895_426783_c1 | |||
| 5095 | nmdc:mga0n895_58600_c1 | |||
| 5096 | nmdc:mga0n895_66607_c1 | |||
| 5097 | nmdc:mga0n895_686489_c1 | |||
| 5098 | nmdc:mga0n895_735164_c1 | |||
| 5099 | nmdc:mga0n895_8433_c1 | |||
| 5100 | nmdc:mga0n895_889507_c1 | |||
| 5101 | nmdc:mga0rr50_1137_c2 | |||
| 5102 | nmdc:mga0rr50_161849_c1 | |||
| 5103 | nmdc:mga0rr50_223652_c1 | |||
| 5104 | nmdc:mga0rr50_23467_c1 | |||
| 5105 | nmdc:mga0rr50_26163_c1 | |||
| 5106 | nmdc:mga0rr50_44277_c1 | |||
| 5107 | nmdc:mga0rr50_457787_c1 | |||
| 5108 | nmdc:mga0rr50_6472_c1 | |||
| 5109 | nmdc:mga0rr50_72784_c1 | |||
| 5110 | nmdc:mga08x19_1108514_c1 | |||
| 5111 | nmdc:mga08x19_221628_c1 | |||
| 5112 | nmdc:mga08x19_29827_c1 | |||
| 5113 | nmdc:mga08x19_525248_c1 | |||
| 5114 | nmdc:mga08x19_64303_c1 | |||
| 5115 | nmdc:mga0a205_119797_c1 | |||
| 5116 | nmdc:mga0a205_123144_c1 | |||
| 5117 | nmdc:mga0a205_128247_c1 | |||
| 5118 | nmdc:mga0a205_1288_c1 | |||
| 5119 | nmdc:mga0a205_1383640_c1 | |||
| 5120 | nmdc:mga0a205_2131_c1 | |||
| 5121 | nmdc:mga0a205_23887_c1 | |||
| 5122 | nmdc:mga0a205_25144_c1 | |||
| 5123 | nmdc:mga0a205_255663_c1 | |||
| 5124 | nmdc:mga0a205_330526_c1 | |||
| 5125 | nmdc:mga0a205_34802_c1 | |||
| 5126 | nmdc:mga0a205_463659_c1 | |||
| 5127 | nmdc:mga0a205_495418_c1 | |||
| 5128 | nmdc:mga0a205_55369_c1 | |||
| 5129 | nmdc:mga0a205_617923_c1 | |||
| 5130 | nmdc:mga0a205_658392_c1 | |||
| 5131 | nmdc:mga0a205_849795_c1 | |||
| 5132 | Ga0495601_0006402 | |||
| 5133 | Ga0495601_0024751 | |||
| 5134 | Ga0495601_0148695 | |||
| 5135 | Ga0495601_0345043 | |||
| 5136 | Ga0495595_0233959 | |||
| 5137 | Ga0495619_0009733 | |||
| 5138 | Ga0495619_0113384 | |||
| 5139 | Ga0495619_0226349 | |||
| 5140 | Ga0495619_0493149 | |||
| 5141 | Ga0495619_0585239 | |||
| 5142 | Ga0495619_0635129 | |||
| 5143 | Ga0495619_0805831 | |||
| 5144 | Ga0500628_120392 | |||
| 5145 | Ga0501084_0023198 | |||
| 5146 | Ga0501084_0365658 | |||
| 5147 | Ga0501084_0459203 | |||
| 5148 | Ga0501084_0480139 | |||
| 5149 | Ga0501084_0762796 | |||
| 5150 | Ga0590071_027534 | |||
| 5151 | Ga0501082_0006809 | |||
| 5152 | Ga0501082_0043983 | |||
| 5153 | Ga0501082_0205551 | |||
| 5154 | Ga0501082_0644256 | |||
| 5155 | Ga0530510_0001782 | |||
| 5156 | Ga0530510_0006476 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4co4-assembly1.cif.gz_A | structure of pii signaling protein glnz from azospirillum brasilense in complex with adenosine triphosphate | 0.9527 | 1 | 108 |
| 4c3m-assembly1.cif.gz_B | structure of wildtype pii from s. elongatus at medium resolution | 0.9429 | 1 | 106 |
| 4co4-assembly1.cif.gz_A | structure of pii signaling protein glnz from azospirillum brasilense in complex with adenosine triphosphate | 0.9426 | 1 | 108 |
| 3t9z-assembly1.cif.gz_A | a. fulgidus glnk3, ligand-free | 0.9406 | 1 | 108 |
| 1v9o-assembly1.cif.gz_C | crystal structure of tt1020 from thermus thermophilus hb8 | 0.9405 | 1 | 108 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4c3kE00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9098 | 1 | 109 | 3.30.70.120 |
| 4oznB00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9067 | 2 | 107 | 3.30.70.120 |
| 2o66C00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.8985 | 2 | 108 | 3.30.70.120 |
| 4c3kE00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.8832 | 1 | 109 | 3.30.70.120 |
| 4usiC00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.8771 | 2 | 109 | 3.30.70.120 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-F8XWX0-F1-model_v4 | deleted | 0.909 | 1 | 102 |
|
| AF-A0A0S6WXS2-F1-model_v4 | Nitrogen regulatory protein P-II | 0.9085 | 5 | 102 |
GO:0005524
GO:0005829 GO:0006808 GO:0030234 |
| AF-A0A2V7CKF6-F1-model_v4 | P-II family nitrogen regulator | 0.9073 | 1 | 108 |
GO:0005524
GO:0005829 GO:0006808 GO:0030234 |
| AF-A0A7C3Q2H0-F1-model_v4 | P-II family nitrogen regulator | 0.907 | 1 | 108 |
GO:0005524
GO:0005829 GO:0006808 GO:0030234 |
| AF-A0A3D3KPN2-F1-model_v4 | P-II family nitrogen regulator | 0.9042 | 1 | 97 |
GO:0005524
GO:0005829 GO:0006808 GO:0030234 |