F496940

General Info

Members Datasets Scaffolds Average Seq Length
2595 1462 5190 383

Family's Representative Sequence

Representative Sequence 3300049582|Ga0501048_0086242|Ga0501048_0086242_205_1404
Length 399
Sequence LIFAIRIKDMTAPTANWSYPTAIRFGPGRVKELAEACKSAGINRPLLVTDAGLAKLPITQMALDLIKQAGMKAAMFADVQPNPVDANVDAGVAVFRDGKHDGVIAFGGGSGLDTGKVIAFMAGQTRPLWDFEDIGDWWTRADPDKIAPVVAVPTTAGTGSEVGRAGVITQESTHTKKVIFHPKMMPKVVICDPELTVGMPPAITAGTGMDALAHCLEAYCAPSYHPIAEGIAVEGMRLVFANLPKAVANGKDLEARAHMMSAAAMGAAAFQKGLGAIHALSHPVGALYHTHHGMTNGVFMPYVLVFNRAAIEPKIERLAGFLQIDGGFDGFLKAVLDLRKQVGVPHDLAGLKVDGGKAELISEMAVVDPTAGGNPIPVTKEGARKLFDAALKGDVAAAA

Samples

Sample ID Description Type Environment
1 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
7 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
8 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
9 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
10 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
11 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
12 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
13 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
14 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
15 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
16 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
17 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
18 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
19 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
20 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
21 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
22 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
23 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
24 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
25 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
26 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
27 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
28 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
29 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
30 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
31 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
32 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
33 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
34 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
35 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
36 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
37 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
38 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
39 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
40 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
41 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
42 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
43 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
44 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
45 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
46 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
47 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
48 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
49 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
50 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
51 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
52 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
53 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
54 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
55 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
56 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
57 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
58 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
59 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
60 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
61 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
62 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
63 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
64 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
65 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
66 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
67 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
68 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
69 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
70 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
71 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
72 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
73 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
74 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
75 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
76 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
77 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
78 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
79 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
80 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
81 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
82 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
83 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
84 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
85 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
86 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
87 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
88 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
89 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
90 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
91 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
92 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
93 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
94 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
95 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
96 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
97 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
98 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
99 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
100 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
101 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
102 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
103 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
104 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
105 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
106 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
107 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
108 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
109 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
110 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
111 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
112 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
113 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
114 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
115 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
116 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
117 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
118 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
119 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
120 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
121 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
122 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
123 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
124 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
125 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
126 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
127 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
128 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
129 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
130 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
131 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
132 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
133 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
134 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
135 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
136 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
137 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
138 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
139 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
140 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
141 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
142 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
143 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
144 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
145 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
146 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
147 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
148 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
149 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
150 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
151 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
152 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
153 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
154 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
155 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
156 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
157 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
158 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
159 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
160 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
161 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
162 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
163 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
164 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
165 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
166 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
167 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
168 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
169 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
170 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
171 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
172 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
173 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
174 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
175 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
176 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
177 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
178 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
179 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
180 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
181 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
182 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
183 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
184 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
185 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
186 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
187 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
188 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
189 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
190 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
191 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
192 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
193 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
194 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
195 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
196 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
197 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
198 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
199 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
200 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
201 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
202 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
203 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
264 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
265 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
267 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
268 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
269 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
270 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
273 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
274 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
275 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
276 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
277 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
278 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
279 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
280 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
281 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
282 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
283 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
284 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
285 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
286 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
287 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
288 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
289 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
290 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
291 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
292 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
293 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
294 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
295 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
296 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
297 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
298 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
299 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
300 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
301 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
302 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
303 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
304 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
305 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
306 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
307 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
308 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
309 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
310 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
311 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
312 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
313 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
314 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
315 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
316 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
317 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
318 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
319 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
320 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
321 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
322 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
323 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
324 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
325 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
326 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
327 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
328 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
329 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
330 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
331 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
332 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
333 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
334 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
335 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
336 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
337 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
338 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
339 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
340 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
341 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
342 3300041506 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT Metatranscriptome Unclassified
343 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
344 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
345 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
346 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
347 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
348 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
349 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
350 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
351 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
352 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
353 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
354 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
355 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
356 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
357 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
358 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
359 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
360 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
361 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
362 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
363 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
364 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
365 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
366 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
367 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
368 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
369 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
370 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
371 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
372 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
373 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
374 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
375 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
376 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
377 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
378 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
379 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
380 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
381 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
382 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
383 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
384 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
385 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
386 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
387 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
388 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
389 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
390 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
391 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
392 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
393 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
394 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
395 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
396 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
397 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
398 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
399 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
400 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
401 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
402 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
403 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
404 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
405 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
406 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
407 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
408 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
409 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
410 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
411 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
412 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
413 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
414 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
415 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
416 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
417 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
418 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
419 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
420 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
421 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
422 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
423 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
424 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
425 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
426 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
427 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
428 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
429 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
430 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
431 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
432 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
433 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
434 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
435 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
436 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
437 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
438 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
439 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
440 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
441 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
442 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
443 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
444 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
445 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
446 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
447 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
448 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
449 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
450 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
451 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
452 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
453 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
454 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
455 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
456 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
457 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
458 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
459 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
460 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
461 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
462 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
463 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
464 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
465 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
466 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
467 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
468 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
469 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
470 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
471 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
472 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
473 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
474 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
475 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
476 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
477 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
478 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
479 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
480 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
481 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
482 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
483 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
484 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
485 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
486 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
487 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
488 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
489 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
490 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
491 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
492 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
493 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
494 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
495 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
496 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
497 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
498 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
499 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
500 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
501 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
502 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
503 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
504 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
505 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
506 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
507 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
508 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
509 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
510 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
511 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
512 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
513 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
514 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
515 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
516 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
517 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
518 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
519 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
520 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
521 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
522 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
523 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
524 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
525 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
526 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
527 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
528 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
529 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
530 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
531 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
532 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
533 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
534 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
535 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
536 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
537 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
538 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
539 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
540 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
541 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
542 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
543 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
544 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
545 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
546 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
547 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
548 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
549 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
550 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
551 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
552 2508501050 Microvirga lupini Lut6 Isolate Nodule
553 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
554 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
555 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
556 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
557 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
558 2509276019 Ensifer aridi TW10 Isolate Nodule
559 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
560 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
561 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
562 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
563 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
564 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
565 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
566 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
567 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
568 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
569 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
570 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
571 2511231004 Pseudomonas sp. GM102 Isolate Nodule
572 2511231007 Pseudomonas sp. GM18 Isolate Nodule
573 2511231008 Pseudomonas sp. GM21 Isolate Nodule
574 2511231012 Pseudomonas sp. GM33 Isolate Nodule
575 2511231014 Pseudomonas sp. GM48 Isolate Nodule
576 2511231015 Pseudomonas sp. GM49 Isolate Nodule
577 2511231016 Pseudomonas sp. GM50 Isolate Nodule
578 2511231017 Pseudomonas sp. GM55 Isolate Nodule
579 2511231018 Pseudomonas sp. GM60 Isolate Nodule
580 2511231019 Pseudomonas sp. GM67 Isolate Nodule
581 2511231020 Pseudomonas sp. GM74 Isolate Nodule
582 2511231021 Pseudomonas sp. GM78 Isolate Nodule
583 2511231022 Pseudomonas sp. GM79 Isolate Nodule
584 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
585 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
586 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
587 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
588 2512875024
589 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
590 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
591 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
592 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
593 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
594 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
595 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
596 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
597 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
598 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
599 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
600 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
601 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
602 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
603 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
604 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
605 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
606 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
607 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
608 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
609 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
610 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
611 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
612 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
613 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
614 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
615 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
616 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
617 2516143018 Ensifer sp. BR816 Isolate Nodule
618 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
619 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
620 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
621 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
622 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
623 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
624 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
625 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
626 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
627 2534681786 Brucella suis 92/29 Isolate Unclassified
628 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
629 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
630 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
631 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
632 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
633 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
634 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
635 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
636 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
637 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
638 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
639 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
640 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
641 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
642 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
643 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
644 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
645 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
646 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
647 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
648 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
649 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
650 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
651 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
652 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
653 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
654 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
655 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
656 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
657 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
658 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
659 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
660 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
661 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
662 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
663 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
664 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
665 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
666 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
667 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
668 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
669 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
670 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
671 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
672 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
673 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
674 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
675 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
676 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
677 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
678 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
679 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
680 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
681 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
682 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
683 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
684 2643221557 Ensifer sp. Root558 Isolate Unclassified
685 2643221558 Rhizobium sp. Root149 Isolate Unclassified
686 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
687 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
688 2643221568 Rhizobium sp. Root564 Isolate Unclassified
689 2643221580 Devosia sp. Root635 Isolate Unclassified
690 2643221582 Rhizobium sp. Root651 Isolate Unclassified
691 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
692 2643221591 Devosia sp. Root685 Isolate Unclassified
693 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
694 2643221599 Rhizobium sp. Root708 Isolate Unclassified
695 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
696 2643221607 Rhizobium sp. Root73 Isolate Unclassified
697 2643221610 Ensifer sp. Root74 Isolate Unclassified
698 2643221618 Ensifer sp. Root231 Isolate Unclassified
699 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
700 2643221626 Ensifer sp. Root31 Isolate Unclassified
701 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
702 2643221629 Devosia sp. Root105 Isolate Unclassified
703 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
704 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
705 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
706 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
707 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
708 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
709 2643221655 Ensifer sp. Root1252 Isolate Unclassified
710 2643221659 Ensifer sp. Root127 Isolate Unclassified
711 2643221662 Devosia sp. Root413D1 Isolate Unclassified
712 2643221668 Ensifer sp. Root423 Isolate Unclassified
713 2643221674 Devosia sp. Root436 Isolate Unclassified
714 2643221675 Ensifer sp. Root1298 Isolate Unclassified
715 2643221680 Ensifer sp. Root1312 Isolate Unclassified
716 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
717 2643221688 Rhizobium sp. Root482 Isolate Unclassified
718 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
719 2643221693 Rhizobium sp. Root491 Isolate Unclassified
720 2643221698 Ensifer sp. Root142 Isolate Unclassified
721 2643221712 Ensifer sp. Root258 Isolate Unclassified
722 2643221718 Rhizobium sp. Root268 Isolate Unclassified
723 2643221719 Rhizobium sp. Root274 Isolate Unclassified
724 2643221723 Ensifer sp. Root278 Isolate Unclassified
725 2643221726 Ensifer sp. Root954 Isolate Unclassified
726 2643221733 Bosea sp. Root381 Isolate Unclassified
727 2643221734 Bosea sp. Root670 Isolate Unclassified
728 2643221736 Bosea sp. Root483D1 Isolate Unclassified
729 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
730 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
731 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
732 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
733 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
734 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
735 2718217882 Rhizobium sp. N741 Isolate Nodule
736 2718217927 Rhizobium sp. N324 Isolate Nodule
737 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
738 2718218009 Rhizobium sp. N561 Isolate Nodule
739 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
740 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
741 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
742 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
743 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
744 2718218363 Rhizobium sp. N113 Isolate Nodule
745 2718218365 Rhizobium sp. N731 Isolate Nodule
746 2718218366 Rhizobium sp. N621 Isolate Nodule
747 2718218423 Rhizobium sp. N941 Isolate Nodule
748 2721755514 Rhizobium sp. N6212 Isolate Nodule
749 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
750 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
751 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
752 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
753 2721755809 Rhizobium sp. N541 Isolate Nodule
754 2721755810 Rhizobium sp. N871 Isolate Nodule
755 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
756 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
757 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
758 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
759 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
760 2728369365 Rhizobium sp. N1341 Isolate Nodule
761 2728369397 Rhizobium sp. N1314 Isolate Nodule
762 2738541293 Rhizobium sp. GV031 Isolate Unclassified
763 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
764 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
765 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
766 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
767 2738543024 Aminobacter sp. AP02 Isolate Unclassified
768 2751185800 Brucella pituitosa AA2 Isolate Unclassified
769 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
770 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
771 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
772 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
773 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
774 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
775 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
776 2773857670 Pseudomonas sp. 478 Isolate Unclassified
777 2773857925 Microvirga vignae BR3299 Isolate Unclassified
778 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
779 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
780 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
781 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
782 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
783 2784132072 Pseudomonas sp. 460 Isolate Unclassified
784 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
785 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
786 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
787 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
788 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
789 2791355256 Rhizobium sp. M10 Isolate Nodule
790 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
791 2791355260 Rhizobium sp. L9 Isolate Nodule
792 2791355261 Rhizobium sp. J15 Isolate Nodule
793 2791355262 Rhizobium sp. M1 Isolate Nodule
794 2791355263 Rhizobium chutanense C5 Isolate Nodule
795 2791355264 Rhizobium sp. S9 Isolate Nodule
796 2791355265 Rhizobium sp. H4 Isolate Nodule
797 2791355266 Rhizobium sp. L43 Isolate Nodule
798 2791355267 Rhizobium sp. L18 Isolate Nodule
799 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
800 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
801 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
802 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
803 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
804 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
805 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
806 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
807 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
808 2802429633 Rhizobium anhuiense J3 Isolate Nodule
809 2802429634 Rhizobium anhuiense S10 Isolate Nodule
810 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
811 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
812 2802429637 Rhizobium anhuiense C15 Isolate Nodule
813 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
814 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
815 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
816 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
817 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
818 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
819 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
820 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
821 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
822 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
823 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
824 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
825 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
826 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
827 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
828 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
829 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
830 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
831 2838048938 Rhizobium pisi 27/80 Isolate Nodule
832 2838061910 Rhizobium phaseoli L15 Isolate Nodule
833 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
834 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
835 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
836 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
837 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
838 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
839 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
840 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
841 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
842 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
843 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
844 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
845 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
846 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
847 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
848 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
849 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
850 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
851 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
852 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
853 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
854 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
855 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
856 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
857 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
858 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
859 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
860 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
861 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
862 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
863 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
864 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
865 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
866 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
867 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
868 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
869 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
870 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
871 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
872 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
873 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
874 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
875 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
876 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
877 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
878 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
879 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
880 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
881 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
882 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
883 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
884 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
885 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
886 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
887 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
888 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
889 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
890 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
891 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
892 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
893 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
894 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
895 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
896 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
897 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
898 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
899 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
900 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
901 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
902 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
903 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
904 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
905 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
906 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
907 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
908 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
909 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
910 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
911 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
912 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
913 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
914 2842694124 Methylopila sp. R-72369 Isolate Unclassified
915 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
916 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
917 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
918 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
919 2844163670 Ensifer sp. 1H6 Isolate Unclassified
920 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
921 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
922 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
923 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
924 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
925 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
926 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
927 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
928 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
929 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
930 2854911287 Brucella lupini LUP21 Isolate Unclassified
931 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
932 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
933 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
934 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
935 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
936 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
937 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
938 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
939 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
940 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
941 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
942 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
943 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
944 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
945 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
946 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
947 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
948 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
949 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
950 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
951 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
952 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
953 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
954 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
955 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
956 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
957 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
958 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
959 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
960 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
961 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
962 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
963 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
964 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
965 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
966 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
967 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
968 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
969 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
970 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
971 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
972 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
973 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
974 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
975 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
976 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
977 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
978 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
979 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
980 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
981 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
982 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
983 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
984 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
985 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
986 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
987 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
988 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
989 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
990 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
991 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
992 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
993 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
994 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
995 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
996 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
997 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
998 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
999 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
1000 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
1001 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
1002 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
1003 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
1004 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
1005 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
1006 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
1007 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
1008 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
1009 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
1010 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
1011 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
1012 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
1013 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
1014 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
1015 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
1016 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
1017 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
1018 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
1019 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
1020 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
1021 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
1022 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
1023 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
1024 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
1025 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
1026 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
1027 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
1028 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
1029 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
1030 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
1031 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
1032 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
1033 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
1034 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
1035 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
1036 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
1037 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
1038 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
1039 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
1040 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
1041 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
1042 2909042592 Labrys sp. LIt4 Isolate Nodule
1043 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
1044 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
1045 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
1046 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
1047 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
1048 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
1049 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
1050 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
1051 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
1052 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
1053 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
1054 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
1055 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
1056 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
1057 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
1058 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
1059 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
1060 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
1061 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
1062 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
1063 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
1064 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
1065 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
1066 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
1067 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
1068 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
1069 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
1070 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
1071 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
1072 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
1073 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
1074 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
1075 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
1076 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
1077 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
1078 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
1079 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
1080 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
1081 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
1082 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
1083 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
1084 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
1085 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
1086 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
1087 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
1088 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
1089 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
1090 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
1091 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
1092 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
1093 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
1094 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
1095 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
1096 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
1097 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
1098 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
1099 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
1100 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
1101 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
1102 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
1103 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
1104 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
1105 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
1106 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
1107 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
1108 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
1109 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
1110 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
1111 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
1112 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
1113 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
1114 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
1115 2932401849 Devosia sp. 2618 Isolate Rhizosphere
1116 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
1117 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
1118 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
1119 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
1120 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
1121 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
1122 2933599457 Rhizobium phaseoli M3 Isolate Nodule
1123 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
1124 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
1125 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
1126 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
1127 2936381700 Rhizobium chutanense C16 Isolate Unclassified
1128 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
1129 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
1130 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
1131 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
1132 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
1133 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
1134 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
1135 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
1136 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
1137 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
1138 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
1139 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
1140 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
1141 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
1142 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
1143 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
1144 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
1145 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
1146 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
1147 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
1148 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
1149 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
1150 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
1151 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
1152 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
1153 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
1154 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
1155 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
1156 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
1157 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
1158 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
1159 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
1160 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
1161 2952252522 Salinicola sp. DM10 Isolate Unclassified
1162 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
1163 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
1164 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
1165 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
1166 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
1167 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
1168 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
1169 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
1170 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
1171 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
1172 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
1173 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
1174 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
1175 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
1176 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
1177 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
1178 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
1179 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
1180 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
1181 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
1182 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
1183 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
1184 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
1185 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
1186 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
1187 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
1188 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
1189 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
1190 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
1191 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
1192 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
1193 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
1194 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
1195 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
1196 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
1197 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
1198 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
1199 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
1200 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
1201 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
1202 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
1203 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
1204 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
1205 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
1206 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
1207 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
1208 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
1209 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
1210 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
1211 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
1212 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
1213 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
1214 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
1215 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
1216 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
1217 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
1218 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
1219 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
1220 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
1221 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
1222 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
1223 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
1224 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
1225 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
1226 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
1227 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
1228 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
1229 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
1230 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
1231 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
1232 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
1233 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
1234 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
1235 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
1236 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
1237 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
1238 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
1239 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
1240 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
1241 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
1242 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
1243 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
1244 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
1245 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
1246 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
1247 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
1248 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
1249 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
1250 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
1251 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
1252 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
1253 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
1254 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
1255 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
1256 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
1257 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
1258 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
1259 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
1260 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
1261 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
1262 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
1263 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
1264 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
1265 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
1266 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
1267 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
1268 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
1269 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
1270 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
1271 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
1272 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
1273 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
1274 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
1275 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
1276 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
1277 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
1278 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
1279 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
1280 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
1281 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
1282 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
1283 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
1284 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
1285 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
1286 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
1287 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
1288 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
1289 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
1290 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
1291 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
1292 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
1293 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
1294 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
1295 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
1296 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
1297 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
1298 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
1299 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
1300 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
1301 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
1302 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
1303 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
1304 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
1305 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
1306 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
1307 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
1308 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
1309 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
1310 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
1311 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
1312 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
1313 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
1314 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
1315 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
1316 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
1317 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
1318 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
1319 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
1320 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
1321 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
1322 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
1323 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
1324 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
1325 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
1326 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
1327 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
1328 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
1329 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
1330 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
1331 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
1332 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
1333 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
1334 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
1335 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
1336 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
1337 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
1338 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
1339 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
1340 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
1341 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
1342 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
1343 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
1344 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
1345 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
1346 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
1347 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
1348 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
1349 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
1350 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
1351 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
1352 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
1353 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
1354 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
1355 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
1356 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
1357 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
1358 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
1359 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
1360 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
1361 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
1362 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
1363 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
1364 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
1365 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
1366 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
1367 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
1368 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
1369 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
1370 2996887358 Rhizobium sp. R711 Isolate Nodule
1371 2996893221 Rhizobium sp. R635 Isolate Nodule
1372 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
1373 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
1374 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
1375 3004167301 Mesorhizobium loti 582 Isolate Unclassified
1376 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
1377 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
1378 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
1379 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
1380 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
1381 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
1382 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
1383 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
1384 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
1385 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
1386 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
1387 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
1388 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
1389 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
1390 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
1391 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
1392 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
1393 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
1394 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
1395 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
1396 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
1397 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
1398 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
1399 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
1400 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
1401 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
1402 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
1403 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
1404 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
1405 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
1406 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
1407 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
1408 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
1409 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
1410 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
1411 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
1412 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
1413 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
1414 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
1415 8005258706 Rhizobium sp. R693 Isolate Nodule
1416 8005275841 Rhizobium sp. N4311 Isolate Nodule
1417 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
1418 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
1419 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
1420 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
1421 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
1422 8005321885 Rhizobium sp. R72 Isolate Nodule
1423 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
1424 8005382845 Rhizobium sp. R634 Isolate Nodule
1425 8005395548 Rhizobium sp. R339 Isolate Nodule
1426 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
1427 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
1428 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
1429 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
1430 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
1431 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
1432 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
1433 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
1434 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
1435 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
1436 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
1437 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
1438 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
1439 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
1440 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
1441 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
1442 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
1443 8018176218 Rhizobium sp. N122 Isolate Nodule
1444 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
1445 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
1446 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
1447 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
1448 8024501048 Rhizobium sp. H4 Isolate Nodule
1449 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
1450 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
1451 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
1452 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
1453 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
1454 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
1455 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
1456 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
1457 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
1458 8056382006 Rhizobium croatiense 13T Isolate Nodule
1459 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
1460 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule
1461 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
1462 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 64.51
Metatranscriptomes 0.12
Isolates 35.38

Biome Distribution

Category Percentage (%)
Aerial Root 0.19
Bulb 0
Endosphere 9.06
Nodule 26.24
Rhizoplane 2.89
Rhizosphere 50.75
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501048_0086242 3300049582 Bacteria 2215
2 MRS2a_Contig_8 2124908027 Bacteria 21551
3 JGI24740J21852_10000504 3300001979 Bacteria 16777
4 JGI24739J22299_10009479 3300001989 Bacteria 3629
5 JGI24738J21930_10007464 3300002075 Bacteria 2521
6 JGI25155J39150_1000001 3300002704 Bacteria 354543
7 JGI25156J39149_1000001 3300002705 Bacteria 354557
8 JGI25156J39149_1001987 3300002705 Bacteria 7842
9 JGI25156J39149_1002999 3300002705 Bacteria 5734
10 JGI25162J39368_1000304 3300002737 Bacteria 45066
11 JGI25162J39368_1000820 3300002737 Bacteria 20523
12 JGI25162J39368_1000825 3300002737 Bacteria 20436
13 JGI25154J39366_1000122 3300002738 Bacteria 61892
14 JGI25157J39369_1000044 3300002741 Bacteria 122466
15 JGI25157J39369_1000475 3300002741 Bacteria 25238
16 JGI25157J39369_1000502 3300002741 Bacteria 24104
17 JGI25163J39215_1000074 3300002771 Bacteria 44810
18 JGI25164J39214_1000223 3300002772 Bacteria 45067
19 JGI25152J39213_1002276 3300002773 Bacteria 7405
20 JGI25152J39213_1005176 3300002773 Bacteria 3893
21 JGI25150J39212_1000074 3300002774 Bacteria 60735
22 JGI25150J39212_1005822 3300002774 Bacteria 2597
23 JGI25159J45721_1000014 3300002987 Bacteria 147809
24 JGI25159J45721_1000411 3300002987 Bacteria 19832
25 JGI25159J45721_1004159 3300002987 Bacteria 4896
26 JGI25159J45721_1005892 3300002987 Bacteria 3769
27 JGI25151J46595_10000015 3300003187 Bacteria 250420
28 JGI25151J46595_10000414 3300003187 Bacteria 43361
29 JGI25151J46595_10000486 3300003187 Bacteria 37582
30 JGI25151J46595_10000628 3300003187 Bacteria 30686
31 JGI25151J46595_10001750 3300003187 Bacteria 14073
32 JGI25151J46595_10007168 3300003187 Bacteria 5495
33 JGI25406J46586_10003356 3300003203 Bacteria 7539
34 JGI25165J46597_1000042 3300003214 Bacteria 271606
35 JGI25165J46597_1000410 3300003214 Bacteria 45073
36 JGI25165J46597_1000910 3300003214 Bacteria 20508
37 JGI25165J46597_1000918 3300003214 Bacteria 20436
38 JGI25153J46596_10000267 3300003215 Bacteria 41505
39 JGI25160J50197_1000001 3300003354 Bacteria 782301
40 JGI25160J50197_1000020 3300003354 Bacteria 232739
41 JGI25160J50197_1000695 3300003354 Bacteria 18566
42 JGI25161J50226_1000001 3300003374 Bacteria 655036
43 JGI25161J50226_1001013 3300003374 Bacteria 9799
44 JGI25161J50226_1001697 3300003374 Bacteria 6301
45 Ga0055542_1000488 3300003762 Bacteria 36554
46 Ga0055529_1002050 3300003763 Bacteria 4374
47 Ga0055526_1000375 3300003771 Bacteria 36235
48 Ga0055526_1001939 3300003771 Bacteria 14317
49 Ga0055526_1002938 3300003771 Bacteria 11169
50 Ga0055526_1006372 3300003771 Bacteria 6416
51 Ga0055526_1009545 3300003771 Bacteria 4649
52 Ga0055524_1000064 3300003775 Bacteria 133574
53 Ga0055524_1001090 3300003775 Bacteria 16525
54 Ga0055524_1002653 3300003775 Bacteria 9082
55 Ga0055524_1008708 3300003775 Bacteria 4192
56 Ga0055524_1010743 3300003775 Bacteria 3625
57 Ga0055536_1003980 3300003781 Bacteria 7733
58 Ga0055528_1000234 3300003790 Bacteria 46499
59 Ga0055528_1000512 3300003790 Bacteria 30456
60 Ga0055528_1004264 3300003790 Bacteria 6918
61 Ga0055528_1005478 3300003790 Bacteria 5906
62 Ga0055528_1012612 3300003790 Bacteria 3267
63 Ga0055540_1000350 3300003792 Bacteria 39199
64 Ga0055540_1005671 3300003792 Bacteria 5172
65 Ga0055540_1010745 3300003792 Bacteria 3022
66 Ga0055531_10004086 3300003794 Bacteria 9038
67 Ga0055531_10004879 3300003794 Bacteria 7993
68 Ga0058692_1001739 3300003856 Bacteria 7755
69 Ga0055543_1000003 3300004625 Bacteria 358656
70 Ga0055543_1000047 3300004625 Bacteria 111073
71 Ga0055543_1000355 3300004625 Bacteria 31085
72 Ga0065165_1000013 3300005262 Bacteria 301887
73 Ga0065165_1000026 3300005262 Bacteria 233376
74 Ga0065165_1000068 3300005262 Bacteria 170609
75 Ga0065165_1003530 3300005262 Bacteria 10825
76 Ga0065714_10000178 3300005288 Bacteria 8386
77 Ga0065714_10012843 3300005288 Bacteria 3773
78 Ga0065714_10065762 3300005288 Bacteria 8606
79 Ga0065714_10070084 3300005288 Bacteria 3968
80 Ga0065714_10106726 3300005288 Bacteria 1543
81 Ga0065712_10007353 3300005290 Bacteria 7474
82 Ga0065715_10027883 3300005293 Bacteria 2329
83 Ga0070658_10000115 3300005327 Bacteria 72027
84 Ga0070658_10012728 3300005327 Bacteria 6748
85 Ga0070658_10038151 3300005327 Bacteria 3875
86 Ga0070658_10038361 3300005327 Bacteria 3863
87 Ga0070683_100028048 3300005329 Bacteria 5085
88 Ga0070683_100223864 3300005329 Bacteria 1788
89 Ga0070683_100262281 3300005329 Bacteria 1644
90 Ga0070690_100003585 3300005330 Bacteria 8528
91 Ga0070690_100005518 3300005330 Bacteria 7115
92 Ga0070690_100034720 3300005330 Bacteria 3161
93 Ga0070690_100096304 3300005330 Bacteria 1956
94 Ga0070670_100000515 3300005331 Bacteria 30924
95 Ga0070670_100008496 3300005331 Bacteria 8758
96 Ga0070670_100019091 3300005331 Bacteria 5879
97 Ga0070670_100076542 3300005331 Bacteria 2875
98 Ga0070666_10000544 3300005335 Bacteria 22761
99 Ga0070666_10002592 3300005335 Bacteria 10922
100 Ga0070680_100092799 3300005336 Bacteria 2500
101 Ga0070682_100000925 3300005337 Bacteria 17113
102 Ga0068868_100009860 3300005338 Bacteria 6896
103 Ga0070660_100010552 3300005339 Bacteria 6529
104 Ga0070660_100010563 3300005339 Bacteria 6524
105 Ga0070660_100010989 3300005339 Bacteria 6415
106 Ga0070660_100058511 3300005339 Bacteria 2987
107 Ga0070660_100184257 3300005339 Bacteria 1690
108 Ga0070689_100001087 3300005340 Bacteria 17046
109 Ga0070691_10002849 3300005341 Bacteria 7742
110 Ga0070687_100006424 3300005343 Bacteria 4817
111 Ga0070661_100001127 3300005344 Bacteria 18765
112 Ga0070661_100086529 3300005344 Bacteria 2317
113 Ga0070692_10004469 3300005345 Bacteria 5849
114 Ga0070692_10011484 3300005345 Bacteria 4068
115 Ga0070668_100001269 3300005347 Bacteria 18012
116 Ga0070668_100009332 3300005347 Bacteria 7278
117 Ga0070668_100011919 3300005347 Bacteria 6472
118 Ga0070668_100046733 3300005347 Bacteria 3326
119 Ga0070668_100068691 3300005347 Bacteria 2755
120 Ga0070668_100072494 3300005347 Bacteria 2683
121 Ga0070669_100000012 3300005353 Bacteria 211302
122 Ga0070669_100010577 3300005353 Bacteria 6551
123 Ga0070675_100086044 3300005354 Bacteria 2627
124 Ga0070671_100000006 3300005355 Bacteria 250635
125 Ga0070671_100008175 3300005355 Bacteria 8371
126 Ga0070671_100034405 3300005355 Bacteria 4195
127 Ga0070674_100211489 3300005356 Bacteria 1503
128 Ga0070673_100005483 3300005364 Bacteria 8123
129 Ga0070688_100001689 3300005365 Bacteria 11028
130 Ga0070659_100001552 3300005366 Bacteria 16572
131 Ga0070667_100005567 3300005367 Bacteria 10515
132 Ga0070667_100007827 3300005367 Bacteria 8863
133 Ga0070703_10010999 3300005406 Bacteria 2554
134 Ga0070709_10002492 3300005434 Bacteria 9966
135 Ga0070709_10028933 3300005434 Bacteria 3309
136 Ga0070709_10079269 3300005434 Bacteria 2139
137 Ga0070714_100023734 3300005435 Bacteria 5042
138 Ga0070714_100038414 3300005435 Bacteria 4024
139 Ga0070713_100035660 3300005436 Bacteria 4007
140 Ga0070710_10001696 3300005437 Bacteria 10379
141 Ga0070711_100017961 3300005439 Bacteria 4509
142 Ga0070711_100021276 3300005439 Bacteria 4191
143 Ga0070711_100215964 3300005439 Bacteria 1488
144 Ga0070705_100001003 3300005440 Bacteria 15730
145 Ga0070705_100018853 3300005440 Bacteria 3623
146 Ga0070700_100005734 3300005441 Bacteria 6589
147 Ga0070700_100009949 3300005441 Bacteria 5233
148 Ga0070694_100029953 3300005444 Bacteria 3556
149 Ga0070708_100164311 3300005445 Bacteria 2070
150 Ga0070663_100002743 3300005455 Bacteria 9979
151 Ga0070663_100149367 3300005455 Bacteria 1791
152 Ga0070678_100007142 3300005456 Bacteria 6603
153 Ga0070678_100130462 3300005456 Bacteria 1996
154 Ga0070662_100006832 3300005457 Bacteria 7377
155 Ga0070662_100074667 3300005457 Bacteria 2509
156 Ga0068867_100011024 3300005459 Bacteria 6375
157 Ga0070685_10030634 3300005466 Bacteria 3000
158 Ga0070679_100043670 3300005530 Bacteria 4463
159 Ga0070679_100087105 3300005530 Bacteria 3110
160 Ga0070684_100149525 3300005535 Bacteria 2115
161 Ga0070697_100002319 3300005536 Bacteria 14622
162 Ga0068853_100006365 3300005539 Bacteria 9375
163 Ga0068853_100011416 3300005539 Bacteria 7216
164 Ga0068853_100033238 3300005539 Bacteria 4375
165 Ga0068853_100042340 3300005539 Bacteria 3893
166 Ga0070686_100000175 3300005544 Bacteria 45160
167 Ga0070686_100009379 3300005544 Bacteria 5501
168 Ga0070695_100001902 3300005545 Bacteria 11817
169 Ga0070695_100003227 3300005545 Bacteria 9518
170 Ga0070696_100005973 3300005546 Bacteria 8125
171 Ga0070696_100315359 3300005546 Bacteria 1202
172 Ga0070693_100000527 3300005547 Bacteria 17176
173 Ga0070693_100054562 3300005547 Bacteria 2299
174 Ga0070693_100125349 3300005547 Bacteria 1598
175 Ga0070665_100002086 3300005548 Bacteria 22429
176 Ga0070665_100007051 3300005548 Bacteria 11417
177 Ga0070665_100015259 3300005548 Bacteria 7712
178 Ga0070665_100035091 3300005548 Bacteria 5043
179 Ga0070665_100052825 3300005548 Bacteria 4075
180 Ga0070665_100058389 3300005548 Bacteria 3868
181 Ga0070665_100067282 3300005548 Bacteria 3592
182 Ga0070665_100160239 3300005548 Bacteria 2252
183 Ga0070704_100003817 3300005549 Bacteria 8673
184 Ga0068855_100010084 3300005563 Bacteria 11387
185 Ga0068855_100037000 3300005563 Bacteria 5807
186 Ga0068855_100097741 3300005563 Bacteria 3382
187 Ga0068855_100123235 3300005563 Bacteria 2966
188 Ga0068855_100154117 3300005563 Bacteria 2611
189 Ga0068855_100230726 3300005563 Bacteria 2073
190 Ga0070664_100011523 3300005564 Bacteria 7177
191 Ga0068857_100002111 3300005577 Bacteria 16157
192 Ga0068857_100244163 3300005577 Bacteria 1645
193 Ga0068854_100022865 3300005578 Bacteria 4265
194 Ga0068854_100049011 3300005578 Bacteria 3016
195 Ga0068854_100072675 3300005578 Bacteria 2519
196 Ga0068854_100077792 3300005578 Bacteria 2442
197 Ga0068854_100227419 3300005578 Bacteria 1479
198 Ga0068854_100282419 3300005578 Bacteria 1337
199 Ga0068856_100012739 3300005614 Bacteria 8142
200 Ga0068856_100032737 3300005614 Bacteria 5091
201 Ga0068856_100301729 3300005614 Bacteria 1619
202 Ga0068856_100428139 3300005614 Bacteria 1343
203 Ga0070702_100001296 3300005615 Bacteria 10137
204 Ga0070702_100024869 3300005615 Bacteria 3201
205 Ga0068852_100013171 3300005616 Bacteria 6320
206 Ga0068852_100018126 3300005616 Bacteria 5541
207 Ga0068852_100037637 3300005616 Bacteria 4058
208 Ga0068852_100043421 3300005616 Bacteria 3813
209 Ga0068859_100000303 3300005617 Bacteria 48928
210 Ga0068859_100022477 3300005617 Bacteria 6324
211 Ga0068864_100002024 3300005618 Bacteria 16727
212 Ga0068864_100003487 3300005618 Bacteria 13001
213 Ga0068864_100046732 3300005618 Bacteria 3715
214 Ga0068861_100000068 3300005719 Bacteria 49630
215 Ga0068861_100006058 3300005719 Bacteria 8224
216 Ga0068861_100016621 3300005719 Bacteria 5210
217 Ga0068863_100015068 3300005841 Bacteria 7427
218 Ga0068863_100212413 3300005841 Bacteria 1863
219 Ga0068858_100002445 3300005842 Bacteria 18770
220 Ga0068858_100007331 3300005842 Bacteria 10675
221 Ga0068860_100003525 3300005843 Bacteria 16092
222 Ga0068860_100004219 3300005843 Bacteria 14731
223 Ga0068862_100000222 3300005844 Bacteria 62883
224 Ga0068862_100003748 3300005844 Bacteria 12965
225 Ga0068862_100064655 3300005844 Bacteria 3149
226 Ga0081455_10000085 3300005937 Bacteria 101651
227 Ga0081455_10002838 3300005937 Bacteria 20395
228 Ga0081455_10010430 3300005937 Bacteria 9433
229 Ga0081455_10086461 3300005937 Bacteria 2554
230 Ga0081455_10108216 3300005937 Bacteria 2215
231 Ga0081455_10130514 3300005937 Bacteria 1965
232 Ga0081538_10007329 3300005981 Bacteria 9552
233 Ga0081540_1000566 3300005983 Bacteria 35881
234 Ga0081540_1028435 3300005983 Bacteria 3140
235 Ga0081539_10001521 3300005985 Bacteria 38875
236 Ga0075365_10000068 3300006038 Bacteria 31130
237 Ga0075365_10001419 3300006038 Bacteria 10826
238 Ga0075365_10003339 3300006038 Bacteria 8246
239 Ga0075365_10022375 3300006038 Bacteria 3960
240 Ga0075365_10064544 3300006038 Bacteria 2453
241 Ga0075368_10002310 3300006042 Bacteria 6190
242 Ga0075368_10013155 3300006042 Bacteria 3036
243 Ga0075368_10031988 3300006042 Bacteria 2042
244 Ga0075363_100010518 3300006048 Bacteria 4400
245 Ga0075363_100028520 3300006048 Bacteria 2872
246 Ga0075363_100090054 3300006048 Bacteria 1687
247 Ga0075363_100097361 3300006048 Bacteria 1625
248 Ga0075364_10000023 3300006051 Bacteria 52112
249 Ga0075364_10001246 3300006051 Bacteria 13675
250 Ga0075364_10030904 3300006051 Bacteria 3439
251 Ga0075364_10067536 3300006051 Bacteria 2350
252 Ga0075432_10003110 3300006058 Bacteria 5604
253 Ga0075432_10003786 3300006058 Bacteria 5154
254 Ga0075432_10006500 3300006058 Bacteria 3978
255 Ga0070715_10002097 3300006163 Bacteria 6027
256 Ga0070716_100031664 3300006173 Bacteria 2878
257 Ga0070712_100004491 3300006175 Bacteria 8614
258 Ga0075362_10018143 3300006177 Bacteria 2907
259 Ga0075362_10031839 3300006177 Bacteria 2285
260 Ga0075367_10007206 3300006178 Bacteria 5677
261 Ga0075367_10014330 3300006178 Bacteria 4291
262 Ga0075367_10017282 3300006178 Bacteria 3956
263 Ga0075367_10020097 3300006178 Bacteria 3714
264 Ga0075367_10090870 3300006178 Bacteria 1857
265 Ga0075367_10094307 3300006178 Bacteria 1824
266 Ga0075367_10113637 3300006178 Bacteria 1664
267 Ga0075369_10001599 3300006186 Bacteria 7789
268 Ga0075369_10016859 3300006186 Bacteria 2954
269 Ga0075369_10063135 3300006186 Bacteria 1620
270 Ga0075366_10000495 3300006195 Bacteria 18223
271 Ga0075366_10082884 3300006195 Bacteria 1916
272 Ga0097621_100008926 3300006237 Bacteria 7247
273 Ga0075370_10003151 3300006353 Bacteria 7790
274 Ga0075370_10017904 3300006353 Bacteria 3834
275 Ga0068871_100012799 3300006358 Bacteria 6208
276 Ga0075428_100009932 3300006844 Bacteria 10572
277 Ga0075428_100014282 3300006844 Bacteria 8831
278 Ga0075428_100111329 3300006844 Bacteria 2983
279 Ga0075428_100154978 3300006844 Bacteria 2489
280 Ga0075428_100158062 3300006844 Bacteria 2461
281 Ga0075430_100060765 3300006846 Bacteria 3176
282 Ga0075430_100180111 3300006846 Bacteria 1758
283 Ga0075431_100001296 3300006847 Bacteria 22847
284 Ga0075431_100008939 3300006847 Bacteria 10039
285 Ga0075431_100031890 3300006847 Bacteria 5428
286 Ga0075431_100111026 3300006847 Bacteria 2830
287 Ga0075431_100347781 3300006847 Bacteria 1491
288 Ga0075433_10010455 3300006852 Bacteria 7451
289 Ga0075433_10022732 3300006852 Bacteria 5268
290 Ga0075434_100024485 3300006871 Bacteria 5901
291 Ga0075434_100037816 3300006871 Bacteria 4778
292 Ga0075434_100082433 3300006871 Bacteria 3213
293 Ga0075429_100002571 3300006880 Bacteria 15296
294 Ga0075429_100071754 3300006880 Bacteria 3016
295 Ga0075429_100103025 3300006880 Bacteria 2492
296 Ga0068865_100017949 3300006881 Bacteria 4559
297 Ga0075436_100013064 3300006914 Bacteria 5692
298 Ga0075436_100106952 3300006914 Bacteria 1951
299 Ga0097620_100000303 3300006931 Bacteria 48928
300 Ga0097620_100022477 3300006931 Bacteria 6324
301 Ga0079104_1000242 3300006946 Bacteria 72707
302 Ga0079104_1016712 3300006946 Bacteria 2135
303 Ga0099826_10000841 3300006948 Bacteria 16595
304 Ga0075435_100007536 3300007076 Bacteria 7769
305 Ga0099795_10000032 3300007788 Bacteria 37057
306 Ga0099795_10022242 3300007788 Bacteria 2091
307 Ga0105251_10032150 3300009011 Bacteria 2618
308 Ga0105244_10038974 3300009036 Bacteria 2476
309 Ga0105244_10067730 3300009036 Bacteria 1785
310 Ga0105250_10018806 3300009092 Bacteria 2795
311 Ga0105240_10000028 3300009093 Bacteria 347789
312 Ga0105240_10000076 3300009093 Bacteria 198848
313 Ga0105240_10036562 3300009093 Bacteria 6314
314 Ga0105240_10064551 3300009093 Bacteria 4549
315 Ga0105240_10115849 3300009093 Bacteria 3234
316 Ga0105240_10197548 3300009093 Bacteria 2360
317 Ga0105240_10258727 3300009093 Bacteria 2009
318 Ga0105240_10456874 3300009093 Bacteria 1428
319 Ga0111539_10001004 3300009094 Bacteria 36978
320 Ga0111539_10035026 3300009094 Bacteria 6080
321 Ga0111539_10125173 3300009094 Bacteria 3012
322 Ga0111539_10225320 3300009094 Bacteria 2184
323 Ga0111539_10276310 3300009094 Bacteria 1955
324 Ga0111539_10483727 3300009094 Bacteria 1442
325 Ga0111539_10563679 3300009094 Bacteria 1326
326 Ga0105245_10037358 3300009098 Bacteria 4317
327 Ga0105247_10003685 3300009101 Bacteria 9943
328 Ga0105247_10004179 3300009101 Bacteria 9266
329 Ga0114129_10000717 3300009147 Bacteria 41954
330 Ga0114129_10034862 3300009147 Bacteria 7110
331 Ga0114129_10222103 3300009147 Bacteria 2548
332 Ga0114129_10251576 3300009147 Bacteria 2372
333 Ga0114129_10326787 3300009147 Bacteria 2037
334 Ga0105243_10003392 3300009148 Bacteria 12922
335 Ga0105243_10004327 3300009148 Bacteria 11246
336 Ga0105243_10162824 3300009148 Bacteria 1925
337 Ga0105242_10018125 3300009176 Bacteria 5499
338 Ga0105248_10001946 3300009177 Bacteria 22943
339 Ga0105237_10000226 3300009545 Bacteria 79798
340 Ga0105237_10003921 3300009545 Bacteria 17431
341 Ga0105237_10006872 3300009545 Bacteria 12546
342 Ga0105237_10034855 3300009545 Bacteria 5093
343 Ga0105237_10064529 3300009545 Bacteria 3658
344 Ga0105237_10389291 3300009545 Bacteria 1399
345 Ga0105238_10005446 3300009551 Bacteria 12572
346 Ga0105238_10011069 3300009551 Bacteria 9065
347 Ga0105238_10445648 3300009551 Bacteria 1291
348 Ga0105249_10001500 3300009553 Bacteria 20468
349 Ga0105249_10001582 3300009553 Bacteria 19970
350 Ga0123341_1000007 3300009765 Bacteria 147072
351 Ga0099796_10000020 3300010159 Bacteria 41259
352 Ga0105239_10003384 3300010375 Bacteria 19568
353 Ga0105239_10004650 3300010375 Bacteria 16317
354 Ga0105239_10019613 3300010375 Bacteria 7463
355 Ga0105239_10030720 3300010375 Bacteria 5909
356 Ga0105239_10081150 3300010375 Bacteria 3570
357 Ga0105239_10130574 3300010375 Bacteria 2794
358 Ga0105239_10336056 3300010375 Bacteria 1704
359 Ga0105246_10004363 3300011119 Bacteria 8609
360 Ga0157373_10011394 3300013100 Bacteria 6539
361 Ga0157373_10109444 3300013100 Bacteria 1943
362 Ga0157371_10000017 3300013102 Bacteria 320830
363 Ga0157371_10000739 3300013102 Bacteria 38165
364 Ga0157371_10003248 3300013102 Bacteria 14909
365 Ga0157371_10006289 3300013102 Bacteria 9837
366 Ga0157370_10000494 3300013104 Bacteria 49013
367 Ga0157370_10001902 3300013104 Bacteria 25703
368 Ga0157370_10004750 3300013104 Bacteria 15463
369 Ga0157370_10034314 3300013104 Bacteria 4942
370 Ga0157370_10063008 3300013104 Bacteria 3514
371 Ga0157370_10069140 3300013104 Bacteria 3336
372 Ga0157370_10248826 3300013104 Bacteria 1644
373 Ga0157370_10416910 3300013104 Bacteria 1235
374 Ga0157369_10039677 3300013105 Bacteria 5145
375 Ga0157369_10116856 3300013105 Bacteria 2832
376 Ga0157369_10120642 3300013105 Bacteria 2782
377 Ga0157369_10236145 3300013105 Bacteria 1910
378 Ga0171463_1003 3300013249 Bacteria 695693
379 Ga0157374_10028786 3300013296 Bacteria 5022
380 Ga0157374_10072533 3300013296 Bacteria 3248
381 Ga0157378_10007872 3300013297 Bacteria 9299
382 Ga0157378_10089784 3300013297 Bacteria 2792
383 Ga0163162_10002906 3300013306 Bacteria 16316
384 Ga0163162_10008951 3300013306 Bacteria 9732
385 Ga0163162_10048385 3300013306 Bacteria 4260
386 Ga0157372_10028979 3300013307 Bacteria 6040
387 Ga0157372_10032223 3300013307 Bacteria 5745
388 Ga0157372_10032521 3300013307 Bacteria 5721
389 Ga0157375_10041224 3300013308 Bacteria 4456
390 Ga0157375_10284075 3300013308 Bacteria 1818
391 Ga0157375_10356042 3300013308 Bacteria 1630
392 Ga0163163_10029879 3300014325 Bacteria 5244
393 Ga0163163_10057034 3300014325 Bacteria 3861
394 Ga0163163_10083456 3300014325 Bacteria 3200
395 Ga0163163_10150353 3300014325 Bacteria 2372
396 Ga0163163_10340327 3300014325 Bacteria 1555
397 Ga0157380_10006541 3300014326 Bacteria 8215
398 Ga0157380_10261899 3300014326 Bacteria 1571
399 Ga0182008_10038707 3300014497 Bacteria 2384
400 Ga0157377_10008238 3300014745 Bacteria 5074
401 Ga0157379_10013267 3300014968 Bacteria 7216
402 Ga0157379_10019661 3300014968 Bacteria 5967
403 Ga0157379_10055415 3300014968 Bacteria 3542
404 Ga0157376_10002750 3300014969 Bacteria 12010
405 Ga0157376_10266996 3300014969 Bacteria 1606
406 Ga0182006_1000385 3300015261 Bacteria 36409
407 Ga0182006_1026757 3300015261 Bacteria 2359
408 Ga0182007_10000286 3300015262 Bacteria 33489
409 Ga0182007_10002059 3300015262 Bacteria 10333
410 Ga0182005_1003541 3300015265 Bacteria 5270
411 Ga0182005_1026178 3300015265 Bacteria 1592
412 Ga0183363_1085 3300015690 Bacteria 28396
413 Ga0163161_10002366 3300017792 Bacteria 13514
414 Ga0163161_10015581 3300017792 Bacteria 5301
415 Ga0163161_10034859 3300017792 Bacteria 3600
416 Ga0163161_10079586 3300017792 Bacteria 2410
417 Ga0163161_10091175 3300017792 Bacteria 2255
418 Ga0206356_11203268 3300020070 Bacteria 2314
419 Ga0214544_1003096 3300021320 Bacteria 34775
420 Ga0214542_1000012 3300021321 Bacteria 235800
421 Ga0214542_1013089 3300021321 Bacteria 10220
422 Ga0214543_1000024 3300021327 Bacteria 235745
423 Ga0214543_1000038 3300021327 Bacteria 182106
424 Ga0213876_10001237 3300021384 Bacteria 16109
425 Ga0213875_10000067 3300021388 Bacteria 127481
426 Ga0228711_1010496 3300022739 Bacteria 12155
427 Ga0228710_1010751 3300022740 Bacteria 12109
428 Ga0209435_100012 3300025206 Bacteria 401621
429 Ga0209760_100109 3300025207 Bacteria 58898
430 Ga0209436_100147 3300025208 Bacteria 34133
431 Ga0209436_103527 3300025208 Bacteria 4123
432 Ga0209436_109845 3300025208 Bacteria 1788
433 Ga0207427_100114 3300025231 Bacteria 104357
434 Ga0207427_100636 3300025231 Bacteria 17040
435 Ga0209437_100051 3300025233 Bacteria 392523
436 Ga0209437_100098 3300025233 Bacteria 229766
437 Ga0209437_100219 3300025233 Bacteria 104357
438 Ga0209437_106862 3300025233 Bacteria 1879
439 Ga0207425_1000075 3300025245 Bacteria 107452
440 Ga0207425_1001868 3300025245 Bacteria 8076
441 Ga0209646_1000026 3300025246 Bacteria 401621
442 Ga0209026_1000014 3300025250 Bacteria 401621
443 Ga0209026_1000023 3300025250 Bacteria 357521
444 Ga0209026_1000029 3300025250 Bacteria 337109
445 Ga0209677_101213 3300025253 Bacteria 11737
446 Ga0209148_1000080 3300025254 Bacteria 277806
447 Ga0209148_1003734 3300025254 Bacteria 4021
448 Ga0209759_1000012 3300025256 Bacteria 401621
449 Ga0209759_1000167 3300025256 Bacteria 112160
450 Ga0209759_1000393 3300025256 Bacteria 54357
451 Ga0209129_1000156 3300025258 Bacteria 107484
452 Ga0209129_1000218 3300025258 Bacteria 66076
453 Ga0209129_1000537 3300025258 Bacteria 26442
454 Ga0209129_1000876 3300025258 Bacteria 18555
455 Ga0209129_1008635 3300025258 Bacteria 2805
456 Ga0209233_1000012 3300025261 Bacteria 1019519
457 Ga0209233_1000028 3300025261 Bacteria 642062
458 Ga0209233_1000095 3300025261 Bacteria 303783
459 Ga0209233_1000113 3300025261 Bacteria 253455
460 Ga0209233_1000148 3300025261 Bacteria 185135
461 Ga0209233_1000631 3300025261 Bacteria 17562
462 Ga0209455_1000171 3300025272 Bacteria 109696
463 Ga0209673_1000010 3300025273 Bacteria 596656
464 Ga0209673_1000117 3300025273 Bacteria 172081
465 Ga0209673_1000151 3300025273 Bacteria 148103
466 Ga0209673_1001898 3300025273 Bacteria 16778
467 Ga0209130_1000003 3300025284 Bacteria 677988
468 Ga0209130_1000020 3300025284 Bacteria 379297
469 Ga0209130_1000034 3300025284 Bacteria 302439
470 Ga0209130_1000150 3300025284 Bacteria 108274
471 Ga0209130_1000906 3300025284 Bacteria 23912
472 Ga0209675_1000529 3300025291 Bacteria 27963
473 Ga0209676_1001566 3300025292 Bacteria 20451
474 Ga0209676_1004814 3300025292 Bacteria 7328
475 Ga0209676_1011005 3300025292 Bacteria 3698
476 Ga0209025_1000010 3300025294 Bacteria 986612
477 Ga0209025_1000070 3300025294 Bacteria 287776
478 Ga0209025_1000099 3300025294 Bacteria 231353
479 Ga0209025_1000140 3300025294 Bacteria 184765
480 Ga0209025_1000213 3300025294 Bacteria 139002
481 Ga0209025_1000311 3300025294 Bacteria 108141
482 Ga0209025_1000571 3300025294 Bacteria 66955
483 Ga0209025_1001887 3300025294 Bacteria 24479
484 Ga0209025_1003502 3300025294 Bacteria 14757
485 Ga0209025_1009690 3300025294 Bacteria 6662
486 Ga0209025_1019714 3300025294 Bacteria 3735
487 Ga0209025_1038252 3300025294 Bacteria 2113
488 Ga0209025_1056162 3300025294 Bacteria 1516
489 Ga0209564_1000013 3300025295 Bacteria 775755
490 Ga0209564_1000048 3300025295 Bacteria 364806
491 Ga0209564_1000386 3300025295 Bacteria 79939
492 Ga0209564_1000424 3300025295 Bacteria 74299
493 Ga0209564_1003849 3300025295 Bacteria 9687
494 Ga0209564_1008813 3300025295 Bacteria 4912
495 Ga0209758_1000094 3300025297 Bacteria 241068
496 Ga0209758_1000405 3300025297 Bacteria 73971
497 Ga0209758_1000413 3300025297 Bacteria 72744
498 Ga0209758_1001271 3300025297 Bacteria 31244
499 Ga0209758_1004514 3300025297 Bacteria 11534
500 Ga0209758_1008701 3300025297 Bacteria 6495
501 Ga0209758_1009338 3300025297 Bacteria 6118
502 Ga0209758_1009734 3300025297 Bacteria 5904
503 Ga0209050_1000734 3300025298 Bacteria 47579
504 Ga0209050_1006356 3300025298 Bacteria 7022
505 Ga0209256_1000041 3300025299 Bacteria 364827
506 Ga0209256_1000396 3300025299 Bacteria 69216
507 Ga0209256_1000610 3300025299 Bacteria 49586
508 Ga0209256_1000717 3300025299 Bacteria 43910
509 Ga0209256_1000729 3300025299 Bacteria 43454
510 Ga0209256_1002535 3300025299 Bacteria 14621
511 Ga0209256_1003746 3300025299 Bacteria 10279
512 Ga0209256_1003980 3300025299 Bacteria 9703
513 Ga0207426_1000006 3300025302 Bacteria 1025969
514 Ga0207426_1000008 3300025302 Bacteria 848730
515 Ga0207426_1000011 3300025302 Bacteria 791203
516 Ga0207426_1000065 3300025302 Bacteria 353625
517 Ga0207426_1000394 3300025302 Bacteria 74327
518 Ga0207426_1000449 3300025302 Bacteria 65802
519 Ga0209051_1000097 3300025303 Bacteria 167378
520 Ga0209051_1000314 3300025303 Bacteria 74316
521 Ga0209051_1003938 3300025303 Bacteria 9463
522 Ga0209051_1026414 3300025303 Bacteria 2341
523 Ga0209257_1000302 3300025304 Bacteria 108038
524 Ga0209257_1003955 3300025304 Bacteria 12028
525 Ga0209257_1006318 3300025304 Bacteria 7714
526 Ga0209257_1025324 3300025304 Bacteria 2029
527 Ga0209257_1038013 3300025304 Bacteria 1462
528 Ga0207697_10001617 3300025315 Bacteria 12162
529 Ga0207655_1010754 3300025728 Bacteria 5520
530 Ga0207655_1046058 3300025728 Bacteria 1815
531 Ga0207713_1013193 3300025735 Bacteria 4371
532 Ga0207713_1017718 3300025735 Bacteria 3556
533 Ga0207692_10043940 3300025898 Bacteria 2227
534 Ga0207710_10000638 3300025900 Bacteria 20100
535 Ga0207710_10001624 3300025900 Bacteria 10982
536 Ga0207680_10000023 3300025903 Bacteria 84146
537 Ga0207680_10044146 3300025903 Bacteria 2619
538 Ga0207647_10008196 3300025904 Bacteria 7507
539 Ga0207647_10059910 3300025904 Bacteria 2328
540 Ga0207685_10004327 3300025905 Bacteria 3595
541 Ga0207699_10012588 3300025906 Bacteria 4307
542 Ga0207699_10033136 3300025906 Bacteria 2917
543 Ga0207645_10171585 3300025907 Bacteria 1422
544 Ga0207705_10003682 3300025909 Bacteria 11660
545 Ga0207705_10031308 3300025909 Bacteria 3796
546 Ga0207705_10038810 3300025909 Bacteria 3411
547 Ga0207705_10084083 3300025909 Bacteria 2323
548 Ga0207695_10000011 3300025913 Bacteria 910221
549 Ga0207695_10000088 3300025913 Bacteria 275833
550 Ga0207695_10015356 3300025913 Bacteria 9017
551 Ga0207695_10148683 3300025913 Bacteria 2283
552 Ga0207695_10278669 3300025913 Bacteria 1566
553 Ga0207671_10000093 3300025914 Bacteria 138939
554 Ga0207671_10000368 3300025914 Bacteria 64246
555 Ga0207671_10024233 3300025914 Bacteria 4567
556 Ga0207671_10170518 3300025914 Bacteria 1690
557 Ga0207693_10002851 3300025915 Bacteria 14970
558 Ga0207663_10030938 3300025916 Bacteria 3162
559 Ga0207660_10016785 3300025917 Bacteria 4855
560 Ga0207660_10232795 3300025917 Bacteria 1449
561 Ga0207662_10002364 3300025918 Bacteria 9455
562 Ga0207657_10001218 3300025919 Bacteria 27415
563 Ga0207657_10004999 3300025919 Bacteria 13931
564 Ga0207657_10008223 3300025919 Bacteria 10621
565 Ga0207657_10057585 3300025919 Bacteria 3348
566 Ga0207649_10012372 3300025920 Bacteria 4733
567 Ga0207649_10016880 3300025920 Bacteria 4130
568 Ga0207649_10067350 3300025920 Bacteria 2272
569 Ga0207649_10073961 3300025920 Bacteria 2185
570 Ga0207649_10143927 3300025920 Bacteria 1634
571 Ga0207652_10057622 3300025921 Bacteria 3346
572 Ga0207652_10302574 3300025921 Bacteria 1443
573 Ga0207646_10279254 3300025922 Bacteria 1509
574 Ga0207681_10000004 3300025923 Bacteria 559005
575 Ga0207681_10014839 3300025923 Bacteria 4851
576 Ga0207681_10036835 3300025923 Bacteria 3230
577 Ga0207694_10040372 3300025924 Bacteria 3592
578 Ga0207694_10098828 3300025924 Bacteria 2311
579 Ga0207694_10308791 3300025924 Bacteria 1303
580 Ga0207650_10002272 3300025925 Bacteria 13416
581 Ga0207650_10008291 3300025925 Bacteria 7096
582 Ga0207650_10013146 3300025925 Bacteria 5729
583 Ga0207650_10042106 3300025925 Bacteria 3350
584 Ga0207659_10006123 3300025926 Bacteria 7349
585 Ga0207687_10007687 3300025927 Bacteria 7080
586 Ga0207700_10139893 3300025928 Bacteria 1987
587 Ga0207700_10173452 3300025928 Bacteria 1801
588 Ga0207664_10046042 3300025929 Bacteria 3423
589 Ga0207664_10154515 3300025929 Bacteria 1952
590 Ga0207644_10000009 3300025931 Bacteria 251643
591 Ga0207644_10010500 3300025931 Bacteria 6104
592 Ga0207644_10065896 3300025931 Bacteria 2635
593 Ga0207690_10011287 3300025932 Bacteria 5337
594 Ga0207690_10046314 3300025932 Bacteria 2880
595 Ga0207706_10002603 3300025933 Bacteria 17564
596 Ga0207706_10047395 3300025933 Bacteria 3802
597 Ga0207686_10243665 3300025934 Bacteria 1310
598 Ga0207709_10027572 3300025935 Bacteria 3274
599 Ga0207670_10003291 3300025936 Bacteria 8559
600 Ga0207669_10013036 3300025937 Bacteria 4113
601 Ga0207704_10010142 3300025938 Bacteria 4579
602 Ga0207704_10164837 3300025938 Bacteria 1582
603 Ga0207665_10003784 3300025939 Bacteria 10106
604 Ga0207691_10003385 3300025940 Bacteria 15515
605 Ga0207691_10140542 3300025940 Bacteria 2128
606 Ga0207711_10084358 3300025941 Bacteria 2780
607 Ga0207711_10135510 3300025941 Bacteria 2211
608 Ga0207661_10039077 3300025944 Bacteria 3723
609 Ga0207661_10351606 3300025944 Bacteria 1330
610 Ga0207679_10030316 3300025945 Bacteria 3775
611 Ga0207679_10085495 3300025945 Bacteria 2423
612 Ga0207679_10211714 3300025945 Bacteria 1626
613 Ga0207667_10007864 3300025949 Bacteria 12735
614 Ga0207667_10051811 3300025949 Bacteria 4325
615 Ga0207667_10062660 3300025949 Bacteria 3887
616 Ga0207667_10117255 3300025949 Bacteria 2744
617 Ga0207667_10197550 3300025949 Bacteria 2063
618 Ga0207651_10007136 3300025960 Bacteria 5935
619 Ga0207651_10257102 3300025960 Bacteria 1432
620 Ga0207712_10011208 3300025961 Bacteria 5709
621 Ga0207712_10037841 3300025961 Bacteria 3295
622 Ga0207712_10218850 3300025961 Bacteria 1521
623 Ga0207668_10000169 3300025972 Bacteria 45173
624 Ga0207668_10032057 3300025972 Bacteria 3469
625 Ga0207668_10048245 3300025972 Bacteria 2921
626 Ga0207668_10074744 3300025972 Bacteria 2434
627 Ga0207668_10098224 3300025972 Bacteria 2169
628 Ga0207640_10016981 3300025981 Bacteria 4249
629 Ga0207640_10049307 3300025981 Bacteria 2726
630 Ga0207640_10088697 3300025981 Bacteria 2136
631 Ga0207640_10128462 3300025981 Bacteria 1828
632 Ga0207640_10318481 3300025981 Bacteria 1237
633 Ga0207658_10020412 3300025986 Bacteria 4588
634 Ga0207658_10045699 3300025986 Bacteria 3193
635 Ga0207677_10126961 3300026023 Bacteria 1929
636 Ga0207703_10007713 3300026035 Bacteria 8522
637 Ga0207639_10001916 3300026041 Bacteria 13965
638 Ga0207639_10025379 3300026041 Bacteria 4297
639 Ga0207639_10040856 3300026041 Bacteria 3465
640 Ga0207678_10001222 3300026067 Bacteria 23629
641 Ga0207678_10066022 3300026067 Bacteria 3107
642 Ga0207678_10183948 3300026067 Bacteria 1784
643 Ga0207708_10000385 3300026075 Bacteria 34524
644 Ga0207708_10003153 3300026075 Bacteria 12139
645 Ga0207702_10013749 3300026078 Bacteria 6722
646 Ga0207702_10182589 3300026078 Bacteria 1933
647 Ga0207702_10274838 3300026078 Bacteria 1590
648 Ga0207702_10446373 3300026078 Bacteria 1254
649 Ga0207641_10005070 3300026088 Bacteria 11294
650 Ga0207641_10020177 3300026088 Bacteria 5471
651 Ga0207648_10009094 3300026089 Bacteria 9550
652 Ga0207676_10001820 3300026095 Bacteria 15614
653 Ga0207676_10039025 3300026095 Bacteria 3629
654 Ga0207674_10001584 3300026116 Bacteria 29294
655 Ga0207674_10021080 3300026116 Bacteria 7027
656 Ga0207674_10135331 3300026116 Bacteria 2426
657 Ga0207675_100000060 3300026118 Bacteria 81241
658 Ga0207675_100007201 3300026118 Bacteria 10503
659 Ga0207675_100175378 3300026118 Bacteria 2051
660 Ga0207683_10001503 3300026121 Bacteria 21014
661 Ga0207698_10009822 3300026142 Bacteria 6116
662 Ga0207698_10042092 3300026142 Bacteria 3410
663 Ga0207698_10068687 3300026142 Bacteria 2799
664 Ga0207698_10240238 3300026142 Bacteria 1650
665 Ga0207698_10476863 3300026142 Bacteria 1209
666 Ga0209281_1000245 3300027111 Bacteria 109870
667 Ga0209281_1000246 3300027111 Bacteria 107513
668 Ga0209281_1001017 3300027111 Bacteria 21872
669 Ga0209371_1000022 3300027312 Bacteria 536342
670 Ga0209371_1000173 3300027312 Bacteria 96201
671 Ga0209371_1001156 3300027312 Bacteria 19303
672 Ga0209179_1000063 3300027512 Bacteria 19219
673 Ga0209282_1000563 3300027666 Bacteria 18029
674 Ga0209282_1001720 3300027666 Bacteria 12231
675 Ga0209813_10005557 3300027866 Bacteria 3066
676 Ga0209813_10011809 3300027866 Bacteria 2292
677 Ga0209974_10020284 3300027876 Bacteria 2203
678 Ga0207428_10001431 3300027907 Bacteria 25080
679 Ga0207428_10027225 3300027907 Bacteria 4762
680 Ga0207428_10048219 3300027907 Bacteria 3418
681 Ga0207428_10067766 3300027907 Bacteria 2810
682 Ga0207428_10103303 3300027907 Bacteria 2200
683 Ga0268266_10000243 3300028379 Bacteria 92211
684 Ga0268266_10002745 3300028379 Bacteria 18393
685 Ga0268266_10030921 3300028379 Bacteria 4547
686 Ga0268266_10077476 3300028379 Bacteria 2890
687 Ga0268266_10272384 3300028379 Bacteria 1572
688 Ga0268265_10000576 3300028380 Bacteria 37132
689 Ga0268265_10022524 3300028380 Bacteria 4428
690 Ga0268264_10000069 3300028381 Bacteria 270492
691 Ga0268264_10006449 3300028381 Bacteria 9877
692 Ga0265318_10005250 3300028577 Bacteria 6100
693 Ga0307517_10044289 3300028786 Bacteria 4711
694 Ga0307515_10003171 3300028794 Bacteria 34790
695 Ga0307515_10006338 3300028794 Bacteria 23697
696 Ga0307515_10020078 3300028794 Bacteria 11960
697 Ga0307515_10174514 3300028794 Bacteria 2126
698 Ga0268256_1000019 3300030500 Bacteria 587949
699 Ga0307511_10092817 3300030521 Bacteria 2033
700 Ga0265330_10006061 3300031235 Bacteria 5987
701 Ga0265330_10045499 3300031235 Bacteria 1935
702 Ga0265330_10055314 3300031235 Bacteria 1733
703 Ga0265328_10006323 3300031239 Bacteria 5026
704 Ga0265325_10002139 3300031241 Bacteria 13477
705 Ga0265325_10027473 3300031241 Bacteria 3075
706 Ga0265339_10004708 3300031249 Bacteria 9258
707 Ga0265339_10011145 3300031249 Bacteria 5550
708 Ga0265327_10005132 3300031251 Bacteria 11111
709 Ga0265316_10048512 3300031344 Bacteria 3351
710 Ga0307513_10003757 3300031456 Bacteria 20483
711 Ga0307513_10012121 3300031456 Bacteria 10662
712 Ga0307513_10149430 3300031456 Bacteria 2248
713 Ga0307509_10106888 3300031507 Bacteria 2816
714 Ga0307408_100320037 3300031548 Bacteria 1306
715 Ga0265313_10000063 3300031595 Bacteria 104056
716 Ga0307508_10032271 3300031616 Bacteria 4731
717 Ga0316579_10000602 3300031691 Bacteria 12101
718 Ga0316579_10003046 3300031691 Bacteria 6455
719 Ga0265314_10015400 3300031711 Bacteria 6071
720 Ga0316576_10100109 3300031727 Bacteria 2166
721 Ga0316578_10034359 3300031728 Bacteria 2912
722 Ga0316578_10096736 3300031728 Bacteria 1768
723 Ga0307516_10001719 3300031730 Bacteria 30077
724 Ga0307516_10225238 3300031730 Bacteria 1582
725 Ga0307516_10243886 3300031730 Bacteria 1494
726 Ga0307405_10001594 3300031731 Bacteria 9629
727 Ga0307405_10060473 3300031731 Bacteria 2391
728 Ga0307405_10069996 3300031731 Bacteria 2251
729 Ga0307410_10004095 3300031852 Bacteria 7467
730 Ga0307406_10037380 3300031901 Bacteria 2998
731 Ga0307407_10147924 3300031903 Bacteria 1523
732 Ga0307412_10014053 3300031911 Bacteria 4713
733 Ga0315914_1000015 3300031967 Bacteria 128727
734 Ga0307414_10001368 3300032004 Bacteria 12613
735 Ga0307414_10051845 3300032004 Bacteria 2851
736 Ga0307411_10053700 3300032005 Bacteria 2642
737 Ga0316593_10046937 3300032168 Bacteria 1451
738 Ga0315913_1008719 3300033430 Bacteria 11987
739 Ga0315915_1000020 3300033464 Bacteria 128727
740 Ga0373940_0013654 3300035088 Bacteria 1970
741 Ga0373949_0029193 3300035090 Bacteria 1305
742 Ga0373939_0007086 3300035114 Bacteria 2715
743 Ga0373939_0035535 3300035114 Bacteria 1469
744 Ga0373941_0005225 3300035115 Bacteria 3044
745 Ga0373941_0055694 3300035115 Bacteria 1272
746 Ga0373960_0007893 3300035121 Bacteria 2534
747 Ga0373961_0007824 3300035241 Bacteria 2590
748 Ga0373962_0002300 3300035242 Bacteria 4562
749 Ga0373962_0003880 3300035242 Bacteria 3600
750 Ga0316574_0055341 3300035398 Bacteria 2479
751 Ga0316574_0137414 3300035398 Bacteria 1574
752 Ga0373931_0004634 3300035691 Bacteria 6288
753 Ga0373931_0010811 3300035691 Bacteria 4392
754 Ga0373931_0032593 3300035691 Bacteria 2697
755 Ga0373931_0051497 3300035691 Bacteria 2193
756 Ga0373931_0096025 3300035691 Bacteria 1660
757 Ga0373927_0000058 3300035695 Bacteria 80217
758 Ga0373937_0218965 3300036401 Bacteria 1792
759 Ga0316582_0006740 3300036647 Bacteria 6062
760 Ga0316584_0036814 3300036712 Bacteria 3632
761 Ga0373925_0005785 3300037068 Bacteria 9189
762 Ga0395899_0000044 3300037312 Bacteria 248735
763 Ga0395899_0099170 3300037312 Bacteria 2105
764 Ga0395900_0000042 3300037418 Bacteria 242667
765 Ga0395900_0013297 3300037418 Bacteria 8415
766 Ga0395900_0018704 3300037418 Bacteria 7066
767 Ga0395900_0105539 3300037418 Bacteria 2894
768 Ga0395898_0000080 3300037466 Bacteria 242667
769 Ga0395898_0096236 3300037466 Bacteria 2844
770 Ga0395898_0101483 3300037466 Bacteria 2763
771 Ga0395905_0000044 3300037471 Bacteria 242916
772 Ga0395905_0001069 3300037471 Bacteria 34516
773 Ga0395905_0012064 3300037471 Bacteria 8328
774 Ga0395905_0035395 3300037471 Bacteria 4689
775 Ga0395905_0036925 3300037471 Bacteria 4589
776 Ga0395905_0056748 3300037471 Bacteria 3663
777 Ga0395905_0059709 3300037471 Bacteria 3565
778 Ga0436364_0410392 3300037853 Bacteria 19971
779 Ga0395901_0000027 3300038443 Bacteria 244204
780 Ga0395901_0024093 3300038443 Bacteria 6243
781 Ga0395901_0064567 3300038443 Bacteria 3811
782 Ga0395901_0098115 3300038443 Bacteria 3072
783 Ga0400488_24627 3300038741 Bacteria 1629
784 Ga0242420_009488 3300038996 Bacteria 1597
785 Ga0400483_005361 3300039062 Bacteria 1627
786 Ga0400483_134363 3300039062 Bacteria 17839
787 Ga0400483_143286 3300039062 Bacteria 14413
788 Ga0400483_156554 3300039062 Bacteria 24287
789 Ga0400483_168664 3300039062 Bacteria 1484
790 Ga0400483_181996 3300039062 Bacteria 5047
791 Ga0400483_215517 3300039062 Bacteria 4759
792 Ga0400483_220054 3300039062 Bacteria 3601
793 Ga0400483_242580 3300039062 Bacteria 1520
794 Ga0400483_253791 3300039062 Bacteria 1414
795 Ga0400483_269816 3300039062 Bacteria 4535
796 Ga0436365_1382071 3300039437 Bacteria 38509
797 Ga0436365_1909219 3300039437 Bacteria 3552
798 Ga0436360_1174268 3300039438 Bacteria 5551
799 Ga0436363_0826910 3300039450 Bacteria 4759
800 Ga0436362_0327940 3300039453 Bacteria 1323
801 Ga0439436_0009616 3300041404 Bacteria 2965
802 Ga0439436_0021462 3300041404 Bacteria 1919
803 Ga0439438_000091 3300041405 Bacteria 41456
804 Ga0439438_003966 3300041405 Bacteria 5824
805 Ga0439447_000016 3300041407 Bacteria 61120
806 Ga0439447_000270 3300041407 Bacteria 18339
807 Ga0439447_002713 3300041407 Bacteria 6398
808 Ga0439447_006042 3300041407 Bacteria 3971
809 Ga0439466_0000324 3300041411 Bacteria 18343
810 Ga0439466_0012748 3300041411 Bacteria 3088
811 Ga0439466_0016319 3300041411 Bacteria 2685
812 Ga0439466_0041354 3300041411 Bacteria 1538
813 Ga0439466_0052910 3300041411 Bacteria 1326
814 Ga0439465_0000523 3300041413 Bacteria 11477
815 Ga0439465_0000778 3300041413 Bacteria 9945
816 Ga0439465_0006978 3300041413 Bacteria 3587
817 Ga0451787_281779 3300041441 Bacteria 4591
818 Ga0451793_0055025 3300041452 Bacteria 1425
819 Ga0451807_0079335 3300041486 Bacteria 1625
820 Ga0451839_0382298 3300041496 Bacteria 6212
821 Ga0451849_0157453 3300041505 Bacteria 2071
822 Ga0451850_10280 3300041506 Bacteria 1892
823 Ga0451855_0035652 3300041511 Bacteria 1726
824 Ga0451855_1331344 3300041511 Bacteria 1144
825 Ga0451853_1792368 3300041512 Bacteria 2987
826 Ga0439431_0026962 3300041997 Bacteria 1410
827 Ga0439445_0001308 3300042004 Bacteria 5375
828 Ga0439432_047291 3300042006 Bacteria 1350
829 Ga0439449_0000439 3300042007 Bacteria 15402
830 Ga0439449_0013003 3300042007 Bacteria 3130
831 Ga0439451_001654 3300042009 Bacteria 4427
832 Ga0439451_002285 3300042009 Bacteria 3864
833 Ga0439451_007893 3300042009 Bacteria 2160
834 Ga0439452_000046 3300042010 Bacteria 130842
835 Ga0439452_000163 3300042010 Bacteria 49709
836 Ga0439452_001028 3300042010 Bacteria 12348
837 Ga0439452_001433 3300042010 Bacteria 9767
838 Ga0439455_0009370 3300042012 Bacteria 2123
839 Ga0439456_002428 3300042013 Bacteria 3757
840 Ga0439456_010957 3300042013 Bacteria 1874
841 Ga0439456_016546 3300042013 Bacteria 1542
842 Ga0439463_004915 3300042016 Bacteria 3334
843 Ga0450911_001620 3300042115 Bacteria 5024
844 Ga0450919_001004 3300042121 Bacteria 3649
845 Ga0450920_001322 3300042122 Bacteria 4080
846 Ga0450922_000043 3300042124 Bacteria 10994
847 Ga0450922_001535 3300042124 Bacteria 2262
848 Ga0450923_001626 3300042125 Bacteria 3033
849 Ga0450902_001152 3300042137 Bacteria 3528
850 Ga0450902_005509 3300042137 Bacteria 1915
851 Ga0450903_000582 3300042138 Bacteria 7507
852 Ga0450903_002468 3300042138 Bacteria 3286
853 Ga0450903_011334 3300042138 Bacteria 1437
854 Ga0450906_000456 3300042145 Bacteria 8541
855 Ga0450907_000003 3300042146 Bacteria 138102
856 Ga0450907_000973 3300042146 Bacteria 6775
857 Ga0450907_002050 3300042146 Bacteria 4005
858 Ga0450907_013692 3300042146 Bacteria 1352
859 Ga0450910_001936 3300042147 Bacteria 2679
860 Ga0439446_0005478 3300042156 Bacteria 3267
861 Ga0450908_004701 3300042184 Bacteria 2630
862 Ga0450909_000170 3300042185 Bacteria 7133
863 Ga0439434_0000019 3300042435 Bacteria 41172
864 Ga0439434_0025096 3300042435 Bacteria 1799
865 Ga0439464_0005830 3300042439 Bacteria 3196
866 Ga0439460_0000388 3300042461 Bacteria 9340
867 Ga0439460_0002987 3300042461 Bacteria 4083
868 Ga0450916_000364 3300042530 Bacteria 3780
869 Ga0450918_002089 3300042531 Bacteria 3818
870 Ga0451577_0331336 3300042876 Bacteria 1381
871 Ga0439440_0000508 3300042993 Bacteria 6530
872 Ga0439440_0001836 3300042993 Bacteria 3934
873 Ga0466972_0050729 3300044658 Bacteria 2002
874 Ga0453684_0000136 3300044712 Bacteria 323402
875 Ga0453684_0117281 3300044712 Bacteria 3222
876 Ga0466970_0051098 3300044765 Bacteria 2206
877 Ga0466960_0144294 3300044901 Bacteria 1267
878 Ga0451576_0000025 3300045051 Bacteria 427980
879 Ga0451576_0023381 3300045051 Bacteria 6691
880 Ga0451576_0541263 3300045051 Bacteria 1223
881 Ga0495617_000282 3300046452 Bacteria 29411
882 Ga0495617_000613 3300046452 Bacteria 17917
883 Ga0495617_003080 3300046452 Bacteria 6350
884 Ga0495617_008507 3300046452 Bacteria 3536
885 Ga0495617_045186 3300046452 Bacteria 1468
886 Ga0495627_000010 3300046453 Bacteria 381168
887 Ga0495627_003377 3300046453 Bacteria 7078
888 Ga0495627_003483 3300046453 Bacteria 6930
889 Ga0495627_013990 3300046453 Bacteria 2813
890 Ga0495627_017194 3300046453 Bacteria 2463
891 Ga0495603_0000535 3300046455 Bacteria 21117
892 Ga0495603_0002140 3300046455 Bacteria 11624
893 Ga0495590_0000040 3300046457 Bacteria 122610
894 Ga0495590_0003390 3300046457 Bacteria 6515
895 Ga0495590_0004520 3300046457 Bacteria 5606
896 Ga0495590_0005815 3300046457 Bacteria 4847
897 Ga0495590_0022600 3300046457 Bacteria 2224
898 Ga0495590_0047473 3300046457 Bacteria 1498
899 Ga0495591_000016 3300046458 Bacteria 244927
900 Ga0495591_000143 3300046458 Bacteria 76321
901 Ga0495591_000736 3300046458 Bacteria 23661
902 Ga0495591_004102 3300046458 Bacteria 7251
903 Ga0495591_004844 3300046458 Bacteria 6415
904 Ga0495591_010620 3300046458 Bacteria 3551
905 Ga0495591_016244 3300046458 Bacteria 2601
906 Ga0495591_020149 3300046458 Bacteria 2211
907 Ga0495629_0066124 3300046459 Bacteria 2523
908 Ga0495629_0110708 3300046459 Bacteria 1914
909 Ga0495638_0000381 3300046460 Bacteria 55116
910 Ga0495638_0000906 3300046460 Bacteria 30294
911 Ga0495638_0001340 3300046460 Bacteria 22591
912 Ga0495638_0001770 3300046460 Bacteria 18918
913 Ga0495638_0002038 3300046460 Bacteria 17193
914 Ga0495638_0002185 3300046460 Bacteria 16364
915 Ga0495638_0002734 3300046460 Bacteria 14175
916 Ga0495638_0003287 3300046460 Bacteria 12749
917 Ga0495638_0008823 3300046460 Bacteria 7121
918 Ga0495638_0010217 3300046460 Bacteria 6533
919 Ga0495638_0014796 3300046460 Bacteria 5261
920 Ga0495638_0020752 3300046460 Bacteria 4337
921 Ga0495638_0044542 3300046460 Bacteria 2795
922 Ga0495638_0053148 3300046460 Bacteria 2521
923 Ga0495638_0104069 3300046460 Bacteria 1693
924 Ga0495650_0001536 3300046471 Bacteria 21887
925 Ga0495650_0001586 3300046471 Bacteria 21331
926 Ga0495650_0002125 3300046471 Bacteria 16922
927 Ga0495650_0003945 3300046471 Bacteria 10454
928 Ga0495650_0011227 3300046471 Bacteria 4924
929 Ga0495650_0011776 3300046471 Bacteria 4755
930 Ga0495582_0005973 3300046473 Bacteria 6786
931 Ga0495605_0000013 3300046474 Bacteria 308178
932 Ga0495605_0000244 3300046474 Bacteria 64456
933 Ga0495605_0000321 3300046474 Bacteria 49788
934 Ga0495605_0000751 3300046474 Bacteria 23782
935 Ga0495605_0001173 3300046474 Bacteria 17399
936 Ga0495605_0003344 3300046474 Bacteria 9590
937 Ga0495605_0006620 3300046474 Bacteria 6636
938 Ga0495605_0017540 3300046474 Bacteria 3850
939 Ga0495605_0018221 3300046474 Bacteria 3768
940 Ga0495605_0018907 3300046474 Bacteria 3688
941 Ga0495639_0000037 3300046475 Bacteria 58725
942 Ga0495639_0000553 3300046475 Bacteria 17412
943 Ga0495639_0021054 3300046475 Bacteria 2853
944 Ga0495584_0000019 3300046491 Bacteria 140608
945 Ga0495584_0000086 3300046491 Bacteria 64500
946 Ga0495584_0001430 3300046491 Bacteria 14368
947 Ga0495584_0005615 3300046491 Bacteria 6632
948 Ga0495584_0009593 3300046491 Bacteria 4985
949 Ga0495584_0020550 3300046491 Bacteria 3352
950 Ga0495584_0022419 3300046491 Bacteria 3204
951 Ga0495584_0031838 3300046491 Bacteria 2669
952 Ga0495584_0036443 3300046491 Bacteria 2485
953 Ga0495584_0046865 3300046491 Bacteria 2180
954 Ga0495584_0075776 3300046491 Bacteria 1691
955 Ga0495585_0000012 3300046492 Bacteria 203064
956 Ga0495585_0004015 3300046492 Bacteria 9688
957 Ga0495585_0005603 3300046492 Bacteria 7889
958 Ga0495585_0024800 3300046492 Bacteria 3437
959 Ga0495585_0041609 3300046492 Bacteria 2577
960 Ga0495594_0010177 3300046499 Bacteria 4874
961 Ga0495594_0012773 3300046499 Bacteria 4380
962 Ga0495594_0017998 3300046499 Bacteria 3740
963 Ga0495594_0037722 3300046499 Bacteria 2637
964 Ga0495596_0000050 3300046500 Bacteria 87493
965 Ga0495607_0000031 3300046501 Bacteria 153964
966 Ga0495607_0000637 3300046501 Bacteria 34042
967 Ga0495607_0001848 3300046501 Bacteria 18001
968 Ga0495607_0002549 3300046501 Bacteria 14730
969 Ga0495607_0005774 3300046501 Bacteria 8800
970 Ga0495607_0006918 3300046501 Bacteria 7908
971 Ga0495607_0008933 3300046501 Bacteria 6821
972 Ga0495607_0013112 3300046501 Bacteria 5442
973 Ga0495607_0024437 3300046501 Bacteria 3767
974 Ga0495607_0094305 3300046501 Bacteria 1614
975 Ga0495607_0111238 3300046501 Bacteria 1452
976 Ga0495583_0000042 3300046506 Bacteria 234630
977 Ga0495583_0000112 3300046506 Bacteria 138078
978 Ga0495583_0001014 3300046506 Bacteria 32055
979 Ga0495583_0008546 3300046506 Bacteria 6243
980 Ga0495583_0020181 3300046506 Bacteria 3459
981 Ga0495606_0001735 3300046507 Bacteria 28008
982 Ga0495606_0005023 3300046507 Bacteria 12893
983 Ga0495606_0011380 3300046507 Bacteria 7261
984 Ga0495610_0002479 3300046512 Bacteria 15472
985 Ga0495610_0004038 3300046512 Bacteria 11046
986 Ga0495610_0005663 3300046512 Bacteria 8809
987 Ga0495610_0010968 3300046512 Bacteria 5581
988 Ga0495610_0015724 3300046512 Bacteria 4386
989 Ga0495610_0018507 3300046512 Bacteria 3931
990 Ga0495610_0020528 3300046512 Bacteria 3666
991 Ga0495610_0021223 3300046512 Bacteria 3577
992 Ga0495610_0026983 3300046512 Bacteria 3059
993 Ga0495616_0000245 3300046513 Bacteria 44179
994 Ga0495616_0004681 3300046513 Bacteria 8582
995 Ga0495616_0018190 3300046513 Bacteria 3862
996 Ga0495616_0063293 3300046513 Bacteria 1808
997 Ga0495616_0093068 3300046513 Bacteria 1424
998 Ga0495620_0000005 3300046515 Bacteria 284456
999 Ga0495620_0001456 3300046515 Bacteria 14164
1000 Ga0495620_0018086 3300046515 Bacteria 3496
1001 Ga0495620_0022288 3300046515 Bacteria 3054
1002 Ga0495620_0025085 3300046515 Bacteria 2826
1003 Ga0495628_0148606 3300046516 Bacteria 1785
1004 Ga0495630_0005993 3300046517 Bacteria 8596
1005 Ga0495630_0032806 3300046517 Bacteria 3871
1006 Ga0495630_0033080 3300046517 Bacteria 3855
1007 Ga0495631_0000327 3300046518 Bacteria 32708
1008 Ga0495631_0000336 3300046518 Bacteria 32317
1009 Ga0495631_0004032 3300046518 Bacteria 7903
1010 Ga0495631_0006054 3300046518 Bacteria 6284
1011 Ga0495631_0007632 3300046518 Bacteria 5495
1012 Ga0495631_0010474 3300046518 Bacteria 4584
1013 Ga0495631_0039079 3300046518 Bacteria 2107
1014 Ga0495632_0000058 3300046519 Bacteria 122648
1015 Ga0495632_0001123 3300046519 Bacteria 22908
1016 Ga0495632_0001410 3300046519 Bacteria 20086
1017 Ga0495632_0002362 3300046519 Bacteria 14436
1018 Ga0495632_0006229 3300046519 Bacteria 7716
1019 Ga0495632_0013850 3300046519 Bacteria 4582
1020 Ga0495632_0038353 3300046519 Bacteria 2426
1021 Ga0495632_0038372 3300046519 Bacteria 2425
1022 Ga0495632_0050064 3300046519 Bacteria 2062
1023 Ga0495632_0052582 3300046519 Bacteria 2002
1024 Ga0495632_0062245 3300046519 Bacteria 1809
1025 Ga0495637_0000315 3300046520 Bacteria 37537
1026 Ga0495637_0000493 3300046520 Bacteria 28658
1027 Ga0495637_0000968 3300046520 Bacteria 18289
1028 Ga0495637_0002855 3300046520 Bacteria 9372
1029 Ga0495637_0004378 3300046520 Bacteria 7325
1030 Ga0495637_0005273 3300046520 Bacteria 6613
1031 Ga0495637_0013823 3300046520 Bacteria 3822
1032 Ga0495637_0014825 3300046520 Bacteria 3672
1033 Ga0495637_0016577 3300046520 Bacteria 3442
1034 Ga0495637_0019639 3300046520 Bacteria 3121
1035 Ga0495637_0048913 3300046520 Bacteria 1779
1036 Ga0495643_0004441 3300046522 Bacteria 9803
1037 Ga0495643_0004788 3300046522 Bacteria 9337
1038 Ga0495643_0006068 3300046522 Bacteria 8047
1039 Ga0495643_0011294 3300046522 Bacteria 5448
1040 Ga0495643_0023187 3300046522 Bacteria 3530
1041 Ga0495644_0000031 3300046523 Bacteria 65825
1042 Ga0495644_0000217 3300046523 Bacteria 27038
1043 Ga0495644_0002110 3300046523 Bacteria 7990
1044 Ga0495644_0006236 3300046523 Bacteria 4633
1045 Ga0495644_0008000 3300046523 Bacteria 4067
1046 Ga0495648_0000884 3300046524 Bacteria 31492
1047 Ga0495648_0001115 3300046524 Bacteria 27217
1048 Ga0495648_0004068 3300046524 Bacteria 12615
1049 Ga0495648_0010455 3300046524 Bacteria 7066
1050 Ga0495648_0011307 3300046524 Bacteria 6735
1051 Ga0495648_0016268 3300046524 Bacteria 5366
1052 Ga0495648_0017141 3300046524 Bacteria 5190
1053 Ga0495648_0018407 3300046524 Bacteria 4944
1054 Ga0495648_0025638 3300046524 Bacteria 3987
1055 Ga0495648_0034981 3300046524 Bacteria 3261
1056 Ga0495648_0073026 3300046524 Bacteria 1982
1057 Ga0495648_0118228 3300046524 Bacteria 1429
1058 Ga0495663_0000180 3300046525 Bacteria 25223
1059 Ga0495666_0000430 3300046526 Bacteria 18614
1060 Ga0495666_0000574 3300046526 Bacteria 16440
1061 Ga0495666_0031956 3300046526 Bacteria 2578
1062 Ga0495666_0072715 3300046526 Bacteria 1632
1063 Ga0495642_0000003 3300046528 Bacteria 185425
1064 Ga0495642_0000165 3300046528 Bacteria 38677
1065 Ga0495642_0001529 3300046528 Bacteria 10268
1066 Ga0495654_0000253 3300046530 Bacteria 48877
1067 Ga0495654_0000914 3300046530 Bacteria 21930
1068 Ga0495654_0001303 3300046530 Bacteria 17456
1069 Ga0495654_0005244 3300046530 Bacteria 7564
1070 Ga0495654_0005849 3300046530 Bacteria 7080
1071 Ga0495654_0007176 3300046530 Bacteria 6257
1072 Ga0495654_0008468 3300046530 Bacteria 5678
1073 Ga0495654_0017228 3300046530 Bacteria 3801
1074 Ga0495654_0018606 3300046530 Bacteria 3637
1075 Ga0495654_0040263 3300046530 Bacteria 2329
1076 Ga0495654_0050553 3300046530 Bacteria 2031
1077 Ga0495587_0001215 3300046536 Bacteria 17044
1078 Ga0495587_0002012 3300046536 Bacteria 13543
1079 Ga0495609_0000193 3300046538 Bacteria 60831
1080 Ga0495609_0000517 3300046538 Bacteria 31107
1081 Ga0495609_0001638 3300046538 Bacteria 14592
1082 Ga0495609_0004786 3300046538 Bacteria 7309
1083 Ga0495597_0000012 3300046542 Bacteria 212005
1084 Ga0495597_0001398 3300046542 Bacteria 17434
1085 Ga0495597_0002798 3300046542 Bacteria 10721
1086 Ga0495597_0004197 3300046542 Bacteria 7979
1087 Ga0495597_0008762 3300046542 Bacteria 5053
1088 Ga0495597_0029401 3300046542 Bacteria 2508
1089 Ga0495597_0040352 3300046542 Bacteria 2086
1090 Ga0495597_0042732 3300046542 Bacteria 2020
1091 Ga0495622_0000202 3300046557 Bacteria 47328
1092 Ga0495622_0000446 3300046557 Bacteria 26677
1093 Ga0495622_0066242 3300046557 Bacteria 1669
1094 Ga0495633_0000013 3300046558 Bacteria 262742
1095 Ga0495633_0002527 3300046558 Bacteria 12859
1096 Ga0495633_0076000 3300046558 Bacteria 1564
1097 Ga0495633_0084553 3300046558 Bacteria 1476
1098 Ga0495656_0004408 3300046615 Bacteria 4819
1099 Ga0495656_0026320 3300046615 Bacteria 2315
1100 Ga0495668_0000424 3300046616 Bacteria 55046
1101 Ga0495634_0000154 3300046642 Bacteria 61397
1102 Ga0495611_0002162 3300046648 Bacteria 9168
1103 Ga0495611_0002456 3300046648 Bacteria 8461
1104 Ga0495611_0002693 3300046648 Bacteria 8011
1105 Ga0495625_0002559 3300046660 Bacteria 19540
1106 Ga0495625_0002784 3300046660 Bacteria 18440
1107 Ga0495625_0002896 3300046660 Bacteria 17929
1108 Ga0495625_0010204 3300046660 Bacteria 7794
1109 Ga0495625_0010569 3300046660 Bacteria 7622
1110 Ga0495625_0037088 3300046660 Bacteria 3578
1111 Ga0495625_0039201 3300046660 Bacteria 3461
1112 Ga0495625_0044542 3300046660 Bacteria 3212
1113 Ga0495625_0046809 3300046660 Bacteria 3119
1114 Ga0495625_0112011 3300046660 Bacteria 1864
1115 Ga0495625_0151765 3300046660 Bacteria 1557
1116 Ga0495625_0162358 3300046660 Bacteria 1496
1117 Ga0495635_0000051 3300046663 Bacteria 74756
1118 Ga0495635_0055550 3300046663 Bacteria 2727
1119 Ga0495659_0000061 3300046664 Bacteria 48142
1120 Ga0495659_0000978 3300046664 Bacteria 10026
1121 Ga0495661_0000128 3300046665 Bacteria 92679
1122 Ga0495661_0003829 3300046665 Bacteria 11004
1123 Ga0495661_0004366 3300046665 Bacteria 10230
1124 Ga0495661_0065155 3300046665 Bacteria 2147
1125 Ga0495661_0068625 3300046665 Bacteria 2079
1126 Ga0495588_0003387 3300046674 Bacteria 6925
1127 Ga0495588_0012092 3300046674 Bacteria 4069
1128 Ga0495623_0002213 3300046679 Bacteria 12943
1129 Ga0495623_0005942 3300046679 Bacteria 7955
1130 Ga0495669_0000263 3300046684 Bacteria 30264
1131 Ga0495669_0045973 3300046684 Bacteria 1947
1132 Ga0495613_0002488 3300046689 Bacteria 13905
1133 Ga0495670_0000103 3300046691 Bacteria 37384
1134 Ga0495670_0000179 3300046691 Bacteria 28233
1135 Ga0495670_0000800 3300046691 Bacteria 15118
1136 Ga0495670_0002654 3300046691 Bacteria 8828
1137 Ga0495670_0005587 3300046691 Bacteria 6169
1138 Ga0495670_0055726 3300046691 Bacteria 1982
1139 Ga0495670_0058202 3300046691 Bacteria 1940
1140 Ga0495670_0085888 3300046691 Bacteria 1606
1141 Ga0495671_0000138 3300046692 Bacteria 64535
1142 Ga0495671_0007182 3300046692 Bacteria 6372
1143 Ga0495671_0009774 3300046692 Bacteria 5343
1144 Ga0495671_0010690 3300046692 Bacteria 5076
1145 Ga0495671_0014547 3300046692 Bacteria 4230
1146 Ga0495671_0019479 3300046692 Bacteria 3586
1147 Ga0495671_0022019 3300046692 Bacteria 3342
1148 Ga0495671_0022611 3300046692 Bacteria 3292
1149 Ga0495671_0032108 3300046692 Bacteria 2681
1150 Ga0495671_0051021 3300046692 Bacteria 2059
1151 Ga0495671_0054409 3300046692 Bacteria 1984
1152 Ga0495671_0069211 3300046692 Bacteria 1734
1153 Ga0495649_0000086 3300046694 Bacteria 80528
1154 Ga0495649_0000393 3300046694 Bacteria 37829
1155 Ga0495649_0002906 3300046694 Bacteria 11857
1156 Ga0495649_0005630 3300046694 Bacteria 7918
1157 Ga0495649_0018585 3300046694 Bacteria 3908
1158 Ga0495649_0045133 3300046694 Bacteria 2404
1159 Ga0495649_0064046 3300046694 Bacteria 1975
1160 Ga0495649_0119454 3300046694 Bacteria 1394
1161 Ga0495589_0000242 3300046794 Bacteria 45548
1162 Ga0495589_0000583 3300046794 Bacteria 25061
1163 Ga0495589_0000636 3300046794 Bacteria 23067
1164 Ga0495589_0000758 3300046794 Bacteria 20597
1165 Ga0495589_0008285 3300046794 Bacteria 5428
1166 Ga0495589_0010820 3300046794 Bacteria 4742
1167 Ga0495589_0029141 3300046794 Bacteria 2782
1168 Ga0495589_0069497 3300046794 Bacteria 1722
1169 Ga0495600_0070338 3300046809 Bacteria 2286
1170 Ga0495660_0001195 3300046810 Bacteria 18227
1171 Ga0495660_0002240 3300046810 Bacteria 12445
1172 Ga0495660_0003894 3300046810 Bacteria 9126
1173 Ga0495660_0007879 3300046810 Bacteria 6255
1174 Ga0495660_0035887 3300046810 Bacteria 2767
1175 Ga0495660_0044405 3300046810 Bacteria 2444
1176 Ga0495660_0056933 3300046810 Bacteria 2110
1177 Ga0495660_0073953 3300046810 Bacteria 1801
1178 Ga0495581_0000262 3300047315 Bacteria 25295
1179 Ga0495581_0056514 3300047315 Bacteria 2265
1180 Ga0495604_0003245 3300047317 Bacteria 12995
1181 Ga0495604_0021285 3300047317 Bacteria 5177
1182 Ga0495604_0086447 3300047317 Bacteria 2337
1183 Ga0495636_0001197 3300047318 Bacteria 9805
1184 Ga0495672_0001126 3300047320 Bacteria 27097
1185 Ga0495672_0002647 3300047320 Bacteria 16162
1186 Ga0495672_0010412 3300047320 Bacteria 6627
1187 Ga0495672_0010744 3300047320 Bacteria 6498
1188 Ga0495672_0011293 3300047320 Bacteria 6312
1189 Ga0495672_0013220 3300047320 Bacteria 5704
1190 Ga0495672_0013711 3300047320 Bacteria 5577
1191 Ga0495672_0016563 3300047320 Bacteria 4961
1192 Ga0495672_0018174 3300047320 Bacteria 4678
1193 Ga0495680_0005209 3300047322 Bacteria 12270
1194 Ga0495683_0000002 3300047323 Bacteria 638279
1195 Ga0495683_0000010 3300047323 Bacteria 223494
1196 Ga0495683_0000116 3300047323 Bacteria 80411
1197 Ga0495683_0001491 3300047323 Bacteria 15259
1198 Ga0495683_0003259 3300047323 Bacteria 9484
1199 Ga0495683_0007271 3300047323 Bacteria 6004
1200 Ga0495683_0009520 3300047323 Bacteria 5174
1201 Ga0495683_0024934 3300047323 Bacteria 3066
1202 Ga0495683_0040402 3300047323 Bacteria 2357
1203 Ga0495683_0041920 3300047323 Bacteria 2308
1204 Ga0495687_000906 3300047443 Bacteria 30980
1205 Ga0495687_001073 3300047443 Bacteria 26922
1206 Ga0495687_004002 3300047443 Bacteria 10250
1207 Ga0495687_012942 3300047443 Bacteria 4380
1208 Ga0495687_022347 3300047443 Bacteria 3037
1209 Ga0495675_0002774 3300047444 Bacteria 10504
1210 Ga0495677_0000047 3300047445 Bacteria 72197
1211 Ga0495679_000073 3300047446 Bacteria 96014
1212 Ga0495679_001421 3300047446 Bacteria 13632
1213 Ga0495679_002923 3300047446 Bacteria 8457
1214 Ga0495679_004986 3300047446 Bacteria 5981
1215 Ga0495673_0000077 3300047469 Bacteria 204403
1216 Ga0495673_0000242 3300047469 Bacteria 77375
1217 Ga0495673_0000426 3300047469 Bacteria 47785
1218 Ga0495673_0001672 3300047469 Bacteria 17072
1219 Ga0495673_0002266 3300047469 Bacteria 13803
1220 Ga0495673_0002390 3300047469 Bacteria 13262
1221 Ga0495673_0003183 3300047469 Bacteria 10969
1222 Ga0495673_0003934 3300047469 Bacteria 9523
1223 Ga0495673_0004107 3300047469 Bacteria 9243
1224 Ga0495673_0006926 3300047469 Bacteria 6599
1225 Ga0495673_0014495 3300047469 Bacteria 4096
1226 Ga0495673_0040914 3300047469 Bacteria 2089
1227 Ga0495673_0056600 3300047469 Bacteria 1695
1228 Ga0495681_0000232 3300047470 Bacteria 46130
1229 Ga0495681_0001247 3300047470 Bacteria 19314
1230 Ga0495681_0001288 3300047470 Bacteria 18982
1231 Ga0495681_0002295 3300047470 Bacteria 13750
1232 Ga0495681_0002859 3300047470 Bacteria 12196
1233 Ga0495681_0002891 3300047470 Bacteria 12140
1234 Ga0495681_0005771 3300047470 Bacteria 8232
1235 Ga0495681_0008830 3300047470 Bacteria 6268
1236 Ga0495681_0010168 3300047470 Bacteria 5718
1237 Ga0495681_0016446 3300047470 Bacteria 4146
1238 Ga0495681_0028607 3300047470 Bacteria 2864
1239 Ga0495681_0052971 3300047470 Bacteria 1901
1240 Ga0495681_0101191 3300047470 Bacteria 1259
1241 Ga0495686_0000556 3300047472 Bacteria 53309
1242 Ga0495686_0001770 3300047472 Bacteria 22015
1243 Ga0495686_0004878 3300047472 Bacteria 10819
1244 Ga0495686_0021918 3300047472 Bacteria 4233
1245 Ga0495686_0038906 3300047472 Bacteria 3040
1246 Ga0495593_0002572 3300047673 Bacteria 10900
1247 Ga0495593_0011099 3300047673 Bacteria 5182
1248 Ga0495593_0012587 3300047673 Bacteria 4830
1249 Ga0495593_0020449 3300047673 Bacteria 3706
1250 Ga0495593_0046087 3300047673 Bacteria 2324
1251 Ga0495614_0063673 3300048089 Bacteria 1585
1252 Ga0495626_0000169 3300048091 Bacteria 80674
1253 Ga0495626_0000198 3300048091 Bacteria 72611
1254 Ga0495626_0000280 3300048091 Bacteria 56131
1255 Ga0495626_0000345 3300048091 Bacteria 48769
1256 Ga0495626_0000490 3300048091 Bacteria 39851
1257 Ga0495626_0000531 3300048091 Bacteria 37903
1258 Ga0496100_0017768 3300048903 Bacteria 4206
1259 Ga0496101_0028888 3300048904 Bacteria 3875
1260 Ga0496101_0108564 3300048904 Bacteria 2086
1261 Ga0496101_0213915 3300048904 Bacteria 1494
1262 Ga0496102_0000311 3300048905 Bacteria 61342
1263 Ga0496102_0024513 3300048905 Bacteria 5365
1264 Ga0496102_0034559 3300048905 Bacteria 4546
1265 Ga0496102_0062555 3300048905 Bacteria 3408
1266 Ga0496102_0119525 3300048905 Bacteria 2460
1267 Ga0496102_0212709 3300048905 Bacteria 1823
1268 Ga0496102_0237333 3300048905 Bacteria 1719
1269 Ga0496103_0000272 3300048906 Bacteria 49098
1270 Ga0496103_0009977 3300048906 Bacteria 5616
1271 Ga0496103_0023618 3300048906 Bacteria 3710
1272 Ga0496104_0002045 3300048907 Bacteria 17515
1273 Ga0496104_0005566 3300048907 Bacteria 11029
1274 Ga0496104_0015640 3300048907 Bacteria 6880
1275 Ga0496104_0027111 3300048907 Bacteria 5299
1276 Ga0496104_0071945 3300048907 Bacteria 3288
1277 Ga0496104_0231979 3300048907 Bacteria 1757
1278 Ga0496104_0318481 3300048907 Bacteria 1468
1279 Ga0496105_0015796 3300048908 Bacteria 6023
1280 Ga0496105_0050619 3300048908 Bacteria 3431
1281 Ga0496105_0066696 3300048908 Bacteria 2972
1282 Ga0496106_0002702 3300048909 Bacteria 13155
1283 Ga0496106_0027233 3300048909 Bacteria 4256
1284 Ga0496106_0034270 3300048909 Bacteria 3791
1285 Ga0496106_0137564 3300048909 Bacteria 1920
1286 Ga0496107_0042341 3300048910 Bacteria 3270
1287 Ga0496107_0052099 3300048910 Bacteria 2952
1288 Ga0496108_0004332 3300048911 Bacteria 11410
1289 Ga0496108_0049723 3300048911 Bacteria 3506
1290 Ga0496108_0070518 3300048911 Bacteria 2949
1291 Ga0496108_0149952 3300048911 Bacteria 2012
1292 Ga0496109_0007632 3300048912 Bacteria 9172
1293 Ga0496109_0022579 3300048912 Bacteria 5574
1294 Ga0496109_0077736 3300048912 Bacteria 3054
1295 Ga0496109_0242504 3300048912 Bacteria 1696
1296 Ga0496110_0000722 3300048913 Bacteria 22828
1297 Ga0496110_0027042 3300048913 Bacteria 4915
1298 Ga0496110_0045612 3300048913 Bacteria 3832
1299 Ga0496110_0063470 3300048913 Bacteria 3264
1300 Ga0496110_0146085 3300048913 Bacteria 2139
1301 Ga0496110_0228657 3300048913 Bacteria 1691
1302 Ga0496111_0013061 3300048914 Bacteria 5639
1303 Ga0496111_0040756 3300048914 Bacteria 3332
1304 Ga0496111_0042657 3300048914 Bacteria 3258
1305 Ga0496111_0060316 3300048914 Bacteria 2750
1306 Ga0496112_0005045 3300048915 Bacteria 11336
1307 Ga0496112_0008175 3300048915 Bacteria 9349
1308 Ga0496112_0061426 3300048915 Bacteria 3704
1309 Ga0496112_0103931 3300048915 Bacteria 2811
1310 Ga0496112_0231047 3300048915 Bacteria 1804
1311 Ga0496113_0000237 3300048916 Bacteria 26001
1312 Ga0496113_0007215 3300048916 Bacteria 7123
1313 Ga0496113_0011759 3300048916 Bacteria 5859
1314 Ga0496113_0021250 3300048916 Bacteria 4575
1315 Ga0496113_0047481 3300048916 Bacteria 3191
1316 Ga0496113_0169987 3300048916 Bacteria 1726
1317 Ga0496114_0009944 3300048917 Bacteria 7561
1318 Ga0496114_0178233 3300048917 Bacteria 1855
1319 Ga0496115_0031772 3300048918 Bacteria 4162
1320 Ga0496115_0047280 3300048918 Bacteria 3440
1321 Ga0496116_0000142 3300048919 Bacteria 150342
1322 Ga0496116_0005592 3300048919 Bacteria 11583
1323 Ga0496116_0012847 3300048919 Bacteria 6806
1324 Ga0496116_0058507 3300048919 Bacteria 2512
1325 Ga0496117_0000002 3300048920 Bacteria 2483758
1326 Ga0496117_0001668 3300048920 Bacteria 31030
1327 Ga0496117_0002159 3300048920 Bacteria 25663
1328 Ga0496117_0002597 3300048920 Bacteria 22457
1329 Ga0496117_0004903 3300048920 Bacteria 14402
1330 Ga0496117_0034162 3300048920 Bacteria 3836
1331 Ga0496117_0052729 3300048920 Bacteria 2863
1332 Ga0496117_0070318 3300048920 Bacteria 2352
1333 Ga0496118_0000087 3300048921 Bacteria 176693
1334 Ga0496118_0003066 3300048921 Bacteria 21440
1335 Ga0496118_0008151 3300048921 Bacteria 10908
1336 Ga0496118_0027810 3300048921 Bacteria 4776
1337 Ga0496119_0012549 3300048922 Bacteria 6867
1338 Ga0496119_0043061 3300048922 Bacteria 2857
1339 Ga0496119_0044559 3300048922 Bacteria 2791
1340 Ga0496119_0063251 3300048922 Bacteria 2202
1341 Ga0496119_0093667 3300048922 Bacteria 1701
1342 Ga0496120_0000413 3300048923 Bacteria 68125
1343 Ga0496120_0002399 3300048923 Bacteria 19066
1344 Ga0496120_0004176 3300048923 Bacteria 12372
1345 Ga0496120_0031474 3300048923 Bacteria 3211
1346 Ga0496121_0000003 3300048924 Bacteria 1191431
1347 Ga0496121_0003720 3300048924 Bacteria 21393
1348 Ga0496121_0014041 3300048924 Bacteria 8549
1349 Ga0496122_0000004 3300048925 Bacteria 645283
1350 Ga0496122_0000215 3300048925 Bacteria 128810
1351 Ga0496122_0000840 3300048925 Bacteria 58107
1352 Ga0496122_0001103 3300048925 Bacteria 46670
1353 Ga0496122_0017685 3300048925 Bacteria 6642
1354 Ga0496122_0018671 3300048925 Bacteria 6386
1355 Ga0496122_0031306 3300048925 Bacteria 4432
1356 Ga0496122_0054501 3300048925 Bacteria 3002
1357 Ga0496122_0143343 3300048925 Bacteria 1490
1358 Ga0496123_0000007 3300048926 Bacteria 645283
1359 Ga0496123_0000306 3300048926 Bacteria 95266
1360 Ga0496123_0000336 3300048926 Bacteria 89161
1361 Ga0496123_0007538 3300048926 Bacteria 10204
1362 Ga0496123_0016914 3300048926 Bacteria 5893
1363 Ga0496123_0038132 3300048926 Bacteria 3383
1364 Ga0496123_0047092 3300048926 Bacteria 2917
1365 Ga0496123_0057637 3300048926 Bacteria 2526
1366 Ga0496124_0000252 3300048927 Bacteria 103596
1367 Ga0496124_0002136 3300048927 Bacteria 26565
1368 Ga0496124_0002555 3300048927 Bacteria 23595
1369 Ga0496124_0009734 3300048927 Bacteria 9839
1370 Ga0496124_0038651 3300048927 Bacteria 4143
1371 Ga0496124_0082442 3300048927 Bacteria 2640
1372 Ga0496124_0120816 3300048927 Bacteria 2094
1373 Ga0496124_0123127 3300048927 Bacteria 2069
1374 Ga0496124_0216891 3300048927 Bacteria 1442
1375 Ga0496125_0000039 3300048928 Bacteria 318665
1376 Ga0496125_0000115 3300048928 Bacteria 181994
1377 Ga0496125_0000248 3300048928 Bacteria 110840
1378 Ga0496125_0004709 3300048928 Bacteria 15548
1379 Ga0496125_0005054 3300048928 Bacteria 14879
1380 Ga0496125_0006807 3300048928 Bacteria 12270
1381 Ga0496125_0012178 3300048928 Bacteria 8558
1382 Ga0496125_0040662 3300048928 Bacteria 3985
1383 Ga0496125_0156958 3300048928 Bacteria 1553
1384 Ga0496125_0167150 3300048928 Bacteria 1484
1385 Ga0496126_0004507 3300048929 Bacteria 16595
1386 Ga0496126_0089490 3300048929 Bacteria 2709
1387 Ga0496126_0152247 3300048929 Bacteria 1981
1388 Ga0495678_000005 3300049459 Bacteria 522958
1389 Ga0495678_000437 3300049459 Bacteria 41568
1390 Ga0495678_002064 3300049459 Bacteria 14343
1391 Ga0495678_004456 3300049459 Bacteria 8090
1392 Ga0495678_005290 3300049459 Bacteria 7168
1393 Ga0495678_008281 3300049459 Bacteria 5265
1394 Ga0495678_013283 3300049459 Bacteria 3873
1395 Ga0495678_040918 3300049459 Bacteria 1858
1396 Ga0495682_0005670 3300049460 Bacteria 5157
1397 Ga0495682_0007712 3300049460 Bacteria 4267
1398 Ga0495682_0013439 3300049460 Bacteria 3118
1399 Ga0495682_0029551 3300049460 Bacteria 2030
1400 Ga0501031_0000024 3300049568 Bacteria 89705
1401 Ga0501031_0004592 3300049568 Bacteria 8954
1402 Ga0501031_0014364 3300049568 Bacteria 5148
1403 Ga0501031_0026503 3300049568 Bacteria 3779
1404 Ga0501031_0060373 3300049568 Bacteria 2471
1405 Ga0501032_0000007 3300049569 Bacteria 253881
1406 Ga0501032_0000067 3300049569 Bacteria 89910
1407 Ga0501032_0001002 3300049569 Bacteria 22752
1408 Ga0501032_0006627 3300049569 Bacteria 8501
1409 Ga0501032_0041213 3300049569 Bacteria 3136
1410 Ga0501032_0155955 3300049569 Bacteria 1500
1411 Ga0501033_0000051 3300049570 Bacteria 111291
1412 Ga0501033_0000117 3300049570 Bacteria 75935
1413 Ga0501033_0000349 3300049570 Bacteria 43927
1414 Ga0501033_0004757 3300049570 Bacteria 10853
1415 Ga0501033_0093682 3300049570 Bacteria 2197
1416 Ga0501033_0094349 3300049570 Bacteria 2188
1417 Ga0501033_0142634 3300049570 Bacteria 1732
1418 Ga0501033_0199016 3300049570 Bacteria 1431
1419 Ga0501033_0221602 3300049570 Bacteria 1346
1420 Ga0501034_0000029 3300049571 Bacteria 253881
1421 Ga0501034_0000153 3300049571 Bacteria 129892
1422 Ga0501034_0000464 3300049571 Bacteria 67252
1423 Ga0501034_0000732 3300049571 Bacteria 49733
1424 Ga0501034_0000856 3300049571 Bacteria 45007
1425 Ga0501034_0008570 3300049571 Bacteria 10791
1426 Ga0501034_0027155 3300049571 Bacteria 5823
1427 Ga0501034_0039601 3300049571 Bacteria 4774
1428 Ga0501034_0045866 3300049571 Bacteria 4416
1429 Ga0501034_0148126 3300049571 Bacteria 2323
1430 Ga0501034_0158948 3300049571 Bacteria 2232
1431 Ga0501034_0281830 3300049571 Bacteria 1601
1432 Ga0501034_0303541 3300049571 Bacteria 1533
1433 Ga0501034_0346230 3300049571 Bacteria 1415
1434 Ga0501034_0452520 3300049571 Bacteria 1201
1435 Ga0501036_0000004 3300049572 Bacteria 253881
1436 Ga0501036_0000928 3300049572 Bacteria 21973
1437 Ga0501036_0012091 3300049572 Bacteria 7155
1438 Ga0501036_0013985 3300049572 Bacteria 6671
1439 Ga0501036_0037538 3300049572 Bacteria 4098
1440 Ga0501037_0000004 3300049573 Bacteria 253989
1441 Ga0501037_0000007 3300049573 Bacteria 215187
1442 Ga0501037_0000081 3300049573 Bacteria 86623
1443 Ga0501037_0043652 3300049573 Bacteria 3294
1444 Ga0501037_0214610 3300049573 Bacteria 1356
1445 Ga0501037_0229568 3300049573 Bacteria 1303
1446 Ga0501038_0000005 3300049574 Bacteria 253881
1447 Ga0501038_0000033 3300049574 Bacteria 129840
1448 Ga0501038_0000520 3300049574 Bacteria 33827
1449 Ga0501038_0019048 3300049574 Bacteria 6191
1450 Ga0501038_0030498 3300049574 Bacteria 4771
1451 Ga0501038_0051192 3300049574 Bacteria 3566
1452 Ga0501038_0094900 3300049574 Bacteria 2493
1453 Ga0501038_0437373 3300049574 Bacteria 1007
1454 Ga0501039_0000009 3300049575 Bacteria 253881
1455 Ga0501039_0000031 3300049575 Bacteria 129814
1456 Ga0501039_0014960 3300049575 Bacteria 5934
1457 Ga0501039_0015253 3300049575 Bacteria 5881
1458 Ga0501039_0044932 3300049575 Bacteria 3412
1459 Ga0501039_0159140 3300049575 Bacteria 1775
1460 Ga0501040_0009968 3300049576 Bacteria 6205
1461 Ga0501040_0023407 3300049576 Bacteria 4142
1462 Ga0501040_0036626 3300049576 Bacteria 3330
1463 Ga0501040_0042264 3300049576 Bacteria 3104
1464 Ga0501041_0006543 3300049577 Bacteria 6824
1465 Ga0501041_0012239 3300049577 Bacteria 5082
1466 Ga0501041_0081398 3300049577 Bacteria 1994
1467 Ga0501041_0160012 3300049577 Bacteria 1408
1468 Ga0501042_0019465 3300049578 Bacteria 4714
1469 Ga0501042_0025815 3300049578 Bacteria 4129
1470 Ga0501042_0038541 3300049578 Bacteria 3394
1471 Ga0501042_0044684 3300049578 Bacteria 3157
1472 Ga0501043_0000034 3300049579 Bacteria 133724
1473 Ga0501043_0000044 3300049579 Bacteria 114304
1474 Ga0501043_0001790 3300049579 Bacteria 18455
1475 Ga0501043_0035499 3300049579 Bacteria 3921
1476 Ga0501043_0048558 3300049579 Bacteria 3337
1477 Ga0501043_0085182 3300049579 Bacteria 2483
1478 Ga0501043_0115629 3300049579 Bacteria 2105
1479 Ga0501046_0011042 3300049580 Bacteria 7738
1480 Ga0501046_0035913 3300049580 Bacteria 3991
1481 Ga0501046_0041626 3300049580 Bacteria 3665
1482 Ga0501046_0052392 3300049580 Bacteria 3216
1483 Ga0501046_0083875 3300049580 Bacteria 2459
1484 Ga0501046_0107340 3300049580 Bacteria 2136
1485 Ga0501047_0005769 3300049581 Bacteria 11658
1486 Ga0501047_0008561 3300049581 Bacteria 9653
1487 Ga0501047_0032505 3300049581 Bacteria 5036
1488 Ga0501047_0041765 3300049581 Bacteria 4431
1489 Ga0501047_0062853 3300049581 Bacteria 3581
1490 Ga0501047_0063378 3300049581 Bacteria 3566
1491 Ga0501047_0106266 3300049581 Bacteria 2687
1492 Ga0501048_0022942 3300049582 Bacteria 4562
1493 Ga0501048_0025003 3300049582 Bacteria 4356
1494 Ga0501048_0059773 3300049582 Bacteria 2701
1495 Ga0501048_0108592 3300049582 Bacteria 1959
1496 Ga0501067_0045863 3300049583 Bacteria 2426
1497 Ga0501068_0006004 3300049584 Bacteria 6671
1498 Ga0501068_0036659 3300049584 Bacteria 2934
1499 Ga0501068_0048843 3300049584 Bacteria 2555
1500 Ga0501069_0000075 3300049585 Bacteria 48324
1501 Ga0501069_0002889 3300049585 Bacteria 8818
1502 Ga0501069_0006374 3300049585 Bacteria 6167
1503 Ga0501069_0049686 3300049585 Bacteria 2331
1504 Ga0501070_0000284 3300049586 Bacteria 47435
1505 Ga0501070_0004793 3300049586 Bacteria 11571
1506 Ga0501070_0005298 3300049586 Bacteria 11003
1507 Ga0501070_0006011 3300049586 Bacteria 10337
1508 Ga0501071_0000788 3300049587 Bacteria 16887
1509 Ga0501071_0038242 3300049587 Bacteria 3428
1510 Ga0501071_0047775 3300049587 Bacteria 3075
1511 Ga0501071_0068628 3300049587 Bacteria 2580
1512 Ga0501071_0069364 3300049587 Bacteria 2567
1513 Ga0501071_0209729 3300049587 Bacteria 1465
1514 Ga0501072_0006065 3300049588 Bacteria 9227
1515 Ga0501072_0013019 3300049588 Bacteria 6367
1516 Ga0501072_0042201 3300049588 Bacteria 3583
1517 Ga0501073_0007771 3300049589 Bacteria 7962
1518 Ga0501074_0000101 3300049590 Bacteria 41856
1519 Ga0501074_0030410 3300049590 Bacteria 3913
1520 Ga0501074_0034278 3300049590 Bacteria 3680
1521 Ga0501074_0038952 3300049590 Bacteria 3443
1522 Ga0501075_0030295 3300049591 Bacteria 4007
1523 Ga0501075_0052526 3300049591 Bacteria 3064
1524 Ga0501075_0282940 3300049591 Bacteria 1264
1525 Ga0501076_0010182 3300049592 Bacteria 6967
1526 Ga0501076_0014907 3300049592 Bacteria 5866
1527 Ga0501076_0020166 3300049592 Bacteria 5101
1528 Ga0501076_0062971 3300049592 Bacteria 2954
1529 Ga0501076_0111709 3300049592 Bacteria 2209
1530 Ga0501076_0116143 3300049592 Bacteria 2166
1531 Ga0501076_0231944 3300049592 Bacteria 1509
1532 Ga0501077_0007500 3300049593 Bacteria 6730
1533 Ga0501077_0024389 3300049593 Bacteria 3841
1534 Ga0501077_0044183 3300049593 Bacteria 2831
1535 Ga0501077_0046334 3300049593 Bacteria 2762
1536 Ga0501079_0020709 3300049741 Bacteria 5028
1537 Ga0501079_0036801 3300049741 Bacteria 3769
1538 Ga0501079_0041950 3300049741 Bacteria 3533
1539 Ga0501079_0090439 3300049741 Bacteria 2371
1540 Ga0501080_0000843 3300049742 Bacteria 25055
1541 Ga0501080_0001651 3300049742 Bacteria 18961
1542 Ga0501080_0026752 3300049742 Bacteria 5361
1543 Ga0501080_0111895 3300049742 Bacteria 2531
1544 Ga0501080_0127833 3300049742 Bacteria 2353
1545 Ga0501081_0004251 3300049743 Bacteria 9176
1546 Ga0501081_0026043 3300049743 Bacteria 3940
1547 Ga0501081_0027775 3300049743 Bacteria 3815
1548 Ga0501081_0113838 3300049743 Bacteria 1921
1549 Ga0501083_0000191 3300049744 Bacteria 39326
1550 Ga0501083_0011637 3300049744 Bacteria 6173
1551 Ga0501083_0052796 3300049744 Bacteria 2730
1552 Ga0501035_0000014 3300049822 Bacteria 253874
1553 Ga0501035_0000469 3300049822 Bacteria 45211
1554 Ga0501035_0000472 3300049822 Bacteria 45098
1555 Ga0501035_0000546 3300049822 Bacteria 41848
1556 Ga0501035_0003018 3300049822 Bacteria 16149
1557 Ga0501035_0009851 3300049822 Bacteria 8873
1558 Ga0501035_0048750 3300049822 Bacteria 3797
1559 Ga0501035_0052261 3300049822 Bacteria 3657
1560 Ga0501035_0065575 3300049822 Bacteria 3224
1561 Ga0501035_0085804 3300049822 Bacteria 2774
1562 Ga0501035_0090284 3300049822 Bacteria 2697
1563 Ga0501035_0151917 3300049822 Bacteria 2009
1564 Ga0501044_0000010 3300049823 Bacteria 260121
1565 Ga0501044_0000012 3300049823 Bacteria 253881
1566 Ga0501044_0003181 3300049823 Bacteria 18539
1567 Ga0501044_0016120 3300049823 Bacteria 8032
1568 Ga0501044_0023375 3300049823 Bacteria 6574
1569 Ga0501044_0069596 3300049823 Bacteria 3582
1570 Ga0501044_0085984 3300049823 Bacteria 3177
1571 Ga0501044_0087979 3300049823 Bacteria 3136
1572 Ga0501044_0114272 3300049823 Bacteria 2706
1573 Ga0501044_0130873 3300049823 Bacteria 2503
1574 Ga0501044_0157420 3300049823 Bacteria 2250
1575 Ga0501044_0224941 3300049823 Bacteria 1826
1576 Ga0501044_0234415 3300049823 Bacteria 1781
1577 Ga0501045_0007600 3300049824 Bacteria 7534
1578 Ga0501045_0007710 3300049824 Bacteria 7488
1579 Ga0501045_0010155 3300049824 Bacteria 6588
1580 Ga0501045_0034851 3300049824 Bacteria 3653
1581 Ga0501045_0063244 3300049824 Bacteria 2715
1582 Ga0501226_000002 3300049853 Bacteria 426935
1583 nmdc:mga03683_3676_c1 3300050489 Bacteria 4696
1584 nmdc:mga03683_58689_c1 3300050489 Bacteria 1622
1585 nmdc:mga03683_61559_c1 3300050489 Bacteria 1588
1586 nmdc:mga03683_7377_c2 3300050489 Bacteria 2876
1587 nmdc:mga03n38_10080_c1 3300050490 Bacteria 3463
1588 nmdc:mga03n38_59665_c1 3300050490 Bacteria 1732
1589 nmdc:mga03n38_6071_c1 3300050490 Bacteria 4169
1590 nmdc:mga00v17_10994_c1 3300050491 Bacteria 4961
1591 nmdc:mga00v17_11669_c1 3300050491 Bacteria 4832
1592 nmdc:mga00v17_1801_c1 3300050491 Bacteria 11100
1593 nmdc:mga00v17_45_c1 3300050491 Bacteria 78686
1594 nmdc:mga00v17_77929_c1 3300050491 Bacteria 2064
1595 nmdc:mga0yw44_1411_c1 3300050492 Bacteria 9526
1596 nmdc:mga0yw44_21763_c1 3300050492 Bacteria 3584
1597 nmdc:mga0yw44_2560_c1 3300050492 Bacteria 7805
1598 nmdc:mga0yw44_59184_c1 3300050492 Bacteria 2343
1599 nmdc:mga0k408_122041_c1 3300050493 Bacteria 1544
1600 nmdc:mga0k408_14605_c1 3300050493 Bacteria 4331
1601 nmdc:mga06z11_11068_c1 3300050494 Bacteria 3874
1602 nmdc:mga06z11_111037_c1 3300050494 Bacteria 1518
1603 nmdc:mga06z11_1859_c1 3300050494 Bacteria 7959
1604 nmdc:mga06z11_4728_c1 3300050494 Bacteria 5384
1605 nmdc:mga06z11_72911_c1 3300050494 Bacteria 1822
1606 nmdc:mga04h51_14377_c1 3300050495 Bacteria 2261
1607 nmdc:mga04h51_17882_c1 3300050495 Bacteria 2080
1608 nmdc:mga04h51_6329_c1 3300050495 Bacteria 3065
1609 nmdc:mga07m45_31009_c1 3300050496 Bacteria 2962
1610 nmdc:mga05p37_146_c2 3300050507 Bacteria 39342
1611 nmdc:mga05p37_175331_c1 3300050507 Bacteria 2612
1612 nmdc:mga05p37_193989_c1 3300050507 Bacteria 2464
1613 nmdc:mga05p37_79974_c1 3300050507 Bacteria 4025
1614 nmdc:mga09592_309_c1 3300050508 Bacteria 35745
1615 nmdc:mga09592_330917_c1 3300050508 Bacteria 1319
1616 nmdc:mga09592_44168_c1 3300050508 Bacteria 3750
1617 nmdc:mga0qj67_201170_c1 3300050509 Bacteria 1618
1618 nmdc:mga0qj67_6132_c1 3300050509 Bacteria 8813
1619 nmdc:mga06r32_163486_c1 3300050510 Bacteria 2208
1620 nmdc:mga06r32_296_c1 3300050510 Bacteria 41448
1621 nmdc:mga06r32_3070_c1 3300050510 Bacteria 14944
1622 nmdc:mga08y16_1223_c1 3300050511 Bacteria 25402
1623 nmdc:mga08y16_144865_c1 3300050511 Bacteria 2469
1624 nmdc:mga08y16_36156_c1 3300050511 Bacteria 5187
1625 nmdc:mga08y16_41233_c1 3300050511 Bacteria 4837
1626 nmdc:mga0n895_118237_c1 3300050512 Bacteria 2670
1627 nmdc:mga0n895_171108_c1 3300050512 Bacteria 2204
1628 nmdc:mga0n895_76619_c1 3300050512 Bacteria 3325
1629 nmdc:mga0rr50_5670_c1 3300050513 Bacteria 7476
1630 nmdc:mga08x19_26494_c1 3300050514 Bacteria 3618
1631 nmdc:mga08x19_31582_c1 3300050514 Bacteria 3332
1632 nmdc:mga08x19_59231_c1 3300050514 Bacteria 2478
1633 nmdc:mga0a205_20791_c1 3300050515 Bacteria 6200
1634 nmdc:mga0a205_218337_c1 3300050515 Bacteria 1793
1635 nmdc:mga0sz30_3249_c1 3300050516 Bacteria 5842
1636 nmdc:mga0sz30_6230_c1 3300050516 Bacteria 3395
1637 Ga0500578_0021908 3300053086 Bacteria 4104
1638 Ga0500643_000153 3300053087 Bacteria 69793
1639 Ga0500555_004924 3300053103 Bacteria 3788
1640 Ga0500595_000747 3300053119 Bacteria 19155
1641 Ga0500608_021334 3300053122 Bacteria 2992
1642 Ga0500658_0037029 3300053134 Bacteria 1938
1643 Ga0500658_0091807 3300053134 Bacteria 1314
1644 Ga0500568_0000202 3300053139 Bacteria 52432
1645 Ga0500568_0051446 3300053139 Bacteria 1620
1646 Ga0500573_0014865 3300053140 Bacteria 4409
1647 Ga0500590_026998 3300053148 Bacteria 2977
1648 Ga0500604_0000130 3300053151 Bacteria 22780
1649 Ga0500616_0000102 3300053153 Bacteria 168834
1650 Ga0500616_0001640 3300053153 Bacteria 20715
1651 Ga0500624_001028 3300053157 Bacteria 5541
1652 Ga0500627_0033440 3300053158 Bacteria 2173
1653 Ga0500634_0000034 3300053161 Bacteria 74144
1654 Ga0500634_0104226 3300053161 Bacteria 1413
1655 Ga0500636_0000003 3300053177 Bacteria 240189
1656 Ga0500609_005863 3300053731 Bacteria 1677
1657 Ga0501084_0021979 3300054114 Bacteria 5321
1658 Ga0501084_0025141 3300054114 Bacteria 4968
1659 Ga0501084_0027937 3300054114 Bacteria 4714
1660 Ga0501084_0086791 3300054114 Bacteria 2627
1661 Ga0501084_0093697 3300054114 Bacteria 2522
1662 Ga0501084_0323688 3300054114 Bacteria 1302
1663 Ga0590071_002592 3300059421 Bacteria 4547
1664 Ga0501082_0008290 3300060353 Bacteria 8961
1665 Ga0501082_0024143 3300060353 Bacteria 5245
1666 Ga0501082_0025691 3300060353 Bacteria 5075
1667 Ga0501082_0029768 3300060353 Bacteria 4704
1668 Ga0501082_0035257 3300060353 Bacteria 4313
1669 Ga0501082_0069344 3300060353 Bacteria 3035
1670 Ga0501082_0104368 3300060353 Bacteria 2452
1671 Ga0501082_0189146 3300060353 Bacteria 1791
1672 Ga0501082_0302900 3300060353 Bacteria 1392
1673 Ga0530510_0001160 3300061734 Bacteria 17501
1674 Ga0530510_0010708 3300061734 Bacteria 6433
1675 Ga0530510_0014719 3300061734 Bacteria 5522
1676 Ga0530510_0062198 3300061734 Bacteria 2703
1677 Ga0530510_0082110 3300061734 Bacteria 2347
1678 2503199909 2503198000 Bacteria 6884444
1679 2508728831 2508501050 Bacteria 9633614
1680 2509075704 2508501114 Bacteria 7082538
1681 2509108366 2508501122 Bacteria 6292184
1682 2509114617 2508501123 Bacteria 6283661
1683 2509142635 2508501127 Bacteria 7037543
1684 2509369617 2509276018 Bacteria 6910194
1685 2509376501 2509276019 Bacteria 6802256
1686 2509392025 2509276021 Bacteria 7634384
1687 2509394831 2509276022 Bacteria 6200534
1688 2509445616 2509276033 Bacteria 7180565
1689 2509447083 2509276033 Bacteria 7180565
1690 2510133984 2510065019 Bacteria 6903379
1691 2510306484 2510065057 Bacteria 6649661
1692 2510318574 2510065059 Bacteria 6847884
1693 2510841240 2510461069 Bacteria 5505000
1694 2510895405 2510461076 Bacteria 8618824
1695 2511134004 2510917022 Bacteria 6504556
1696 2511172756 2510917026 Bacteria 7046020
1697 2511187084 2510917028 Bacteria 6185411
1698 2511199059 2510917030 Bacteria 7460662
1699 2511257459 2511231004 Bacteria 6669789
1700 2511274082 2511231007 Bacteria 6306603
1701 2511276593 2511231008 Bacteria 6624100
1702 2511304155 2511231012 Bacteria 6738011
1703 2511314752 2511231014 Bacteria 6462302
1704 2511322540 2511231015 Bacteria 6598026
1705 2511327815 2511231016 Bacteria 6704427
1706 2511331166 2511231017 Bacteria 6503007
1707 2511340611 2511231018 Bacteria 6436256
1708 2511344623 2511231019 Bacteria 6520662
1709 2511349948 2511231020 Bacteria 6115223
1710 2511358753 2511231021 Bacteria 7302637
1711 2511362454 2511231022 Bacteria 6719296
1712 2511390294 2511231027 Bacteria 5013807
1713 2511502274 2511231052 Bacteria 6974333
1714 2512533648 2512047086 Bacteria 6850303
1715 2512932616 2512875016 Bacteria 6529530
1716 2512960638 2512875024 Bacteria 7195110
1717 2512970652 2512875026 Bacteria 6861065
1718 2513567940 2513237084 Bacteria 7231967
1719 2513576975 2513237085 Bacteria 7695351
1720 2513584354 2513237086 Bacteria 7265287
1721 2513596505 2513237088 Bacteria 6927906
1722 2513601714 2513237089 Bacteria 6553624
1723 2513608735 2513237090 Bacteria 7096802
1724 2513618834 2513237091 Bacteria 6900273
1725 2513633355 2513237093 Bacteria 7545552
1726 2513707628 2513237103 Bacteria 7647401
1727 2513865629 2513237138 Bacteria 7368160
1728 2513884374 2513237140 Bacteria 7076289
1729 2513905041 2513237143 Bacteria 6664116
1730 2513908966 2513237144 Bacteria 7530820
1731 2513925355 2513237146 Bacteria 7166346
1732 2513984133 2513237156 Bacteria 6402557
1733 2514001471 2513237159 Bacteria 6810126
1734 2514002843 2513237160 Bacteria 6650282
1735 2514019976 2513237162 Bacteria 7468464
1736 2514036276 2513237164 Bacteria 7563725
1737 2514422823 2513237305 Bacteria 7293571
1738 2514587423 2513237351 Bacteria 6968952
1739 2515113033 2515075009 Bacteria 7288508
1740 2515609051 2515154107 Bacteria 6795637
1741 2515638312 2515154113 Bacteria 7807172
1742 2515640993 2515154114 Bacteria 7848616
1743 2515655324 2515154116 Bacteria 7552979
1744 2515739515 2515154134 Bacteria 7220242
1745 2516204175 2516143018 Bacteria 6951533
1746 2516893653 2516653046 Bacteria 6989037
1747 2517036735 2516653077 Bacteria 7555578
1748 2517077096 2516653085 Bacteria 7346596
1749 2517095862 2517093000 Bacteria 7412387
1750 2517407433 2517287029 Bacteria 6905599
1751 2517570377 2517487022 Bacteria 7227575
1752 2524448526 2524023207 Bacteria 6813453
1753 2524459618 2524023209 Bacteria 6679728
1754 2530645921 2529292951 Bacteria 6916614
1755 2535486687 2534681786 Bacteria 3308809
1756 2535516896 2534681796 Bacteria 7146037
1757 2537876042 2537561587 Bacteria 5425293
1758 2551678485 2551306084 Bacteria 8942552
1759 2551689787 2551306085 Bacteria 7347181
1760 2551694375 2551306086 Bacteria 6843938
1761 2551701991 2551306087 Bacteria 7351905
1762 2551715262 2551306089 Bacteria 7162724
1763 2551723698 2551306090 Bacteria 7953713
1764 2551738189 2551306092 Bacteria 6992595
1765 2551743399 2551306093 Bacteria 7064773
1766 2554248263 2554235003 Bacteria 5877155
1767 2558864431 2558860100 Bacteria 8458965
1768 2559295379 2558860242 Bacteria 5568029
1769 2585166384 2582581283 Bacteria 6030556
1770 2585202239 2582581294 Bacteria 6626667
1771 2585222862 2582581298 Bacteria 7315509
1772 2585231773 2582581299 Bacteria 6518058
1773 2585255117 2582581304 Bacteria 5831370
1774 2585267391 2582581306 Bacteria 6450535
1775 2585271167 2582581307 Bacteria 6597605
1776 2585277512 2582581308 Bacteria 7413247
1777 2585323304 2582581315 Bacteria 7318924
1778 2585331447 2582581316 Bacteria 7774528
1779 2585386459 2582581865 Bacteria 6644329
1780 2585393286 2582581866 Bacteria 6859583
1781 2585402368 2582581867 Bacteria 7184437
1782 2585527477 2585427526 Bacteria 7258840
1783 2585535139 2585427527 Bacteria 7273426
1784 2585538215 2585427528 Bacteria 6842387
1785 2585545445 2585427529 Bacteria 7395659
1786 2585555989 2585427530 Bacteria 7383882
1787 2585558891 2585427531 Bacteria 6992870
1788 2585822945 2585427590 Bacteria 6824633
1789 2585836164 2585427593 Bacteria 7141551
1790 2585843258 2585427594 Bacteria 6180594
1791 2585898272 2585427608 Bacteria 6544331
1792 2585904139 2585427609 Bacteria 6667127
1793 2585996232 2585427633 Bacteria 6413184
1794 2586000843 2585427634 Bacteria 6455027
1795 2587980744 2585428125 Bacteria 6662905
1796 2588518695 2588253730 Bacteria 6881675
1797 2597812084 2597489875 Bacteria 7010078
1798 2599331779 2599185156 Bacteria 5403036
1799 2599417271 2599185170 Bacteria 7295545
1800 2599601691 2599185210 Bacteria 5624189
1801 2599936480 2599185301 Bacteria 6161860
1802 2600195485 2599185352 Bacteria 7228948
1803 2601610049 2600255279 Bacteria 5605316
1804 2601746824 2600255308 Bacteria 5611129
1805 2616293331 2615840624 Bacteria 6557588
1806 2616308987 2615840626 Bacteria 7921970
1807 2616554258 2615840698 Bacteria 7319877
1808 2617383598 2617270742 Bacteria 6808054
1809 2624492827 2623620446 Bacteria 6500345
1810 2643754798 2643221547 Bacteria 4740017
1811 2643769871 2643221550 Bacteria 4619371
1812 2643803052 2643221557 Bacteria 7184309
1813 2643811503 2643221558 Bacteria 5460675
1814 2643837674 2643221564 Bacteria 4193379
1815 2643845851 2643221565 Bacteria 6216018
1816 2643856735 2643221568 Bacteria 5187270
1817 2643912693 2643221580 Bacteria 3816678
1818 2643920311 2643221582 Bacteria 5804683
1819 2643953778 2643221589 Bacteria 6250934
1820 2643966195 2643221591 Bacteria 4397626
1821 2643987406 2643221595 Bacteria 6565519
1822 2644003139 2643221599 Bacteria 6292121
1823 2644021712 2643221602 Bacteria 6249926
1824 2644050483 2643221607 Bacteria 6314006
1825 2644063414 2643221610 Bacteria 7480339
1826 2644107246 2643221618 Bacteria 7717186
1827 2644133310 2643221623 Bacteria 5239945
1828 2644150812 2643221626 Bacteria 8069654
1829 2644158074 2643221627 Bacteria 6761570
1830 2644169787 2643221629 Bacteria 5850260
1831 2644189435 2643221633 Bacteria 6733554
1832 2644193541 2643221634 Bacteria 6705461
1833 2644205711 2643221636 Bacteria 6583769
1834 2644208998 2643221637 Bacteria 5345260
1835 2644238647 2643221643 Bacteria 5749658
1836 2644298703 2643221653 Bacteria 4569637
1837 2644308641 2643221655 Bacteria 7722067
1838 2644335459 2643221659 Bacteria 7890716
1839 2644350422 2643221662 Bacteria 5851492
1840 2644374697 2643221668 Bacteria 7306521
1841 2644413304 2643221674 Bacteria 3919126
1842 2644414177 2643221675 Bacteria 7473456
1843 2644447705 2643221680 Bacteria 7473610
1844 2644483401 2643221686 Bacteria 6310811
1845 2644492060 2643221688 Bacteria 5260751
1846 2644499614 2643221689 Bacteria 6042950
1847 2644521927 2643221693 Bacteria 5513853
1848 2644539864 2643221698 Bacteria 7756764
1849 2644614582 2643221712 Bacteria 7729434
1850 2644652528 2643221718 Bacteria 5345506
1851 2644656932 2643221719 Bacteria 4568197
1852 2644676045 2643221723 Bacteria 7095460
1853 2644690178 2643221726 Bacteria 7455827
1854 2644732812 2643221733 Bacteria 5690728
1855 2644734594 2643221734 Bacteria 5365412
1856 2644743946 2643221736 Bacteria 6608466
1857 2657681593 2657244999 Bacteria 5946535
1858 2671111401 2667528174 Bacteria 6435400
1859 2688597164 2687453392 Bacteria 6880454
1860 2692315511 2690316117 Bacteria 6800650
1861 2694628770 2693429783 Bacteria 7019804
1862 2694637316 2693429784 Bacteria 7241525
1863 2719181836 2718217882 Bacteria 6556348
1864 2719386442 2718217927 Bacteria 6972593
1865 2719666188 2718217997 Bacteria 6740740
1866 2719732500 2718218009 Bacteria 6478651
1867 2720492608 2718218199 Bacteria 6740745
1868 2720614042 2718218232 Bacteria 6720332
1869 2720620849 2718218233 Bacteria 6662049
1870 2720632174 2718218235 Bacteria 6630699
1871 2720775902 2718218269 Bacteria 6906114
1872 2721147927 2718218363 Bacteria 6524337
1873 2721159378 2718218365 Bacteria 6274507
1874 2721164763 2718218366 Bacteria 6425255
1875 2721400146 2718218423 Bacteria 6438183
1876 2722840933 2721755514 Bacteria 6424414
1877 2723027504 2721755556 Bacteria 6745503
1878 2723561125 2721755684 Bacteria 6859907
1879 2723567721 2721755685 Bacteria 6704835
1880 2723574359 2721755686 Bacteria 7343952
1881 2724038959 2721755809 Bacteria 6438790
1882 2724045256 2721755810 Bacteria 6479005
1883 2724090509 2721755819 Bacteria 6906405
1884 2724104986 2721755822 Bacteria 6726041
1885 2724110843 2721755823 Bacteria 6752556
1886 2725952531 2724679232 Bacteria 7646494
1887 2730108440 2728369352 Bacteria 6745171
1888 2730165071 2728369365 Bacteria 6555560
1889 2730299010 2728369397 Bacteria 6274511
1890 2738800116 2738541293 Bacteria 7065685
1891 2738947302 2738541317 Bacteria 5340176
1892 2739032871 2738541333 Bacteria 7106503
1893 2739199949 2738543004 Bacteria 6381073
1894 2739260175 2738543015 Bacteria 6750701
1895 2739307562 2738543024 Bacteria 5603683
1896 2753357070 2751185800 Bacteria 5467370
1897 2753462057 2751185821 Bacteria 6189929
1898 2756671449 2756170246 Bacteria 7451806
1899 2757571298 2757320392 Bacteria 3737298
1900 2758639356 2758568016 Bacteria 5645291
1901 2765466383 2765235802 Bacteria 5618596
1902 2766065902 2765235942 Bacteria 7445910
1903 2770199013 2767802442 Bacteria 5747986
1904 2774118718 2773857670 Bacteria 6407454
1905 2774874315 2773857925 Bacteria 6472445
1906 2776261944 2775506901 Bacteria 9631051
1907 2776270281 2775506902 Bacteria 6208009
1908 2776284989 2775506904 Bacteria 5954060
1909 2776913973 2775507049 Bacteria 6284736
1910 2778175445 2775507266 Bacteria 7392367
1911 2784312355 2784132072 Bacteria 6596533
1912 2792585097 2791355082 Bacteria 5973319
1913 2792620741 2791355091 Bacteria 6135441
1914 2792626100 2791355092 Bacteria 6248105
1915 2792639037 2791355094 Bacteria 7011481
1916 2792748055 2791355123 Bacteria 8049106
1917 2793294407 2791355256 Bacteria 6798008
1918 2793314514 2791355259 Bacteria 7254731
1919 2793320341 2791355260 Bacteria 6598818
1920 2793331700 2791355261 Bacteria 6661293
1921 2793334520 2791355262 Bacteria 6774204
1922 2793339240 2791355263 Bacteria 6872478
1923 2793348910 2791355264 Bacteria 6429314
1924 2793351802 2791355265 Bacteria 6539969
1925 2793362550 2791355266 Bacteria 7116587
1926 2793368843 2791355267 Bacteria 7222458
1927 2802717006 2802428858 Bacteria 6636079
1928 2802725755 2802428859 Bacteria 6667919
1929 2802730156 2802428860 Bacteria 6525526
1930 2802737873 2802428861 Bacteria 6534206
1931 2802742673 2802428862 Bacteria 6633353
1932 2802750161 2802428863 Bacteria 6410669
1933 2804752782 2802429268 Bacteria 6094027
1934 2805928771 2802429605 Bacteria 6875453
1935 2805935053 2802429606 Bacteria 6346811
1936 2806043851 2802429633 Bacteria 7341974
1937 2806050218 2802429634 Bacteria 7083200
1938 2806057034 2802429635 Bacteria 7650140
1939 2806064415 2802429636 Bacteria 7597525
1940 2806071682 2802429637 Bacteria 7067217
1941 2808905340 2808606373 Bacteria 4423627
1942 2808933204 2808606377 Bacteria 6646337
1943 2808940170 2808606379 Bacteria 5022697
1944 2808955289 2808606381 Bacteria 6646461
1945 2808961781 2808606382 Bacteria 6841132
1946 2808987887 2808606387 Bacteria 5697198
1947 2819241372 2818991272 Bacteria 4622173
1948 2819559092 2818991439 Bacteria 6907412
1949 2819609177 2818991448 Bacteria 6772224
1950 2819637594 2818991453 Bacteria 7181617
1951 2819684942 2818991461 Bacteria 7026071
1952 2835320033 2835312727 Bacteria 7413381
1953 2837651168 2837651117 Bacteria 3772164
1954 2838017622 2838016132 Bacteria 6577831
1955 2838027578 2838022645 Bacteria 6494267
1956 2838029776 2838029111 Bacteria 6603031
1957 2838038530 2838035591 Bacteria 7166484
1958 2838044993 2838042994 Bacteria 6046894
1959 2838054332 2838048938 Bacteria 6044578
1960 2838067705 2838061910 Bacteria 6794874
1961 2838070112 2838068647 Bacteria 6208656
1962 2838076828 2838074704 Bacteria 6785777
1963 2838661559 2838661181 Bacteria 7385261
1964 2838670391 2838668709 Bacteria 6671819
1965 2838675740 2838675328 Bacteria 4909118
1966 2838683434 2838680041 Bacteria 6545511
1967 2838687021 2838686498 Bacteria 7807632
1968 2838697623 2838694306 Bacteria 6853137
1969 2838702762 2838701080 Bacteria 6669771
1970 2838710739 2838707686 Bacteria 6619912
1971 2838714622 2838714209 Bacteria 5525906
1972 2838721577 2838719591 Bacteria 5523910
1973 2838725382 2838724970 Bacteria 4908691
1974 2838730006 2838729681 Bacteria 7400765
1975 2838742979 2838742623 Bacteria 7396178
1976 2839998269 2839993093 Bacteria 5512535
1977 2840769105 2840764183 Bacteria 6358399
1978 2840882777 2840878972 Bacteria 5483153
1979 2841738074 2841734538 Bacteria 6784580
1980 2841848527 2841846520 Bacteria 5345850
1981 2841852465 2841851746 Bacteria 7532261
1982 2841862157 2841859092 Bacteria 5436171
1983 2841870813 2841864319 Bacteria 6742987
1984 2842078912 2842077413 Bacteria 6508645
1985 2842113235 2842110456 Bacteria 7656360
1986 2842118578 2842118031 Bacteria 7033875
1987 2842125442 2842124991 Bacteria 5346824
1988 2842130635 2842130223 Bacteria 4909145
1989 2842147980 2842146304 Bacteria 5957337
1990 2842154195 2842152218 Bacteria 4908957
1991 2842158076 2842156927 Bacteria 6894975
1992 2842168761 2842163707 Bacteria 6916235
1993 2842170866 2842170452 Bacteria 5525737
1994 2842177815 2842175837 Bacteria 4908771
1995 2842181695 2842180545 Bacteria 6888678
1996 2842187731 2842187318 Bacteria 5524014
1997 2842197388 2842192696 Bacteria 6147454
1998 2842203588 2842198810 Bacteria 6608673
1999 2842205450 2842205361 Bacteria 6340321
2000 2842212042 2842211629 Bacteria 5523832
2001 2842217967 2842217011 Bacteria 7497767
2002 2842226339 2842224351 Bacteria 5524473
2003 2842230254 2842229732 Bacteria 7475766
2004 2842240490 2842237096 Bacteria 6620661
2005 2842244157 2842243621 Bacteria 7421798
2006 2842253046 2842250916 Bacteria 6579627
2007 2842257757 2842257432 Bacteria 7401195
2008 2842266297 2842264693 Bacteria 6472963
2009 2842271441 2842271015 Bacteria 7807131
2010 2842278907 2842278818 Bacteria 6340002
2011 2842285569 2842285085 Bacteria 6011953
2012 2842292574 2842291075 Bacteria 7076806
2013 2842301400 2842298080 Bacteria 6123127
2014 2842305070 2842304105 Bacteria 7023636
2015 2842316973 2842311132 Bacteria 6616990
2016 2842320740 2842317721 Bacteria 6793725
2017 2842346489 2842341865 Bacteria 7003929
2018 2842357937 2842357229 Bacteria 6485165
2019 2842368928 2842363717 Bacteria 6844742
2020 2842374065 2842370503 Bacteria 7038661
2021 2842378972 2842377471 Bacteria 7140707
2022 2842385089 2842384541 Bacteria 7057858
2023 2842399849 2842395702 Bacteria 6780583
2024 2842402929 2842402390 Bacteria 6681310
2025 2842409699 2842409023 Bacteria 6687331
2026 2842416350 2842415677 Bacteria 6596907
2027 2842423726 2842422224 Bacteria 6239196
2028 2842430760 2842428310 Bacteria 6767288
2029 2842437253 2842434925 Bacteria 6502746
2030 2842443623 2842441272 Bacteria 6769273
2031 2842453871 2842447887 Bacteria 6754142
2032 2842464903 2842462802 Bacteria 6588055
2033 2842471871 2842469257 Bacteria 6752936
2034 2842476939 2842475841 Bacteria 6603183
2035 2842484531 2842482326 Bacteria 7212537
2036 2842492008 2842489311 Bacteria 6620893
2037 2842496796 2842495871 Bacteria 6820686
2038 2842503304 2842502639 Bacteria 6604161
2039 2842511099 2842509118 Bacteria 6850950
2040 2842518941 2842515876 Bacteria 5436280
2041 2842521847 2842521101 Bacteria 6569494
2042 2842695379 2842694124 Bacteria 4063419
2043 2842872263 2842871566 Bacteria 4827117
2044 2842924185 2842922631 Bacteria 5824079
2045 2844008643 2844002411 Bacteria 7168230
2046 2844012541 2844009547 Bacteria 6728125
2047 2844164609 2844163670 Bacteria 7266046
2048 2844458388 2844454524 Bacteria 7952546
2049 2844535307 2844533157 Bacteria 7517899
2050 2847419427 2847417321 Bacteria 6913799
2051 2847674964 2847670302 Bacteria 6165597
2052 2847691053 2847686936 Bacteria 6278406
2053 2848994455 2848992105 Bacteria 6810864
2054 2850081498 2850079185 Bacteria 6848280
2055 2852390256 2852387548 Bacteria 8025568
2056 2854684059 2854681122 Bacteria 4548679
2057 2854899620 2854896431 Bacteria 5869725
2058 2854916296 2854911287 Bacteria 5582813
2059 2854918445 2854916844 Bacteria 5725939
2060 2855826375 2855825444 Bacteria 6785811
2061 2855841764 2855839649 Bacteria 7135830
2062 2855872491 2855872281 Bacteria 6964271
2063 2856320682 2856314179 Bacteria 6477897
2064 2856323025 2856320880 Bacteria 7263508
2065 2856334784 2856328259 Bacteria 6528202
2066 2856336555 2856334872 Bacteria 7037011
2067 2856346523 2856342000 Bacteria 7176905
2068 2856359022 2856356410 Bacteria 6297484
2069 2856367984 2856364286 Bacteria 6939991
2070 2857351893 2857349434 Bacteria 7926032
2071 2857368859 2857367948 Bacteria 6965560
2072 2857517399 2857516855 Bacteria 7787325
2073 2858802549 2858800743 Bacteria 6603254
2074 2860344174 2860339153 Bacteria 6846989
2075 2869164738 2869162929 Bacteria 6399702
2076 2869173989 2869169390 Bacteria 6659796
2077 2869237841 2869234852 Bacteria 6654993
2078 2869247767 2869242130 Bacteria 6609239
2079 2869253176 2869249662 Bacteria 6868783
2080 2869263236 2869256925 Bacteria 6981691
2081 2869267594 2869264136 Bacteria 6880765
2082 2869277600 2869271264 Bacteria 6908218
2083 2869282576 2869278585 Bacteria 7077053
2084 2869283104 2869278585 Bacteria 7077053
2085 2869290397 2869285874 Bacteria 6901219
2086 2871432681 2871429161 Bacteria 6547891
2087 2871441035 2871435913 Bacteria 6880295
2088 2871447830 2871444079 Bacteria 6423508
2089 2871455734 2871451962 Bacteria 7336357
2090 2871460996 2871459585 Bacteria 6866887
2091 2871468238 2871466892 Bacteria 6923287
2092 2871475985 2871474448 Bacteria 6806570
2093 2871483428 2871481445 Bacteria 6700002
2094 2871493297 2871488783 Bacteria 6929816
2095 2871499115 2871495908 Bacteria 6935695
2096 2874108640 2874102143 Bacteria 6342645
2097 2874112238 2874109183 Bacteria 6517025
2098 2874117685 2874116593 Bacteria 6674494
2099 2874126673 2874123672 Bacteria 7238285
2100 2874133701 2874131515 Bacteria 6820270
2101 2874142232 2874139085 Bacteria 7021506
2102 2874152648 2874146452 Bacteria 7533118
2103 2874160048 2874155637 Bacteria 6724144
2104 2874168038 2874162495 Bacteria 6174670
2105 2874174866 2874168670 Bacteria 8062617
2106 2876365131 2876363079 Bacteria 6544991
2107 2876374499 2876369609 Bacteria 6807521
2108 2876388844 2876386047 Bacteria 6698674
2109 2876397946 2876392853 Bacteria 6660880
2110 2876402778 2876399893 Bacteria 6927900
2111 2876409011 2876406927 Bacteria 6191900
2112 2876418564 2876413966 Bacteria 6831344
2113 2876422280 2876420981 Bacteria 6687741
2114 2878036015 2878035449 Bacteria 6555736
2115 2878744584 2878738818 Bacteria 7136951
2116 2878750295 2878745973 Bacteria 6867388
2117 2878757342 2878753008 Bacteria 6922523
2118 2878763314 2878760144 Bacteria 6823465
2119 2878770302 2878767105 Bacteria 6898628
2120 2878774766 2878774303 Bacteria 6108671
2121 2878787687 2878781027 Bacteria 6834456
2122 2881149845 2881147464 Bacteria 7779814
2123 2881160992 2881155292 Bacteria 6461656
2124 2881166724 2881161766 Bacteria 7127907
2125 2881859184 2881853255 Bacteria 6698367
2126 2881868975 2881861095 Bacteria 7128710
2127 2882458511 2882456835 Bacteria 6863978
2128 2882632481 2882632389 Bacteria 8154593
2129 2882919256 2882912400 Bacteria 6801539
2130 2884299063 2884298095 Bacteria 3823049
2131 2885308245 2885305155 Bacteria 7348390
2132 2885312964 2885312484 Bacteria 6415165
2133 2885325829 2885318864 Bacteria 6729568
2134 2885332271 2885326080 Bacteria 7134805
2135 2885341270 2885334103 Bacteria 7216818
2136 2885353989 2885350715 Bacteria 6787678
2137 2888345853 2888343758 Bacteria 6611049
2138 2889010058 2889010040 Bacteria 6749192
2139 2889018269 2889016732 Bacteria 6700763
2140 2889795554 2889790730 Bacteria 5689708
2141 2889916115 2889914905 Bacteria 5702301
2142 2891050968 2891048133 Bacteria 4447501
2143 2891373381 2891373044 Bacteria 5202277
2144 2894235580 2894232714 Bacteria 8834183
2145 2894655609 2894652903 Bacteria 4587256
2146 2896388995 2896384573 Bacteria 7700774
2147 2898796042 2898795034 Bacteria 4294459
2148 2899796019 2899792073 Bacteria 4926588
2149 2899807234 2899803654 Bacteria 5577784
2150 2899850596 2899845264 Bacteria 5672268
2151 2903450131 2903448605 Bacteria 7357801
2152 2903500037 2903492973 Bacteria 13473544
2153 2903501069 2903492973 Bacteria 13473544
2154 2903520564 2903513507 Bacteria 6344008
2155 2903522134 2903521522 Bacteria 6525694
2156 2903528512 2903528002 Bacteria 6586099
2157 2903543917 2903540706 Bacteria 7062119
2158 2904553691 2904550169 Bacteria 6221258
2159 2904582229 2904578770 Bacteria 5302906
2160 2904664597 2904659560 Bacteria 6685615
2161 2906312653 2906308376 Bacteria 6841989
2162 2906325362 2906321335 Bacteria 6579571
2163 2906330754 2906328253 Bacteria 6585166
2164 2906362117 2906354277 Bacteria 6991324
2165 2906364504 2906363423 Bacteria 6856682
2166 2906373556 2906370794 Bacteria 6881062
2167 2906390267 2906386501 Bacteria 5977019
2168 2906395739 2906393657 Bacteria 6790866
2169 2906406159 2906401398 Bacteria 6693206
2170 2906411159 2906408224 Bacteria 6162342
2171 2906419869 2906414383 Bacteria 6580790
2172 2909043551 2909042592 Bacteria 6499737
2173 2913299281 2913295892 Bacteria 6333755
2174 2913312601 2913308742 Bacteria 5350706
2175 2915652801 2915650412 Bacteria 4288180
2176 2915982976 2915980308 Bacteria 6624279
2177 2915991477 2915986958 Bacteria 6739310
2178 2916000828 2915993759 Bacteria 7016183
2179 2916003452 2916000859 Bacteria 6865702
2180 2916008079 2916007675 Bacteria 6898660
2181 2916019574 2916014648 Bacteria 6946486
2182 2916022162 2916021584 Bacteria 6854472
2183 2916034221 2916028427 Bacteria 6748433
2184 2916037900 2916035215 Bacteria 6755766
2185 2916045300 2916041962 Bacteria 6820487
2186 2916049076 2916048683 Bacteria 6543552
2187 2916055686 2916055098 Bacteria 6758838
2188 2916062284 2916061851 Bacteria 6737736
2189 2916082288 2916076590 Bacteria 6596108
2190 2917557354 2917554339 Bacteria 4987857
2191 2919107626 2919100787 Bacteria 7710546
2192 2919114660 2919114240 Bacteria 5700270
2193 2919122990 2919119836 Bacteria 5208557
2194 2919169278 2919166419 Bacteria 4952238
2195 2919174679 2919171160 Bacteria 6499771
2196 2919410009 2919408235 Bacteria 6149349
2197 2919461216 2919456309 Bacteria 6586567
2198 2919682044 2919679072 Bacteria 4629602
2199 2919703485 2919697872 Bacteria 6553725
2200 2920761487 2920760137 Bacteria 7427611
2201 2920825252 2920822456 Bacteria 6897201
2202 2921208503 2921201388 Bacteria 6926299
2203 2921210958 2921208531 Bacteria 6745326
2204 2921240896 2921237296 Bacteria 6876710
2205 2921246740 2921244191 Bacteria 6568419
2206 2921253823 2921250672 Bacteria 6677771
2207 2921263079 2921257292 Bacteria 6808382
2208 2921266243 2921263974 Bacteria 6864552
2209 2921289162 2921282425 Bacteria 6826397
2210 2921296279 2921289301 Bacteria 7316391
2211 2921299071 2921296804 Bacteria 7176999
2212 2922136938 2922130491 Bacteria 7173936
2213 2922157196 2922151315 Bacteria 6902399
2214 2922160908 2922158528 Bacteria 6573167
2215 2922172817 2922172374 Bacteria 6167644
2216 2922188078 2922185730 Bacteria 7113964
2217 2923558603 2923556063 Bacteria 6793593
2218 2924146720 2924144063 Bacteria 6883928
2219 2924157958 2924150972 Bacteria 7169444
2220 2924159308 2924158325 Bacteria 7188855
2221 2924170518 2924165586 Bacteria 7260590
2222 2924174535 2924172951 Bacteria 6749356
2223 2924182966 2924179722 Bacteria 6843264
2224 2924193313 2924186466 Bacteria 6876637
2225 2924195418 2924193448 Bacteria 6955718
2226 2924203291 2924200457 Bacteria 6757188
2227 2924210710 2924207177 Bacteria 6917007
2228 2924217618 2924214083 Bacteria 7080103
2229 2924223260 2924221636 Bacteria 7113495
2230 2924230554 2924228884 Bacteria 6633132
2231 2924716922 2924710171 Bacteria 6752351
2232 2924726480 2924718760 Bacteria 6331356
2233 2924730920 2924726620 Bacteria 6271473
2234 2924737953 2924733363 Bacteria 7574837
2235 2924753435 2924748358 Bacteria 6154725
2236 2924760511 2924754689 Bacteria 6774424
2237 2924768352 2924762789 Bacteria 6561353
2238 2924782614 2924776078 Bacteria 7492003
2239 2924786648 2924784321 Bacteria 7416538
2240 2926755676 2926754445 Bacteria 5964435
2241 2926762796 2926760298 Bacteria 5505990
2242 2928524189 2928521798 Bacteria 4960112
2243 2929140906 2929138655 Bacteria 5810547
2244 2931402933 2931396565 Bacteria 7251677
2245 2932404846 2932401849 Bacteria 4262978
2246 2933008840 2933006813 Bacteria 4912075
2247 2933014885 2933011516 Bacteria 5439334
2248 2933022192 2933016740 Bacteria 6355406
2249 2933570878 2933570622 Bacteria 7023390
2250 2933588709 2933586486 Bacteria 7667493
2251 2933596563 2933594066 Bacteria 5594265
2252 2933600918 2933599457 Bacteria 5858799
2253 2935896991 2935894831 Bacteria 6620579
2254 2935901925 2935901341 Bacteria 7341747
2255 2936372004 2936367885 Bacteria 7324495
2256 2936379866 2936375103 Bacteria 6652732
2257 2936382770 2936381700 Bacteria 7006523
2258 2936998249 2936996657 Bacteria 6298727
2259 2937004525 2937002841 Bacteria 6934057
2260 2937011232 2937009748 Bacteria 6746052
2261 2937019790 2937016420 Bacteria 6782579
2262 2937024619 2937023124 Bacteria 6815156
2263 2937031107 2937029754 Bacteria 6424026
2264 2937037023 2937036028 Bacteria 6846469
2265 2937047977 2937042894 Bacteria 6741576
2266 2937056464 2937049772 Bacteria 6757901
2267 2937063537 2937056579 Bacteria 7107896
2268 2937067808 2937063883 Bacteria 7199456
2269 2937074425 2937071275 Bacteria 6984483
2270 2937081573 2937078374 Bacteria 6610289
2271 2937094579 2937091812 Bacteria 6979387
2272 2937105456 2937098957 Bacteria 7249374
2273 2937111291 2937106411 Bacteria 6947143
2274 2937116110 2937113482 Bacteria 6505872
2275 2937122019 2937119839 Bacteria 6597547
2276 2937128860 2937126314 Bacteria 6771275
2277 2937819202 2937813078 Bacteria 7783518
2278 2937827749 2937822353 Bacteria 7290551
2279 2937842074 2937836603 Bacteria 6811263
2280 2937846575 2937843397 Bacteria 5256375
2281 2937852081 2937848649 Bacteria 6983481
2282 2937864598 2937861824 Bacteria 6660327
2283 2937870805 2937868953 Bacteria 6639878
2284 2937881257 2937877337 Bacteria 7246526
2285 2937895662 2937891427 Bacteria 6357007
2286 2937977347 2937972304 Bacteria 7532020
2287 2937982633 2937980651 Bacteria 6517427
2288 2937997766 2937994558 Bacteria 7036190
2289 2939640228 2939636861 Bacteria 6297853
2290 2941502101 2941499720 Bacteria 7599444
2291 2952255286 2952252522 Bacteria 4171745
2292 2954013135 2954011201 Bacteria 4762601
2293 2957378373 2957375807 Bacteria 6425588
2294 2957384244 2957382221 Bacteria 6737050
2295 2957390707 2957388812 Bacteria 6778072
2296 2957401692 2957395598 Bacteria 6822399
2297 2957404469 2957402308 Bacteria 6741770
2298 2957414105 2957408893 Bacteria 6558585
2299 2957416211 2957415311 Bacteria 6991633
2300 2957431750 2957430029 Bacteria 7022557
2301 2957438185 2957437181 Bacteria 6568994
2302 2957446875 2957443900 Bacteria 6869977
2303 2957453717 2957450854 Bacteria 6765715
2304 2957461913 2957457609 Bacteria 6967680
2305 2957467011 2957464669 Bacteria 6568877
2306 2957471605 2957471148 Bacteria 6797643
2307 2957479571 2957478035 Bacteria 6756658
2308 2957490429 2957484790 Bacteria 6703082
2309 2957497368 2957491536 Bacteria 6695180
2310 2957503344 2957498199 Bacteria 7126688
2311 2957506239 2957505466 Bacteria 7253085
2312 2958039359 2958034702 Bacteria 6989922
2313 2958043241 2958041894 Bacteria 13082850
2314 2958051581 2958041894 Bacteria 13082850
2315 2958053013 2958041894 Bacteria 13082850
2316 2958070624 2958064165 Bacteria 7158582
2317 2958073708 2958071322 Bacteria 6815895
2318 2958088186 2958084443 Bacteria 7312792
2319 2958097466 2958092219 Bacteria 6861151
2320 2958107745 2958100919 Bacteria 6800575
2321 2958121122 2958115193 Bacteria 6923548
2322 2958127322 2958122699 Bacteria 7280457
2323 2958134785 2958130278 Bacteria 6897202
2324 2958147008 2958144490 Bacteria 6677056
2325 2958168239 2958165035 Bacteria 6906348
2326 2958178233 2958172287 Bacteria 6716688
2327 2958186435 2958179912 Bacteria 6874908
2328 2960590881 2960584000 Bacteria 6864594
2329 2960594247 2960591022 Bacteria 6622873
2330 2960599960 2960597568 Bacteria 6550735
2331 2960610624 2960603979 Bacteria 6898737
2332 2960614559 2960610863 Bacteria 6691244
2333 2960620498 2960617483 Bacteria 6727748
2334 2960624448 2960624210 Bacteria 6875384
2335 2960633629 2960631154 Bacteria 6732508
2336 2960645009 2960637947 Bacteria 7296468
2337 2960652446 2960645483 Bacteria 7211087
2338 2960654684 2960652885 Bacteria 7083688
2339 2960666528 2960660292 Bacteria 7041660
2340 2960669691 2960667422 Bacteria 6763020
2341 2960675127 2960674078 Bacteria 6609048
2342 2960681037 2960680706 Bacteria 6624464
2343 2960692502 2960687367 Bacteria 6535474
2344 2960698033 2960693952 Bacteria 6749742
2345 2961084934 2961077736 Bacteria 7079850
2346 2961119596 2961114664 Bacteria 6680456
2347 2961131238 2961127735 Bacteria 7196641
2348 2961140362 2961136820 Bacteria 6775228
2349 2961166705 2961163497 Bacteria 6901077
2350 2961175329 2961170736 Bacteria 7072258
2351 2961185676 2961183825 Bacteria 6688536
2352 2963646586 2963644680 Bacteria 6530403
2353 2964614159 2964607997 Bacteria 7101408
2354 2964618000 2964615318 Bacteria 6809089
2355 2964623600 2964621998 Bacteria 6834995
2356 2964632620 2964628898 Bacteria 7083044
2357 2964645652 2964643177 Bacteria 6820887
2358 2964651589 2964649959 Bacteria 6675118
2359 2964661778 2964656573 Bacteria 7100150
2360 2964666890 2964663802 Bacteria 7019362
2361 2964677605 2964670856 Bacteria 6851364
2362 2964682908 2964678106 Bacteria 6792020
2363 2964688516 2964685014 Bacteria 6839111
2364 2964692513 2964691889 Bacteria 6802758
2365 2964705353 2964698721 Bacteria 6765331
2366 2964710488 2964705432 Bacteria 7114648
2367 2964718362 2964712639 Bacteria 6695970
2368 2964720712 2964719344 Bacteria 7286602
2369 2965021528 2965018300 Bacteria 6883036
2370 2965027539 2965025482 Bacteria 6532201
2371 2965042216 2965040258 Bacteria 6855979
2372 2965051801 2965047637 Bacteria 6623551
2373 2965067609 2965062239 Bacteria 7412989
2374 2965095376 2965089291 Bacteria 6866420
2375 2965110338 2965102966 Bacteria 6800987
2376 2965118158 2965110997 Bacteria 6693150
2377 2965122438 2965119406 Bacteria 6956431
2378 2967670739 2967664464 Bacteria 6948836
2379 2967678381 2967671571 Bacteria 7021409
2380 2967684393 2967678726 Bacteria 7264382
2381 2967689964 2967686174 Bacteria 6678622
2382 2967694677 2967693043 Bacteria 6804451
2383 2967701364 2967699805 Bacteria 6854538
2384 2967708655 2967706974 Bacteria 7186053
2385 2967714908 2967714385 Bacteria 7000047
2386 2967727951 2967721400 Bacteria 7073753
2387 2967730033 2967728569 Bacteria 6641507
2388 2967737180 2967735183 Bacteria 6827012
2389 2967742290 2967742019 Bacteria 6794534
2390 2967751570 2967748971 Bacteria 6733771
2391 2967757879 2967755722 Bacteria 6814706
2392 2967767702 2967762386 Bacteria 6923502
2393 2967772088 2967769361 Bacteria 6587838
2394 2967779014 2967775926 Bacteria 6738189
2395 2967999669 2967996073 Bacteria 6787468
2396 2968008027 2968003550 Bacteria 6929263
2397 2968020686 2968016561 Bacteria 7022047
2398 2968090621 2968083720 Bacteria 7351627
2399 2968094700 2968091066 Bacteria 6052692
2400 2968100907 2968097103 Bacteria 6107094
2401 2968115851 2968110612 Bacteria 6814636
2402 2968119224 2968117919 Bacteria 6536078
2403 2968133729 2968128360 Bacteria 6270294
2404 2968142521 2968138860 Bacteria 6605449
2405 2968175110 2968171901 Bacteria 6894245
2406 2970021029 2970019648 Bacteria 7072033
2407 2970031742 2970026789 Bacteria 6785236
2408 2970034129 2970033650 Bacteria 7118744
2409 2970042521 2970040964 Bacteria 6731123
2410 2970054578 2970047711 Bacteria 7088379
2411 2970056734 2970054988 Bacteria 6611507
2412 2970067176 2970061556 Bacteria 7099761
2413 2970071620 2970068827 Bacteria 7123112
2414 2970078296 2970076120 Bacteria 6697332
2415 2970085277 2970082768 Bacteria 6183754
2416 2970092580 2970088815 Bacteria 6933825
2417 2970096151 2970095765 Bacteria 6936963
2418 2970107965 2970102677 Bacteria 6812532
2419 2970110742 2970109326 Bacteria 6863976
2420 2970117387 2970116247 Bacteria 6501857
2421 2970124911 2970122695 Bacteria 6625855
2422 2970131133 2970129317 Bacteria 6806560
2423 2970136326 2970136068 Bacteria 7207982
2424 2970145129 2970143518 Bacteria 6446480
2425 2970151583 2970149975 Bacteria 6779706
2426 2970159601 2970156795 Bacteria 7168044
2427 2970166945 2970164137 Bacteria 6861252
2428 2970174276 2970170962 Bacteria 6876229
2429 2970180857 2970177841 Bacteria 6768001
2430 2970189203 2970184632 Bacteria 7054431
2431 2970198839 2970191845 Bacteria 7032787
2432 2970473983 2970469710 Bacteria 6969209
2433 2970490628 2970489779 Bacteria 6517260
2434 2970507917 2970503327 Bacteria 7099517
2435 2970514286 2970510686 Bacteria 7006402
2436 2970527308 2970524798 Bacteria 6840927
2437 2970534681 2970532167 Bacteria 6553173
2438 2970543004 2970540015 Bacteria 6977556
2439 2970548602 2970547951 Bacteria 6931819
2440 2970558159 2970554993 Bacteria 6814252
2441 2970597185 2970593180 Bacteria 7073582
2442 2970597724 2970593180 Bacteria 7073582
2443 2970619484 2970619444 Bacteria 6986144
2444 2970629116 2970627176 Bacteria 6680862
2445 2977523719 2977516862 Bacteria 6940108
2446 2977528837 2977523885 Bacteria 6960446
2447 2977531451 2977530762 Bacteria 6951399
2448 2977539659 2977537788 Bacteria 6929320
2449 2977548342 2977544691 Bacteria 6875412
2450 2977558465 2977551784 Bacteria 7125765
2451 2977563206 2977558990 Bacteria 6863948
2452 2977567699 2977565890 Bacteria 6901543
2453 2977575714 2977572785 Bacteria 6763888
2454 2977581965 2977579622 Bacteria 6772100
2455 2977826501 2977821940 Bacteria 6906439
2456 2977831850 2977828996 Bacteria 7007971
2457 2977848441 2977843712 Bacteria 6753583
2458 2977855175 2977851361 Bacteria 6694324
2459 2977859417 2977858184 Bacteria 6215359
2460 2977865098 2977864932 Bacteria 7534097
2461 2977873542 2977872689 Bacteria 7270173
2462 2977903229 2977898635 Bacteria 6675551
2463 2977909123 2977907340 Bacteria 6577984
2464 2977922056 2977915119 Bacteria 6829656
2465 2977922906 2977922695 Bacteria 6956781
2466 2977938109 2977935797 Bacteria 6252826
2467 2977944849 2977942078 Bacteria 7570577
2468 2977956131 2977950692 Bacteria 6893264
2469 2977958419 2977957713 Bacteria 6877875
2470 2977978315 2977971508 Bacteria 7472917
2471 2977987854 2977986579 Bacteria 6581278
2472 2978974655 2978969890 Bacteria 5400756
2473 2979094714 2979089926 Bacteria 5670289
2474 2979100720 2979095461 Bacteria 5669583
2475 2979103946 2979100975 Bacteria 5423623
2476 2979715859 2979710463 Bacteria 6785254
2477 2979749880 2979742915 Bacteria 7301278
2478 2979771094 2979764755 Bacteria 6610066
2479 2979779750 2979772303 Bacteria 6618277
2480 2979783672 2979779861 Bacteria 6219781
2481 2979800949 2979793036 Bacteria 6808957
2482 2979813101 2979808191 Bacteria 7179355
2483 2984511486 2984509177 Bacteria 5274802
2484 2984522153 2984518228 Bacteria 5277463
2485 2984541451 2984537506 Bacteria 5277481
2486 2984589976 2984587000 Bacteria 5263363
2487 2984603729 2984601300 Bacteria 5455244
2488 2987639077 2987636660 Bacteria 8088555
2489 2987647903 2987645492 Bacteria 6117018
2490 2987659057 2987652177 Bacteria 6969023
2491 2987662717 2987659509 Bacteria 6966464
2492 2987671519 2987666974 Bacteria 6509233
2493 2987676826 2987673487 Bacteria 6884027
2494 2989349707 2989349275 Bacteria 6349068
2495 2989774323 2989771324 Bacteria 5605128
2496 2989779238 2989776772 Bacteria 4843317
2497 2995393172 2995392953 Bacteria 4539380
2498 2996312147 2996310559 Bacteria 6357320
2499 2996338591 2996336353 Bacteria 5511628
2500 2996344143 2996341866 Bacteria 6643098
2501 2996352697 2996348954 Bacteria 7239054
2502 2996389192 2996386984 Bacteria 6978667
2503 2996889007 2996887358 Bacteria 5795980
2504 2996894297 2996893221 Bacteria 5823108
2505 3000139548 3000135777 Bacteria 6891109
2506 3002145096 3002141150 Bacteria 5254435
2507 3003934104 3003930520 Bacteria 5667563
2508 3004167564 3004167301 Bacteria 8330599
2509 3004191767 3004188549 Bacteria 6952365
2510 3004202678 3004195979 Bacteria 6776956
2511 3004204680 3004203850 Bacteria 7307914
2512 3004217983 3004211236 Bacteria 7417683
2513 3004220969 3004218560 Bacteria 7421728
2514 3004233934 3004232784 Bacteria 6662140
2515 3004241010 3004239961 Bacteria 6892290
2516 3004255314 3004248173 Bacteria 6563236
2517 3004273975 3004268573 Bacteria 7043476
2518 3004279379 3004275668 Bacteria 7114440
2519 3004335839 3004334049 Bacteria 8449246
2520 3005414565 3005409236 Bacteria 7188837
2521 3005417405 3005416602 Bacteria 7064308
2522 3005448477 3005445848 Bacteria 6906074
2523 3005454655 3005452660 Bacteria 5889319
2524 3007515129 3007511990 Bacteria 6481491
2525 3007620619 3007619802 Bacteria 6411688
2526 637075711 637000159 Bacteria 7596297
2527 639649217 639633055 Bacteria 7751309
2528 643826341 643692032 Bacteria 6891900
2529 648739242 648276728 Bacteria 6968865
2530 649871719 649633066 Bacteria 6690028
2531 650740589 650716007 Bacteria 5573770
2532 8002291576 8002285264 Bacteria 6717907
2533 8003571656 8003570095 Bacteria 5747666
2534 8003994199 8003992118 Bacteria 7266902
2535 8004001841 8003999396 Bacteria 7063185
2536 8004306619 8004300914 Bacteria 6132239
2537 8004319058 8004312739 Bacteria 7444653
2538 8004368570 8004361976 Bacteria 6858373
2539 8004378917 8004374579 Bacteria 6898112
2540 8004392603 8004387939 Bacteria 7049250
2541 8004634488 8004633249 Bacteria 6723080
2542 8004645210 8004640170 Bacteria 6723001
2543 8004697608 8004695233 Bacteria 6731676
2544 8004712125 8004703790 Bacteria 8006957
2545 8004718912 8004714634 Bacteria 6776161
2546 8004729784 8004727605 Bacteria 6643904
2547 8005248799 8005246636 Bacteria 4933972
2548 8005260336 8005258706 Bacteria 6184835
2549 8005281240 8005275841 Bacteria 6929066
2550 8005286103 8005282627 Bacteria 6675747
2551 8005292238 8005289223 Bacteria 6634003
2552 8005303156 8005301065 Bacteria 6614431
2553 8005312864 8005307578 Bacteria 7395396
2554 8005315806 8005314921 Bacteria 7072929
2555 8005323534 8005321885 Bacteria 5795980
2556 8005380958 8005376324 Bacteria 6590079
2557 8005389091 8005382845 Bacteria 6732062
2558 8005396074 8005395548 Bacteria 6806915
2559 8005435184 8005430974 Bacteria 6689030
2560 8005463714 8005460587 Bacteria 7157962
2561 8005489158 8005484373 Bacteria 6297373
2562 8005500926 8005497431 Bacteria 6477605
2563 8005545650 8005542996 Bacteria 7077758
2564 8005556988 8005556819 Bacteria 6908598
2565 8005568020 8005563573 Bacteria 7153261
2566 8005573435 8005570704 Bacteria 6957481
2567 8005622299 8005619151 Bacteria 7030230
2568 8005629800 8005626139 Bacteria 6534237
2569 8005648167 8005645114 Bacteria 6950293
2570 8005672344 8005668836 Bacteria 6953162
2571 8005682860 8005682033 Bacteria 6726518
2572 8005692076 8005688590 Bacteria 6610080
2573 8005697430 8005695170 Bacteria 6912330
2574 8018134124 8018127388 Bacteria 7351159
2575 8018164599 8018163183 Bacteria 7277977
2576 8018181294 8018176218 Bacteria 6896178
2577 8019781786 8019775933 Bacteria 6858656
2578 8023683138 8023680758 Bacteria 7729763
2579 8024482836 8024479707 Bacteria 6954785
2580 8024488057 8024486573 Bacteria 6540512
2581 8024504450 8024501048 Bacteria 6427847
2582 8046771116 8046767195 Bacteria 7547379
2583 8049295353 8049293176 Bacteria 6128433
2584 8054463014 8054460903 Bacteria 4872905
2585 8054558610 8054558443 Bacteria 5204801
2586 8055619397 8055617313 Bacteria 7548464
2587 8056129665 8056125926 Bacteria 6228218
2588 8056156877 8056155041 Bacteria 6486948
2589 8056182596 8056177738 Bacteria 6748268
2590 8056375961 8056375014 Bacteria 7006639
2591 8056386753 8056382006 Bacteria 6408074
2592 8056877268 8056875544 Bacteria 4355797
2593 8057529699 8057529695 Bacteria 6306553
2594 8057575707 8057575449 Bacteria 7367519
2595 8057877646 8057874678 Bacteria 7494653
2596 Ga0501048_0086242
2597 MRS2a_Contig_8
2598 JGI24740J21852_10000504
2599 JGI24739J22299_10009479
2600 JGI24738J21930_10007464
2601 JGI25155J39150_1000001
2602 JGI25156J39149_1000001
2603 JGI25156J39149_1001987
2604 JGI25156J39149_1002999
2605 JGI25162J39368_1000304
2606 JGI25162J39368_1000820
2607 JGI25162J39368_1000825
2608 JGI25154J39366_1000122
2609 JGI25157J39369_1000044
2610 JGI25157J39369_1000475
2611 JGI25157J39369_1000502
2612 JGI25163J39215_1000074
2613 JGI25164J39214_1000223
2614 JGI25152J39213_1002276
2615 JGI25152J39213_1005176
2616 JGI25150J39212_1000074
2617 JGI25150J39212_1005822
2618 JGI25159J45721_1000014
2619 JGI25159J45721_1000411
2620 JGI25159J45721_1004159
2621 JGI25159J45721_1005892
2622 JGI25151J46595_10000015
2623 JGI25151J46595_10000414
2624 JGI25151J46595_10000486
2625 JGI25151J46595_10000628
2626 JGI25151J46595_10001750
2627 JGI25151J46595_10007168
2628 JGI25406J46586_10003356
2629 JGI25165J46597_1000042
2630 JGI25165J46597_1000410
2631 JGI25165J46597_1000910
2632 JGI25165J46597_1000918
2633 JGI25153J46596_10000267
2634 JGI25160J50197_1000001
2635 JGI25160J50197_1000020
2636 JGI25160J50197_1000695
2637 JGI25161J50226_1000001
2638 JGI25161J50226_1001013
2639 JGI25161J50226_1001697
2640 Ga0055542_1000488
2641 Ga0055529_1002050
2642 Ga0055526_1000375
2643 Ga0055526_1001939
2644 Ga0055526_1002938
2645 Ga0055526_1006372
2646 Ga0055526_1009545
2647 Ga0055524_1000064
2648 Ga0055524_1001090
2649 Ga0055524_1002653
2650 Ga0055524_1008708
2651 Ga0055524_1010743
2652 Ga0055536_1003980
2653 Ga0055528_1000234
2654 Ga0055528_1000512
2655 Ga0055528_1004264
2656 Ga0055528_1005478
2657 Ga0055528_1012612
2658 Ga0055540_1000350
2659 Ga0055540_1005671
2660 Ga0055540_1010745
2661 Ga0055531_10004086
2662 Ga0055531_10004879
2663 Ga0058692_1001739
2664 Ga0055543_1000003
2665 Ga0055543_1000047
2666 Ga0055543_1000355
2667 Ga0065165_1000013
2668 Ga0065165_1000026
2669 Ga0065165_1000068
2670 Ga0065165_1003530
2671 Ga0065714_10000178
2672 Ga0065714_10012843
2673 Ga0065714_10065762
2674 Ga0065714_10070084
2675 Ga0065714_10106726
2676 Ga0065712_10007353
2677 Ga0065715_10027883
2678 Ga0070658_10000115
2679 Ga0070658_10012728
2680 Ga0070658_10038151
2681 Ga0070658_10038361
2682 Ga0070683_100028048
2683 Ga0070683_100223864
2684 Ga0070683_100262281
2685 Ga0070690_100003585
2686 Ga0070690_100005518
2687 Ga0070690_100034720
2688 Ga0070690_100096304
2689 Ga0070670_100000515
2690 Ga0070670_100008496
2691 Ga0070670_100019091
2692 Ga0070670_100076542
2693 Ga0070666_10000544
2694 Ga0070666_10002592
2695 Ga0070680_100092799
2696 Ga0070682_100000925
2697 Ga0068868_100009860
2698 Ga0070660_100010552
2699 Ga0070660_100010563
2700 Ga0070660_100010989
2701 Ga0070660_100058511
2702 Ga0070660_100184257
2703 Ga0070689_100001087
2704 Ga0070691_10002849
2705 Ga0070687_100006424
2706 Ga0070661_100001127
2707 Ga0070661_100086529
2708 Ga0070692_10004469
2709 Ga0070692_10011484
2710 Ga0070668_100001269
2711 Ga0070668_100009332
2712 Ga0070668_100011919
2713 Ga0070668_100046733
2714 Ga0070668_100068691
2715 Ga0070668_100072494
2716 Ga0070669_100000012
2717 Ga0070669_100010577
2718 Ga0070675_100086044
2719 Ga0070671_100000006
2720 Ga0070671_100008175
2721 Ga0070671_100034405
2722 Ga0070674_100211489
2723 Ga0070673_100005483
2724 Ga0070688_100001689
2725 Ga0070659_100001552
2726 Ga0070667_100005567
2727 Ga0070667_100007827
2728 Ga0070703_10010999
2729 Ga0070709_10002492
2730 Ga0070709_10028933
2731 Ga0070709_10079269
2732 Ga0070714_100023734
2733 Ga0070714_100038414
2734 Ga0070713_100035660
2735 Ga0070710_10001696
2736 Ga0070711_100017961
2737 Ga0070711_100021276
2738 Ga0070711_100215964
2739 Ga0070705_100001003
2740 Ga0070705_100018853
2741 Ga0070700_100005734
2742 Ga0070700_100009949
2743 Ga0070694_100029953
2744 Ga0070708_100164311
2745 Ga0070663_100002743
2746 Ga0070663_100149367
2747 Ga0070678_100007142
2748 Ga0070678_100130462
2749 Ga0070662_100006832
2750 Ga0070662_100074667
2751 Ga0068867_100011024
2752 Ga0070685_10030634
2753 Ga0070679_100043670
2754 Ga0070679_100087105
2755 Ga0070684_100149525
2756 Ga0070697_100002319
2757 Ga0068853_100006365
2758 Ga0068853_100011416
2759 Ga0068853_100033238
2760 Ga0068853_100042340
2761 Ga0070686_100000175
2762 Ga0070686_100009379
2763 Ga0070695_100001902
2764 Ga0070695_100003227
2765 Ga0070696_100005973
2766 Ga0070696_100315359
2767 Ga0070693_100000527
2768 Ga0070693_100054562
2769 Ga0070693_100125349
2770 Ga0070665_100002086
2771 Ga0070665_100007051
2772 Ga0070665_100015259
2773 Ga0070665_100035091
2774 Ga0070665_100052825
2775 Ga0070665_100058389
2776 Ga0070665_100067282
2777 Ga0070665_100160239
2778 Ga0070704_100003817
2779 Ga0068855_100010084
2780 Ga0068855_100037000
2781 Ga0068855_100097741
2782 Ga0068855_100123235
2783 Ga0068855_100154117
2784 Ga0068855_100230726
2785 Ga0070664_100011523
2786 Ga0068857_100002111
2787 Ga0068857_100244163
2788 Ga0068854_100022865
2789 Ga0068854_100049011
2790 Ga0068854_100072675
2791 Ga0068854_100077792
2792 Ga0068854_100227419
2793 Ga0068854_100282419
2794 Ga0068856_100012739
2795 Ga0068856_100032737
2796 Ga0068856_100301729
2797 Ga0068856_100428139
2798 Ga0070702_100001296
2799 Ga0070702_100024869
2800 Ga0068852_100013171
2801 Ga0068852_100018126
2802 Ga0068852_100037637
2803 Ga0068852_100043421
2804 Ga0068859_100000303
2805 Ga0068859_100022477
2806 Ga0068864_100002024
2807 Ga0068864_100003487
2808 Ga0068864_100046732
2809 Ga0068861_100000068
2810 Ga0068861_100006058
2811 Ga0068861_100016621
2812 Ga0068863_100015068
2813 Ga0068863_100212413
2814 Ga0068858_100002445
2815 Ga0068858_100007331
2816 Ga0068860_100003525
2817 Ga0068860_100004219
2818 Ga0068862_100000222
2819 Ga0068862_100003748
2820 Ga0068862_100064655
2821 Ga0081455_10000085
2822 Ga0081455_10002838
2823 Ga0081455_10010430
2824 Ga0081455_10086461
2825 Ga0081455_10108216
2826 Ga0081455_10130514
2827 Ga0081538_10007329
2828 Ga0081540_1000566
2829 Ga0081540_1028435
2830 Ga0081539_10001521
2831 Ga0075365_10000068
2832 Ga0075365_10001419
2833 Ga0075365_10003339
2834 Ga0075365_10022375
2835 Ga0075365_10064544
2836 Ga0075368_10002310
2837 Ga0075368_10013155
2838 Ga0075368_10031988
2839 Ga0075363_100010518
2840 Ga0075363_100028520
2841 Ga0075363_100090054
2842 Ga0075363_100097361
2843 Ga0075364_10000023
2844 Ga0075364_10001246
2845 Ga0075364_10030904
2846 Ga0075364_10067536
2847 Ga0075432_10003110
2848 Ga0075432_10003786
2849 Ga0075432_10006500
2850 Ga0070715_10002097
2851 Ga0070716_100031664
2852 Ga0070712_100004491
2853 Ga0075362_10018143
2854 Ga0075362_10031839
2855 Ga0075367_10007206
2856 Ga0075367_10014330
2857 Ga0075367_10017282
2858 Ga0075367_10020097
2859 Ga0075367_10090870
2860 Ga0075367_10094307
2861 Ga0075367_10113637
2862 Ga0075369_10001599
2863 Ga0075369_10016859
2864 Ga0075369_10063135
2865 Ga0075366_10000495
2866 Ga0075366_10082884
2867 Ga0097621_100008926
2868 Ga0075370_10003151
2869 Ga0075370_10017904
2870 Ga0068871_100012799
2871 Ga0075428_100009932
2872 Ga0075428_100014282
2873 Ga0075428_100111329
2874 Ga0075428_100154978
2875 Ga0075428_100158062
2876 Ga0075430_100060765
2877 Ga0075430_100180111
2878 Ga0075431_100001296
2879 Ga0075431_100008939
2880 Ga0075431_100031890
2881 Ga0075431_100111026
2882 Ga0075431_100347781
2883 Ga0075433_10010455
2884 Ga0075433_10022732
2885 Ga0075434_100024485
2886 Ga0075434_100037816
2887 Ga0075434_100082433
2888 Ga0075429_100002571
2889 Ga0075429_100071754
2890 Ga0075429_100103025
2891 Ga0068865_100017949
2892 Ga0075436_100013064
2893 Ga0075436_100106952
2894 Ga0097620_100000303
2895 Ga0097620_100022477
2896 Ga0079104_1000242
2897 Ga0079104_1016712
2898 Ga0099826_10000841
2899 Ga0075435_100007536
2900 Ga0099795_10000032
2901 Ga0099795_10022242
2902 Ga0105251_10032150
2903 Ga0105244_10038974
2904 Ga0105244_10067730
2905 Ga0105250_10018806
2906 Ga0105240_10000028
2907 Ga0105240_10000076
2908 Ga0105240_10036562
2909 Ga0105240_10064551
2910 Ga0105240_10115849
2911 Ga0105240_10197548
2912 Ga0105240_10258727
2913 Ga0105240_10456874
2914 Ga0111539_10001004
2915 Ga0111539_10035026
2916 Ga0111539_10125173
2917 Ga0111539_10225320
2918 Ga0111539_10276310
2919 Ga0111539_10483727
2920 Ga0111539_10563679
2921 Ga0105245_10037358
2922 Ga0105247_10003685
2923 Ga0105247_10004179
2924 Ga0114129_10000717
2925 Ga0114129_10034862
2926 Ga0114129_10222103
2927 Ga0114129_10251576
2928 Ga0114129_10326787
2929 Ga0105243_10003392
2930 Ga0105243_10004327
2931 Ga0105243_10162824
2932 Ga0105242_10018125
2933 Ga0105248_10001946
2934 Ga0105237_10000226
2935 Ga0105237_10003921
2936 Ga0105237_10006872
2937 Ga0105237_10034855
2938 Ga0105237_10064529
2939 Ga0105237_10389291
2940 Ga0105238_10005446
2941 Ga0105238_10011069
2942 Ga0105238_10445648
2943 Ga0105249_10001500
2944 Ga0105249_10001582
2945 Ga0123341_1000007
2946 Ga0099796_10000020
2947 Ga0105239_10003384
2948 Ga0105239_10004650
2949 Ga0105239_10019613
2950 Ga0105239_10030720
2951 Ga0105239_10081150
2952 Ga0105239_10130574
2953 Ga0105239_10336056
2954 Ga0105246_10004363
2955 Ga0157373_10011394
2956 Ga0157373_10109444
2957 Ga0157371_10000017
2958 Ga0157371_10000739
2959 Ga0157371_10003248
2960 Ga0157371_10006289
2961 Ga0157370_10000494
2962 Ga0157370_10001902
2963 Ga0157370_10004750
2964 Ga0157370_10034314
2965 Ga0157370_10063008
2966 Ga0157370_10069140
2967 Ga0157370_10248826
2968 Ga0157370_10416910
2969 Ga0157369_10039677
2970 Ga0157369_10116856
2971 Ga0157369_10120642
2972 Ga0157369_10236145
2973 Ga0171463_1003
2974 Ga0157374_10028786
2975 Ga0157374_10072533
2976 Ga0157378_10007872
2977 Ga0157378_10089784
2978 Ga0163162_10002906
2979 Ga0163162_10008951
2980 Ga0163162_10048385
2981 Ga0157372_10028979
2982 Ga0157372_10032223
2983 Ga0157372_10032521
2984 Ga0157375_10041224
2985 Ga0157375_10284075
2986 Ga0157375_10356042
2987 Ga0163163_10029879
2988 Ga0163163_10057034
2989 Ga0163163_10083456
2990 Ga0163163_10150353
2991 Ga0163163_10340327
2992 Ga0157380_10006541
2993 Ga0157380_10261899
2994 Ga0182008_10038707
2995 Ga0157377_10008238
2996 Ga0157379_10013267
2997 Ga0157379_10019661
2998 Ga0157379_10055415
2999 Ga0157376_10002750
3000 Ga0157376_10266996
3001 Ga0182006_1000385
3002 Ga0182006_1026757
3003 Ga0182007_10000286
3004 Ga0182007_10002059
3005 Ga0182005_1003541
3006 Ga0182005_1026178
3007 Ga0183363_1085
3008 Ga0163161_10002366
3009 Ga0163161_10015581
3010 Ga0163161_10034859
3011 Ga0163161_10079586
3012 Ga0163161_10091175
3013 Ga0206356_11203268
3014 Ga0214544_1003096
3015 Ga0214542_1000012
3016 Ga0214542_1013089
3017 Ga0214543_1000024
3018 Ga0214543_1000038
3019 Ga0213876_10001237
3020 Ga0213875_10000067
3021 Ga0228711_1010496
3022 Ga0228710_1010751
3023 Ga0209435_100012
3024 Ga0209760_100109
3025 Ga0209436_100147
3026 Ga0209436_103527
3027 Ga0209436_109845
3028 Ga0207427_100114
3029 Ga0207427_100636
3030 Ga0209437_100051
3031 Ga0209437_100098
3032 Ga0209437_100219
3033 Ga0209437_106862
3034 Ga0207425_1000075
3035 Ga0207425_1001868
3036 Ga0209646_1000026
3037 Ga0209026_1000014
3038 Ga0209026_1000023
3039 Ga0209026_1000029
3040 Ga0209677_101213
3041 Ga0209148_1000080
3042 Ga0209148_1003734
3043 Ga0209759_1000012
3044 Ga0209759_1000167
3045 Ga0209759_1000393
3046 Ga0209129_1000156
3047 Ga0209129_1000218
3048 Ga0209129_1000537
3049 Ga0209129_1000876
3050 Ga0209129_1008635
3051 Ga0209233_1000012
3052 Ga0209233_1000028
3053 Ga0209233_1000095
3054 Ga0209233_1000113
3055 Ga0209233_1000148
3056 Ga0209233_1000631
3057 Ga0209455_1000171
3058 Ga0209673_1000010
3059 Ga0209673_1000117
3060 Ga0209673_1000151
3061 Ga0209673_1001898
3062 Ga0209130_1000003
3063 Ga0209130_1000020
3064 Ga0209130_1000034
3065 Ga0209130_1000150
3066 Ga0209130_1000906
3067 Ga0209675_1000529
3068 Ga0209676_1001566
3069 Ga0209676_1004814
3070 Ga0209676_1011005
3071 Ga0209025_1000010
3072 Ga0209025_1000070
3073 Ga0209025_1000099
3074 Ga0209025_1000140
3075 Ga0209025_1000213
3076 Ga0209025_1000311
3077 Ga0209025_1000571
3078 Ga0209025_1001887
3079 Ga0209025_1003502
3080 Ga0209025_1009690
3081 Ga0209025_1019714
3082 Ga0209025_1038252
3083 Ga0209025_1056162
3084 Ga0209564_1000013
3085 Ga0209564_1000048
3086 Ga0209564_1000386
3087 Ga0209564_1000424
3088 Ga0209564_1003849
3089 Ga0209564_1008813
3090 Ga0209758_1000094
3091 Ga0209758_1000405
3092 Ga0209758_1000413
3093 Ga0209758_1001271
3094 Ga0209758_1004514
3095 Ga0209758_1008701
3096 Ga0209758_1009338
3097 Ga0209758_1009734
3098 Ga0209050_1000734
3099 Ga0209050_1006356
3100 Ga0209256_1000041
3101 Ga0209256_1000396
3102 Ga0209256_1000610
3103 Ga0209256_1000717
3104 Ga0209256_1000729
3105 Ga0209256_1002535
3106 Ga0209256_1003746
3107 Ga0209256_1003980
3108 Ga0207426_1000006
3109 Ga0207426_1000008
3110 Ga0207426_1000011
3111 Ga0207426_1000065
3112 Ga0207426_1000394
3113 Ga0207426_1000449
3114 Ga0209051_1000097
3115 Ga0209051_1000314
3116 Ga0209051_1003938
3117 Ga0209051_1026414
3118 Ga0209257_1000302
3119 Ga0209257_1003955
3120 Ga0209257_1006318
3121 Ga0209257_1025324
3122 Ga0209257_1038013
3123 Ga0207697_10001617
3124 Ga0207655_1010754
3125 Ga0207655_1046058
3126 Ga0207713_1013193
3127 Ga0207713_1017718
3128 Ga0207692_10043940
3129 Ga0207710_10000638
3130 Ga0207710_10001624
3131 Ga0207680_10000023
3132 Ga0207680_10044146
3133 Ga0207647_10008196
3134 Ga0207647_10059910
3135 Ga0207685_10004327
3136 Ga0207699_10012588
3137 Ga0207699_10033136
3138 Ga0207645_10171585
3139 Ga0207705_10003682
3140 Ga0207705_10031308
3141 Ga0207705_10038810
3142 Ga0207705_10084083
3143 Ga0207695_10000011
3144 Ga0207695_10000088
3145 Ga0207695_10015356
3146 Ga0207695_10148683
3147 Ga0207695_10278669
3148 Ga0207671_10000093
3149 Ga0207671_10000368
3150 Ga0207671_10024233
3151 Ga0207671_10170518
3152 Ga0207693_10002851
3153 Ga0207663_10030938
3154 Ga0207660_10016785
3155 Ga0207660_10232795
3156 Ga0207662_10002364
3157 Ga0207657_10001218
3158 Ga0207657_10004999
3159 Ga0207657_10008223
3160 Ga0207657_10057585
3161 Ga0207649_10012372
3162 Ga0207649_10016880
3163 Ga0207649_10067350
3164 Ga0207649_10073961
3165 Ga0207649_10143927
3166 Ga0207652_10057622
3167 Ga0207652_10302574
3168 Ga0207646_10279254
3169 Ga0207681_10000004
3170 Ga0207681_10014839
3171 Ga0207681_10036835
3172 Ga0207694_10040372
3173 Ga0207694_10098828
3174 Ga0207694_10308791
3175 Ga0207650_10002272
3176 Ga0207650_10008291
3177 Ga0207650_10013146
3178 Ga0207650_10042106
3179 Ga0207659_10006123
3180 Ga0207687_10007687
3181 Ga0207700_10139893
3182 Ga0207700_10173452
3183 Ga0207664_10046042
3184 Ga0207664_10154515
3185 Ga0207644_10000009
3186 Ga0207644_10010500
3187 Ga0207644_10065896
3188 Ga0207690_10011287
3189 Ga0207690_10046314
3190 Ga0207706_10002603
3191 Ga0207706_10047395
3192 Ga0207686_10243665
3193 Ga0207709_10027572
3194 Ga0207670_10003291
3195 Ga0207669_10013036
3196 Ga0207704_10010142
3197 Ga0207704_10164837
3198 Ga0207665_10003784
3199 Ga0207691_10003385
3200 Ga0207691_10140542
3201 Ga0207711_10084358
3202 Ga0207711_10135510
3203 Ga0207661_10039077
3204 Ga0207661_10351606
3205 Ga0207679_10030316
3206 Ga0207679_10085495
3207 Ga0207679_10211714
3208 Ga0207667_10007864
3209 Ga0207667_10051811
3210 Ga0207667_10062660
3211 Ga0207667_10117255
3212 Ga0207667_10197550
3213 Ga0207651_10007136
3214 Ga0207651_10257102
3215 Ga0207712_10011208
3216 Ga0207712_10037841
3217 Ga0207712_10218850
3218 Ga0207668_10000169
3219 Ga0207668_10032057
3220 Ga0207668_10048245
3221 Ga0207668_10074744
3222 Ga0207668_10098224
3223 Ga0207640_10016981
3224 Ga0207640_10049307
3225 Ga0207640_10088697
3226 Ga0207640_10128462
3227 Ga0207640_10318481
3228 Ga0207658_10020412
3229 Ga0207658_10045699
3230 Ga0207677_10126961
3231 Ga0207703_10007713
3232 Ga0207639_10001916
3233 Ga0207639_10025379
3234 Ga0207639_10040856
3235 Ga0207678_10001222
3236 Ga0207678_10066022
3237 Ga0207678_10183948
3238 Ga0207708_10000385
3239 Ga0207708_10003153
3240 Ga0207702_10013749
3241 Ga0207702_10182589
3242 Ga0207702_10274838
3243 Ga0207702_10446373
3244 Ga0207641_10005070
3245 Ga0207641_10020177
3246 Ga0207648_10009094
3247 Ga0207676_10001820
3248 Ga0207676_10039025
3249 Ga0207674_10001584
3250 Ga0207674_10021080
3251 Ga0207674_10135331
3252 Ga0207675_100000060
3253 Ga0207675_100007201
3254 Ga0207675_100175378
3255 Ga0207683_10001503
3256 Ga0207698_10009822
3257 Ga0207698_10042092
3258 Ga0207698_10068687
3259 Ga0207698_10240238
3260 Ga0207698_10476863
3261 Ga0209281_1000245
3262 Ga0209281_1000246
3263 Ga0209281_1001017
3264 Ga0209371_1000022
3265 Ga0209371_1000173
3266 Ga0209371_1001156
3267 Ga0209179_1000063
3268 Ga0209282_1000563
3269 Ga0209282_1001720
3270 Ga0209813_10005557
3271 Ga0209813_10011809
3272 Ga0209974_10020284
3273 Ga0207428_10001431
3274 Ga0207428_10027225
3275 Ga0207428_10048219
3276 Ga0207428_10067766
3277 Ga0207428_10103303
3278 Ga0268266_10000243
3279 Ga0268266_10002745
3280 Ga0268266_10030921
3281 Ga0268266_10077476
3282 Ga0268266_10272384
3283 Ga0268265_10000576
3284 Ga0268265_10022524
3285 Ga0268264_10000069
3286 Ga0268264_10006449
3287 Ga0265318_10005250
3288 Ga0307517_10044289
3289 Ga0307515_10003171
3290 Ga0307515_10006338
3291 Ga0307515_10020078
3292 Ga0307515_10174514
3293 Ga0268256_1000019
3294 Ga0307511_10092817
3295 Ga0265330_10006061
3296 Ga0265330_10045499
3297 Ga0265330_10055314
3298 Ga0265328_10006323
3299 Ga0265325_10002139
3300 Ga0265325_10027473
3301 Ga0265339_10004708
3302 Ga0265339_10011145
3303 Ga0265327_10005132
3304 Ga0265316_10048512
3305 Ga0307513_10003757
3306 Ga0307513_10012121
3307 Ga0307513_10149430
3308 Ga0307509_10106888
3309 Ga0307408_100320037
3310 Ga0265313_10000063
3311 Ga0307508_10032271
3312 Ga0316579_10000602
3313 Ga0316579_10003046
3314 Ga0265314_10015400
3315 Ga0316576_10100109
3316 Ga0316578_10034359
3317 Ga0316578_10096736
3318 Ga0307516_10001719
3319 Ga0307516_10225238
3320 Ga0307516_10243886
3321 Ga0307405_10001594
3322 Ga0307405_10060473
3323 Ga0307405_10069996
3324 Ga0307410_10004095
3325 Ga0307406_10037380
3326 Ga0307407_10147924
3327 Ga0307412_10014053
3328 Ga0315914_1000015
3329 Ga0307414_10001368
3330 Ga0307414_10051845
3331 Ga0307411_10053700
3332 Ga0316593_10046937
3333 Ga0315913_1008719
3334 Ga0315915_1000020
3335 Ga0373940_0013654
3336 Ga0373949_0029193
3337 Ga0373939_0007086
3338 Ga0373939_0035535
3339 Ga0373941_0005225
3340 Ga0373941_0055694
3341 Ga0373960_0007893
3342 Ga0373961_0007824
3343 Ga0373962_0002300
3344 Ga0373962_0003880
3345 Ga0316574_0055341
3346 Ga0316574_0137414
3347 Ga0373931_0004634
3348 Ga0373931_0010811
3349 Ga0373931_0032593
3350 Ga0373931_0051497
3351 Ga0373931_0096025
3352 Ga0373927_0000058
3353 Ga0373937_0218965
3354 Ga0316582_0006740
3355 Ga0316584_0036814
3356 Ga0373925_0005785
3357 Ga0395899_0000044
3358 Ga0395899_0099170
3359 Ga0395900_0000042
3360 Ga0395900_0013297
3361 Ga0395900_0018704
3362 Ga0395900_0105539
3363 Ga0395898_0000080
3364 Ga0395898_0096236
3365 Ga0395898_0101483
3366 Ga0395905_0000044
3367 Ga0395905_0001069
3368 Ga0395905_0012064
3369 Ga0395905_0035395
3370 Ga0395905_0036925
3371 Ga0395905_0056748
3372 Ga0395905_0059709
3373 Ga0436364_0410392
3374 Ga0395901_0000027
3375 Ga0395901_0024093
3376 Ga0395901_0064567
3377 Ga0395901_0098115
3378 Ga0400488_24627
3379 Ga0242420_009488
3380 Ga0400483_005361
3381 Ga0400483_134363
3382 Ga0400483_143286
3383 Ga0400483_156554
3384 Ga0400483_168664
3385 Ga0400483_181996
3386 Ga0400483_215517
3387 Ga0400483_220054
3388 Ga0400483_242580
3389 Ga0400483_253791
3390 Ga0400483_269816
3391 Ga0436365_1382071
3392 Ga0436365_1909219
3393 Ga0436360_1174268
3394 Ga0436363_0826910
3395 Ga0436362_0327940
3396 Ga0439436_0009616
3397 Ga0439436_0021462
3398 Ga0439438_000091
3399 Ga0439438_003966
3400 Ga0439447_000016
3401 Ga0439447_000270
3402 Ga0439447_002713
3403 Ga0439447_006042
3404 Ga0439466_0000324
3405 Ga0439466_0012748
3406 Ga0439466_0016319
3407 Ga0439466_0041354
3408 Ga0439466_0052910
3409 Ga0439465_0000523
3410 Ga0439465_0000778
3411 Ga0439465_0006978
3412 Ga0451787_281779
3413 Ga0451793_0055025
3414 Ga0451807_0079335
3415 Ga0451839_0382298
3416 Ga0451849_0157453
3417 Ga0451850_10280
3418 Ga0451855_0035652
3419 Ga0451855_1331344
3420 Ga0451853_1792368
3421 Ga0439431_0026962
3422 Ga0439445_0001308
3423 Ga0439432_047291
3424 Ga0439449_0000439
3425 Ga0439449_0013003
3426 Ga0439451_001654
3427 Ga0439451_002285
3428 Ga0439451_007893
3429 Ga0439452_000046
3430 Ga0439452_000163
3431 Ga0439452_001028
3432 Ga0439452_001433
3433 Ga0439455_0009370
3434 Ga0439456_002428
3435 Ga0439456_010957
3436 Ga0439456_016546
3437 Ga0439463_004915
3438 Ga0450911_001620
3439 Ga0450919_001004
3440 Ga0450920_001322
3441 Ga0450922_000043
3442 Ga0450922_001535
3443 Ga0450923_001626
3444 Ga0450902_001152
3445 Ga0450902_005509
3446 Ga0450903_000582
3447 Ga0450903_002468
3448 Ga0450903_011334
3449 Ga0450906_000456
3450 Ga0450907_000003
3451 Ga0450907_000973
3452 Ga0450907_002050
3453 Ga0450907_013692
3454 Ga0450910_001936
3455 Ga0439446_0005478
3456 Ga0450908_004701
3457 Ga0450909_000170
3458 Ga0439434_0000019
3459 Ga0439434_0025096
3460 Ga0439464_0005830
3461 Ga0439460_0000388
3462 Ga0439460_0002987
3463 Ga0450916_000364
3464 Ga0450918_002089
3465 Ga0451577_0331336
3466 Ga0439440_0000508
3467 Ga0439440_0001836
3468 Ga0466972_0050729
3469 Ga0453684_0000136
3470 Ga0453684_0117281
3471 Ga0466970_0051098
3472 Ga0466960_0144294
3473 Ga0451576_0000025
3474 Ga0451576_0023381
3475 Ga0451576_0541263
3476 Ga0495617_000282
3477 Ga0495617_000613
3478 Ga0495617_003080
3479 Ga0495617_008507
3480 Ga0495617_045186
3481 Ga0495627_000010
3482 Ga0495627_003377
3483 Ga0495627_003483
3484 Ga0495627_013990
3485 Ga0495627_017194
3486 Ga0495603_0000535
3487 Ga0495603_0002140
3488 Ga0495590_0000040
3489 Ga0495590_0003390
3490 Ga0495590_0004520
3491 Ga0495590_0005815
3492 Ga0495590_0022600
3493 Ga0495590_0047473
3494 Ga0495591_000016
3495 Ga0495591_000143
3496 Ga0495591_000736
3497 Ga0495591_004102
3498 Ga0495591_004844
3499 Ga0495591_010620
3500 Ga0495591_016244
3501 Ga0495591_020149
3502 Ga0495629_0066124
3503 Ga0495629_0110708
3504 Ga0495638_0000381
3505 Ga0495638_0000906
3506 Ga0495638_0001340
3507 Ga0495638_0001770
3508 Ga0495638_0002038
3509 Ga0495638_0002185
3510 Ga0495638_0002734
3511 Ga0495638_0003287
3512 Ga0495638_0008823
3513 Ga0495638_0010217
3514 Ga0495638_0014796
3515 Ga0495638_0020752
3516 Ga0495638_0044542
3517 Ga0495638_0053148
3518 Ga0495638_0104069
3519 Ga0495650_0001536
3520 Ga0495650_0001586
3521 Ga0495650_0002125
3522 Ga0495650_0003945
3523 Ga0495650_0011227
3524 Ga0495650_0011776
3525 Ga0495582_0005973
3526 Ga0495605_0000013
3527 Ga0495605_0000244
3528 Ga0495605_0000321
3529 Ga0495605_0000751
3530 Ga0495605_0001173
3531 Ga0495605_0003344
3532 Ga0495605_0006620
3533 Ga0495605_0017540
3534 Ga0495605_0018221
3535 Ga0495605_0018907
3536 Ga0495639_0000037
3537 Ga0495639_0000553
3538 Ga0495639_0021054
3539 Ga0495584_0000019
3540 Ga0495584_0000086
3541 Ga0495584_0001430
3542 Ga0495584_0005615
3543 Ga0495584_0009593
3544 Ga0495584_0020550
3545 Ga0495584_0022419
3546 Ga0495584_0031838
3547 Ga0495584_0036443
3548 Ga0495584_0046865
3549 Ga0495584_0075776
3550 Ga0495585_0000012
3551 Ga0495585_0004015
3552 Ga0495585_0005603
3553 Ga0495585_0024800
3554 Ga0495585_0041609
3555 Ga0495594_0010177
3556 Ga0495594_0012773
3557 Ga0495594_0017998
3558 Ga0495594_0037722
3559 Ga0495596_0000050
3560 Ga0495607_0000031
3561 Ga0495607_0000637
3562 Ga0495607_0001848
3563 Ga0495607_0002549
3564 Ga0495607_0005774
3565 Ga0495607_0006918
3566 Ga0495607_0008933
3567 Ga0495607_0013112
3568 Ga0495607_0024437
3569 Ga0495607_0094305
3570 Ga0495607_0111238
3571 Ga0495583_0000042
3572 Ga0495583_0000112
3573 Ga0495583_0001014
3574 Ga0495583_0008546
3575 Ga0495583_0020181
3576 Ga0495606_0001735
3577 Ga0495606_0005023
3578 Ga0495606_0011380
3579 Ga0495610_0002479
3580 Ga0495610_0004038
3581 Ga0495610_0005663
3582 Ga0495610_0010968
3583 Ga0495610_0015724
3584 Ga0495610_0018507
3585 Ga0495610_0020528
3586 Ga0495610_0021223
3587 Ga0495610_0026983
3588 Ga0495616_0000245
3589 Ga0495616_0004681
3590 Ga0495616_0018190
3591 Ga0495616_0063293
3592 Ga0495616_0093068
3593 Ga0495620_0000005
3594 Ga0495620_0001456
3595 Ga0495620_0018086
3596 Ga0495620_0022288
3597 Ga0495620_0025085
3598 Ga0495628_0148606
3599 Ga0495630_0005993
3600 Ga0495630_0032806
3601 Ga0495630_0033080
3602 Ga0495631_0000327
3603 Ga0495631_0000336
3604 Ga0495631_0004032
3605 Ga0495631_0006054
3606 Ga0495631_0007632
3607 Ga0495631_0010474
3608 Ga0495631_0039079
3609 Ga0495632_0000058
3610 Ga0495632_0001123
3611 Ga0495632_0001410
3612 Ga0495632_0002362
3613 Ga0495632_0006229
3614 Ga0495632_0013850
3615 Ga0495632_0038353
3616 Ga0495632_0038372
3617 Ga0495632_0050064
3618 Ga0495632_0052582
3619 Ga0495632_0062245
3620 Ga0495637_0000315
3621 Ga0495637_0000493
3622 Ga0495637_0000968
3623 Ga0495637_0002855
3624 Ga0495637_0004378
3625 Ga0495637_0005273
3626 Ga0495637_0013823
3627 Ga0495637_0014825
3628 Ga0495637_0016577
3629 Ga0495637_0019639
3630 Ga0495637_0048913
3631 Ga0495643_0004441
3632 Ga0495643_0004788
3633 Ga0495643_0006068
3634 Ga0495643_0011294
3635 Ga0495643_0023187
3636 Ga0495644_0000031
3637 Ga0495644_0000217
3638 Ga0495644_0002110
3639 Ga0495644_0006236
3640 Ga0495644_0008000
3641 Ga0495648_0000884
3642 Ga0495648_0001115
3643 Ga0495648_0004068
3644 Ga0495648_0010455
3645 Ga0495648_0011307
3646 Ga0495648_0016268
3647 Ga0495648_0017141
3648 Ga0495648_0018407
3649 Ga0495648_0025638
3650 Ga0495648_0034981
3651 Ga0495648_0073026
3652 Ga0495648_0118228
3653 Ga0495663_0000180
3654 Ga0495666_0000430
3655 Ga0495666_0000574
3656 Ga0495666_0031956
3657 Ga0495666_0072715
3658 Ga0495642_0000003
3659 Ga0495642_0000165
3660 Ga0495642_0001529
3661 Ga0495654_0000253
3662 Ga0495654_0000914
3663 Ga0495654_0001303
3664 Ga0495654_0005244
3665 Ga0495654_0005849
3666 Ga0495654_0007176
3667 Ga0495654_0008468
3668 Ga0495654_0017228
3669 Ga0495654_0018606
3670 Ga0495654_0040263
3671 Ga0495654_0050553
3672 Ga0495587_0001215
3673 Ga0495587_0002012
3674 Ga0495609_0000193
3675 Ga0495609_0000517
3676 Ga0495609_0001638
3677 Ga0495609_0004786
3678 Ga0495597_0000012
3679 Ga0495597_0001398
3680 Ga0495597_0002798
3681 Ga0495597_0004197
3682 Ga0495597_0008762
3683 Ga0495597_0029401
3684 Ga0495597_0040352
3685 Ga0495597_0042732
3686 Ga0495622_0000202
3687 Ga0495622_0000446
3688 Ga0495622_0066242
3689 Ga0495633_0000013
3690 Ga0495633_0002527
3691 Ga0495633_0076000
3692 Ga0495633_0084553
3693 Ga0495656_0004408
3694 Ga0495656_0026320
3695 Ga0495668_0000424
3696 Ga0495634_0000154
3697 Ga0495611_0002162
3698 Ga0495611_0002456
3699 Ga0495611_0002693
3700 Ga0495625_0002559
3701 Ga0495625_0002784
3702 Ga0495625_0002896
3703 Ga0495625_0010204
3704 Ga0495625_0010569
3705 Ga0495625_0037088
3706 Ga0495625_0039201
3707 Ga0495625_0044542
3708 Ga0495625_0046809
3709 Ga0495625_0112011
3710 Ga0495625_0151765
3711 Ga0495625_0162358
3712 Ga0495635_0000051
3713 Ga0495635_0055550
3714 Ga0495659_0000061
3715 Ga0495659_0000978
3716 Ga0495661_0000128
3717 Ga0495661_0003829
3718 Ga0495661_0004366
3719 Ga0495661_0065155
3720 Ga0495661_0068625
3721 Ga0495588_0003387
3722 Ga0495588_0012092
3723 Ga0495623_0002213
3724 Ga0495623_0005942
3725 Ga0495669_0000263
3726 Ga0495669_0045973
3727 Ga0495613_0002488
3728 Ga0495670_0000103
3729 Ga0495670_0000179
3730 Ga0495670_0000800
3731 Ga0495670_0002654
3732 Ga0495670_0005587
3733 Ga0495670_0055726
3734 Ga0495670_0058202
3735 Ga0495670_0085888
3736 Ga0495671_0000138
3737 Ga0495671_0007182
3738 Ga0495671_0009774
3739 Ga0495671_0010690
3740 Ga0495671_0014547
3741 Ga0495671_0019479
3742 Ga0495671_0022019
3743 Ga0495671_0022611
3744 Ga0495671_0032108
3745 Ga0495671_0051021
3746 Ga0495671_0054409
3747 Ga0495671_0069211
3748 Ga0495649_0000086
3749 Ga0495649_0000393
3750 Ga0495649_0002906
3751 Ga0495649_0005630
3752 Ga0495649_0018585
3753 Ga0495649_0045133
3754 Ga0495649_0064046
3755 Ga0495649_0119454
3756 Ga0495589_0000242
3757 Ga0495589_0000583
3758 Ga0495589_0000636
3759 Ga0495589_0000758
3760 Ga0495589_0008285
3761 Ga0495589_0010820
3762 Ga0495589_0029141
3763 Ga0495589_0069497
3764 Ga0495600_0070338
3765 Ga0495660_0001195
3766 Ga0495660_0002240
3767 Ga0495660_0003894
3768 Ga0495660_0007879
3769 Ga0495660_0035887
3770 Ga0495660_0044405
3771 Ga0495660_0056933
3772 Ga0495660_0073953
3773 Ga0495581_0000262
3774 Ga0495581_0056514
3775 Ga0495604_0003245
3776 Ga0495604_0021285
3777 Ga0495604_0086447
3778 Ga0495636_0001197
3779 Ga0495672_0001126
3780 Ga0495672_0002647
3781 Ga0495672_0010412
3782 Ga0495672_0010744
3783 Ga0495672_0011293
3784 Ga0495672_0013220
3785 Ga0495672_0013711
3786 Ga0495672_0016563
3787 Ga0495672_0018174
3788 Ga0495680_0005209
3789 Ga0495683_0000002
3790 Ga0495683_0000010
3791 Ga0495683_0000116
3792 Ga0495683_0001491
3793 Ga0495683_0003259
3794 Ga0495683_0007271
3795 Ga0495683_0009520
3796 Ga0495683_0024934
3797 Ga0495683_0040402
3798 Ga0495683_0041920
3799 Ga0495687_000906
3800 Ga0495687_001073
3801 Ga0495687_004002
3802 Ga0495687_012942
3803 Ga0495687_022347
3804 Ga0495675_0002774
3805 Ga0495677_0000047
3806 Ga0495679_000073
3807 Ga0495679_001421
3808 Ga0495679_002923
3809 Ga0495679_004986
3810 Ga0495673_0000077
3811 Ga0495673_0000242
3812 Ga0495673_0000426
3813 Ga0495673_0001672
3814 Ga0495673_0002266
3815 Ga0495673_0002390
3816 Ga0495673_0003183
3817 Ga0495673_0003934
3818 Ga0495673_0004107
3819 Ga0495673_0006926
3820 Ga0495673_0014495
3821 Ga0495673_0040914
3822 Ga0495673_0056600
3823 Ga0495681_0000232
3824 Ga0495681_0001247
3825 Ga0495681_0001288
3826 Ga0495681_0002295
3827 Ga0495681_0002859
3828 Ga0495681_0002891
3829 Ga0495681_0005771
3830 Ga0495681_0008830
3831 Ga0495681_0010168
3832 Ga0495681_0016446
3833 Ga0495681_0028607
3834 Ga0495681_0052971
3835 Ga0495681_0101191
3836 Ga0495686_0000556
3837 Ga0495686_0001770
3838 Ga0495686_0004878
3839 Ga0495686_0021918
3840 Ga0495686_0038906
3841 Ga0495593_0002572
3842 Ga0495593_0011099
3843 Ga0495593_0012587
3844 Ga0495593_0020449
3845 Ga0495593_0046087
3846 Ga0495614_0063673
3847 Ga0495626_0000169
3848 Ga0495626_0000198
3849 Ga0495626_0000280
3850 Ga0495626_0000345
3851 Ga0495626_0000490
3852 Ga0495626_0000531
3853 Ga0496100_0017768
3854 Ga0496101_0028888
3855 Ga0496101_0108564
3856 Ga0496101_0213915
3857 Ga0496102_0000311
3858 Ga0496102_0024513
3859 Ga0496102_0034559
3860 Ga0496102_0062555
3861 Ga0496102_0119525
3862 Ga0496102_0212709
3863 Ga0496102_0237333
3864 Ga0496103_0000272
3865 Ga0496103_0009977
3866 Ga0496103_0023618
3867 Ga0496104_0002045
3868 Ga0496104_0005566
3869 Ga0496104_0015640
3870 Ga0496104_0027111
3871 Ga0496104_0071945
3872 Ga0496104_0231979
3873 Ga0496104_0318481
3874 Ga0496105_0015796
3875 Ga0496105_0050619
3876 Ga0496105_0066696
3877 Ga0496106_0002702
3878 Ga0496106_0027233
3879 Ga0496106_0034270
3880 Ga0496106_0137564
3881 Ga0496107_0042341
3882 Ga0496107_0052099
3883 Ga0496108_0004332
3884 Ga0496108_0049723
3885 Ga0496108_0070518
3886 Ga0496108_0149952
3887 Ga0496109_0007632
3888 Ga0496109_0022579
3889 Ga0496109_0077736
3890 Ga0496109_0242504
3891 Ga0496110_0000722
3892 Ga0496110_0027042
3893 Ga0496110_0045612
3894 Ga0496110_0063470
3895 Ga0496110_0146085
3896 Ga0496110_0228657
3897 Ga0496111_0013061
3898 Ga0496111_0040756
3899 Ga0496111_0042657
3900 Ga0496111_0060316
3901 Ga0496112_0005045
3902 Ga0496112_0008175
3903 Ga0496112_0061426
3904 Ga0496112_0103931
3905 Ga0496112_0231047
3906 Ga0496113_0000237
3907 Ga0496113_0007215
3908 Ga0496113_0011759
3909 Ga0496113_0021250
3910 Ga0496113_0047481
3911 Ga0496113_0169987
3912 Ga0496114_0009944
3913 Ga0496114_0178233
3914 Ga0496115_0031772
3915 Ga0496115_0047280
3916 Ga0496116_0000142
3917 Ga0496116_0005592
3918 Ga0496116_0012847
3919 Ga0496116_0058507
3920 Ga0496117_0000002
3921 Ga0496117_0001668
3922 Ga0496117_0002159
3923 Ga0496117_0002597
3924 Ga0496117_0004903
3925 Ga0496117_0034162
3926 Ga0496117_0052729
3927 Ga0496117_0070318
3928 Ga0496118_0000087
3929 Ga0496118_0003066
3930 Ga0496118_0008151
3931 Ga0496118_0027810
3932 Ga0496119_0012549
3933 Ga0496119_0043061
3934 Ga0496119_0044559
3935 Ga0496119_0063251
3936 Ga0496119_0093667
3937 Ga0496120_0000413
3938 Ga0496120_0002399
3939 Ga0496120_0004176
3940 Ga0496120_0031474
3941 Ga0496121_0000003
3942 Ga0496121_0003720
3943 Ga0496121_0014041
3944 Ga0496122_0000004
3945 Ga0496122_0000215
3946 Ga0496122_0000840
3947 Ga0496122_0001103
3948 Ga0496122_0017685
3949 Ga0496122_0018671
3950 Ga0496122_0031306
3951 Ga0496122_0054501
3952 Ga0496122_0143343
3953 Ga0496123_0000007
3954 Ga0496123_0000306
3955 Ga0496123_0000336
3956 Ga0496123_0007538
3957 Ga0496123_0016914
3958 Ga0496123_0038132
3959 Ga0496123_0047092
3960 Ga0496123_0057637
3961 Ga0496124_0000252
3962 Ga0496124_0002136
3963 Ga0496124_0002555
3964 Ga0496124_0009734
3965 Ga0496124_0038651
3966 Ga0496124_0082442
3967 Ga0496124_0120816
3968 Ga0496124_0123127
3969 Ga0496124_0216891
3970 Ga0496125_0000039
3971 Ga0496125_0000115
3972 Ga0496125_0000248
3973 Ga0496125_0004709
3974 Ga0496125_0005054
3975 Ga0496125_0006807
3976 Ga0496125_0012178
3977 Ga0496125_0040662
3978 Ga0496125_0156958
3979 Ga0496125_0167150
3980 Ga0496126_0004507
3981 Ga0496126_0089490
3982 Ga0496126_0152247
3983 Ga0495678_000005
3984 Ga0495678_000437
3985 Ga0495678_002064
3986 Ga0495678_004456
3987 Ga0495678_005290
3988 Ga0495678_008281
3989 Ga0495678_013283
3990 Ga0495678_040918
3991 Ga0495682_0005670
3992 Ga0495682_0007712
3993 Ga0495682_0013439
3994 Ga0495682_0029551
3995 Ga0501031_0000024
3996 Ga0501031_0004592
3997 Ga0501031_0014364
3998 Ga0501031_0026503
3999 Ga0501031_0060373
4000 Ga0501032_0000007
4001 Ga0501032_0000067
4002 Ga0501032_0001002
4003 Ga0501032_0006627
4004 Ga0501032_0041213
4005 Ga0501032_0155955
4006 Ga0501033_0000051
4007 Ga0501033_0000117
4008 Ga0501033_0000349
4009 Ga0501033_0004757
4010 Ga0501033_0093682
4011 Ga0501033_0094349
4012 Ga0501033_0142634
4013 Ga0501033_0199016
4014 Ga0501033_0221602
4015 Ga0501034_0000029
4016 Ga0501034_0000153
4017 Ga0501034_0000464
4018 Ga0501034_0000732
4019 Ga0501034_0000856
4020 Ga0501034_0008570
4021 Ga0501034_0027155
4022 Ga0501034_0039601
4023 Ga0501034_0045866
4024 Ga0501034_0148126
4025 Ga0501034_0158948
4026 Ga0501034_0281830
4027 Ga0501034_0303541
4028 Ga0501034_0346230
4029 Ga0501034_0452520
4030 Ga0501036_0000004
4031 Ga0501036_0000928
4032 Ga0501036_0012091
4033 Ga0501036_0013985
4034 Ga0501036_0037538
4035 Ga0501037_0000004
4036 Ga0501037_0000007
4037 Ga0501037_0000081
4038 Ga0501037_0043652
4039 Ga0501037_0214610
4040 Ga0501037_0229568
4041 Ga0501038_0000005
4042 Ga0501038_0000033
4043 Ga0501038_0000520
4044 Ga0501038_0019048
4045 Ga0501038_0030498
4046 Ga0501038_0051192
4047 Ga0501038_0094900
4048 Ga0501038_0437373
4049 Ga0501039_0000009
4050 Ga0501039_0000031
4051 Ga0501039_0014960
4052 Ga0501039_0015253
4053 Ga0501039_0044932
4054 Ga0501039_0159140
4055 Ga0501040_0009968
4056 Ga0501040_0023407
4057 Ga0501040_0036626
4058 Ga0501040_0042264
4059 Ga0501041_0006543
4060 Ga0501041_0012239
4061 Ga0501041_0081398
4062 Ga0501041_0160012
4063 Ga0501042_0019465
4064 Ga0501042_0025815
4065 Ga0501042_0038541
4066 Ga0501042_0044684
4067 Ga0501043_0000034
4068 Ga0501043_0000044
4069 Ga0501043_0001790
4070 Ga0501043_0035499
4071 Ga0501043_0048558
4072 Ga0501043_0085182
4073 Ga0501043_0115629
4074 Ga0501046_0011042
4075 Ga0501046_0035913
4076 Ga0501046_0041626
4077 Ga0501046_0052392
4078 Ga0501046_0083875
4079 Ga0501046_0107340
4080 Ga0501047_0005769
4081 Ga0501047_0008561
4082 Ga0501047_0032505
4083 Ga0501047_0041765
4084 Ga0501047_0062853
4085 Ga0501047_0063378
4086 Ga0501047_0106266
4087 Ga0501048_0022942
4088 Ga0501048_0025003
4089 Ga0501048_0059773
4090 Ga0501048_0108592
4091 Ga0501067_0045863
4092 Ga0501068_0006004
4093 Ga0501068_0036659
4094 Ga0501068_0048843
4095 Ga0501069_0000075
4096 Ga0501069_0002889
4097 Ga0501069_0006374
4098 Ga0501069_0049686
4099 Ga0501070_0000284
4100 Ga0501070_0004793
4101 Ga0501070_0005298
4102 Ga0501070_0006011
4103 Ga0501071_0000788
4104 Ga0501071_0038242
4105 Ga0501071_0047775
4106 Ga0501071_0068628
4107 Ga0501071_0069364
4108 Ga0501071_0209729
4109 Ga0501072_0006065
4110 Ga0501072_0013019
4111 Ga0501072_0042201
4112 Ga0501073_0007771
4113 Ga0501074_0000101
4114 Ga0501074_0030410
4115 Ga0501074_0034278
4116 Ga0501074_0038952
4117 Ga0501075_0030295
4118 Ga0501075_0052526
4119 Ga0501075_0282940
4120 Ga0501076_0010182
4121 Ga0501076_0014907
4122 Ga0501076_0020166
4123 Ga0501076_0062971
4124 Ga0501076_0111709
4125 Ga0501076_0116143
4126 Ga0501076_0231944
4127 Ga0501077_0007500
4128 Ga0501077_0024389
4129 Ga0501077_0044183
4130 Ga0501077_0046334
4131 Ga0501079_0020709
4132 Ga0501079_0036801
4133 Ga0501079_0041950
4134 Ga0501079_0090439
4135 Ga0501080_0000843
4136 Ga0501080_0001651
4137 Ga0501080_0026752
4138 Ga0501080_0111895
4139 Ga0501080_0127833
4140 Ga0501081_0004251
4141 Ga0501081_0026043
4142 Ga0501081_0027775
4143 Ga0501081_0113838
4144 Ga0501083_0000191
4145 Ga0501083_0011637
4146 Ga0501083_0052796
4147 Ga0501035_0000014
4148 Ga0501035_0000469
4149 Ga0501035_0000472
4150 Ga0501035_0000546
4151 Ga0501035_0003018
4152 Ga0501035_0009851
4153 Ga0501035_0048750
4154 Ga0501035_0052261
4155 Ga0501035_0065575
4156 Ga0501035_0085804
4157 Ga0501035_0090284
4158 Ga0501035_0151917
4159 Ga0501044_0000010
4160 Ga0501044_0000012
4161 Ga0501044_0003181
4162 Ga0501044_0016120
4163 Ga0501044_0023375
4164 Ga0501044_0069596
4165 Ga0501044_0085984
4166 Ga0501044_0087979
4167 Ga0501044_0114272
4168 Ga0501044_0130873
4169 Ga0501044_0157420
4170 Ga0501044_0224941
4171 Ga0501044_0234415
4172 Ga0501045_0007600
4173 Ga0501045_0007710
4174 Ga0501045_0010155
4175 Ga0501045_0034851
4176 Ga0501045_0063244
4177 Ga0501226_000002
4178 nmdc:mga03683_3676_c1
4179 nmdc:mga03683_58689_c1
4180 nmdc:mga03683_61559_c1
4181 nmdc:mga03683_7377_c2
4182 nmdc:mga03n38_10080_c1
4183 nmdc:mga03n38_59665_c1
4184 nmdc:mga03n38_6071_c1
4185 nmdc:mga00v17_10994_c1
4186 nmdc:mga00v17_11669_c1
4187 nmdc:mga00v17_1801_c1
4188 nmdc:mga00v17_45_c1
4189 nmdc:mga00v17_77929_c1
4190 nmdc:mga0yw44_1411_c1
4191 nmdc:mga0yw44_21763_c1
4192 nmdc:mga0yw44_2560_c1
4193 nmdc:mga0yw44_59184_c1
4194 nmdc:mga0k408_122041_c1
4195 nmdc:mga0k408_14605_c1
4196 nmdc:mga06z11_11068_c1
4197 nmdc:mga06z11_111037_c1
4198 nmdc:mga06z11_1859_c1
4199 nmdc:mga06z11_4728_c1
4200 nmdc:mga06z11_72911_c1
4201 nmdc:mga04h51_14377_c1
4202 nmdc:mga04h51_17882_c1
4203 nmdc:mga04h51_6329_c1
4204 nmdc:mga07m45_31009_c1
4205 nmdc:mga05p37_146_c2
4206 nmdc:mga05p37_175331_c1
4207 nmdc:mga05p37_193989_c1
4208 nmdc:mga05p37_79974_c1
4209 nmdc:mga09592_309_c1
4210 nmdc:mga09592_330917_c1
4211 nmdc:mga09592_44168_c1
4212 nmdc:mga0qj67_201170_c1
4213 nmdc:mga0qj67_6132_c1
4214 nmdc:mga06r32_163486_c1
4215 nmdc:mga06r32_296_c1
4216 nmdc:mga06r32_3070_c1
4217 nmdc:mga08y16_1223_c1
4218 nmdc:mga08y16_144865_c1
4219 nmdc:mga08y16_36156_c1
4220 nmdc:mga08y16_41233_c1
4221 nmdc:mga0n895_118237_c1
4222 nmdc:mga0n895_171108_c1
4223 nmdc:mga0n895_76619_c1
4224 nmdc:mga0rr50_5670_c1
4225 nmdc:mga08x19_26494_c1
4226 nmdc:mga08x19_31582_c1
4227 nmdc:mga08x19_59231_c1
4228 nmdc:mga0a205_20791_c1
4229 nmdc:mga0a205_218337_c1
4230 nmdc:mga0sz30_3249_c1
4231 nmdc:mga0sz30_6230_c1
4232 Ga0500578_0021908
4233 Ga0500643_000153
4234 Ga0500555_004924
4235 Ga0500595_000747
4236 Ga0500608_021334
4237 Ga0500658_0037029
4238 Ga0500658_0091807
4239 Ga0500568_0000202
4240 Ga0500568_0051446
4241 Ga0500573_0014865
4242 Ga0500590_026998
4243 Ga0500604_0000130
4244 Ga0500616_0000102
4245 Ga0500616_0001640
4246 Ga0500624_001028
4247 Ga0500627_0033440
4248 Ga0500634_0000034
4249 Ga0500634_0104226
4250 Ga0500636_0000003
4251 Ga0500609_005863
4252 Ga0501084_0021979
4253 Ga0501084_0025141
4254 Ga0501084_0027937
4255 Ga0501084_0086791
4256 Ga0501084_0093697
4257 Ga0501084_0323688
4258 Ga0590071_002592
4259 Ga0501082_0008290
4260 Ga0501082_0024143
4261 Ga0501082_0025691
4262 Ga0501082_0029768
4263 Ga0501082_0035257
4264 Ga0501082_0069344
4265 Ga0501082_0104368
4266 Ga0501082_0189146
4267 Ga0501082_0302900
4268 Ga0530510_0001160
4269 Ga0530510_0010708
4270 Ga0530510_0014719
4271 Ga0530510_0062198
4272 Ga0530510_0082110
4273 2503199909
4274 2508728831
4275 2509075704
4276 2509108366
4277 2509114617
4278 2509142635
4279 2509369617
4280 2509376501
4281 2509392025
4282 2509394831
4283 2509445616
4284 2509447083
4285 2510133984
4286 2510306484
4287 2510318574
4288 2510841240
4289 2510895405
4290 2511134004
4291 2511172756
4292 2511187084
4293 2511199059
4294 2511257459
4295 2511274082
4296 2511276593
4297 2511304155
4298 2511314752
4299 2511322540
4300 2511327815
4301 2511331166
4302 2511340611
4303 2511344623
4304 2511349948
4305 2511358753
4306 2511362454
4307 2511390294
4308 2511502274
4309 2512533648
4310 2512932616
4311 2512960638
4312 2512970652
4313 2513567940
4314 2513576975
4315 2513584354
4316 2513596505
4317 2513601714
4318 2513608735
4319 2513618834
4320 2513633355
4321 2513707628
4322 2513865629
4323 2513884374
4324 2513905041
4325 2513908966
4326 2513925355
4327 2513984133
4328 2514001471
4329 2514002843
4330 2514019976
4331 2514036276
4332 2514422823
4333 2514587423
4334 2515113033
4335 2515609051
4336 2515638312
4337 2515640993
4338 2515655324
4339 2515739515
4340 2516204175
4341 2516893653
4342 2517036735
4343 2517077096
4344 2517095862
4345 2517407433
4346 2517570377
4347 2524448526
4348 2524459618
4349 2530645921
4350 2535486687
4351 2535516896
4352 2537876042
4353 2551678485
4354 2551689787
4355 2551694375
4356 2551701991
4357 2551715262
4358 2551723698
4359 2551738189
4360 2551743399
4361 2554248263
4362 2558864431
4363 2559295379
4364 2585166384
4365 2585202239
4366 2585222862
4367 2585231773
4368 2585255117
4369 2585267391
4370 2585271167
4371 2585277512
4372 2585323304
4373 2585331447
4374 2585386459
4375 2585393286
4376 2585402368
4377 2585527477
4378 2585535139
4379 2585538215
4380 2585545445
4381 2585555989
4382 2585558891
4383 2585822945
4384 2585836164
4385 2585843258
4386 2585898272
4387 2585904139
4388 2585996232
4389 2586000843
4390 2587980744
4391 2588518695
4392 2597812084
4393 2599331779
4394 2599417271
4395 2599601691
4396 2599936480
4397 2600195485
4398 2601610049
4399 2601746824
4400 2616293331
4401 2616308987
4402 2616554258
4403 2617383598
4404 2624492827
4405 2643754798
4406 2643769871
4407 2643803052
4408 2643811503
4409 2643837674
4410 2643845851
4411 2643856735
4412 2643912693
4413 2643920311
4414 2643953778
4415 2643966195
4416 2643987406
4417 2644003139
4418 2644021712
4419 2644050483
4420 2644063414
4421 2644107246
4422 2644133310
4423 2644150812
4424 2644158074
4425 2644169787
4426 2644189435
4427 2644193541
4428 2644205711
4429 2644208998
4430 2644238647
4431 2644298703
4432 2644308641
4433 2644335459
4434 2644350422
4435 2644374697
4436 2644413304
4437 2644414177
4438 2644447705
4439 2644483401
4440 2644492060
4441 2644499614
4442 2644521927
4443 2644539864
4444 2644614582
4445 2644652528
4446 2644656932
4447 2644676045
4448 2644690178
4449 2644732812
4450 2644734594
4451 2644743946
4452 2657681593
4453 2671111401
4454 2688597164
4455 2692315511
4456 2694628770
4457 2694637316
4458 2719181836
4459 2719386442
4460 2719666188
4461 2719732500
4462 2720492608
4463 2720614042
4464 2720620849
4465 2720632174
4466 2720775902
4467 2721147927
4468 2721159378
4469 2721164763
4470 2721400146
4471 2722840933
4472 2723027504
4473 2723561125
4474 2723567721
4475 2723574359
4476 2724038959
4477 2724045256
4478 2724090509
4479 2724104986
4480 2724110843
4481 2725952531
4482 2730108440
4483 2730165071
4484 2730299010
4485 2738800116
4486 2738947302
4487 2739032871
4488 2739199949
4489 2739260175
4490 2739307562
4491 2753357070
4492 2753462057
4493 2756671449
4494 2757571298
4495 2758639356
4496 2765466383
4497 2766065902
4498 2770199013
4499 2774118718
4500 2774874315
4501 2776261944
4502 2776270281
4503 2776284989
4504 2776913973
4505 2778175445
4506 2784312355
4507 2792585097
4508 2792620741
4509 2792626100
4510 2792639037
4511 2792748055
4512 2793294407
4513 2793314514
4514 2793320341
4515 2793331700
4516 2793334520
4517 2793339240
4518 2793348910
4519 2793351802
4520 2793362550
4521 2793368843
4522 2802717006
4523 2802725755
4524 2802730156
4525 2802737873
4526 2802742673
4527 2802750161
4528 2804752782
4529 2805928771
4530 2805935053
4531 2806043851
4532 2806050218
4533 2806057034
4534 2806064415
4535 2806071682
4536 2808905340
4537 2808933204
4538 2808940170
4539 2808955289
4540 2808961781
4541 2808987887
4542 2819241372
4543 2819559092
4544 2819609177
4545 2819637594
4546 2819684942
4547 2835320033
4548 2837651168
4549 2838017622
4550 2838027578
4551 2838029776
4552 2838038530
4553 2838044993
4554 2838054332
4555 2838067705
4556 2838070112
4557 2838076828
4558 2838661559
4559 2838670391
4560 2838675740
4561 2838683434
4562 2838687021
4563 2838697623
4564 2838702762
4565 2838710739
4566 2838714622
4567 2838721577
4568 2838725382
4569 2838730006
4570 2838742979
4571 2839998269
4572 2840769105
4573 2840882777
4574 2841738074
4575 2841848527
4576 2841852465
4577 2841862157
4578 2841870813
4579 2842078912
4580 2842113235
4581 2842118578
4582 2842125442
4583 2842130635
4584 2842147980
4585 2842154195
4586 2842158076
4587 2842168761
4588 2842170866
4589 2842177815
4590 2842181695
4591 2842187731
4592 2842197388
4593 2842203588
4594 2842205450
4595 2842212042
4596 2842217967
4597 2842226339
4598 2842230254
4599 2842240490
4600 2842244157
4601 2842253046
4602 2842257757
4603 2842266297
4604 2842271441
4605 2842278907
4606 2842285569
4607 2842292574
4608 2842301400
4609 2842305070
4610 2842316973
4611 2842320740
4612 2842346489
4613 2842357937
4614 2842368928
4615 2842374065
4616 2842378972
4617 2842385089
4618 2842399849
4619 2842402929
4620 2842409699
4621 2842416350
4622 2842423726
4623 2842430760
4624 2842437253
4625 2842443623
4626 2842453871
4627 2842464903
4628 2842471871
4629 2842476939
4630 2842484531
4631 2842492008
4632 2842496796
4633 2842503304
4634 2842511099
4635 2842518941
4636 2842521847
4637 2842695379
4638 2842872263
4639 2842924185
4640 2844008643
4641 2844012541
4642 2844164609
4643 2844458388
4644 2844535307
4645 2847419427
4646 2847674964
4647 2847691053
4648 2848994455
4649 2850081498
4650 2852390256
4651 2854684059
4652 2854899620
4653 2854916296
4654 2854918445
4655 2855826375
4656 2855841764
4657 2855872491
4658 2856320682
4659 2856323025
4660 2856334784
4661 2856336555
4662 2856346523
4663 2856359022
4664 2856367984
4665 2857351893
4666 2857368859
4667 2857517399
4668 2858802549
4669 2860344174
4670 2869164738
4671 2869173989
4672 2869237841
4673 2869247767
4674 2869253176
4675 2869263236
4676 2869267594
4677 2869277600
4678 2869282576
4679 2869283104
4680 2869290397
4681 2871432681
4682 2871441035
4683 2871447830
4684 2871455734
4685 2871460996
4686 2871468238
4687 2871475985
4688 2871483428
4689 2871493297
4690 2871499115
4691 2874108640
4692 2874112238
4693 2874117685
4694 2874126673
4695 2874133701
4696 2874142232
4697 2874152648
4698 2874160048
4699 2874168038
4700 2874174866
4701 2876365131
4702 2876374499
4703 2876388844
4704 2876397946
4705 2876402778
4706 2876409011
4707 2876418564
4708 2876422280
4709 2878036015
4710 2878744584
4711 2878750295
4712 2878757342
4713 2878763314
4714 2878770302
4715 2878774766
4716 2878787687
4717 2881149845
4718 2881160992
4719 2881166724
4720 2881859184
4721 2881868975
4722 2882458511
4723 2882632481
4724 2882919256
4725 2884299063
4726 2885308245
4727 2885312964
4728 2885325829
4729 2885332271
4730 2885341270
4731 2885353989
4732 2888345853
4733 2889010058
4734 2889018269
4735 2889795554
4736 2889916115
4737 2891050968
4738 2891373381
4739 2894235580
4740 2894655609
4741 2896388995
4742 2898796042
4743 2899796019
4744 2899807234
4745 2899850596
4746 2903450131
4747 2903500037
4748 2903501069
4749 2903520564
4750 2903522134
4751 2903528512
4752 2903543917
4753 2904553691
4754 2904582229
4755 2904664597
4756 2906312653
4757 2906325362
4758 2906330754
4759 2906362117
4760 2906364504
4761 2906373556
4762 2906390267
4763 2906395739
4764 2906406159
4765 2906411159
4766 2906419869
4767 2909043551
4768 2913299281
4769 2913312601
4770 2915652801
4771 2915982976
4772 2915991477
4773 2916000828
4774 2916003452
4775 2916008079
4776 2916019574
4777 2916022162
4778 2916034221
4779 2916037900
4780 2916045300
4781 2916049076
4782 2916055686
4783 2916062284
4784 2916082288
4785 2917557354
4786 2919107626
4787 2919114660
4788 2919122990
4789 2919169278
4790 2919174679
4791 2919410009
4792 2919461216
4793 2919682044
4794 2919703485
4795 2920761487
4796 2920825252
4797 2921208503
4798 2921210958
4799 2921240896
4800 2921246740
4801 2921253823
4802 2921263079
4803 2921266243
4804 2921289162
4805 2921296279
4806 2921299071
4807 2922136938
4808 2922157196
4809 2922160908
4810 2922172817
4811 2922188078
4812 2923558603
4813 2924146720
4814 2924157958
4815 2924159308
4816 2924170518
4817 2924174535
4818 2924182966
4819 2924193313
4820 2924195418
4821 2924203291
4822 2924210710
4823 2924217618
4824 2924223260
4825 2924230554
4826 2924716922
4827 2924726480
4828 2924730920
4829 2924737953
4830 2924753435
4831 2924760511
4832 2924768352
4833 2924782614
4834 2924786648
4835 2926755676
4836 2926762796
4837 2928524189
4838 2929140906
4839 2931402933
4840 2932404846
4841 2933008840
4842 2933014885
4843 2933022192
4844 2933570878
4845 2933588709
4846 2933596563
4847 2933600918
4848 2935896991
4849 2935901925
4850 2936372004
4851 2936379866
4852 2936382770
4853 2936998249
4854 2937004525
4855 2937011232
4856 2937019790
4857 2937024619
4858 2937031107
4859 2937037023
4860 2937047977
4861 2937056464
4862 2937063537
4863 2937067808
4864 2937074425
4865 2937081573
4866 2937094579
4867 2937105456
4868 2937111291
4869 2937116110
4870 2937122019
4871 2937128860
4872 2937819202
4873 2937827749
4874 2937842074
4875 2937846575
4876 2937852081
4877 2937864598
4878 2937870805
4879 2937881257
4880 2937895662
4881 2937977347
4882 2937982633
4883 2937997766
4884 2939640228
4885 2941502101
4886 2952255286
4887 2954013135
4888 2957378373
4889 2957384244
4890 2957390707
4891 2957401692
4892 2957404469
4893 2957414105
4894 2957416211
4895 2957431750
4896 2957438185
4897 2957446875
4898 2957453717
4899 2957461913
4900 2957467011
4901 2957471605
4902 2957479571
4903 2957490429
4904 2957497368
4905 2957503344
4906 2957506239
4907 2958039359
4908 2958043241
4909 2958051581
4910 2958053013
4911 2958070624
4912 2958073708
4913 2958088186
4914 2958097466
4915 2958107745
4916 2958121122
4917 2958127322
4918 2958134785
4919 2958147008
4920 2958168239
4921 2958178233
4922 2958186435
4923 2960590881
4924 2960594247
4925 2960599960
4926 2960610624
4927 2960614559
4928 2960620498
4929 2960624448
4930 2960633629
4931 2960645009
4932 2960652446
4933 2960654684
4934 2960666528
4935 2960669691
4936 2960675127
4937 2960681037
4938 2960692502
4939 2960698033
4940 2961084934
4941 2961119596
4942 2961131238
4943 2961140362
4944 2961166705
4945 2961175329
4946 2961185676
4947 2963646586
4948 2964614159
4949 2964618000
4950 2964623600
4951 2964632620
4952 2964645652
4953 2964651589
4954 2964661778
4955 2964666890
4956 2964677605
4957 2964682908
4958 2964688516
4959 2964692513
4960 2964705353
4961 2964710488
4962 2964718362
4963 2964720712
4964 2965021528
4965 2965027539
4966 2965042216
4967 2965051801
4968 2965067609
4969 2965095376
4970 2965110338
4971 2965118158
4972 2965122438
4973 2967670739
4974 2967678381
4975 2967684393
4976 2967689964
4977 2967694677
4978 2967701364
4979 2967708655
4980 2967714908
4981 2967727951
4982 2967730033
4983 2967737180
4984 2967742290
4985 2967751570
4986 2967757879
4987 2967767702
4988 2967772088
4989 2967779014
4990 2967999669
4991 2968008027
4992 2968020686
4993 2968090621
4994 2968094700
4995 2968100907
4996 2968115851
4997 2968119224
4998 2968133729
4999 2968142521
5000 2968175110
5001 2970021029
5002 2970031742
5003 2970034129
5004 2970042521
5005 2970054578
5006 2970056734
5007 2970067176
5008 2970071620
5009 2970078296
5010 2970085277
5011 2970092580
5012 2970096151
5013 2970107965
5014 2970110742
5015 2970117387
5016 2970124911
5017 2970131133
5018 2970136326
5019 2970145129
5020 2970151583
5021 2970159601
5022 2970166945
5023 2970174276
5024 2970180857
5025 2970189203
5026 2970198839
5027 2970473983
5028 2970490628
5029 2970507917
5030 2970514286
5031 2970527308
5032 2970534681
5033 2970543004
5034 2970548602
5035 2970558159
5036 2970597185
5037 2970597724
5038 2970619484
5039 2970629116
5040 2977523719
5041 2977528837
5042 2977531451
5043 2977539659
5044 2977548342
5045 2977558465
5046 2977563206
5047 2977567699
5048 2977575714
5049 2977581965
5050 2977826501
5051 2977831850
5052 2977848441
5053 2977855175
5054 2977859417
5055 2977865098
5056 2977873542
5057 2977903229
5058 2977909123
5059 2977922056
5060 2977922906
5061 2977938109
5062 2977944849
5063 2977956131
5064 2977958419
5065 2977978315
5066 2977987854
5067 2978974655
5068 2979094714
5069 2979100720
5070 2979103946
5071 2979715859
5072 2979749880
5073 2979771094
5074 2979779750
5075 2979783672
5076 2979800949
5077 2979813101
5078 2984511486
5079 2984522153
5080 2984541451
5081 2984589976
5082 2984603729
5083 2987639077
5084 2987647903
5085 2987659057
5086 2987662717
5087 2987671519
5088 2987676826
5089 2989349707
5090 2989774323
5091 2989779238
5092 2995393172
5093 2996312147
5094 2996338591
5095 2996344143
5096 2996352697
5097 2996389192
5098 2996889007
5099 2996894297
5100 3000139548
5101 3002145096
5102 3003934104
5103 3004167564
5104 3004191767
5105 3004202678
5106 3004204680
5107 3004217983
5108 3004220969
5109 3004233934
5110 3004241010
5111 3004255314
5112 3004273975
5113 3004279379
5114 3004335839
5115 3005414565
5116 3005417405
5117 3005448477
5118 3005454655
5119 3007515129
5120 3007620619
5121 637075711
5122 639649217
5123 643826341
5124 648739242
5125 649871719
5126 650740589
5127 8002291576
5128 8003571656
5129 8003994199
5130 8004001841
5131 8004306619
5132 8004319058
5133 8004368570
5134 8004378917
5135 8004392603
5136 8004634488
5137 8004645210
5138 8004697608
5139 8004712125
5140 8004718912
5141 8004729784
5142 8005248799
5143 8005260336
5144 8005281240
5145 8005286103
5146 8005292238
5147 8005303156
5148 8005312864
5149 8005315806
5150 8005323534
5151 8005380958
5152 8005389091
5153 8005396074
5154 8005435184
5155 8005463714
5156 8005489158
5157 8005500926
5158 8005545650
5159 8005556988
5160 8005568020
5161 8005573435
5162 8005622299
5163 8005629800
5164 8005648167
5165 8005672344
5166 8005682860
5167 8005692076
5168 8005697430
5169 8018134124
5170 8018164599
5171 8018181294
5172 8019781786
5173 8023683138
5174 8024482836
5175 8024488057
5176 8024504450
5177 8046771116
5178 8049295353
5179 8054463014
5180 8054558610
5181 8055619397
5182 8056129665
5183 8056156877
5184 8056182596
5185 8056375961
5186 8056386753
5187 8056877268
5188 8057529699
5189 8057575707
5190 8057877646

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00465

Fe-ADH

Iron-containing alcohol dehydrogenase

20

193

0.97

PF13685

Fe-ADH_2

Iron-containing alcohol dehydrogenase

24

126

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3owo-assembly2.cif.gz_D structures of iron-dependent alcohol dehydrogenase 2 from zymomonas mobilis zm4 with and without nad cofactor 0.9497 4 378
5br4-assembly1.cif.gz_B e. coli lactaldehyde reductase (fuco) m185c mutant 0.9402 4 378
6scg-assembly1.cif.gz_B structure of adhe form 1 0.9377 5 381
7qls-assembly1.cif.gz_BBB crystal structure of e.coli alcohol dehydrogenase - fuco mutant n151g, l259v complexed with fe, nadh, and dimethoxyphenyl acetamide 0.9357 4 378
7qlq-assembly1.cif.gz_BBB crystal structure of e.coli alcohol dehydrogenase - fuco mutant n151g, l259v complexed with fe, nad, and dimethoxyphenyl acetamide 0.9356 12 378
ID Description Score Start End Superfamily
af_Q09669_229_422_1.20.1090.10 Mainly Alpha;Up-down Bundle;Dehydroquinate synthase-like, alpha domain;Dehydroquinate synthase-like - alpha domain 0.9706 193 377 1.20.1090.10
af_P76553_203_395_1.20.1090.10 Mainly Alpha;Up-down Bundle;Dehydroquinate synthase-like, alpha domain;Dehydroquinate synthase-like - alpha domain 0.9596 191 377 1.20.1090.10
af_P0A9Q7_645_865_1.20.1090.10 Mainly Alpha;Up-down Bundle;Dehydroquinate synthase-like, alpha domain;Dehydroquinate synthase-like - alpha domain 0.9529 193 381 1.20.1090.10
3zdrA02 Mainly Alpha;Up-down Bundle;Dehydroquinate synthase-like, alpha domain;Dehydroquinate synthase-like - alpha domain 0.9392 192 379 1.20.1090.10
3bfjA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9341 4 189 3.40.50.1970
ID Description Score Start End GO Terms
AF-A0A528BYV0-F1-model_v4 Iron-containing alcohol dehydrogenase 0.9931 9 253 GO:0004022
GO:0046872
AF-A0A7C1NZ22-F1-model_v4 Iron-containing alcohol dehydrogenase 0.9903 40 378 GO:0004022
GO:0046872
AF-A0A0Q0DHR9-F1-model_v4 deleted 0.9854 2 380
AF-A0A3M5PFU8-F1-model_v4 Alcohol dehydrogenase 0.9845 1 380 GO:0004022
GO:0046872
AF-A0A528BYV0-F1-model_v4 Iron-containing alcohol dehydrogenase 0.9811 9 253 GO:0004022
GO:0046872

Map