F496940
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 2595 | 1462 | 5190 | 383 |
Family's Representative Sequence
| Representative Sequence | 3300049582|Ga0501048_0086242|Ga0501048_0086242_205_1404 |
| Length | 399 |
| Sequence | LIFAIRIKDMTAPTANWSYPTAIRFGPGRVKELAEACKSAGINRPLLVTDAGLAKLPITQMALDLIKQAGMKAAMFADVQPNPVDANVDAGVAVFRDGKHDGVIAFGGGSGLDTGKVIAFMAGQTRPLWDFEDIGDWWTRADPDKIAPVVAVPTTAGTGSEVGRAGVITQESTHTKKVIFHPKMMPKVVICDPELTVGMPPAITAGTGMDALAHCLEAYCAPSYHPIAEGIAVEGMRLVFANLPKAVANGKDLEARAHMMSAAAMGAAAFQKGLGAIHALSHPVGALYHTHHGMTNGVFMPYVLVFNRAAIEPKIERLAGFLQIDGGFDGFLKAVLDLRKQVGVPHDLAGLKVDGGKAELISEMAVVDPTAGGNPIPVTKEGARKLFDAALKGDVAAAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 2 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 6 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 7 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 8 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 9 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 10 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 11 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 12 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 13 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 14 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 15 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 16 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 17 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 18 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 19 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 20 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 21 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 22 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 23 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 24 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 25 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 26 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 27 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 28 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 29 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 30 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 31 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 32 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 33 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 34 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 35 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 36 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 44 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 46 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 57 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 73 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 75 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 76 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 78 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 79 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 85 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 87 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 88 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 89 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 91 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 92 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 93 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 94 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 95 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 96 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 97 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 98 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 99 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 100 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 101 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 102 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 103 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 104 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 105 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 106 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 107 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 108 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 109 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 110 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 111 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 112 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 113 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 114 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 116 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 117 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 118 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 119 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 120 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 121 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 122 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 123 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 124 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 125 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 127 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 128 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 129 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 130 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 145 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 146 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 153 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 161 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 165 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 166 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 167 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 168 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 170 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 171 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 172 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 173 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 174 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 175 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 176 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 177 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 178 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 183 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 184 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 185 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 187 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 188 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 189 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 190 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 191 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 192 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 193 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 194 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 195 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 196 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 197 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 198 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 199 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 200 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 201 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 202 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 203 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 264 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 267 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 268 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 270 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 274 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 275 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 276 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 277 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 278 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 279 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 280 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 281 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 282 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 283 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 284 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 285 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 286 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 287 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 288 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 289 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 290 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 291 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 292 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 293 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 294 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 295 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 296 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 297 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 298 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 299 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 300 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 301 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 302 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 303 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 304 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 305 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 306 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 307 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 308 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 309 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 310 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 311 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 312 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 313 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 314 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 315 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 316 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 317 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 318 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 319 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 320 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 321 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 322 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 323 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 324 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 325 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 326 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 327 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 328 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 329 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 330 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 331 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 332 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 333 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 334 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 335 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 336 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 337 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 338 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 339 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 340 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 341 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 342 | 3300041506 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT | Metatranscriptome | Unclassified |
| 343 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 344 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 345 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 346 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 347 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 348 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 349 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 350 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 351 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 352 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 353 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 354 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 355 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 356 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 357 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 358 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 359 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 360 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 361 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 362 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 363 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 364 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 365 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 366 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 367 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 368 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 369 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 370 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 371 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 372 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 373 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 374 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 375 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 376 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 377 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 378 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 379 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 452 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 453 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 454 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 455 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 456 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 457 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 458 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 459 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 460 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 461 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 462 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 463 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 464 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 465 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 466 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 467 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 468 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 469 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 470 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 471 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 472 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 473 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 474 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 475 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 476 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 477 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 478 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 481 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 482 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 483 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 484 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 485 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 486 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 487 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 488 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 489 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 490 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 491 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 492 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 493 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 494 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 495 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 496 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 497 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 498 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 499 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 500 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 501 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 502 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 503 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 504 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 505 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 506 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 507 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 508 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 509 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 510 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 511 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 512 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 513 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 514 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 515 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 516 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 517 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 518 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 519 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 520 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 521 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 522 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 523 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 524 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 525 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 526 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 527 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 528 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 529 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 530 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 531 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 532 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 533 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 534 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 535 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 536 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 537 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 538 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 539 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 540 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 541 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 542 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 543 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 544 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 545 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 546 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 547 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 548 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 549 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 550 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 551 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 552 | 2508501050 | Microvirga lupini Lut6 | Isolate | Nodule |
| 553 | 2508501114 | Microvirga lotononidis WSM3557 | Isolate | Nodule |
| 554 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 555 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 556 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 557 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 558 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 559 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 560 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 561 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 562 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 563 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 564 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 565 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 566 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 567 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 568 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 569 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 570 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 571 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 572 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 573 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 574 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 575 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 576 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 577 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 578 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 579 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 580 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 581 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 582 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 583 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 584 | 2511231027 | Phyllobacterium sp. YR531 | Isolate | Rhizosphere |
| 585 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 586 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 587 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 588 | 2512875024 | |||
| 589 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 590 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 591 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 592 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 593 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 594 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 595 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 596 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 597 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 598 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 599 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 600 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 601 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 602 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 603 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 604 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 605 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 606 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 607 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 608 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 609 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 610 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 611 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 612 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 613 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 614 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 615 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 616 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 617 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 618 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 619 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 620 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 621 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 622 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 623 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 624 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 625 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 626 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 627 | 2534681786 | Brucella suis 92/29 | Isolate | Unclassified |
| 628 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 629 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 630 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 631 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 632 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 633 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 634 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 635 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 636 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 637 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 638 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 639 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 640 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 641 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 642 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 643 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 644 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 645 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 646 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 647 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 648 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 649 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 650 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 651 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 652 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 653 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 654 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 655 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 656 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 657 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 658 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 659 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 660 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 661 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 662 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 663 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 664 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 665 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 666 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 667 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 668 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 669 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 670 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 671 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 672 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 673 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 674 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 675 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 676 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 677 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 678 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 679 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 680 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 681 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 682 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 683 | 2643221550 | Mesorhizobium sp. Root552 | Isolate | Unclassified |
| 684 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 685 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 686 | 2643221564 | Mesorhizobium sp. Root157 | Isolate | Unclassified |
| 687 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 688 | 2643221568 | Rhizobium sp. Root564 | Isolate | Unclassified |
| 689 | 2643221580 | Devosia sp. Root635 | Isolate | Unclassified |
| 690 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 691 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 692 | 2643221591 | Devosia sp. Root685 | Isolate | Unclassified |
| 693 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 694 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 695 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 696 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 697 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 698 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 699 | 2643221623 | Aminobacter sp. DSM 101952 Root100 | Isolate | Unclassified |
| 700 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 701 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 702 | 2643221629 | Devosia sp. Root105 | Isolate | Unclassified |
| 703 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 704 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 705 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 706 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 707 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 708 | 2643221653 | Rhizobium sp. Root1240 | Isolate | Unclassified |
| 709 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 710 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 711 | 2643221662 | Devosia sp. Root413D1 | Isolate | Unclassified |
| 712 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 713 | 2643221674 | Devosia sp. Root436 | Isolate | Unclassified |
| 714 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 715 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 716 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 717 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 718 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 719 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 720 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 721 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 722 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 723 | 2643221719 | Rhizobium sp. Root274 | Isolate | Unclassified |
| 724 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 725 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 726 | 2643221733 | Bosea sp. Root381 | Isolate | Unclassified |
| 727 | 2643221734 | Bosea sp. Root670 | Isolate | Unclassified |
| 728 | 2643221736 | Bosea sp. Root483D1 | Isolate | Unclassified |
| 729 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 730 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 731 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 732 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 733 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 734 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 735 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 736 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 737 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 738 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 739 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 740 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 741 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 742 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 743 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 744 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 745 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 746 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 747 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 748 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 749 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 750 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 751 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 752 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 753 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 754 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 755 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 756 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 757 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 758 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 759 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 760 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 761 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 762 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 763 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 764 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 765 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 766 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 767 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 768 | 2751185800 | Brucella pituitosa AA2 | Isolate | Unclassified |
| 769 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 770 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 771 | 2757320392 | Phyllobacterium leguminum ORS 1419 | Isolate | Nodule |
| 772 | 2758568016 | [Ochrobactrum] quorumnocens A44 | Isolate | Rhizosphere |
| 773 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 774 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 775 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 776 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 777 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 778 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 779 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 780 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 781 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 782 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 783 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 784 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 785 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 786 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 787 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 788 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 789 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 790 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 791 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 792 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 793 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 794 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 795 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 796 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 797 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 798 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 799 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 800 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 801 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 802 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 803 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 804 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 805 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 806 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 807 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 808 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 809 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 810 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 811 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 812 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 813 | 2808606373 | Pseudomonas sp. SLBN-2 | Isolate | Unclassified |
| 814 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 815 | 2808606379 | Pseudomonas sp. SJZ079 | Isolate | Rhizosphere |
| 816 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 817 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 818 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 819 | 2818991272 | Rhizobium sp. SLBN-4 | Isolate | Unclassified |
| 820 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 821 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 822 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 823 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 824 | 2835312727 | Microvirga calopogonii CCBAU 65841 | Isolate | Nodule |
| 825 | 2837651117 | Pseudohoeflea suaedae YC6898 | Isolate | Unclassified |
| 826 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 827 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 828 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 829 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 830 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 831 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 832 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 833 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 834 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 835 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 836 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 837 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 838 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 839 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 840 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 841 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 842 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 843 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 844 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 845 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 846 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 847 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 848 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 849 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 850 | 2840878972 | Albibacillus kandeliae J95 | Isolate | Rhizosphere |
| 851 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 852 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 853 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 854 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 855 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 856 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 857 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 858 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 859 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 860 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 861 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 862 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 863 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 864 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 865 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 866 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 867 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 868 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 869 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 870 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 871 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 872 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 873 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 874 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 875 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 876 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 877 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 878 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 879 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 880 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 881 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 882 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 883 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 884 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 885 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 886 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 887 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 888 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 889 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 890 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 891 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 892 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 893 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 894 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 895 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 896 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 897 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 898 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 899 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 900 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 901 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 902 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 903 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 904 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 905 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 906 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 907 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 908 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 909 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 910 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 911 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 912 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 913 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 914 | 2842694124 | Methylopila sp. R-72369 | Isolate | Unclassified |
| 915 | 2842871566 | Phyllobacterium sp. R-73111 | Isolate | Unclassified |
| 916 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 917 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 918 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 919 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 920 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 921 | 2844533157 | Inquilinus sp. R-72501 v. 2 | Isolate | Unclassified |
| 922 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 923 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 924 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 925 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 926 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 927 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 928 | 2854681122 | Luteovulum sphaeroides SCJ | Isolate | Unclassified |
| 929 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 930 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 931 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 932 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 933 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 934 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 935 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 936 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 937 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 938 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 939 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 940 | 2856356410 | Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 | Isolate | Nodule |
| 941 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 942 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 943 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 944 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 945 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 946 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 947 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 948 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 949 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 950 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 951 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 952 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 953 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 954 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 955 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 956 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 957 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 958 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 959 | 2871444079 | Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 | Isolate | Nodule |
| 960 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 961 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 962 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 963 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 964 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 965 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 966 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 967 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 968 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 969 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 970 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 971 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 972 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 973 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 974 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 975 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 976 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 977 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 978 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 979 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 980 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 981 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 982 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 983 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 984 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 985 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 986 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 987 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 988 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 989 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 990 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 991 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 992 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 993 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 994 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 995 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 996 | 2881853255 | Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 | Isolate | Nodule |
| 997 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 998 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 999 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 1000 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 1001 | 2884298095 | Microvirga thermotolerans HR1 | Isolate | Rhizosphere |
| 1002 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 1003 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 1004 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 1005 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 1006 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 1007 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 1008 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 1009 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 1010 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 1011 | 2889790730 | Chelativorans xinjiangense lm93 | Isolate | Rhizosphere |
| 1012 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 1013 | 2891048133 | Martelella lutilitoris GH2-6 | Isolate | Rhizosphere |
| 1014 | 2891373044 | Shinella sp. AETb1-6 | Isolate | Rhizosphere |
| 1015 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 1016 | 2894652903 | Phyllobacterium sp. SYP-B3895 | Isolate | Rhizosphere |
| 1017 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 1018 | 2898795034 | Rhodobacter sp. SGA-6-6 | Isolate | Rhizosphere |
| 1019 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 1020 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 1021 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 1022 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 1023 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 1024 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 1025 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 1026 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 1027 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 1028 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 1029 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 1030 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 1031 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 1032 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 1033 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 1034 | 2906354277 | Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 | Isolate | Nodule |
| 1035 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 1036 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 1037 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 1038 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 1039 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 1040 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 1041 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 1042 | 2909042592 | Labrys sp. LIt4 | Isolate | Nodule |
| 1043 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 1044 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 1045 | 2915650412 | Ochrobactrum sp. CM-21-5 | Isolate | Rhizosphere |
| 1046 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 1047 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 1048 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 1049 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 1050 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 1051 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 1052 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 1053 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 1054 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 1055 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 1056 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 1057 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 1058 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 1059 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 1060 | 2917554339 | Chthonobacter rhizosphaerae yh7-1 | Isolate | Rhizosphere |
| 1061 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 1062 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 1063 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 1064 | 2919166419 | Agrobacterium cavarae 2074 | Isolate | Unclassified |
| 1065 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 1066 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 1067 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 1068 | 2919679072 | Pseudotabrizicola sp. 4114 | Isolate | Unclassified |
| 1069 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 1070 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 1071 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 1072 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 1073 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 1074 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 1075 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 1076 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 1077 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 1078 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 1079 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 1080 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 1081 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 1082 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 1083 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 1084 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 1085 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 1086 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 1087 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 1088 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 1089 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 1090 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 1091 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 1092 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 1093 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 1094 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 1095 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 1096 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 1097 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 1098 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 1099 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 1100 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 1101 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 1102 | 2924718760 | Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 | Isolate | Nodule |
| 1103 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 1104 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 1105 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 1106 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 1107 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 1108 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 1109 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 1110 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 1111 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 1112 | 2928521798 | Phyllobacterium ifriqiyense 1451 | Isolate | Rhizosphere |
| 1113 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 1114 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 1115 | 2932401849 | Devosia sp. 2618 | Isolate | Rhizosphere |
| 1116 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 1117 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 1118 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 1119 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 1120 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 1121 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 1122 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 1123 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 1124 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 1125 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 1126 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 1127 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 1128 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 1129 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 1130 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 1131 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 1132 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 1133 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 1134 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 1135 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 1136 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 1137 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 1138 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 1139 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 1140 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 1141 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 1142 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 1143 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 1144 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 1145 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 1146 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 1147 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 1148 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 1149 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 1150 | 2937843397 | Mesorhizobium xinjiangense lm94 | Isolate | Rhizosphere |
| 1151 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 1152 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 1153 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 1154 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 1155 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 1156 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 1157 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 1158 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 1159 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 1160 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 1161 | 2952252522 | Salinicola sp. DM10 | Isolate | Unclassified |
| 1162 | 2954011201 | Phyllobacterium ifrigiyense W4I11 | Isolate | Rhizosphere |
| 1163 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 1164 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 1165 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 1166 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 1167 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 1168 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 1169 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 1170 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 1171 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 1172 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 1173 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 1174 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 1175 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 1176 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 1177 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 1178 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 1179 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 1180 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 1181 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 1182 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 1183 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 1184 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 1185 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 1186 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 1187 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 1188 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 1189 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 1190 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 1191 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 1192 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 1193 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 1194 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 1195 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 1196 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 1197 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 1198 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 1199 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 1200 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 1201 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 1202 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 1203 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 1204 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 1205 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 1206 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 1207 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 1208 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 1209 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 1210 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 1211 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 1212 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 1213 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 1214 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 1215 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 1216 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 1217 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 1218 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 1219 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 1220 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 1221 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 1222 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 1223 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 1224 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 1225 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 1226 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 1227 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 1228 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 1229 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 1230 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 1231 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 1232 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 1233 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 1234 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 1235 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 1236 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 1237 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 1238 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 1239 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 1240 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 1241 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 1242 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 1243 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 1244 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 1245 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 1246 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 1247 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 1248 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 1249 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 1250 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 1251 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 1252 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 1253 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 1254 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 1255 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 1256 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 1257 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 1258 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 1259 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 1260 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 1261 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 1262 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 1263 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 1264 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 1265 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 1266 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 1267 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 1268 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 1269 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 1270 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 1271 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 1272 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 1273 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 1274 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 1275 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 1276 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 1277 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 1278 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 1279 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 1280 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 1281 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 1282 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 1283 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 1284 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 1285 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 1286 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 1287 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 1288 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 1289 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 1290 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 1291 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 1292 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 1293 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 1294 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 1295 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 1296 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 1297 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 1298 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 1299 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 1300 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 1301 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 1302 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 1303 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 1304 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 1305 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 1306 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 1307 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 1308 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 1309 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 1310 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 1311 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 1312 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 1313 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 1314 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 1315 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 1316 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 1317 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 1318 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 1319 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 1320 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 1321 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 1322 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 1323 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 1324 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 1325 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 1326 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 1327 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 1328 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 1329 | 2977898635 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 | Isolate | Nodule |
| 1330 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 1331 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 1332 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 1333 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 1334 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 1335 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 1336 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 1337 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 1338 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 1339 | 2978969890 | Agrobacterium sp. SORGH_AS 787 | Isolate | Unclassified |
| 1340 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 1341 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 1342 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 1343 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 1344 | 2979742915 | Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 | Isolate | Nodule |
| 1345 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 1346 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 1347 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 1348 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 1349 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 1350 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 1351 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 1352 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 1353 | 2984587000 | Agrobacterium larrymoorei SORGH_AS974 | Isolate | Aerial Root |
| 1354 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 1355 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 1356 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 1357 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 1358 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 1359 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 1360 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 1361 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 1362 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 1363 | 2989776772 | Rhizobium glycinendophyticum CL12 | Isolate | Unclassified |
| 1364 | 2995392953 | Martelella limonii NBRC 109441 | Isolate | Unclassified |
| 1365 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 1366 | 2996336353 | Mesorhizobium sp. YM1C-6-2 | Isolate | Unclassified |
| 1367 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 1368 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 1369 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 1370 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 1371 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 1372 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 1373 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 1374 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 1375 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 1376 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 1377 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 1378 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 1379 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 1380 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 1381 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 1382 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 1383 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 1384 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 1385 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 1386 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 1387 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 1388 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 1389 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 1390 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 1391 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 1392 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 1393 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 1394 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 1395 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 1396 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 1397 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 1398 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 1399 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
| 1400 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 1401 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 1402 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 1403 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 1404 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 1405 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 1406 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 1407 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 1408 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 1409 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 1410 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 1411 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 1412 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 1413 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 1414 | 8005246636 | Rhizobium wuzhouense W44 | Isolate | Rhizosphere |
| 1415 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 1416 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 1417 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 1418 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 1419 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 1420 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 1421 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 1422 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 1423 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 1424 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 1425 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 1426 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 1427 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 1428 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 1429 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 1430 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 1431 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 1432 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 1433 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 1434 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 1435 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 1436 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 1437 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 1438 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 1439 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 1440 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 1441 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 1442 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 1443 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 1444 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 1445 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 1446 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 1447 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 1448 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 1449 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 1450 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 1451 | 8054460903 | Agrobacterium vaccinii B7.6 | Isolate | Unclassified |
| 1452 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 1453 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
| 1454 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 1455 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 1456 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 1457 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 1458 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 1459 | 8056875544 | Rhizobium halophilum TRM95001 | Isolate | Rhizosphere |
| 1460 | 8057529695 | Bosea vestrisii A18/4-2 | Isolate | Nodule |
| 1461 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
| 1462 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 64.51 |
| Metatranscriptomes | 0.12 |
| Isolates | 35.38 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.19 |
| Bulb | 0 |
| Endosphere | 9.06 |
| Nodule | 26.24 |
| Rhizoplane | 2.89 |
| Rhizosphere | 50.75 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501048_0086242 | 3300049582 | Bacteria | 2215 |
| 2 | MRS2a_Contig_8 | 2124908027 | Bacteria | 21551 |
| 3 | JGI24740J21852_10000504 | 3300001979 | Bacteria | 16777 |
| 4 | JGI24739J22299_10009479 | 3300001989 | Bacteria | 3629 |
| 5 | JGI24738J21930_10007464 | 3300002075 | Bacteria | 2521 |
| 6 | JGI25155J39150_1000001 | 3300002704 | Bacteria | 354543 |
| 7 | JGI25156J39149_1000001 | 3300002705 | Bacteria | 354557 |
| 8 | JGI25156J39149_1001987 | 3300002705 | Bacteria | 7842 |
| 9 | JGI25156J39149_1002999 | 3300002705 | Bacteria | 5734 |
| 10 | JGI25162J39368_1000304 | 3300002737 | Bacteria | 45066 |
| 11 | JGI25162J39368_1000820 | 3300002737 | Bacteria | 20523 |
| 12 | JGI25162J39368_1000825 | 3300002737 | Bacteria | 20436 |
| 13 | JGI25154J39366_1000122 | 3300002738 | Bacteria | 61892 |
| 14 | JGI25157J39369_1000044 | 3300002741 | Bacteria | 122466 |
| 15 | JGI25157J39369_1000475 | 3300002741 | Bacteria | 25238 |
| 16 | JGI25157J39369_1000502 | 3300002741 | Bacteria | 24104 |
| 17 | JGI25163J39215_1000074 | 3300002771 | Bacteria | 44810 |
| 18 | JGI25164J39214_1000223 | 3300002772 | Bacteria | 45067 |
| 19 | JGI25152J39213_1002276 | 3300002773 | Bacteria | 7405 |
| 20 | JGI25152J39213_1005176 | 3300002773 | Bacteria | 3893 |
| 21 | JGI25150J39212_1000074 | 3300002774 | Bacteria | 60735 |
| 22 | JGI25150J39212_1005822 | 3300002774 | Bacteria | 2597 |
| 23 | JGI25159J45721_1000014 | 3300002987 | Bacteria | 147809 |
| 24 | JGI25159J45721_1000411 | 3300002987 | Bacteria | 19832 |
| 25 | JGI25159J45721_1004159 | 3300002987 | Bacteria | 4896 |
| 26 | JGI25159J45721_1005892 | 3300002987 | Bacteria | 3769 |
| 27 | JGI25151J46595_10000015 | 3300003187 | Bacteria | 250420 |
| 28 | JGI25151J46595_10000414 | 3300003187 | Bacteria | 43361 |
| 29 | JGI25151J46595_10000486 | 3300003187 | Bacteria | 37582 |
| 30 | JGI25151J46595_10000628 | 3300003187 | Bacteria | 30686 |
| 31 | JGI25151J46595_10001750 | 3300003187 | Bacteria | 14073 |
| 32 | JGI25151J46595_10007168 | 3300003187 | Bacteria | 5495 |
| 33 | JGI25406J46586_10003356 | 3300003203 | Bacteria | 7539 |
| 34 | JGI25165J46597_1000042 | 3300003214 | Bacteria | 271606 |
| 35 | JGI25165J46597_1000410 | 3300003214 | Bacteria | 45073 |
| 36 | JGI25165J46597_1000910 | 3300003214 | Bacteria | 20508 |
| 37 | JGI25165J46597_1000918 | 3300003214 | Bacteria | 20436 |
| 38 | JGI25153J46596_10000267 | 3300003215 | Bacteria | 41505 |
| 39 | JGI25160J50197_1000001 | 3300003354 | Bacteria | 782301 |
| 40 | JGI25160J50197_1000020 | 3300003354 | Bacteria | 232739 |
| 41 | JGI25160J50197_1000695 | 3300003354 | Bacteria | 18566 |
| 42 | JGI25161J50226_1000001 | 3300003374 | Bacteria | 655036 |
| 43 | JGI25161J50226_1001013 | 3300003374 | Bacteria | 9799 |
| 44 | JGI25161J50226_1001697 | 3300003374 | Bacteria | 6301 |
| 45 | Ga0055542_1000488 | 3300003762 | Bacteria | 36554 |
| 46 | Ga0055529_1002050 | 3300003763 | Bacteria | 4374 |
| 47 | Ga0055526_1000375 | 3300003771 | Bacteria | 36235 |
| 48 | Ga0055526_1001939 | 3300003771 | Bacteria | 14317 |
| 49 | Ga0055526_1002938 | 3300003771 | Bacteria | 11169 |
| 50 | Ga0055526_1006372 | 3300003771 | Bacteria | 6416 |
| 51 | Ga0055526_1009545 | 3300003771 | Bacteria | 4649 |
| 52 | Ga0055524_1000064 | 3300003775 | Bacteria | 133574 |
| 53 | Ga0055524_1001090 | 3300003775 | Bacteria | 16525 |
| 54 | Ga0055524_1002653 | 3300003775 | Bacteria | 9082 |
| 55 | Ga0055524_1008708 | 3300003775 | Bacteria | 4192 |
| 56 | Ga0055524_1010743 | 3300003775 | Bacteria | 3625 |
| 57 | Ga0055536_1003980 | 3300003781 | Bacteria | 7733 |
| 58 | Ga0055528_1000234 | 3300003790 | Bacteria | 46499 |
| 59 | Ga0055528_1000512 | 3300003790 | Bacteria | 30456 |
| 60 | Ga0055528_1004264 | 3300003790 | Bacteria | 6918 |
| 61 | Ga0055528_1005478 | 3300003790 | Bacteria | 5906 |
| 62 | Ga0055528_1012612 | 3300003790 | Bacteria | 3267 |
| 63 | Ga0055540_1000350 | 3300003792 | Bacteria | 39199 |
| 64 | Ga0055540_1005671 | 3300003792 | Bacteria | 5172 |
| 65 | Ga0055540_1010745 | 3300003792 | Bacteria | 3022 |
| 66 | Ga0055531_10004086 | 3300003794 | Bacteria | 9038 |
| 67 | Ga0055531_10004879 | 3300003794 | Bacteria | 7993 |
| 68 | Ga0058692_1001739 | 3300003856 | Bacteria | 7755 |
| 69 | Ga0055543_1000003 | 3300004625 | Bacteria | 358656 |
| 70 | Ga0055543_1000047 | 3300004625 | Bacteria | 111073 |
| 71 | Ga0055543_1000355 | 3300004625 | Bacteria | 31085 |
| 72 | Ga0065165_1000013 | 3300005262 | Bacteria | 301887 |
| 73 | Ga0065165_1000026 | 3300005262 | Bacteria | 233376 |
| 74 | Ga0065165_1000068 | 3300005262 | Bacteria | 170609 |
| 75 | Ga0065165_1003530 | 3300005262 | Bacteria | 10825 |
| 76 | Ga0065714_10000178 | 3300005288 | Bacteria | 8386 |
| 77 | Ga0065714_10012843 | 3300005288 | Bacteria | 3773 |
| 78 | Ga0065714_10065762 | 3300005288 | Bacteria | 8606 |
| 79 | Ga0065714_10070084 | 3300005288 | Bacteria | 3968 |
| 80 | Ga0065714_10106726 | 3300005288 | Bacteria | 1543 |
| 81 | Ga0065712_10007353 | 3300005290 | Bacteria | 7474 |
| 82 | Ga0065715_10027883 | 3300005293 | Bacteria | 2329 |
| 83 | Ga0070658_10000115 | 3300005327 | Bacteria | 72027 |
| 84 | Ga0070658_10012728 | 3300005327 | Bacteria | 6748 |
| 85 | Ga0070658_10038151 | 3300005327 | Bacteria | 3875 |
| 86 | Ga0070658_10038361 | 3300005327 | Bacteria | 3863 |
| 87 | Ga0070683_100028048 | 3300005329 | Bacteria | 5085 |
| 88 | Ga0070683_100223864 | 3300005329 | Bacteria | 1788 |
| 89 | Ga0070683_100262281 | 3300005329 | Bacteria | 1644 |
| 90 | Ga0070690_100003585 | 3300005330 | Bacteria | 8528 |
| 91 | Ga0070690_100005518 | 3300005330 | Bacteria | 7115 |
| 92 | Ga0070690_100034720 | 3300005330 | Bacteria | 3161 |
| 93 | Ga0070690_100096304 | 3300005330 | Bacteria | 1956 |
| 94 | Ga0070670_100000515 | 3300005331 | Bacteria | 30924 |
| 95 | Ga0070670_100008496 | 3300005331 | Bacteria | 8758 |
| 96 | Ga0070670_100019091 | 3300005331 | Bacteria | 5879 |
| 97 | Ga0070670_100076542 | 3300005331 | Bacteria | 2875 |
| 98 | Ga0070666_10000544 | 3300005335 | Bacteria | 22761 |
| 99 | Ga0070666_10002592 | 3300005335 | Bacteria | 10922 |
| 100 | Ga0070680_100092799 | 3300005336 | Bacteria | 2500 |
| 101 | Ga0070682_100000925 | 3300005337 | Bacteria | 17113 |
| 102 | Ga0068868_100009860 | 3300005338 | Bacteria | 6896 |
| 103 | Ga0070660_100010552 | 3300005339 | Bacteria | 6529 |
| 104 | Ga0070660_100010563 | 3300005339 | Bacteria | 6524 |
| 105 | Ga0070660_100010989 | 3300005339 | Bacteria | 6415 |
| 106 | Ga0070660_100058511 | 3300005339 | Bacteria | 2987 |
| 107 | Ga0070660_100184257 | 3300005339 | Bacteria | 1690 |
| 108 | Ga0070689_100001087 | 3300005340 | Bacteria | 17046 |
| 109 | Ga0070691_10002849 | 3300005341 | Bacteria | 7742 |
| 110 | Ga0070687_100006424 | 3300005343 | Bacteria | 4817 |
| 111 | Ga0070661_100001127 | 3300005344 | Bacteria | 18765 |
| 112 | Ga0070661_100086529 | 3300005344 | Bacteria | 2317 |
| 113 | Ga0070692_10004469 | 3300005345 | Bacteria | 5849 |
| 114 | Ga0070692_10011484 | 3300005345 | Bacteria | 4068 |
| 115 | Ga0070668_100001269 | 3300005347 | Bacteria | 18012 |
| 116 | Ga0070668_100009332 | 3300005347 | Bacteria | 7278 |
| 117 | Ga0070668_100011919 | 3300005347 | Bacteria | 6472 |
| 118 | Ga0070668_100046733 | 3300005347 | Bacteria | 3326 |
| 119 | Ga0070668_100068691 | 3300005347 | Bacteria | 2755 |
| 120 | Ga0070668_100072494 | 3300005347 | Bacteria | 2683 |
| 121 | Ga0070669_100000012 | 3300005353 | Bacteria | 211302 |
| 122 | Ga0070669_100010577 | 3300005353 | Bacteria | 6551 |
| 123 | Ga0070675_100086044 | 3300005354 | Bacteria | 2627 |
| 124 | Ga0070671_100000006 | 3300005355 | Bacteria | 250635 |
| 125 | Ga0070671_100008175 | 3300005355 | Bacteria | 8371 |
| 126 | Ga0070671_100034405 | 3300005355 | Bacteria | 4195 |
| 127 | Ga0070674_100211489 | 3300005356 | Bacteria | 1503 |
| 128 | Ga0070673_100005483 | 3300005364 | Bacteria | 8123 |
| 129 | Ga0070688_100001689 | 3300005365 | Bacteria | 11028 |
| 130 | Ga0070659_100001552 | 3300005366 | Bacteria | 16572 |
| 131 | Ga0070667_100005567 | 3300005367 | Bacteria | 10515 |
| 132 | Ga0070667_100007827 | 3300005367 | Bacteria | 8863 |
| 133 | Ga0070703_10010999 | 3300005406 | Bacteria | 2554 |
| 134 | Ga0070709_10002492 | 3300005434 | Bacteria | 9966 |
| 135 | Ga0070709_10028933 | 3300005434 | Bacteria | 3309 |
| 136 | Ga0070709_10079269 | 3300005434 | Bacteria | 2139 |
| 137 | Ga0070714_100023734 | 3300005435 | Bacteria | 5042 |
| 138 | Ga0070714_100038414 | 3300005435 | Bacteria | 4024 |
| 139 | Ga0070713_100035660 | 3300005436 | Bacteria | 4007 |
| 140 | Ga0070710_10001696 | 3300005437 | Bacteria | 10379 |
| 141 | Ga0070711_100017961 | 3300005439 | Bacteria | 4509 |
| 142 | Ga0070711_100021276 | 3300005439 | Bacteria | 4191 |
| 143 | Ga0070711_100215964 | 3300005439 | Bacteria | 1488 |
| 144 | Ga0070705_100001003 | 3300005440 | Bacteria | 15730 |
| 145 | Ga0070705_100018853 | 3300005440 | Bacteria | 3623 |
| 146 | Ga0070700_100005734 | 3300005441 | Bacteria | 6589 |
| 147 | Ga0070700_100009949 | 3300005441 | Bacteria | 5233 |
| 148 | Ga0070694_100029953 | 3300005444 | Bacteria | 3556 |
| 149 | Ga0070708_100164311 | 3300005445 | Bacteria | 2070 |
| 150 | Ga0070663_100002743 | 3300005455 | Bacteria | 9979 |
| 151 | Ga0070663_100149367 | 3300005455 | Bacteria | 1791 |
| 152 | Ga0070678_100007142 | 3300005456 | Bacteria | 6603 |
| 153 | Ga0070678_100130462 | 3300005456 | Bacteria | 1996 |
| 154 | Ga0070662_100006832 | 3300005457 | Bacteria | 7377 |
| 155 | Ga0070662_100074667 | 3300005457 | Bacteria | 2509 |
| 156 | Ga0068867_100011024 | 3300005459 | Bacteria | 6375 |
| 157 | Ga0070685_10030634 | 3300005466 | Bacteria | 3000 |
| 158 | Ga0070679_100043670 | 3300005530 | Bacteria | 4463 |
| 159 | Ga0070679_100087105 | 3300005530 | Bacteria | 3110 |
| 160 | Ga0070684_100149525 | 3300005535 | Bacteria | 2115 |
| 161 | Ga0070697_100002319 | 3300005536 | Bacteria | 14622 |
| 162 | Ga0068853_100006365 | 3300005539 | Bacteria | 9375 |
| 163 | Ga0068853_100011416 | 3300005539 | Bacteria | 7216 |
| 164 | Ga0068853_100033238 | 3300005539 | Bacteria | 4375 |
| 165 | Ga0068853_100042340 | 3300005539 | Bacteria | 3893 |
| 166 | Ga0070686_100000175 | 3300005544 | Bacteria | 45160 |
| 167 | Ga0070686_100009379 | 3300005544 | Bacteria | 5501 |
| 168 | Ga0070695_100001902 | 3300005545 | Bacteria | 11817 |
| 169 | Ga0070695_100003227 | 3300005545 | Bacteria | 9518 |
| 170 | Ga0070696_100005973 | 3300005546 | Bacteria | 8125 |
| 171 | Ga0070696_100315359 | 3300005546 | Bacteria | 1202 |
| 172 | Ga0070693_100000527 | 3300005547 | Bacteria | 17176 |
| 173 | Ga0070693_100054562 | 3300005547 | Bacteria | 2299 |
| 174 | Ga0070693_100125349 | 3300005547 | Bacteria | 1598 |
| 175 | Ga0070665_100002086 | 3300005548 | Bacteria | 22429 |
| 176 | Ga0070665_100007051 | 3300005548 | Bacteria | 11417 |
| 177 | Ga0070665_100015259 | 3300005548 | Bacteria | 7712 |
| 178 | Ga0070665_100035091 | 3300005548 | Bacteria | 5043 |
| 179 | Ga0070665_100052825 | 3300005548 | Bacteria | 4075 |
| 180 | Ga0070665_100058389 | 3300005548 | Bacteria | 3868 |
| 181 | Ga0070665_100067282 | 3300005548 | Bacteria | 3592 |
| 182 | Ga0070665_100160239 | 3300005548 | Bacteria | 2252 |
| 183 | Ga0070704_100003817 | 3300005549 | Bacteria | 8673 |
| 184 | Ga0068855_100010084 | 3300005563 | Bacteria | 11387 |
| 185 | Ga0068855_100037000 | 3300005563 | Bacteria | 5807 |
| 186 | Ga0068855_100097741 | 3300005563 | Bacteria | 3382 |
| 187 | Ga0068855_100123235 | 3300005563 | Bacteria | 2966 |
| 188 | Ga0068855_100154117 | 3300005563 | Bacteria | 2611 |
| 189 | Ga0068855_100230726 | 3300005563 | Bacteria | 2073 |
| 190 | Ga0070664_100011523 | 3300005564 | Bacteria | 7177 |
| 191 | Ga0068857_100002111 | 3300005577 | Bacteria | 16157 |
| 192 | Ga0068857_100244163 | 3300005577 | Bacteria | 1645 |
| 193 | Ga0068854_100022865 | 3300005578 | Bacteria | 4265 |
| 194 | Ga0068854_100049011 | 3300005578 | Bacteria | 3016 |
| 195 | Ga0068854_100072675 | 3300005578 | Bacteria | 2519 |
| 196 | Ga0068854_100077792 | 3300005578 | Bacteria | 2442 |
| 197 | Ga0068854_100227419 | 3300005578 | Bacteria | 1479 |
| 198 | Ga0068854_100282419 | 3300005578 | Bacteria | 1337 |
| 199 | Ga0068856_100012739 | 3300005614 | Bacteria | 8142 |
| 200 | Ga0068856_100032737 | 3300005614 | Bacteria | 5091 |
| 201 | Ga0068856_100301729 | 3300005614 | Bacteria | 1619 |
| 202 | Ga0068856_100428139 | 3300005614 | Bacteria | 1343 |
| 203 | Ga0070702_100001296 | 3300005615 | Bacteria | 10137 |
| 204 | Ga0070702_100024869 | 3300005615 | Bacteria | 3201 |
| 205 | Ga0068852_100013171 | 3300005616 | Bacteria | 6320 |
| 206 | Ga0068852_100018126 | 3300005616 | Bacteria | 5541 |
| 207 | Ga0068852_100037637 | 3300005616 | Bacteria | 4058 |
| 208 | Ga0068852_100043421 | 3300005616 | Bacteria | 3813 |
| 209 | Ga0068859_100000303 | 3300005617 | Bacteria | 48928 |
| 210 | Ga0068859_100022477 | 3300005617 | Bacteria | 6324 |
| 211 | Ga0068864_100002024 | 3300005618 | Bacteria | 16727 |
| 212 | Ga0068864_100003487 | 3300005618 | Bacteria | 13001 |
| 213 | Ga0068864_100046732 | 3300005618 | Bacteria | 3715 |
| 214 | Ga0068861_100000068 | 3300005719 | Bacteria | 49630 |
| 215 | Ga0068861_100006058 | 3300005719 | Bacteria | 8224 |
| 216 | Ga0068861_100016621 | 3300005719 | Bacteria | 5210 |
| 217 | Ga0068863_100015068 | 3300005841 | Bacteria | 7427 |
| 218 | Ga0068863_100212413 | 3300005841 | Bacteria | 1863 |
| 219 | Ga0068858_100002445 | 3300005842 | Bacteria | 18770 |
| 220 | Ga0068858_100007331 | 3300005842 | Bacteria | 10675 |
| 221 | Ga0068860_100003525 | 3300005843 | Bacteria | 16092 |
| 222 | Ga0068860_100004219 | 3300005843 | Bacteria | 14731 |
| 223 | Ga0068862_100000222 | 3300005844 | Bacteria | 62883 |
| 224 | Ga0068862_100003748 | 3300005844 | Bacteria | 12965 |
| 225 | Ga0068862_100064655 | 3300005844 | Bacteria | 3149 |
| 226 | Ga0081455_10000085 | 3300005937 | Bacteria | 101651 |
| 227 | Ga0081455_10002838 | 3300005937 | Bacteria | 20395 |
| 228 | Ga0081455_10010430 | 3300005937 | Bacteria | 9433 |
| 229 | Ga0081455_10086461 | 3300005937 | Bacteria | 2554 |
| 230 | Ga0081455_10108216 | 3300005937 | Bacteria | 2215 |
| 231 | Ga0081455_10130514 | 3300005937 | Bacteria | 1965 |
| 232 | Ga0081538_10007329 | 3300005981 | Bacteria | 9552 |
| 233 | Ga0081540_1000566 | 3300005983 | Bacteria | 35881 |
| 234 | Ga0081540_1028435 | 3300005983 | Bacteria | 3140 |
| 235 | Ga0081539_10001521 | 3300005985 | Bacteria | 38875 |
| 236 | Ga0075365_10000068 | 3300006038 | Bacteria | 31130 |
| 237 | Ga0075365_10001419 | 3300006038 | Bacteria | 10826 |
| 238 | Ga0075365_10003339 | 3300006038 | Bacteria | 8246 |
| 239 | Ga0075365_10022375 | 3300006038 | Bacteria | 3960 |
| 240 | Ga0075365_10064544 | 3300006038 | Bacteria | 2453 |
| 241 | Ga0075368_10002310 | 3300006042 | Bacteria | 6190 |
| 242 | Ga0075368_10013155 | 3300006042 | Bacteria | 3036 |
| 243 | Ga0075368_10031988 | 3300006042 | Bacteria | 2042 |
| 244 | Ga0075363_100010518 | 3300006048 | Bacteria | 4400 |
| 245 | Ga0075363_100028520 | 3300006048 | Bacteria | 2872 |
| 246 | Ga0075363_100090054 | 3300006048 | Bacteria | 1687 |
| 247 | Ga0075363_100097361 | 3300006048 | Bacteria | 1625 |
| 248 | Ga0075364_10000023 | 3300006051 | Bacteria | 52112 |
| 249 | Ga0075364_10001246 | 3300006051 | Bacteria | 13675 |
| 250 | Ga0075364_10030904 | 3300006051 | Bacteria | 3439 |
| 251 | Ga0075364_10067536 | 3300006051 | Bacteria | 2350 |
| 252 | Ga0075432_10003110 | 3300006058 | Bacteria | 5604 |
| 253 | Ga0075432_10003786 | 3300006058 | Bacteria | 5154 |
| 254 | Ga0075432_10006500 | 3300006058 | Bacteria | 3978 |
| 255 | Ga0070715_10002097 | 3300006163 | Bacteria | 6027 |
| 256 | Ga0070716_100031664 | 3300006173 | Bacteria | 2878 |
| 257 | Ga0070712_100004491 | 3300006175 | Bacteria | 8614 |
| 258 | Ga0075362_10018143 | 3300006177 | Bacteria | 2907 |
| 259 | Ga0075362_10031839 | 3300006177 | Bacteria | 2285 |
| 260 | Ga0075367_10007206 | 3300006178 | Bacteria | 5677 |
| 261 | Ga0075367_10014330 | 3300006178 | Bacteria | 4291 |
| 262 | Ga0075367_10017282 | 3300006178 | Bacteria | 3956 |
| 263 | Ga0075367_10020097 | 3300006178 | Bacteria | 3714 |
| 264 | Ga0075367_10090870 | 3300006178 | Bacteria | 1857 |
| 265 | Ga0075367_10094307 | 3300006178 | Bacteria | 1824 |
| 266 | Ga0075367_10113637 | 3300006178 | Bacteria | 1664 |
| 267 | Ga0075369_10001599 | 3300006186 | Bacteria | 7789 |
| 268 | Ga0075369_10016859 | 3300006186 | Bacteria | 2954 |
| 269 | Ga0075369_10063135 | 3300006186 | Bacteria | 1620 |
| 270 | Ga0075366_10000495 | 3300006195 | Bacteria | 18223 |
| 271 | Ga0075366_10082884 | 3300006195 | Bacteria | 1916 |
| 272 | Ga0097621_100008926 | 3300006237 | Bacteria | 7247 |
| 273 | Ga0075370_10003151 | 3300006353 | Bacteria | 7790 |
| 274 | Ga0075370_10017904 | 3300006353 | Bacteria | 3834 |
| 275 | Ga0068871_100012799 | 3300006358 | Bacteria | 6208 |
| 276 | Ga0075428_100009932 | 3300006844 | Bacteria | 10572 |
| 277 | Ga0075428_100014282 | 3300006844 | Bacteria | 8831 |
| 278 | Ga0075428_100111329 | 3300006844 | Bacteria | 2983 |
| 279 | Ga0075428_100154978 | 3300006844 | Bacteria | 2489 |
| 280 | Ga0075428_100158062 | 3300006844 | Bacteria | 2461 |
| 281 | Ga0075430_100060765 | 3300006846 | Bacteria | 3176 |
| 282 | Ga0075430_100180111 | 3300006846 | Bacteria | 1758 |
| 283 | Ga0075431_100001296 | 3300006847 | Bacteria | 22847 |
| 284 | Ga0075431_100008939 | 3300006847 | Bacteria | 10039 |
| 285 | Ga0075431_100031890 | 3300006847 | Bacteria | 5428 |
| 286 | Ga0075431_100111026 | 3300006847 | Bacteria | 2830 |
| 287 | Ga0075431_100347781 | 3300006847 | Bacteria | 1491 |
| 288 | Ga0075433_10010455 | 3300006852 | Bacteria | 7451 |
| 289 | Ga0075433_10022732 | 3300006852 | Bacteria | 5268 |
| 290 | Ga0075434_100024485 | 3300006871 | Bacteria | 5901 |
| 291 | Ga0075434_100037816 | 3300006871 | Bacteria | 4778 |
| 292 | Ga0075434_100082433 | 3300006871 | Bacteria | 3213 |
| 293 | Ga0075429_100002571 | 3300006880 | Bacteria | 15296 |
| 294 | Ga0075429_100071754 | 3300006880 | Bacteria | 3016 |
| 295 | Ga0075429_100103025 | 3300006880 | Bacteria | 2492 |
| 296 | Ga0068865_100017949 | 3300006881 | Bacteria | 4559 |
| 297 | Ga0075436_100013064 | 3300006914 | Bacteria | 5692 |
| 298 | Ga0075436_100106952 | 3300006914 | Bacteria | 1951 |
| 299 | Ga0097620_100000303 | 3300006931 | Bacteria | 48928 |
| 300 | Ga0097620_100022477 | 3300006931 | Bacteria | 6324 |
| 301 | Ga0079104_1000242 | 3300006946 | Bacteria | 72707 |
| 302 | Ga0079104_1016712 | 3300006946 | Bacteria | 2135 |
| 303 | Ga0099826_10000841 | 3300006948 | Bacteria | 16595 |
| 304 | Ga0075435_100007536 | 3300007076 | Bacteria | 7769 |
| 305 | Ga0099795_10000032 | 3300007788 | Bacteria | 37057 |
| 306 | Ga0099795_10022242 | 3300007788 | Bacteria | 2091 |
| 307 | Ga0105251_10032150 | 3300009011 | Bacteria | 2618 |
| 308 | Ga0105244_10038974 | 3300009036 | Bacteria | 2476 |
| 309 | Ga0105244_10067730 | 3300009036 | Bacteria | 1785 |
| 310 | Ga0105250_10018806 | 3300009092 | Bacteria | 2795 |
| 311 | Ga0105240_10000028 | 3300009093 | Bacteria | 347789 |
| 312 | Ga0105240_10000076 | 3300009093 | Bacteria | 198848 |
| 313 | Ga0105240_10036562 | 3300009093 | Bacteria | 6314 |
| 314 | Ga0105240_10064551 | 3300009093 | Bacteria | 4549 |
| 315 | Ga0105240_10115849 | 3300009093 | Bacteria | 3234 |
| 316 | Ga0105240_10197548 | 3300009093 | Bacteria | 2360 |
| 317 | Ga0105240_10258727 | 3300009093 | Bacteria | 2009 |
| 318 | Ga0105240_10456874 | 3300009093 | Bacteria | 1428 |
| 319 | Ga0111539_10001004 | 3300009094 | Bacteria | 36978 |
| 320 | Ga0111539_10035026 | 3300009094 | Bacteria | 6080 |
| 321 | Ga0111539_10125173 | 3300009094 | Bacteria | 3012 |
| 322 | Ga0111539_10225320 | 3300009094 | Bacteria | 2184 |
| 323 | Ga0111539_10276310 | 3300009094 | Bacteria | 1955 |
| 324 | Ga0111539_10483727 | 3300009094 | Bacteria | 1442 |
| 325 | Ga0111539_10563679 | 3300009094 | Bacteria | 1326 |
| 326 | Ga0105245_10037358 | 3300009098 | Bacteria | 4317 |
| 327 | Ga0105247_10003685 | 3300009101 | Bacteria | 9943 |
| 328 | Ga0105247_10004179 | 3300009101 | Bacteria | 9266 |
| 329 | Ga0114129_10000717 | 3300009147 | Bacteria | 41954 |
| 330 | Ga0114129_10034862 | 3300009147 | Bacteria | 7110 |
| 331 | Ga0114129_10222103 | 3300009147 | Bacteria | 2548 |
| 332 | Ga0114129_10251576 | 3300009147 | Bacteria | 2372 |
| 333 | Ga0114129_10326787 | 3300009147 | Bacteria | 2037 |
| 334 | Ga0105243_10003392 | 3300009148 | Bacteria | 12922 |
| 335 | Ga0105243_10004327 | 3300009148 | Bacteria | 11246 |
| 336 | Ga0105243_10162824 | 3300009148 | Bacteria | 1925 |
| 337 | Ga0105242_10018125 | 3300009176 | Bacteria | 5499 |
| 338 | Ga0105248_10001946 | 3300009177 | Bacteria | 22943 |
| 339 | Ga0105237_10000226 | 3300009545 | Bacteria | 79798 |
| 340 | Ga0105237_10003921 | 3300009545 | Bacteria | 17431 |
| 341 | Ga0105237_10006872 | 3300009545 | Bacteria | 12546 |
| 342 | Ga0105237_10034855 | 3300009545 | Bacteria | 5093 |
| 343 | Ga0105237_10064529 | 3300009545 | Bacteria | 3658 |
| 344 | Ga0105237_10389291 | 3300009545 | Bacteria | 1399 |
| 345 | Ga0105238_10005446 | 3300009551 | Bacteria | 12572 |
| 346 | Ga0105238_10011069 | 3300009551 | Bacteria | 9065 |
| 347 | Ga0105238_10445648 | 3300009551 | Bacteria | 1291 |
| 348 | Ga0105249_10001500 | 3300009553 | Bacteria | 20468 |
| 349 | Ga0105249_10001582 | 3300009553 | Bacteria | 19970 |
| 350 | Ga0123341_1000007 | 3300009765 | Bacteria | 147072 |
| 351 | Ga0099796_10000020 | 3300010159 | Bacteria | 41259 |
| 352 | Ga0105239_10003384 | 3300010375 | Bacteria | 19568 |
| 353 | Ga0105239_10004650 | 3300010375 | Bacteria | 16317 |
| 354 | Ga0105239_10019613 | 3300010375 | Bacteria | 7463 |
| 355 | Ga0105239_10030720 | 3300010375 | Bacteria | 5909 |
| 356 | Ga0105239_10081150 | 3300010375 | Bacteria | 3570 |
| 357 | Ga0105239_10130574 | 3300010375 | Bacteria | 2794 |
| 358 | Ga0105239_10336056 | 3300010375 | Bacteria | 1704 |
| 359 | Ga0105246_10004363 | 3300011119 | Bacteria | 8609 |
| 360 | Ga0157373_10011394 | 3300013100 | Bacteria | 6539 |
| 361 | Ga0157373_10109444 | 3300013100 | Bacteria | 1943 |
| 362 | Ga0157371_10000017 | 3300013102 | Bacteria | 320830 |
| 363 | Ga0157371_10000739 | 3300013102 | Bacteria | 38165 |
| 364 | Ga0157371_10003248 | 3300013102 | Bacteria | 14909 |
| 365 | Ga0157371_10006289 | 3300013102 | Bacteria | 9837 |
| 366 | Ga0157370_10000494 | 3300013104 | Bacteria | 49013 |
| 367 | Ga0157370_10001902 | 3300013104 | Bacteria | 25703 |
| 368 | Ga0157370_10004750 | 3300013104 | Bacteria | 15463 |
| 369 | Ga0157370_10034314 | 3300013104 | Bacteria | 4942 |
| 370 | Ga0157370_10063008 | 3300013104 | Bacteria | 3514 |
| 371 | Ga0157370_10069140 | 3300013104 | Bacteria | 3336 |
| 372 | Ga0157370_10248826 | 3300013104 | Bacteria | 1644 |
| 373 | Ga0157370_10416910 | 3300013104 | Bacteria | 1235 |
| 374 | Ga0157369_10039677 | 3300013105 | Bacteria | 5145 |
| 375 | Ga0157369_10116856 | 3300013105 | Bacteria | 2832 |
| 376 | Ga0157369_10120642 | 3300013105 | Bacteria | 2782 |
| 377 | Ga0157369_10236145 | 3300013105 | Bacteria | 1910 |
| 378 | Ga0171463_1003 | 3300013249 | Bacteria | 695693 |
| 379 | Ga0157374_10028786 | 3300013296 | Bacteria | 5022 |
| 380 | Ga0157374_10072533 | 3300013296 | Bacteria | 3248 |
| 381 | Ga0157378_10007872 | 3300013297 | Bacteria | 9299 |
| 382 | Ga0157378_10089784 | 3300013297 | Bacteria | 2792 |
| 383 | Ga0163162_10002906 | 3300013306 | Bacteria | 16316 |
| 384 | Ga0163162_10008951 | 3300013306 | Bacteria | 9732 |
| 385 | Ga0163162_10048385 | 3300013306 | Bacteria | 4260 |
| 386 | Ga0157372_10028979 | 3300013307 | Bacteria | 6040 |
| 387 | Ga0157372_10032223 | 3300013307 | Bacteria | 5745 |
| 388 | Ga0157372_10032521 | 3300013307 | Bacteria | 5721 |
| 389 | Ga0157375_10041224 | 3300013308 | Bacteria | 4456 |
| 390 | Ga0157375_10284075 | 3300013308 | Bacteria | 1818 |
| 391 | Ga0157375_10356042 | 3300013308 | Bacteria | 1630 |
| 392 | Ga0163163_10029879 | 3300014325 | Bacteria | 5244 |
| 393 | Ga0163163_10057034 | 3300014325 | Bacteria | 3861 |
| 394 | Ga0163163_10083456 | 3300014325 | Bacteria | 3200 |
| 395 | Ga0163163_10150353 | 3300014325 | Bacteria | 2372 |
| 396 | Ga0163163_10340327 | 3300014325 | Bacteria | 1555 |
| 397 | Ga0157380_10006541 | 3300014326 | Bacteria | 8215 |
| 398 | Ga0157380_10261899 | 3300014326 | Bacteria | 1571 |
| 399 | Ga0182008_10038707 | 3300014497 | Bacteria | 2384 |
| 400 | Ga0157377_10008238 | 3300014745 | Bacteria | 5074 |
| 401 | Ga0157379_10013267 | 3300014968 | Bacteria | 7216 |
| 402 | Ga0157379_10019661 | 3300014968 | Bacteria | 5967 |
| 403 | Ga0157379_10055415 | 3300014968 | Bacteria | 3542 |
| 404 | Ga0157376_10002750 | 3300014969 | Bacteria | 12010 |
| 405 | Ga0157376_10266996 | 3300014969 | Bacteria | 1606 |
| 406 | Ga0182006_1000385 | 3300015261 | Bacteria | 36409 |
| 407 | Ga0182006_1026757 | 3300015261 | Bacteria | 2359 |
| 408 | Ga0182007_10000286 | 3300015262 | Bacteria | 33489 |
| 409 | Ga0182007_10002059 | 3300015262 | Bacteria | 10333 |
| 410 | Ga0182005_1003541 | 3300015265 | Bacteria | 5270 |
| 411 | Ga0182005_1026178 | 3300015265 | Bacteria | 1592 |
| 412 | Ga0183363_1085 | 3300015690 | Bacteria | 28396 |
| 413 | Ga0163161_10002366 | 3300017792 | Bacteria | 13514 |
| 414 | Ga0163161_10015581 | 3300017792 | Bacteria | 5301 |
| 415 | Ga0163161_10034859 | 3300017792 | Bacteria | 3600 |
| 416 | Ga0163161_10079586 | 3300017792 | Bacteria | 2410 |
| 417 | Ga0163161_10091175 | 3300017792 | Bacteria | 2255 |
| 418 | Ga0206356_11203268 | 3300020070 | Bacteria | 2314 |
| 419 | Ga0214544_1003096 | 3300021320 | Bacteria | 34775 |
| 420 | Ga0214542_1000012 | 3300021321 | Bacteria | 235800 |
| 421 | Ga0214542_1013089 | 3300021321 | Bacteria | 10220 |
| 422 | Ga0214543_1000024 | 3300021327 | Bacteria | 235745 |
| 423 | Ga0214543_1000038 | 3300021327 | Bacteria | 182106 |
| 424 | Ga0213876_10001237 | 3300021384 | Bacteria | 16109 |
| 425 | Ga0213875_10000067 | 3300021388 | Bacteria | 127481 |
| 426 | Ga0228711_1010496 | 3300022739 | Bacteria | 12155 |
| 427 | Ga0228710_1010751 | 3300022740 | Bacteria | 12109 |
| 428 | Ga0209435_100012 | 3300025206 | Bacteria | 401621 |
| 429 | Ga0209760_100109 | 3300025207 | Bacteria | 58898 |
| 430 | Ga0209436_100147 | 3300025208 | Bacteria | 34133 |
| 431 | Ga0209436_103527 | 3300025208 | Bacteria | 4123 |
| 432 | Ga0209436_109845 | 3300025208 | Bacteria | 1788 |
| 433 | Ga0207427_100114 | 3300025231 | Bacteria | 104357 |
| 434 | Ga0207427_100636 | 3300025231 | Bacteria | 17040 |
| 435 | Ga0209437_100051 | 3300025233 | Bacteria | 392523 |
| 436 | Ga0209437_100098 | 3300025233 | Bacteria | 229766 |
| 437 | Ga0209437_100219 | 3300025233 | Bacteria | 104357 |
| 438 | Ga0209437_106862 | 3300025233 | Bacteria | 1879 |
| 439 | Ga0207425_1000075 | 3300025245 | Bacteria | 107452 |
| 440 | Ga0207425_1001868 | 3300025245 | Bacteria | 8076 |
| 441 | Ga0209646_1000026 | 3300025246 | Bacteria | 401621 |
| 442 | Ga0209026_1000014 | 3300025250 | Bacteria | 401621 |
| 443 | Ga0209026_1000023 | 3300025250 | Bacteria | 357521 |
| 444 | Ga0209026_1000029 | 3300025250 | Bacteria | 337109 |
| 445 | Ga0209677_101213 | 3300025253 | Bacteria | 11737 |
| 446 | Ga0209148_1000080 | 3300025254 | Bacteria | 277806 |
| 447 | Ga0209148_1003734 | 3300025254 | Bacteria | 4021 |
| 448 | Ga0209759_1000012 | 3300025256 | Bacteria | 401621 |
| 449 | Ga0209759_1000167 | 3300025256 | Bacteria | 112160 |
| 450 | Ga0209759_1000393 | 3300025256 | Bacteria | 54357 |
| 451 | Ga0209129_1000156 | 3300025258 | Bacteria | 107484 |
| 452 | Ga0209129_1000218 | 3300025258 | Bacteria | 66076 |
| 453 | Ga0209129_1000537 | 3300025258 | Bacteria | 26442 |
| 454 | Ga0209129_1000876 | 3300025258 | Bacteria | 18555 |
| 455 | Ga0209129_1008635 | 3300025258 | Bacteria | 2805 |
| 456 | Ga0209233_1000012 | 3300025261 | Bacteria | 1019519 |
| 457 | Ga0209233_1000028 | 3300025261 | Bacteria | 642062 |
| 458 | Ga0209233_1000095 | 3300025261 | Bacteria | 303783 |
| 459 | Ga0209233_1000113 | 3300025261 | Bacteria | 253455 |
| 460 | Ga0209233_1000148 | 3300025261 | Bacteria | 185135 |
| 461 | Ga0209233_1000631 | 3300025261 | Bacteria | 17562 |
| 462 | Ga0209455_1000171 | 3300025272 | Bacteria | 109696 |
| 463 | Ga0209673_1000010 | 3300025273 | Bacteria | 596656 |
| 464 | Ga0209673_1000117 | 3300025273 | Bacteria | 172081 |
| 465 | Ga0209673_1000151 | 3300025273 | Bacteria | 148103 |
| 466 | Ga0209673_1001898 | 3300025273 | Bacteria | 16778 |
| 467 | Ga0209130_1000003 | 3300025284 | Bacteria | 677988 |
| 468 | Ga0209130_1000020 | 3300025284 | Bacteria | 379297 |
| 469 | Ga0209130_1000034 | 3300025284 | Bacteria | 302439 |
| 470 | Ga0209130_1000150 | 3300025284 | Bacteria | 108274 |
| 471 | Ga0209130_1000906 | 3300025284 | Bacteria | 23912 |
| 472 | Ga0209675_1000529 | 3300025291 | Bacteria | 27963 |
| 473 | Ga0209676_1001566 | 3300025292 | Bacteria | 20451 |
| 474 | Ga0209676_1004814 | 3300025292 | Bacteria | 7328 |
| 475 | Ga0209676_1011005 | 3300025292 | Bacteria | 3698 |
| 476 | Ga0209025_1000010 | 3300025294 | Bacteria | 986612 |
| 477 | Ga0209025_1000070 | 3300025294 | Bacteria | 287776 |
| 478 | Ga0209025_1000099 | 3300025294 | Bacteria | 231353 |
| 479 | Ga0209025_1000140 | 3300025294 | Bacteria | 184765 |
| 480 | Ga0209025_1000213 | 3300025294 | Bacteria | 139002 |
| 481 | Ga0209025_1000311 | 3300025294 | Bacteria | 108141 |
| 482 | Ga0209025_1000571 | 3300025294 | Bacteria | 66955 |
| 483 | Ga0209025_1001887 | 3300025294 | Bacteria | 24479 |
| 484 | Ga0209025_1003502 | 3300025294 | Bacteria | 14757 |
| 485 | Ga0209025_1009690 | 3300025294 | Bacteria | 6662 |
| 486 | Ga0209025_1019714 | 3300025294 | Bacteria | 3735 |
| 487 | Ga0209025_1038252 | 3300025294 | Bacteria | 2113 |
| 488 | Ga0209025_1056162 | 3300025294 | Bacteria | 1516 |
| 489 | Ga0209564_1000013 | 3300025295 | Bacteria | 775755 |
| 490 | Ga0209564_1000048 | 3300025295 | Bacteria | 364806 |
| 491 | Ga0209564_1000386 | 3300025295 | Bacteria | 79939 |
| 492 | Ga0209564_1000424 | 3300025295 | Bacteria | 74299 |
| 493 | Ga0209564_1003849 | 3300025295 | Bacteria | 9687 |
| 494 | Ga0209564_1008813 | 3300025295 | Bacteria | 4912 |
| 495 | Ga0209758_1000094 | 3300025297 | Bacteria | 241068 |
| 496 | Ga0209758_1000405 | 3300025297 | Bacteria | 73971 |
| 497 | Ga0209758_1000413 | 3300025297 | Bacteria | 72744 |
| 498 | Ga0209758_1001271 | 3300025297 | Bacteria | 31244 |
| 499 | Ga0209758_1004514 | 3300025297 | Bacteria | 11534 |
| 500 | Ga0209758_1008701 | 3300025297 | Bacteria | 6495 |
| 501 | Ga0209758_1009338 | 3300025297 | Bacteria | 6118 |
| 502 | Ga0209758_1009734 | 3300025297 | Bacteria | 5904 |
| 503 | Ga0209050_1000734 | 3300025298 | Bacteria | 47579 |
| 504 | Ga0209050_1006356 | 3300025298 | Bacteria | 7022 |
| 505 | Ga0209256_1000041 | 3300025299 | Bacteria | 364827 |
| 506 | Ga0209256_1000396 | 3300025299 | Bacteria | 69216 |
| 507 | Ga0209256_1000610 | 3300025299 | Bacteria | 49586 |
| 508 | Ga0209256_1000717 | 3300025299 | Bacteria | 43910 |
| 509 | Ga0209256_1000729 | 3300025299 | Bacteria | 43454 |
| 510 | Ga0209256_1002535 | 3300025299 | Bacteria | 14621 |
| 511 | Ga0209256_1003746 | 3300025299 | Bacteria | 10279 |
| 512 | Ga0209256_1003980 | 3300025299 | Bacteria | 9703 |
| 513 | Ga0207426_1000006 | 3300025302 | Bacteria | 1025969 |
| 514 | Ga0207426_1000008 | 3300025302 | Bacteria | 848730 |
| 515 | Ga0207426_1000011 | 3300025302 | Bacteria | 791203 |
| 516 | Ga0207426_1000065 | 3300025302 | Bacteria | 353625 |
| 517 | Ga0207426_1000394 | 3300025302 | Bacteria | 74327 |
| 518 | Ga0207426_1000449 | 3300025302 | Bacteria | 65802 |
| 519 | Ga0209051_1000097 | 3300025303 | Bacteria | 167378 |
| 520 | Ga0209051_1000314 | 3300025303 | Bacteria | 74316 |
| 521 | Ga0209051_1003938 | 3300025303 | Bacteria | 9463 |
| 522 | Ga0209051_1026414 | 3300025303 | Bacteria | 2341 |
| 523 | Ga0209257_1000302 | 3300025304 | Bacteria | 108038 |
| 524 | Ga0209257_1003955 | 3300025304 | Bacteria | 12028 |
| 525 | Ga0209257_1006318 | 3300025304 | Bacteria | 7714 |
| 526 | Ga0209257_1025324 | 3300025304 | Bacteria | 2029 |
| 527 | Ga0209257_1038013 | 3300025304 | Bacteria | 1462 |
| 528 | Ga0207697_10001617 | 3300025315 | Bacteria | 12162 |
| 529 | Ga0207655_1010754 | 3300025728 | Bacteria | 5520 |
| 530 | Ga0207655_1046058 | 3300025728 | Bacteria | 1815 |
| 531 | Ga0207713_1013193 | 3300025735 | Bacteria | 4371 |
| 532 | Ga0207713_1017718 | 3300025735 | Bacteria | 3556 |
| 533 | Ga0207692_10043940 | 3300025898 | Bacteria | 2227 |
| 534 | Ga0207710_10000638 | 3300025900 | Bacteria | 20100 |
| 535 | Ga0207710_10001624 | 3300025900 | Bacteria | 10982 |
| 536 | Ga0207680_10000023 | 3300025903 | Bacteria | 84146 |
| 537 | Ga0207680_10044146 | 3300025903 | Bacteria | 2619 |
| 538 | Ga0207647_10008196 | 3300025904 | Bacteria | 7507 |
| 539 | Ga0207647_10059910 | 3300025904 | Bacteria | 2328 |
| 540 | Ga0207685_10004327 | 3300025905 | Bacteria | 3595 |
| 541 | Ga0207699_10012588 | 3300025906 | Bacteria | 4307 |
| 542 | Ga0207699_10033136 | 3300025906 | Bacteria | 2917 |
| 543 | Ga0207645_10171585 | 3300025907 | Bacteria | 1422 |
| 544 | Ga0207705_10003682 | 3300025909 | Bacteria | 11660 |
| 545 | Ga0207705_10031308 | 3300025909 | Bacteria | 3796 |
| 546 | Ga0207705_10038810 | 3300025909 | Bacteria | 3411 |
| 547 | Ga0207705_10084083 | 3300025909 | Bacteria | 2323 |
| 548 | Ga0207695_10000011 | 3300025913 | Bacteria | 910221 |
| 549 | Ga0207695_10000088 | 3300025913 | Bacteria | 275833 |
| 550 | Ga0207695_10015356 | 3300025913 | Bacteria | 9017 |
| 551 | Ga0207695_10148683 | 3300025913 | Bacteria | 2283 |
| 552 | Ga0207695_10278669 | 3300025913 | Bacteria | 1566 |
| 553 | Ga0207671_10000093 | 3300025914 | Bacteria | 138939 |
| 554 | Ga0207671_10000368 | 3300025914 | Bacteria | 64246 |
| 555 | Ga0207671_10024233 | 3300025914 | Bacteria | 4567 |
| 556 | Ga0207671_10170518 | 3300025914 | Bacteria | 1690 |
| 557 | Ga0207693_10002851 | 3300025915 | Bacteria | 14970 |
| 558 | Ga0207663_10030938 | 3300025916 | Bacteria | 3162 |
| 559 | Ga0207660_10016785 | 3300025917 | Bacteria | 4855 |
| 560 | Ga0207660_10232795 | 3300025917 | Bacteria | 1449 |
| 561 | Ga0207662_10002364 | 3300025918 | Bacteria | 9455 |
| 562 | Ga0207657_10001218 | 3300025919 | Bacteria | 27415 |
| 563 | Ga0207657_10004999 | 3300025919 | Bacteria | 13931 |
| 564 | Ga0207657_10008223 | 3300025919 | Bacteria | 10621 |
| 565 | Ga0207657_10057585 | 3300025919 | Bacteria | 3348 |
| 566 | Ga0207649_10012372 | 3300025920 | Bacteria | 4733 |
| 567 | Ga0207649_10016880 | 3300025920 | Bacteria | 4130 |
| 568 | Ga0207649_10067350 | 3300025920 | Bacteria | 2272 |
| 569 | Ga0207649_10073961 | 3300025920 | Bacteria | 2185 |
| 570 | Ga0207649_10143927 | 3300025920 | Bacteria | 1634 |
| 571 | Ga0207652_10057622 | 3300025921 | Bacteria | 3346 |
| 572 | Ga0207652_10302574 | 3300025921 | Bacteria | 1443 |
| 573 | Ga0207646_10279254 | 3300025922 | Bacteria | 1509 |
| 574 | Ga0207681_10000004 | 3300025923 | Bacteria | 559005 |
| 575 | Ga0207681_10014839 | 3300025923 | Bacteria | 4851 |
| 576 | Ga0207681_10036835 | 3300025923 | Bacteria | 3230 |
| 577 | Ga0207694_10040372 | 3300025924 | Bacteria | 3592 |
| 578 | Ga0207694_10098828 | 3300025924 | Bacteria | 2311 |
| 579 | Ga0207694_10308791 | 3300025924 | Bacteria | 1303 |
| 580 | Ga0207650_10002272 | 3300025925 | Bacteria | 13416 |
| 581 | Ga0207650_10008291 | 3300025925 | Bacteria | 7096 |
| 582 | Ga0207650_10013146 | 3300025925 | Bacteria | 5729 |
| 583 | Ga0207650_10042106 | 3300025925 | Bacteria | 3350 |
| 584 | Ga0207659_10006123 | 3300025926 | Bacteria | 7349 |
| 585 | Ga0207687_10007687 | 3300025927 | Bacteria | 7080 |
| 586 | Ga0207700_10139893 | 3300025928 | Bacteria | 1987 |
| 587 | Ga0207700_10173452 | 3300025928 | Bacteria | 1801 |
| 588 | Ga0207664_10046042 | 3300025929 | Bacteria | 3423 |
| 589 | Ga0207664_10154515 | 3300025929 | Bacteria | 1952 |
| 590 | Ga0207644_10000009 | 3300025931 | Bacteria | 251643 |
| 591 | Ga0207644_10010500 | 3300025931 | Bacteria | 6104 |
| 592 | Ga0207644_10065896 | 3300025931 | Bacteria | 2635 |
| 593 | Ga0207690_10011287 | 3300025932 | Bacteria | 5337 |
| 594 | Ga0207690_10046314 | 3300025932 | Bacteria | 2880 |
| 595 | Ga0207706_10002603 | 3300025933 | Bacteria | 17564 |
| 596 | Ga0207706_10047395 | 3300025933 | Bacteria | 3802 |
| 597 | Ga0207686_10243665 | 3300025934 | Bacteria | 1310 |
| 598 | Ga0207709_10027572 | 3300025935 | Bacteria | 3274 |
| 599 | Ga0207670_10003291 | 3300025936 | Bacteria | 8559 |
| 600 | Ga0207669_10013036 | 3300025937 | Bacteria | 4113 |
| 601 | Ga0207704_10010142 | 3300025938 | Bacteria | 4579 |
| 602 | Ga0207704_10164837 | 3300025938 | Bacteria | 1582 |
| 603 | Ga0207665_10003784 | 3300025939 | Bacteria | 10106 |
| 604 | Ga0207691_10003385 | 3300025940 | Bacteria | 15515 |
| 605 | Ga0207691_10140542 | 3300025940 | Bacteria | 2128 |
| 606 | Ga0207711_10084358 | 3300025941 | Bacteria | 2780 |
| 607 | Ga0207711_10135510 | 3300025941 | Bacteria | 2211 |
| 608 | Ga0207661_10039077 | 3300025944 | Bacteria | 3723 |
| 609 | Ga0207661_10351606 | 3300025944 | Bacteria | 1330 |
| 610 | Ga0207679_10030316 | 3300025945 | Bacteria | 3775 |
| 611 | Ga0207679_10085495 | 3300025945 | Bacteria | 2423 |
| 612 | Ga0207679_10211714 | 3300025945 | Bacteria | 1626 |
| 613 | Ga0207667_10007864 | 3300025949 | Bacteria | 12735 |
| 614 | Ga0207667_10051811 | 3300025949 | Bacteria | 4325 |
| 615 | Ga0207667_10062660 | 3300025949 | Bacteria | 3887 |
| 616 | Ga0207667_10117255 | 3300025949 | Bacteria | 2744 |
| 617 | Ga0207667_10197550 | 3300025949 | Bacteria | 2063 |
| 618 | Ga0207651_10007136 | 3300025960 | Bacteria | 5935 |
| 619 | Ga0207651_10257102 | 3300025960 | Bacteria | 1432 |
| 620 | Ga0207712_10011208 | 3300025961 | Bacteria | 5709 |
| 621 | Ga0207712_10037841 | 3300025961 | Bacteria | 3295 |
| 622 | Ga0207712_10218850 | 3300025961 | Bacteria | 1521 |
| 623 | Ga0207668_10000169 | 3300025972 | Bacteria | 45173 |
| 624 | Ga0207668_10032057 | 3300025972 | Bacteria | 3469 |
| 625 | Ga0207668_10048245 | 3300025972 | Bacteria | 2921 |
| 626 | Ga0207668_10074744 | 3300025972 | Bacteria | 2434 |
| 627 | Ga0207668_10098224 | 3300025972 | Bacteria | 2169 |
| 628 | Ga0207640_10016981 | 3300025981 | Bacteria | 4249 |
| 629 | Ga0207640_10049307 | 3300025981 | Bacteria | 2726 |
| 630 | Ga0207640_10088697 | 3300025981 | Bacteria | 2136 |
| 631 | Ga0207640_10128462 | 3300025981 | Bacteria | 1828 |
| 632 | Ga0207640_10318481 | 3300025981 | Bacteria | 1237 |
| 633 | Ga0207658_10020412 | 3300025986 | Bacteria | 4588 |
| 634 | Ga0207658_10045699 | 3300025986 | Bacteria | 3193 |
| 635 | Ga0207677_10126961 | 3300026023 | Bacteria | 1929 |
| 636 | Ga0207703_10007713 | 3300026035 | Bacteria | 8522 |
| 637 | Ga0207639_10001916 | 3300026041 | Bacteria | 13965 |
| 638 | Ga0207639_10025379 | 3300026041 | Bacteria | 4297 |
| 639 | Ga0207639_10040856 | 3300026041 | Bacteria | 3465 |
| 640 | Ga0207678_10001222 | 3300026067 | Bacteria | 23629 |
| 641 | Ga0207678_10066022 | 3300026067 | Bacteria | 3107 |
| 642 | Ga0207678_10183948 | 3300026067 | Bacteria | 1784 |
| 643 | Ga0207708_10000385 | 3300026075 | Bacteria | 34524 |
| 644 | Ga0207708_10003153 | 3300026075 | Bacteria | 12139 |
| 645 | Ga0207702_10013749 | 3300026078 | Bacteria | 6722 |
| 646 | Ga0207702_10182589 | 3300026078 | Bacteria | 1933 |
| 647 | Ga0207702_10274838 | 3300026078 | Bacteria | 1590 |
| 648 | Ga0207702_10446373 | 3300026078 | Bacteria | 1254 |
| 649 | Ga0207641_10005070 | 3300026088 | Bacteria | 11294 |
| 650 | Ga0207641_10020177 | 3300026088 | Bacteria | 5471 |
| 651 | Ga0207648_10009094 | 3300026089 | Bacteria | 9550 |
| 652 | Ga0207676_10001820 | 3300026095 | Bacteria | 15614 |
| 653 | Ga0207676_10039025 | 3300026095 | Bacteria | 3629 |
| 654 | Ga0207674_10001584 | 3300026116 | Bacteria | 29294 |
| 655 | Ga0207674_10021080 | 3300026116 | Bacteria | 7027 |
| 656 | Ga0207674_10135331 | 3300026116 | Bacteria | 2426 |
| 657 | Ga0207675_100000060 | 3300026118 | Bacteria | 81241 |
| 658 | Ga0207675_100007201 | 3300026118 | Bacteria | 10503 |
| 659 | Ga0207675_100175378 | 3300026118 | Bacteria | 2051 |
| 660 | Ga0207683_10001503 | 3300026121 | Bacteria | 21014 |
| 661 | Ga0207698_10009822 | 3300026142 | Bacteria | 6116 |
| 662 | Ga0207698_10042092 | 3300026142 | Bacteria | 3410 |
| 663 | Ga0207698_10068687 | 3300026142 | Bacteria | 2799 |
| 664 | Ga0207698_10240238 | 3300026142 | Bacteria | 1650 |
| 665 | Ga0207698_10476863 | 3300026142 | Bacteria | 1209 |
| 666 | Ga0209281_1000245 | 3300027111 | Bacteria | 109870 |
| 667 | Ga0209281_1000246 | 3300027111 | Bacteria | 107513 |
| 668 | Ga0209281_1001017 | 3300027111 | Bacteria | 21872 |
| 669 | Ga0209371_1000022 | 3300027312 | Bacteria | 536342 |
| 670 | Ga0209371_1000173 | 3300027312 | Bacteria | 96201 |
| 671 | Ga0209371_1001156 | 3300027312 | Bacteria | 19303 |
| 672 | Ga0209179_1000063 | 3300027512 | Bacteria | 19219 |
| 673 | Ga0209282_1000563 | 3300027666 | Bacteria | 18029 |
| 674 | Ga0209282_1001720 | 3300027666 | Bacteria | 12231 |
| 675 | Ga0209813_10005557 | 3300027866 | Bacteria | 3066 |
| 676 | Ga0209813_10011809 | 3300027866 | Bacteria | 2292 |
| 677 | Ga0209974_10020284 | 3300027876 | Bacteria | 2203 |
| 678 | Ga0207428_10001431 | 3300027907 | Bacteria | 25080 |
| 679 | Ga0207428_10027225 | 3300027907 | Bacteria | 4762 |
| 680 | Ga0207428_10048219 | 3300027907 | Bacteria | 3418 |
| 681 | Ga0207428_10067766 | 3300027907 | Bacteria | 2810 |
| 682 | Ga0207428_10103303 | 3300027907 | Bacteria | 2200 |
| 683 | Ga0268266_10000243 | 3300028379 | Bacteria | 92211 |
| 684 | Ga0268266_10002745 | 3300028379 | Bacteria | 18393 |
| 685 | Ga0268266_10030921 | 3300028379 | Bacteria | 4547 |
| 686 | Ga0268266_10077476 | 3300028379 | Bacteria | 2890 |
| 687 | Ga0268266_10272384 | 3300028379 | Bacteria | 1572 |
| 688 | Ga0268265_10000576 | 3300028380 | Bacteria | 37132 |
| 689 | Ga0268265_10022524 | 3300028380 | Bacteria | 4428 |
| 690 | Ga0268264_10000069 | 3300028381 | Bacteria | 270492 |
| 691 | Ga0268264_10006449 | 3300028381 | Bacteria | 9877 |
| 692 | Ga0265318_10005250 | 3300028577 | Bacteria | 6100 |
| 693 | Ga0307517_10044289 | 3300028786 | Bacteria | 4711 |
| 694 | Ga0307515_10003171 | 3300028794 | Bacteria | 34790 |
| 695 | Ga0307515_10006338 | 3300028794 | Bacteria | 23697 |
| 696 | Ga0307515_10020078 | 3300028794 | Bacteria | 11960 |
| 697 | Ga0307515_10174514 | 3300028794 | Bacteria | 2126 |
| 698 | Ga0268256_1000019 | 3300030500 | Bacteria | 587949 |
| 699 | Ga0307511_10092817 | 3300030521 | Bacteria | 2033 |
| 700 | Ga0265330_10006061 | 3300031235 | Bacteria | 5987 |
| 701 | Ga0265330_10045499 | 3300031235 | Bacteria | 1935 |
| 702 | Ga0265330_10055314 | 3300031235 | Bacteria | 1733 |
| 703 | Ga0265328_10006323 | 3300031239 | Bacteria | 5026 |
| 704 | Ga0265325_10002139 | 3300031241 | Bacteria | 13477 |
| 705 | Ga0265325_10027473 | 3300031241 | Bacteria | 3075 |
| 706 | Ga0265339_10004708 | 3300031249 | Bacteria | 9258 |
| 707 | Ga0265339_10011145 | 3300031249 | Bacteria | 5550 |
| 708 | Ga0265327_10005132 | 3300031251 | Bacteria | 11111 |
| 709 | Ga0265316_10048512 | 3300031344 | Bacteria | 3351 |
| 710 | Ga0307513_10003757 | 3300031456 | Bacteria | 20483 |
| 711 | Ga0307513_10012121 | 3300031456 | Bacteria | 10662 |
| 712 | Ga0307513_10149430 | 3300031456 | Bacteria | 2248 |
| 713 | Ga0307509_10106888 | 3300031507 | Bacteria | 2816 |
| 714 | Ga0307408_100320037 | 3300031548 | Bacteria | 1306 |
| 715 | Ga0265313_10000063 | 3300031595 | Bacteria | 104056 |
| 716 | Ga0307508_10032271 | 3300031616 | Bacteria | 4731 |
| 717 | Ga0316579_10000602 | 3300031691 | Bacteria | 12101 |
| 718 | Ga0316579_10003046 | 3300031691 | Bacteria | 6455 |
| 719 | Ga0265314_10015400 | 3300031711 | Bacteria | 6071 |
| 720 | Ga0316576_10100109 | 3300031727 | Bacteria | 2166 |
| 721 | Ga0316578_10034359 | 3300031728 | Bacteria | 2912 |
| 722 | Ga0316578_10096736 | 3300031728 | Bacteria | 1768 |
| 723 | Ga0307516_10001719 | 3300031730 | Bacteria | 30077 |
| 724 | Ga0307516_10225238 | 3300031730 | Bacteria | 1582 |
| 725 | Ga0307516_10243886 | 3300031730 | Bacteria | 1494 |
| 726 | Ga0307405_10001594 | 3300031731 | Bacteria | 9629 |
| 727 | Ga0307405_10060473 | 3300031731 | Bacteria | 2391 |
| 728 | Ga0307405_10069996 | 3300031731 | Bacteria | 2251 |
| 729 | Ga0307410_10004095 | 3300031852 | Bacteria | 7467 |
| 730 | Ga0307406_10037380 | 3300031901 | Bacteria | 2998 |
| 731 | Ga0307407_10147924 | 3300031903 | Bacteria | 1523 |
| 732 | Ga0307412_10014053 | 3300031911 | Bacteria | 4713 |
| 733 | Ga0315914_1000015 | 3300031967 | Bacteria | 128727 |
| 734 | Ga0307414_10001368 | 3300032004 | Bacteria | 12613 |
| 735 | Ga0307414_10051845 | 3300032004 | Bacteria | 2851 |
| 736 | Ga0307411_10053700 | 3300032005 | Bacteria | 2642 |
| 737 | Ga0316593_10046937 | 3300032168 | Bacteria | 1451 |
| 738 | Ga0315913_1008719 | 3300033430 | Bacteria | 11987 |
| 739 | Ga0315915_1000020 | 3300033464 | Bacteria | 128727 |
| 740 | Ga0373940_0013654 | 3300035088 | Bacteria | 1970 |
| 741 | Ga0373949_0029193 | 3300035090 | Bacteria | 1305 |
| 742 | Ga0373939_0007086 | 3300035114 | Bacteria | 2715 |
| 743 | Ga0373939_0035535 | 3300035114 | Bacteria | 1469 |
| 744 | Ga0373941_0005225 | 3300035115 | Bacteria | 3044 |
| 745 | Ga0373941_0055694 | 3300035115 | Bacteria | 1272 |
| 746 | Ga0373960_0007893 | 3300035121 | Bacteria | 2534 |
| 747 | Ga0373961_0007824 | 3300035241 | Bacteria | 2590 |
| 748 | Ga0373962_0002300 | 3300035242 | Bacteria | 4562 |
| 749 | Ga0373962_0003880 | 3300035242 | Bacteria | 3600 |
| 750 | Ga0316574_0055341 | 3300035398 | Bacteria | 2479 |
| 751 | Ga0316574_0137414 | 3300035398 | Bacteria | 1574 |
| 752 | Ga0373931_0004634 | 3300035691 | Bacteria | 6288 |
| 753 | Ga0373931_0010811 | 3300035691 | Bacteria | 4392 |
| 754 | Ga0373931_0032593 | 3300035691 | Bacteria | 2697 |
| 755 | Ga0373931_0051497 | 3300035691 | Bacteria | 2193 |
| 756 | Ga0373931_0096025 | 3300035691 | Bacteria | 1660 |
| 757 | Ga0373927_0000058 | 3300035695 | Bacteria | 80217 |
| 758 | Ga0373937_0218965 | 3300036401 | Bacteria | 1792 |
| 759 | Ga0316582_0006740 | 3300036647 | Bacteria | 6062 |
| 760 | Ga0316584_0036814 | 3300036712 | Bacteria | 3632 |
| 761 | Ga0373925_0005785 | 3300037068 | Bacteria | 9189 |
| 762 | Ga0395899_0000044 | 3300037312 | Bacteria | 248735 |
| 763 | Ga0395899_0099170 | 3300037312 | Bacteria | 2105 |
| 764 | Ga0395900_0000042 | 3300037418 | Bacteria | 242667 |
| 765 | Ga0395900_0013297 | 3300037418 | Bacteria | 8415 |
| 766 | Ga0395900_0018704 | 3300037418 | Bacteria | 7066 |
| 767 | Ga0395900_0105539 | 3300037418 | Bacteria | 2894 |
| 768 | Ga0395898_0000080 | 3300037466 | Bacteria | 242667 |
| 769 | Ga0395898_0096236 | 3300037466 | Bacteria | 2844 |
| 770 | Ga0395898_0101483 | 3300037466 | Bacteria | 2763 |
| 771 | Ga0395905_0000044 | 3300037471 | Bacteria | 242916 |
| 772 | Ga0395905_0001069 | 3300037471 | Bacteria | 34516 |
| 773 | Ga0395905_0012064 | 3300037471 | Bacteria | 8328 |
| 774 | Ga0395905_0035395 | 3300037471 | Bacteria | 4689 |
| 775 | Ga0395905_0036925 | 3300037471 | Bacteria | 4589 |
| 776 | Ga0395905_0056748 | 3300037471 | Bacteria | 3663 |
| 777 | Ga0395905_0059709 | 3300037471 | Bacteria | 3565 |
| 778 | Ga0436364_0410392 | 3300037853 | Bacteria | 19971 |
| 779 | Ga0395901_0000027 | 3300038443 | Bacteria | 244204 |
| 780 | Ga0395901_0024093 | 3300038443 | Bacteria | 6243 |
| 781 | Ga0395901_0064567 | 3300038443 | Bacteria | 3811 |
| 782 | Ga0395901_0098115 | 3300038443 | Bacteria | 3072 |
| 783 | Ga0400488_24627 | 3300038741 | Bacteria | 1629 |
| 784 | Ga0242420_009488 | 3300038996 | Bacteria | 1597 |
| 785 | Ga0400483_005361 | 3300039062 | Bacteria | 1627 |
| 786 | Ga0400483_134363 | 3300039062 | Bacteria | 17839 |
| 787 | Ga0400483_143286 | 3300039062 | Bacteria | 14413 |
| 788 | Ga0400483_156554 | 3300039062 | Bacteria | 24287 |
| 789 | Ga0400483_168664 | 3300039062 | Bacteria | 1484 |
| 790 | Ga0400483_181996 | 3300039062 | Bacteria | 5047 |
| 791 | Ga0400483_215517 | 3300039062 | Bacteria | 4759 |
| 792 | Ga0400483_220054 | 3300039062 | Bacteria | 3601 |
| 793 | Ga0400483_242580 | 3300039062 | Bacteria | 1520 |
| 794 | Ga0400483_253791 | 3300039062 | Bacteria | 1414 |
| 795 | Ga0400483_269816 | 3300039062 | Bacteria | 4535 |
| 796 | Ga0436365_1382071 | 3300039437 | Bacteria | 38509 |
| 797 | Ga0436365_1909219 | 3300039437 | Bacteria | 3552 |
| 798 | Ga0436360_1174268 | 3300039438 | Bacteria | 5551 |
| 799 | Ga0436363_0826910 | 3300039450 | Bacteria | 4759 |
| 800 | Ga0436362_0327940 | 3300039453 | Bacteria | 1323 |
| 801 | Ga0439436_0009616 | 3300041404 | Bacteria | 2965 |
| 802 | Ga0439436_0021462 | 3300041404 | Bacteria | 1919 |
| 803 | Ga0439438_000091 | 3300041405 | Bacteria | 41456 |
| 804 | Ga0439438_003966 | 3300041405 | Bacteria | 5824 |
| 805 | Ga0439447_000016 | 3300041407 | Bacteria | 61120 |
| 806 | Ga0439447_000270 | 3300041407 | Bacteria | 18339 |
| 807 | Ga0439447_002713 | 3300041407 | Bacteria | 6398 |
| 808 | Ga0439447_006042 | 3300041407 | Bacteria | 3971 |
| 809 | Ga0439466_0000324 | 3300041411 | Bacteria | 18343 |
| 810 | Ga0439466_0012748 | 3300041411 | Bacteria | 3088 |
| 811 | Ga0439466_0016319 | 3300041411 | Bacteria | 2685 |
| 812 | Ga0439466_0041354 | 3300041411 | Bacteria | 1538 |
| 813 | Ga0439466_0052910 | 3300041411 | Bacteria | 1326 |
| 814 | Ga0439465_0000523 | 3300041413 | Bacteria | 11477 |
| 815 | Ga0439465_0000778 | 3300041413 | Bacteria | 9945 |
| 816 | Ga0439465_0006978 | 3300041413 | Bacteria | 3587 |
| 817 | Ga0451787_281779 | 3300041441 | Bacteria | 4591 |
| 818 | Ga0451793_0055025 | 3300041452 | Bacteria | 1425 |
| 819 | Ga0451807_0079335 | 3300041486 | Bacteria | 1625 |
| 820 | Ga0451839_0382298 | 3300041496 | Bacteria | 6212 |
| 821 | Ga0451849_0157453 | 3300041505 | Bacteria | 2071 |
| 822 | Ga0451850_10280 | 3300041506 | Bacteria | 1892 |
| 823 | Ga0451855_0035652 | 3300041511 | Bacteria | 1726 |
| 824 | Ga0451855_1331344 | 3300041511 | Bacteria | 1144 |
| 825 | Ga0451853_1792368 | 3300041512 | Bacteria | 2987 |
| 826 | Ga0439431_0026962 | 3300041997 | Bacteria | 1410 |
| 827 | Ga0439445_0001308 | 3300042004 | Bacteria | 5375 |
| 828 | Ga0439432_047291 | 3300042006 | Bacteria | 1350 |
| 829 | Ga0439449_0000439 | 3300042007 | Bacteria | 15402 |
| 830 | Ga0439449_0013003 | 3300042007 | Bacteria | 3130 |
| 831 | Ga0439451_001654 | 3300042009 | Bacteria | 4427 |
| 832 | Ga0439451_002285 | 3300042009 | Bacteria | 3864 |
| 833 | Ga0439451_007893 | 3300042009 | Bacteria | 2160 |
| 834 | Ga0439452_000046 | 3300042010 | Bacteria | 130842 |
| 835 | Ga0439452_000163 | 3300042010 | Bacteria | 49709 |
| 836 | Ga0439452_001028 | 3300042010 | Bacteria | 12348 |
| 837 | Ga0439452_001433 | 3300042010 | Bacteria | 9767 |
| 838 | Ga0439455_0009370 | 3300042012 | Bacteria | 2123 |
| 839 | Ga0439456_002428 | 3300042013 | Bacteria | 3757 |
| 840 | Ga0439456_010957 | 3300042013 | Bacteria | 1874 |
| 841 | Ga0439456_016546 | 3300042013 | Bacteria | 1542 |
| 842 | Ga0439463_004915 | 3300042016 | Bacteria | 3334 |
| 843 | Ga0450911_001620 | 3300042115 | Bacteria | 5024 |
| 844 | Ga0450919_001004 | 3300042121 | Bacteria | 3649 |
| 845 | Ga0450920_001322 | 3300042122 | Bacteria | 4080 |
| 846 | Ga0450922_000043 | 3300042124 | Bacteria | 10994 |
| 847 | Ga0450922_001535 | 3300042124 | Bacteria | 2262 |
| 848 | Ga0450923_001626 | 3300042125 | Bacteria | 3033 |
| 849 | Ga0450902_001152 | 3300042137 | Bacteria | 3528 |
| 850 | Ga0450902_005509 | 3300042137 | Bacteria | 1915 |
| 851 | Ga0450903_000582 | 3300042138 | Bacteria | 7507 |
| 852 | Ga0450903_002468 | 3300042138 | Bacteria | 3286 |
| 853 | Ga0450903_011334 | 3300042138 | Bacteria | 1437 |
| 854 | Ga0450906_000456 | 3300042145 | Bacteria | 8541 |
| 855 | Ga0450907_000003 | 3300042146 | Bacteria | 138102 |
| 856 | Ga0450907_000973 | 3300042146 | Bacteria | 6775 |
| 857 | Ga0450907_002050 | 3300042146 | Bacteria | 4005 |
| 858 | Ga0450907_013692 | 3300042146 | Bacteria | 1352 |
| 859 | Ga0450910_001936 | 3300042147 | Bacteria | 2679 |
| 860 | Ga0439446_0005478 | 3300042156 | Bacteria | 3267 |
| 861 | Ga0450908_004701 | 3300042184 | Bacteria | 2630 |
| 862 | Ga0450909_000170 | 3300042185 | Bacteria | 7133 |
| 863 | Ga0439434_0000019 | 3300042435 | Bacteria | 41172 |
| 864 | Ga0439434_0025096 | 3300042435 | Bacteria | 1799 |
| 865 | Ga0439464_0005830 | 3300042439 | Bacteria | 3196 |
| 866 | Ga0439460_0000388 | 3300042461 | Bacteria | 9340 |
| 867 | Ga0439460_0002987 | 3300042461 | Bacteria | 4083 |
| 868 | Ga0450916_000364 | 3300042530 | Bacteria | 3780 |
| 869 | Ga0450918_002089 | 3300042531 | Bacteria | 3818 |
| 870 | Ga0451577_0331336 | 3300042876 | Bacteria | 1381 |
| 871 | Ga0439440_0000508 | 3300042993 | Bacteria | 6530 |
| 872 | Ga0439440_0001836 | 3300042993 | Bacteria | 3934 |
| 873 | Ga0466972_0050729 | 3300044658 | Bacteria | 2002 |
| 874 | Ga0453684_0000136 | 3300044712 | Bacteria | 323402 |
| 875 | Ga0453684_0117281 | 3300044712 | Bacteria | 3222 |
| 876 | Ga0466970_0051098 | 3300044765 | Bacteria | 2206 |
| 877 | Ga0466960_0144294 | 3300044901 | Bacteria | 1267 |
| 878 | Ga0451576_0000025 | 3300045051 | Bacteria | 427980 |
| 879 | Ga0451576_0023381 | 3300045051 | Bacteria | 6691 |
| 880 | Ga0451576_0541263 | 3300045051 | Bacteria | 1223 |
| 881 | Ga0495617_000282 | 3300046452 | Bacteria | 29411 |
| 882 | Ga0495617_000613 | 3300046452 | Bacteria | 17917 |
| 883 | Ga0495617_003080 | 3300046452 | Bacteria | 6350 |
| 884 | Ga0495617_008507 | 3300046452 | Bacteria | 3536 |
| 885 | Ga0495617_045186 | 3300046452 | Bacteria | 1468 |
| 886 | Ga0495627_000010 | 3300046453 | Bacteria | 381168 |
| 887 | Ga0495627_003377 | 3300046453 | Bacteria | 7078 |
| 888 | Ga0495627_003483 | 3300046453 | Bacteria | 6930 |
| 889 | Ga0495627_013990 | 3300046453 | Bacteria | 2813 |
| 890 | Ga0495627_017194 | 3300046453 | Bacteria | 2463 |
| 891 | Ga0495603_0000535 | 3300046455 | Bacteria | 21117 |
| 892 | Ga0495603_0002140 | 3300046455 | Bacteria | 11624 |
| 893 | Ga0495590_0000040 | 3300046457 | Bacteria | 122610 |
| 894 | Ga0495590_0003390 | 3300046457 | Bacteria | 6515 |
| 895 | Ga0495590_0004520 | 3300046457 | Bacteria | 5606 |
| 896 | Ga0495590_0005815 | 3300046457 | Bacteria | 4847 |
| 897 | Ga0495590_0022600 | 3300046457 | Bacteria | 2224 |
| 898 | Ga0495590_0047473 | 3300046457 | Bacteria | 1498 |
| 899 | Ga0495591_000016 | 3300046458 | Bacteria | 244927 |
| 900 | Ga0495591_000143 | 3300046458 | Bacteria | 76321 |
| 901 | Ga0495591_000736 | 3300046458 | Bacteria | 23661 |
| 902 | Ga0495591_004102 | 3300046458 | Bacteria | 7251 |
| 903 | Ga0495591_004844 | 3300046458 | Bacteria | 6415 |
| 904 | Ga0495591_010620 | 3300046458 | Bacteria | 3551 |
| 905 | Ga0495591_016244 | 3300046458 | Bacteria | 2601 |
| 906 | Ga0495591_020149 | 3300046458 | Bacteria | 2211 |
| 907 | Ga0495629_0066124 | 3300046459 | Bacteria | 2523 |
| 908 | Ga0495629_0110708 | 3300046459 | Bacteria | 1914 |
| 909 | Ga0495638_0000381 | 3300046460 | Bacteria | 55116 |
| 910 | Ga0495638_0000906 | 3300046460 | Bacteria | 30294 |
| 911 | Ga0495638_0001340 | 3300046460 | Bacteria | 22591 |
| 912 | Ga0495638_0001770 | 3300046460 | Bacteria | 18918 |
| 913 | Ga0495638_0002038 | 3300046460 | Bacteria | 17193 |
| 914 | Ga0495638_0002185 | 3300046460 | Bacteria | 16364 |
| 915 | Ga0495638_0002734 | 3300046460 | Bacteria | 14175 |
| 916 | Ga0495638_0003287 | 3300046460 | Bacteria | 12749 |
| 917 | Ga0495638_0008823 | 3300046460 | Bacteria | 7121 |
| 918 | Ga0495638_0010217 | 3300046460 | Bacteria | 6533 |
| 919 | Ga0495638_0014796 | 3300046460 | Bacteria | 5261 |
| 920 | Ga0495638_0020752 | 3300046460 | Bacteria | 4337 |
| 921 | Ga0495638_0044542 | 3300046460 | Bacteria | 2795 |
| 922 | Ga0495638_0053148 | 3300046460 | Bacteria | 2521 |
| 923 | Ga0495638_0104069 | 3300046460 | Bacteria | 1693 |
| 924 | Ga0495650_0001536 | 3300046471 | Bacteria | 21887 |
| 925 | Ga0495650_0001586 | 3300046471 | Bacteria | 21331 |
| 926 | Ga0495650_0002125 | 3300046471 | Bacteria | 16922 |
| 927 | Ga0495650_0003945 | 3300046471 | Bacteria | 10454 |
| 928 | Ga0495650_0011227 | 3300046471 | Bacteria | 4924 |
| 929 | Ga0495650_0011776 | 3300046471 | Bacteria | 4755 |
| 930 | Ga0495582_0005973 | 3300046473 | Bacteria | 6786 |
| 931 | Ga0495605_0000013 | 3300046474 | Bacteria | 308178 |
| 932 | Ga0495605_0000244 | 3300046474 | Bacteria | 64456 |
| 933 | Ga0495605_0000321 | 3300046474 | Bacteria | 49788 |
| 934 | Ga0495605_0000751 | 3300046474 | Bacteria | 23782 |
| 935 | Ga0495605_0001173 | 3300046474 | Bacteria | 17399 |
| 936 | Ga0495605_0003344 | 3300046474 | Bacteria | 9590 |
| 937 | Ga0495605_0006620 | 3300046474 | Bacteria | 6636 |
| 938 | Ga0495605_0017540 | 3300046474 | Bacteria | 3850 |
| 939 | Ga0495605_0018221 | 3300046474 | Bacteria | 3768 |
| 940 | Ga0495605_0018907 | 3300046474 | Bacteria | 3688 |
| 941 | Ga0495639_0000037 | 3300046475 | Bacteria | 58725 |
| 942 | Ga0495639_0000553 | 3300046475 | Bacteria | 17412 |
| 943 | Ga0495639_0021054 | 3300046475 | Bacteria | 2853 |
| 944 | Ga0495584_0000019 | 3300046491 | Bacteria | 140608 |
| 945 | Ga0495584_0000086 | 3300046491 | Bacteria | 64500 |
| 946 | Ga0495584_0001430 | 3300046491 | Bacteria | 14368 |
| 947 | Ga0495584_0005615 | 3300046491 | Bacteria | 6632 |
| 948 | Ga0495584_0009593 | 3300046491 | Bacteria | 4985 |
| 949 | Ga0495584_0020550 | 3300046491 | Bacteria | 3352 |
| 950 | Ga0495584_0022419 | 3300046491 | Bacteria | 3204 |
| 951 | Ga0495584_0031838 | 3300046491 | Bacteria | 2669 |
| 952 | Ga0495584_0036443 | 3300046491 | Bacteria | 2485 |
| 953 | Ga0495584_0046865 | 3300046491 | Bacteria | 2180 |
| 954 | Ga0495584_0075776 | 3300046491 | Bacteria | 1691 |
| 955 | Ga0495585_0000012 | 3300046492 | Bacteria | 203064 |
| 956 | Ga0495585_0004015 | 3300046492 | Bacteria | 9688 |
| 957 | Ga0495585_0005603 | 3300046492 | Bacteria | 7889 |
| 958 | Ga0495585_0024800 | 3300046492 | Bacteria | 3437 |
| 959 | Ga0495585_0041609 | 3300046492 | Bacteria | 2577 |
| 960 | Ga0495594_0010177 | 3300046499 | Bacteria | 4874 |
| 961 | Ga0495594_0012773 | 3300046499 | Bacteria | 4380 |
| 962 | Ga0495594_0017998 | 3300046499 | Bacteria | 3740 |
| 963 | Ga0495594_0037722 | 3300046499 | Bacteria | 2637 |
| 964 | Ga0495596_0000050 | 3300046500 | Bacteria | 87493 |
| 965 | Ga0495607_0000031 | 3300046501 | Bacteria | 153964 |
| 966 | Ga0495607_0000637 | 3300046501 | Bacteria | 34042 |
| 967 | Ga0495607_0001848 | 3300046501 | Bacteria | 18001 |
| 968 | Ga0495607_0002549 | 3300046501 | Bacteria | 14730 |
| 969 | Ga0495607_0005774 | 3300046501 | Bacteria | 8800 |
| 970 | Ga0495607_0006918 | 3300046501 | Bacteria | 7908 |
| 971 | Ga0495607_0008933 | 3300046501 | Bacteria | 6821 |
| 972 | Ga0495607_0013112 | 3300046501 | Bacteria | 5442 |
| 973 | Ga0495607_0024437 | 3300046501 | Bacteria | 3767 |
| 974 | Ga0495607_0094305 | 3300046501 | Bacteria | 1614 |
| 975 | Ga0495607_0111238 | 3300046501 | Bacteria | 1452 |
| 976 | Ga0495583_0000042 | 3300046506 | Bacteria | 234630 |
| 977 | Ga0495583_0000112 | 3300046506 | Bacteria | 138078 |
| 978 | Ga0495583_0001014 | 3300046506 | Bacteria | 32055 |
| 979 | Ga0495583_0008546 | 3300046506 | Bacteria | 6243 |
| 980 | Ga0495583_0020181 | 3300046506 | Bacteria | 3459 |
| 981 | Ga0495606_0001735 | 3300046507 | Bacteria | 28008 |
| 982 | Ga0495606_0005023 | 3300046507 | Bacteria | 12893 |
| 983 | Ga0495606_0011380 | 3300046507 | Bacteria | 7261 |
| 984 | Ga0495610_0002479 | 3300046512 | Bacteria | 15472 |
| 985 | Ga0495610_0004038 | 3300046512 | Bacteria | 11046 |
| 986 | Ga0495610_0005663 | 3300046512 | Bacteria | 8809 |
| 987 | Ga0495610_0010968 | 3300046512 | Bacteria | 5581 |
| 988 | Ga0495610_0015724 | 3300046512 | Bacteria | 4386 |
| 989 | Ga0495610_0018507 | 3300046512 | Bacteria | 3931 |
| 990 | Ga0495610_0020528 | 3300046512 | Bacteria | 3666 |
| 991 | Ga0495610_0021223 | 3300046512 | Bacteria | 3577 |
| 992 | Ga0495610_0026983 | 3300046512 | Bacteria | 3059 |
| 993 | Ga0495616_0000245 | 3300046513 | Bacteria | 44179 |
| 994 | Ga0495616_0004681 | 3300046513 | Bacteria | 8582 |
| 995 | Ga0495616_0018190 | 3300046513 | Bacteria | 3862 |
| 996 | Ga0495616_0063293 | 3300046513 | Bacteria | 1808 |
| 997 | Ga0495616_0093068 | 3300046513 | Bacteria | 1424 |
| 998 | Ga0495620_0000005 | 3300046515 | Bacteria | 284456 |
| 999 | Ga0495620_0001456 | 3300046515 | Bacteria | 14164 |
| 1000 | Ga0495620_0018086 | 3300046515 | Bacteria | 3496 |
| 1001 | Ga0495620_0022288 | 3300046515 | Bacteria | 3054 |
| 1002 | Ga0495620_0025085 | 3300046515 | Bacteria | 2826 |
| 1003 | Ga0495628_0148606 | 3300046516 | Bacteria | 1785 |
| 1004 | Ga0495630_0005993 | 3300046517 | Bacteria | 8596 |
| 1005 | Ga0495630_0032806 | 3300046517 | Bacteria | 3871 |
| 1006 | Ga0495630_0033080 | 3300046517 | Bacteria | 3855 |
| 1007 | Ga0495631_0000327 | 3300046518 | Bacteria | 32708 |
| 1008 | Ga0495631_0000336 | 3300046518 | Bacteria | 32317 |
| 1009 | Ga0495631_0004032 | 3300046518 | Bacteria | 7903 |
| 1010 | Ga0495631_0006054 | 3300046518 | Bacteria | 6284 |
| 1011 | Ga0495631_0007632 | 3300046518 | Bacteria | 5495 |
| 1012 | Ga0495631_0010474 | 3300046518 | Bacteria | 4584 |
| 1013 | Ga0495631_0039079 | 3300046518 | Bacteria | 2107 |
| 1014 | Ga0495632_0000058 | 3300046519 | Bacteria | 122648 |
| 1015 | Ga0495632_0001123 | 3300046519 | Bacteria | 22908 |
| 1016 | Ga0495632_0001410 | 3300046519 | Bacteria | 20086 |
| 1017 | Ga0495632_0002362 | 3300046519 | Bacteria | 14436 |
| 1018 | Ga0495632_0006229 | 3300046519 | Bacteria | 7716 |
| 1019 | Ga0495632_0013850 | 3300046519 | Bacteria | 4582 |
| 1020 | Ga0495632_0038353 | 3300046519 | Bacteria | 2426 |
| 1021 | Ga0495632_0038372 | 3300046519 | Bacteria | 2425 |
| 1022 | Ga0495632_0050064 | 3300046519 | Bacteria | 2062 |
| 1023 | Ga0495632_0052582 | 3300046519 | Bacteria | 2002 |
| 1024 | Ga0495632_0062245 | 3300046519 | Bacteria | 1809 |
| 1025 | Ga0495637_0000315 | 3300046520 | Bacteria | 37537 |
| 1026 | Ga0495637_0000493 | 3300046520 | Bacteria | 28658 |
| 1027 | Ga0495637_0000968 | 3300046520 | Bacteria | 18289 |
| 1028 | Ga0495637_0002855 | 3300046520 | Bacteria | 9372 |
| 1029 | Ga0495637_0004378 | 3300046520 | Bacteria | 7325 |
| 1030 | Ga0495637_0005273 | 3300046520 | Bacteria | 6613 |
| 1031 | Ga0495637_0013823 | 3300046520 | Bacteria | 3822 |
| 1032 | Ga0495637_0014825 | 3300046520 | Bacteria | 3672 |
| 1033 | Ga0495637_0016577 | 3300046520 | Bacteria | 3442 |
| 1034 | Ga0495637_0019639 | 3300046520 | Bacteria | 3121 |
| 1035 | Ga0495637_0048913 | 3300046520 | Bacteria | 1779 |
| 1036 | Ga0495643_0004441 | 3300046522 | Bacteria | 9803 |
| 1037 | Ga0495643_0004788 | 3300046522 | Bacteria | 9337 |
| 1038 | Ga0495643_0006068 | 3300046522 | Bacteria | 8047 |
| 1039 | Ga0495643_0011294 | 3300046522 | Bacteria | 5448 |
| 1040 | Ga0495643_0023187 | 3300046522 | Bacteria | 3530 |
| 1041 | Ga0495644_0000031 | 3300046523 | Bacteria | 65825 |
| 1042 | Ga0495644_0000217 | 3300046523 | Bacteria | 27038 |
| 1043 | Ga0495644_0002110 | 3300046523 | Bacteria | 7990 |
| 1044 | Ga0495644_0006236 | 3300046523 | Bacteria | 4633 |
| 1045 | Ga0495644_0008000 | 3300046523 | Bacteria | 4067 |
| 1046 | Ga0495648_0000884 | 3300046524 | Bacteria | 31492 |
| 1047 | Ga0495648_0001115 | 3300046524 | Bacteria | 27217 |
| 1048 | Ga0495648_0004068 | 3300046524 | Bacteria | 12615 |
| 1049 | Ga0495648_0010455 | 3300046524 | Bacteria | 7066 |
| 1050 | Ga0495648_0011307 | 3300046524 | Bacteria | 6735 |
| 1051 | Ga0495648_0016268 | 3300046524 | Bacteria | 5366 |
| 1052 | Ga0495648_0017141 | 3300046524 | Bacteria | 5190 |
| 1053 | Ga0495648_0018407 | 3300046524 | Bacteria | 4944 |
| 1054 | Ga0495648_0025638 | 3300046524 | Bacteria | 3987 |
| 1055 | Ga0495648_0034981 | 3300046524 | Bacteria | 3261 |
| 1056 | Ga0495648_0073026 | 3300046524 | Bacteria | 1982 |
| 1057 | Ga0495648_0118228 | 3300046524 | Bacteria | 1429 |
| 1058 | Ga0495663_0000180 | 3300046525 | Bacteria | 25223 |
| 1059 | Ga0495666_0000430 | 3300046526 | Bacteria | 18614 |
| 1060 | Ga0495666_0000574 | 3300046526 | Bacteria | 16440 |
| 1061 | Ga0495666_0031956 | 3300046526 | Bacteria | 2578 |
| 1062 | Ga0495666_0072715 | 3300046526 | Bacteria | 1632 |
| 1063 | Ga0495642_0000003 | 3300046528 | Bacteria | 185425 |
| 1064 | Ga0495642_0000165 | 3300046528 | Bacteria | 38677 |
| 1065 | Ga0495642_0001529 | 3300046528 | Bacteria | 10268 |
| 1066 | Ga0495654_0000253 | 3300046530 | Bacteria | 48877 |
| 1067 | Ga0495654_0000914 | 3300046530 | Bacteria | 21930 |
| 1068 | Ga0495654_0001303 | 3300046530 | Bacteria | 17456 |
| 1069 | Ga0495654_0005244 | 3300046530 | Bacteria | 7564 |
| 1070 | Ga0495654_0005849 | 3300046530 | Bacteria | 7080 |
| 1071 | Ga0495654_0007176 | 3300046530 | Bacteria | 6257 |
| 1072 | Ga0495654_0008468 | 3300046530 | Bacteria | 5678 |
| 1073 | Ga0495654_0017228 | 3300046530 | Bacteria | 3801 |
| 1074 | Ga0495654_0018606 | 3300046530 | Bacteria | 3637 |
| 1075 | Ga0495654_0040263 | 3300046530 | Bacteria | 2329 |
| 1076 | Ga0495654_0050553 | 3300046530 | Bacteria | 2031 |
| 1077 | Ga0495587_0001215 | 3300046536 | Bacteria | 17044 |
| 1078 | Ga0495587_0002012 | 3300046536 | Bacteria | 13543 |
| 1079 | Ga0495609_0000193 | 3300046538 | Bacteria | 60831 |
| 1080 | Ga0495609_0000517 | 3300046538 | Bacteria | 31107 |
| 1081 | Ga0495609_0001638 | 3300046538 | Bacteria | 14592 |
| 1082 | Ga0495609_0004786 | 3300046538 | Bacteria | 7309 |
| 1083 | Ga0495597_0000012 | 3300046542 | Bacteria | 212005 |
| 1084 | Ga0495597_0001398 | 3300046542 | Bacteria | 17434 |
| 1085 | Ga0495597_0002798 | 3300046542 | Bacteria | 10721 |
| 1086 | Ga0495597_0004197 | 3300046542 | Bacteria | 7979 |
| 1087 | Ga0495597_0008762 | 3300046542 | Bacteria | 5053 |
| 1088 | Ga0495597_0029401 | 3300046542 | Bacteria | 2508 |
| 1089 | Ga0495597_0040352 | 3300046542 | Bacteria | 2086 |
| 1090 | Ga0495597_0042732 | 3300046542 | Bacteria | 2020 |
| 1091 | Ga0495622_0000202 | 3300046557 | Bacteria | 47328 |
| 1092 | Ga0495622_0000446 | 3300046557 | Bacteria | 26677 |
| 1093 | Ga0495622_0066242 | 3300046557 | Bacteria | 1669 |
| 1094 | Ga0495633_0000013 | 3300046558 | Bacteria | 262742 |
| 1095 | Ga0495633_0002527 | 3300046558 | Bacteria | 12859 |
| 1096 | Ga0495633_0076000 | 3300046558 | Bacteria | 1564 |
| 1097 | Ga0495633_0084553 | 3300046558 | Bacteria | 1476 |
| 1098 | Ga0495656_0004408 | 3300046615 | Bacteria | 4819 |
| 1099 | Ga0495656_0026320 | 3300046615 | Bacteria | 2315 |
| 1100 | Ga0495668_0000424 | 3300046616 | Bacteria | 55046 |
| 1101 | Ga0495634_0000154 | 3300046642 | Bacteria | 61397 |
| 1102 | Ga0495611_0002162 | 3300046648 | Bacteria | 9168 |
| 1103 | Ga0495611_0002456 | 3300046648 | Bacteria | 8461 |
| 1104 | Ga0495611_0002693 | 3300046648 | Bacteria | 8011 |
| 1105 | Ga0495625_0002559 | 3300046660 | Bacteria | 19540 |
| 1106 | Ga0495625_0002784 | 3300046660 | Bacteria | 18440 |
| 1107 | Ga0495625_0002896 | 3300046660 | Bacteria | 17929 |
| 1108 | Ga0495625_0010204 | 3300046660 | Bacteria | 7794 |
| 1109 | Ga0495625_0010569 | 3300046660 | Bacteria | 7622 |
| 1110 | Ga0495625_0037088 | 3300046660 | Bacteria | 3578 |
| 1111 | Ga0495625_0039201 | 3300046660 | Bacteria | 3461 |
| 1112 | Ga0495625_0044542 | 3300046660 | Bacteria | 3212 |
| 1113 | Ga0495625_0046809 | 3300046660 | Bacteria | 3119 |
| 1114 | Ga0495625_0112011 | 3300046660 | Bacteria | 1864 |
| 1115 | Ga0495625_0151765 | 3300046660 | Bacteria | 1557 |
| 1116 | Ga0495625_0162358 | 3300046660 | Bacteria | 1496 |
| 1117 | Ga0495635_0000051 | 3300046663 | Bacteria | 74756 |
| 1118 | Ga0495635_0055550 | 3300046663 | Bacteria | 2727 |
| 1119 | Ga0495659_0000061 | 3300046664 | Bacteria | 48142 |
| 1120 | Ga0495659_0000978 | 3300046664 | Bacteria | 10026 |
| 1121 | Ga0495661_0000128 | 3300046665 | Bacteria | 92679 |
| 1122 | Ga0495661_0003829 | 3300046665 | Bacteria | 11004 |
| 1123 | Ga0495661_0004366 | 3300046665 | Bacteria | 10230 |
| 1124 | Ga0495661_0065155 | 3300046665 | Bacteria | 2147 |
| 1125 | Ga0495661_0068625 | 3300046665 | Bacteria | 2079 |
| 1126 | Ga0495588_0003387 | 3300046674 | Bacteria | 6925 |
| 1127 | Ga0495588_0012092 | 3300046674 | Bacteria | 4069 |
| 1128 | Ga0495623_0002213 | 3300046679 | Bacteria | 12943 |
| 1129 | Ga0495623_0005942 | 3300046679 | Bacteria | 7955 |
| 1130 | Ga0495669_0000263 | 3300046684 | Bacteria | 30264 |
| 1131 | Ga0495669_0045973 | 3300046684 | Bacteria | 1947 |
| 1132 | Ga0495613_0002488 | 3300046689 | Bacteria | 13905 |
| 1133 | Ga0495670_0000103 | 3300046691 | Bacteria | 37384 |
| 1134 | Ga0495670_0000179 | 3300046691 | Bacteria | 28233 |
| 1135 | Ga0495670_0000800 | 3300046691 | Bacteria | 15118 |
| 1136 | Ga0495670_0002654 | 3300046691 | Bacteria | 8828 |
| 1137 | Ga0495670_0005587 | 3300046691 | Bacteria | 6169 |
| 1138 | Ga0495670_0055726 | 3300046691 | Bacteria | 1982 |
| 1139 | Ga0495670_0058202 | 3300046691 | Bacteria | 1940 |
| 1140 | Ga0495670_0085888 | 3300046691 | Bacteria | 1606 |
| 1141 | Ga0495671_0000138 | 3300046692 | Bacteria | 64535 |
| 1142 | Ga0495671_0007182 | 3300046692 | Bacteria | 6372 |
| 1143 | Ga0495671_0009774 | 3300046692 | Bacteria | 5343 |
| 1144 | Ga0495671_0010690 | 3300046692 | Bacteria | 5076 |
| 1145 | Ga0495671_0014547 | 3300046692 | Bacteria | 4230 |
| 1146 | Ga0495671_0019479 | 3300046692 | Bacteria | 3586 |
| 1147 | Ga0495671_0022019 | 3300046692 | Bacteria | 3342 |
| 1148 | Ga0495671_0022611 | 3300046692 | Bacteria | 3292 |
| 1149 | Ga0495671_0032108 | 3300046692 | Bacteria | 2681 |
| 1150 | Ga0495671_0051021 | 3300046692 | Bacteria | 2059 |
| 1151 | Ga0495671_0054409 | 3300046692 | Bacteria | 1984 |
| 1152 | Ga0495671_0069211 | 3300046692 | Bacteria | 1734 |
| 1153 | Ga0495649_0000086 | 3300046694 | Bacteria | 80528 |
| 1154 | Ga0495649_0000393 | 3300046694 | Bacteria | 37829 |
| 1155 | Ga0495649_0002906 | 3300046694 | Bacteria | 11857 |
| 1156 | Ga0495649_0005630 | 3300046694 | Bacteria | 7918 |
| 1157 | Ga0495649_0018585 | 3300046694 | Bacteria | 3908 |
| 1158 | Ga0495649_0045133 | 3300046694 | Bacteria | 2404 |
| 1159 | Ga0495649_0064046 | 3300046694 | Bacteria | 1975 |
| 1160 | Ga0495649_0119454 | 3300046694 | Bacteria | 1394 |
| 1161 | Ga0495589_0000242 | 3300046794 | Bacteria | 45548 |
| 1162 | Ga0495589_0000583 | 3300046794 | Bacteria | 25061 |
| 1163 | Ga0495589_0000636 | 3300046794 | Bacteria | 23067 |
| 1164 | Ga0495589_0000758 | 3300046794 | Bacteria | 20597 |
| 1165 | Ga0495589_0008285 | 3300046794 | Bacteria | 5428 |
| 1166 | Ga0495589_0010820 | 3300046794 | Bacteria | 4742 |
| 1167 | Ga0495589_0029141 | 3300046794 | Bacteria | 2782 |
| 1168 | Ga0495589_0069497 | 3300046794 | Bacteria | 1722 |
| 1169 | Ga0495600_0070338 | 3300046809 | Bacteria | 2286 |
| 1170 | Ga0495660_0001195 | 3300046810 | Bacteria | 18227 |
| 1171 | Ga0495660_0002240 | 3300046810 | Bacteria | 12445 |
| 1172 | Ga0495660_0003894 | 3300046810 | Bacteria | 9126 |
| 1173 | Ga0495660_0007879 | 3300046810 | Bacteria | 6255 |
| 1174 | Ga0495660_0035887 | 3300046810 | Bacteria | 2767 |
| 1175 | Ga0495660_0044405 | 3300046810 | Bacteria | 2444 |
| 1176 | Ga0495660_0056933 | 3300046810 | Bacteria | 2110 |
| 1177 | Ga0495660_0073953 | 3300046810 | Bacteria | 1801 |
| 1178 | Ga0495581_0000262 | 3300047315 | Bacteria | 25295 |
| 1179 | Ga0495581_0056514 | 3300047315 | Bacteria | 2265 |
| 1180 | Ga0495604_0003245 | 3300047317 | Bacteria | 12995 |
| 1181 | Ga0495604_0021285 | 3300047317 | Bacteria | 5177 |
| 1182 | Ga0495604_0086447 | 3300047317 | Bacteria | 2337 |
| 1183 | Ga0495636_0001197 | 3300047318 | Bacteria | 9805 |
| 1184 | Ga0495672_0001126 | 3300047320 | Bacteria | 27097 |
| 1185 | Ga0495672_0002647 | 3300047320 | Bacteria | 16162 |
| 1186 | Ga0495672_0010412 | 3300047320 | Bacteria | 6627 |
| 1187 | Ga0495672_0010744 | 3300047320 | Bacteria | 6498 |
| 1188 | Ga0495672_0011293 | 3300047320 | Bacteria | 6312 |
| 1189 | Ga0495672_0013220 | 3300047320 | Bacteria | 5704 |
| 1190 | Ga0495672_0013711 | 3300047320 | Bacteria | 5577 |
| 1191 | Ga0495672_0016563 | 3300047320 | Bacteria | 4961 |
| 1192 | Ga0495672_0018174 | 3300047320 | Bacteria | 4678 |
| 1193 | Ga0495680_0005209 | 3300047322 | Bacteria | 12270 |
| 1194 | Ga0495683_0000002 | 3300047323 | Bacteria | 638279 |
| 1195 | Ga0495683_0000010 | 3300047323 | Bacteria | 223494 |
| 1196 | Ga0495683_0000116 | 3300047323 | Bacteria | 80411 |
| 1197 | Ga0495683_0001491 | 3300047323 | Bacteria | 15259 |
| 1198 | Ga0495683_0003259 | 3300047323 | Bacteria | 9484 |
| 1199 | Ga0495683_0007271 | 3300047323 | Bacteria | 6004 |
| 1200 | Ga0495683_0009520 | 3300047323 | Bacteria | 5174 |
| 1201 | Ga0495683_0024934 | 3300047323 | Bacteria | 3066 |
| 1202 | Ga0495683_0040402 | 3300047323 | Bacteria | 2357 |
| 1203 | Ga0495683_0041920 | 3300047323 | Bacteria | 2308 |
| 1204 | Ga0495687_000906 | 3300047443 | Bacteria | 30980 |
| 1205 | Ga0495687_001073 | 3300047443 | Bacteria | 26922 |
| 1206 | Ga0495687_004002 | 3300047443 | Bacteria | 10250 |
| 1207 | Ga0495687_012942 | 3300047443 | Bacteria | 4380 |
| 1208 | Ga0495687_022347 | 3300047443 | Bacteria | 3037 |
| 1209 | Ga0495675_0002774 | 3300047444 | Bacteria | 10504 |
| 1210 | Ga0495677_0000047 | 3300047445 | Bacteria | 72197 |
| 1211 | Ga0495679_000073 | 3300047446 | Bacteria | 96014 |
| 1212 | Ga0495679_001421 | 3300047446 | Bacteria | 13632 |
| 1213 | Ga0495679_002923 | 3300047446 | Bacteria | 8457 |
| 1214 | Ga0495679_004986 | 3300047446 | Bacteria | 5981 |
| 1215 | Ga0495673_0000077 | 3300047469 | Bacteria | 204403 |
| 1216 | Ga0495673_0000242 | 3300047469 | Bacteria | 77375 |
| 1217 | Ga0495673_0000426 | 3300047469 | Bacteria | 47785 |
| 1218 | Ga0495673_0001672 | 3300047469 | Bacteria | 17072 |
| 1219 | Ga0495673_0002266 | 3300047469 | Bacteria | 13803 |
| 1220 | Ga0495673_0002390 | 3300047469 | Bacteria | 13262 |
| 1221 | Ga0495673_0003183 | 3300047469 | Bacteria | 10969 |
| 1222 | Ga0495673_0003934 | 3300047469 | Bacteria | 9523 |
| 1223 | Ga0495673_0004107 | 3300047469 | Bacteria | 9243 |
| 1224 | Ga0495673_0006926 | 3300047469 | Bacteria | 6599 |
| 1225 | Ga0495673_0014495 | 3300047469 | Bacteria | 4096 |
| 1226 | Ga0495673_0040914 | 3300047469 | Bacteria | 2089 |
| 1227 | Ga0495673_0056600 | 3300047469 | Bacteria | 1695 |
| 1228 | Ga0495681_0000232 | 3300047470 | Bacteria | 46130 |
| 1229 | Ga0495681_0001247 | 3300047470 | Bacteria | 19314 |
| 1230 | Ga0495681_0001288 | 3300047470 | Bacteria | 18982 |
| 1231 | Ga0495681_0002295 | 3300047470 | Bacteria | 13750 |
| 1232 | Ga0495681_0002859 | 3300047470 | Bacteria | 12196 |
| 1233 | Ga0495681_0002891 | 3300047470 | Bacteria | 12140 |
| 1234 | Ga0495681_0005771 | 3300047470 | Bacteria | 8232 |
| 1235 | Ga0495681_0008830 | 3300047470 | Bacteria | 6268 |
| 1236 | Ga0495681_0010168 | 3300047470 | Bacteria | 5718 |
| 1237 | Ga0495681_0016446 | 3300047470 | Bacteria | 4146 |
| 1238 | Ga0495681_0028607 | 3300047470 | Bacteria | 2864 |
| 1239 | Ga0495681_0052971 | 3300047470 | Bacteria | 1901 |
| 1240 | Ga0495681_0101191 | 3300047470 | Bacteria | 1259 |
| 1241 | Ga0495686_0000556 | 3300047472 | Bacteria | 53309 |
| 1242 | Ga0495686_0001770 | 3300047472 | Bacteria | 22015 |
| 1243 | Ga0495686_0004878 | 3300047472 | Bacteria | 10819 |
| 1244 | Ga0495686_0021918 | 3300047472 | Bacteria | 4233 |
| 1245 | Ga0495686_0038906 | 3300047472 | Bacteria | 3040 |
| 1246 | Ga0495593_0002572 | 3300047673 | Bacteria | 10900 |
| 1247 | Ga0495593_0011099 | 3300047673 | Bacteria | 5182 |
| 1248 | Ga0495593_0012587 | 3300047673 | Bacteria | 4830 |
| 1249 | Ga0495593_0020449 | 3300047673 | Bacteria | 3706 |
| 1250 | Ga0495593_0046087 | 3300047673 | Bacteria | 2324 |
| 1251 | Ga0495614_0063673 | 3300048089 | Bacteria | 1585 |
| 1252 | Ga0495626_0000169 | 3300048091 | Bacteria | 80674 |
| 1253 | Ga0495626_0000198 | 3300048091 | Bacteria | 72611 |
| 1254 | Ga0495626_0000280 | 3300048091 | Bacteria | 56131 |
| 1255 | Ga0495626_0000345 | 3300048091 | Bacteria | 48769 |
| 1256 | Ga0495626_0000490 | 3300048091 | Bacteria | 39851 |
| 1257 | Ga0495626_0000531 | 3300048091 | Bacteria | 37903 |
| 1258 | Ga0496100_0017768 | 3300048903 | Bacteria | 4206 |
| 1259 | Ga0496101_0028888 | 3300048904 | Bacteria | 3875 |
| 1260 | Ga0496101_0108564 | 3300048904 | Bacteria | 2086 |
| 1261 | Ga0496101_0213915 | 3300048904 | Bacteria | 1494 |
| 1262 | Ga0496102_0000311 | 3300048905 | Bacteria | 61342 |
| 1263 | Ga0496102_0024513 | 3300048905 | Bacteria | 5365 |
| 1264 | Ga0496102_0034559 | 3300048905 | Bacteria | 4546 |
| 1265 | Ga0496102_0062555 | 3300048905 | Bacteria | 3408 |
| 1266 | Ga0496102_0119525 | 3300048905 | Bacteria | 2460 |
| 1267 | Ga0496102_0212709 | 3300048905 | Bacteria | 1823 |
| 1268 | Ga0496102_0237333 | 3300048905 | Bacteria | 1719 |
| 1269 | Ga0496103_0000272 | 3300048906 | Bacteria | 49098 |
| 1270 | Ga0496103_0009977 | 3300048906 | Bacteria | 5616 |
| 1271 | Ga0496103_0023618 | 3300048906 | Bacteria | 3710 |
| 1272 | Ga0496104_0002045 | 3300048907 | Bacteria | 17515 |
| 1273 | Ga0496104_0005566 | 3300048907 | Bacteria | 11029 |
| 1274 | Ga0496104_0015640 | 3300048907 | Bacteria | 6880 |
| 1275 | Ga0496104_0027111 | 3300048907 | Bacteria | 5299 |
| 1276 | Ga0496104_0071945 | 3300048907 | Bacteria | 3288 |
| 1277 | Ga0496104_0231979 | 3300048907 | Bacteria | 1757 |
| 1278 | Ga0496104_0318481 | 3300048907 | Bacteria | 1468 |
| 1279 | Ga0496105_0015796 | 3300048908 | Bacteria | 6023 |
| 1280 | Ga0496105_0050619 | 3300048908 | Bacteria | 3431 |
| 1281 | Ga0496105_0066696 | 3300048908 | Bacteria | 2972 |
| 1282 | Ga0496106_0002702 | 3300048909 | Bacteria | 13155 |
| 1283 | Ga0496106_0027233 | 3300048909 | Bacteria | 4256 |
| 1284 | Ga0496106_0034270 | 3300048909 | Bacteria | 3791 |
| 1285 | Ga0496106_0137564 | 3300048909 | Bacteria | 1920 |
| 1286 | Ga0496107_0042341 | 3300048910 | Bacteria | 3270 |
| 1287 | Ga0496107_0052099 | 3300048910 | Bacteria | 2952 |
| 1288 | Ga0496108_0004332 | 3300048911 | Bacteria | 11410 |
| 1289 | Ga0496108_0049723 | 3300048911 | Bacteria | 3506 |
| 1290 | Ga0496108_0070518 | 3300048911 | Bacteria | 2949 |
| 1291 | Ga0496108_0149952 | 3300048911 | Bacteria | 2012 |
| 1292 | Ga0496109_0007632 | 3300048912 | Bacteria | 9172 |
| 1293 | Ga0496109_0022579 | 3300048912 | Bacteria | 5574 |
| 1294 | Ga0496109_0077736 | 3300048912 | Bacteria | 3054 |
| 1295 | Ga0496109_0242504 | 3300048912 | Bacteria | 1696 |
| 1296 | Ga0496110_0000722 | 3300048913 | Bacteria | 22828 |
| 1297 | Ga0496110_0027042 | 3300048913 | Bacteria | 4915 |
| 1298 | Ga0496110_0045612 | 3300048913 | Bacteria | 3832 |
| 1299 | Ga0496110_0063470 | 3300048913 | Bacteria | 3264 |
| 1300 | Ga0496110_0146085 | 3300048913 | Bacteria | 2139 |
| 1301 | Ga0496110_0228657 | 3300048913 | Bacteria | 1691 |
| 1302 | Ga0496111_0013061 | 3300048914 | Bacteria | 5639 |
| 1303 | Ga0496111_0040756 | 3300048914 | Bacteria | 3332 |
| 1304 | Ga0496111_0042657 | 3300048914 | Bacteria | 3258 |
| 1305 | Ga0496111_0060316 | 3300048914 | Bacteria | 2750 |
| 1306 | Ga0496112_0005045 | 3300048915 | Bacteria | 11336 |
| 1307 | Ga0496112_0008175 | 3300048915 | Bacteria | 9349 |
| 1308 | Ga0496112_0061426 | 3300048915 | Bacteria | 3704 |
| 1309 | Ga0496112_0103931 | 3300048915 | Bacteria | 2811 |
| 1310 | Ga0496112_0231047 | 3300048915 | Bacteria | 1804 |
| 1311 | Ga0496113_0000237 | 3300048916 | Bacteria | 26001 |
| 1312 | Ga0496113_0007215 | 3300048916 | Bacteria | 7123 |
| 1313 | Ga0496113_0011759 | 3300048916 | Bacteria | 5859 |
| 1314 | Ga0496113_0021250 | 3300048916 | Bacteria | 4575 |
| 1315 | Ga0496113_0047481 | 3300048916 | Bacteria | 3191 |
| 1316 | Ga0496113_0169987 | 3300048916 | Bacteria | 1726 |
| 1317 | Ga0496114_0009944 | 3300048917 | Bacteria | 7561 |
| 1318 | Ga0496114_0178233 | 3300048917 | Bacteria | 1855 |
| 1319 | Ga0496115_0031772 | 3300048918 | Bacteria | 4162 |
| 1320 | Ga0496115_0047280 | 3300048918 | Bacteria | 3440 |
| 1321 | Ga0496116_0000142 | 3300048919 | Bacteria | 150342 |
| 1322 | Ga0496116_0005592 | 3300048919 | Bacteria | 11583 |
| 1323 | Ga0496116_0012847 | 3300048919 | Bacteria | 6806 |
| 1324 | Ga0496116_0058507 | 3300048919 | Bacteria | 2512 |
| 1325 | Ga0496117_0000002 | 3300048920 | Bacteria | 2483758 |
| 1326 | Ga0496117_0001668 | 3300048920 | Bacteria | 31030 |
| 1327 | Ga0496117_0002159 | 3300048920 | Bacteria | 25663 |
| 1328 | Ga0496117_0002597 | 3300048920 | Bacteria | 22457 |
| 1329 | Ga0496117_0004903 | 3300048920 | Bacteria | 14402 |
| 1330 | Ga0496117_0034162 | 3300048920 | Bacteria | 3836 |
| 1331 | Ga0496117_0052729 | 3300048920 | Bacteria | 2863 |
| 1332 | Ga0496117_0070318 | 3300048920 | Bacteria | 2352 |
| 1333 | Ga0496118_0000087 | 3300048921 | Bacteria | 176693 |
| 1334 | Ga0496118_0003066 | 3300048921 | Bacteria | 21440 |
| 1335 | Ga0496118_0008151 | 3300048921 | Bacteria | 10908 |
| 1336 | Ga0496118_0027810 | 3300048921 | Bacteria | 4776 |
| 1337 | Ga0496119_0012549 | 3300048922 | Bacteria | 6867 |
| 1338 | Ga0496119_0043061 | 3300048922 | Bacteria | 2857 |
| 1339 | Ga0496119_0044559 | 3300048922 | Bacteria | 2791 |
| 1340 | Ga0496119_0063251 | 3300048922 | Bacteria | 2202 |
| 1341 | Ga0496119_0093667 | 3300048922 | Bacteria | 1701 |
| 1342 | Ga0496120_0000413 | 3300048923 | Bacteria | 68125 |
| 1343 | Ga0496120_0002399 | 3300048923 | Bacteria | 19066 |
| 1344 | Ga0496120_0004176 | 3300048923 | Bacteria | 12372 |
| 1345 | Ga0496120_0031474 | 3300048923 | Bacteria | 3211 |
| 1346 | Ga0496121_0000003 | 3300048924 | Bacteria | 1191431 |
| 1347 | Ga0496121_0003720 | 3300048924 | Bacteria | 21393 |
| 1348 | Ga0496121_0014041 | 3300048924 | Bacteria | 8549 |
| 1349 | Ga0496122_0000004 | 3300048925 | Bacteria | 645283 |
| 1350 | Ga0496122_0000215 | 3300048925 | Bacteria | 128810 |
| 1351 | Ga0496122_0000840 | 3300048925 | Bacteria | 58107 |
| 1352 | Ga0496122_0001103 | 3300048925 | Bacteria | 46670 |
| 1353 | Ga0496122_0017685 | 3300048925 | Bacteria | 6642 |
| 1354 | Ga0496122_0018671 | 3300048925 | Bacteria | 6386 |
| 1355 | Ga0496122_0031306 | 3300048925 | Bacteria | 4432 |
| 1356 | Ga0496122_0054501 | 3300048925 | Bacteria | 3002 |
| 1357 | Ga0496122_0143343 | 3300048925 | Bacteria | 1490 |
| 1358 | Ga0496123_0000007 | 3300048926 | Bacteria | 645283 |
| 1359 | Ga0496123_0000306 | 3300048926 | Bacteria | 95266 |
| 1360 | Ga0496123_0000336 | 3300048926 | Bacteria | 89161 |
| 1361 | Ga0496123_0007538 | 3300048926 | Bacteria | 10204 |
| 1362 | Ga0496123_0016914 | 3300048926 | Bacteria | 5893 |
| 1363 | Ga0496123_0038132 | 3300048926 | Bacteria | 3383 |
| 1364 | Ga0496123_0047092 | 3300048926 | Bacteria | 2917 |
| 1365 | Ga0496123_0057637 | 3300048926 | Bacteria | 2526 |
| 1366 | Ga0496124_0000252 | 3300048927 | Bacteria | 103596 |
| 1367 | Ga0496124_0002136 | 3300048927 | Bacteria | 26565 |
| 1368 | Ga0496124_0002555 | 3300048927 | Bacteria | 23595 |
| 1369 | Ga0496124_0009734 | 3300048927 | Bacteria | 9839 |
| 1370 | Ga0496124_0038651 | 3300048927 | Bacteria | 4143 |
| 1371 | Ga0496124_0082442 | 3300048927 | Bacteria | 2640 |
| 1372 | Ga0496124_0120816 | 3300048927 | Bacteria | 2094 |
| 1373 | Ga0496124_0123127 | 3300048927 | Bacteria | 2069 |
| 1374 | Ga0496124_0216891 | 3300048927 | Bacteria | 1442 |
| 1375 | Ga0496125_0000039 | 3300048928 | Bacteria | 318665 |
| 1376 | Ga0496125_0000115 | 3300048928 | Bacteria | 181994 |
| 1377 | Ga0496125_0000248 | 3300048928 | Bacteria | 110840 |
| 1378 | Ga0496125_0004709 | 3300048928 | Bacteria | 15548 |
| 1379 | Ga0496125_0005054 | 3300048928 | Bacteria | 14879 |
| 1380 | Ga0496125_0006807 | 3300048928 | Bacteria | 12270 |
| 1381 | Ga0496125_0012178 | 3300048928 | Bacteria | 8558 |
| 1382 | Ga0496125_0040662 | 3300048928 | Bacteria | 3985 |
| 1383 | Ga0496125_0156958 | 3300048928 | Bacteria | 1553 |
| 1384 | Ga0496125_0167150 | 3300048928 | Bacteria | 1484 |
| 1385 | Ga0496126_0004507 | 3300048929 | Bacteria | 16595 |
| 1386 | Ga0496126_0089490 | 3300048929 | Bacteria | 2709 |
| 1387 | Ga0496126_0152247 | 3300048929 | Bacteria | 1981 |
| 1388 | Ga0495678_000005 | 3300049459 | Bacteria | 522958 |
| 1389 | Ga0495678_000437 | 3300049459 | Bacteria | 41568 |
| 1390 | Ga0495678_002064 | 3300049459 | Bacteria | 14343 |
| 1391 | Ga0495678_004456 | 3300049459 | Bacteria | 8090 |
| 1392 | Ga0495678_005290 | 3300049459 | Bacteria | 7168 |
| 1393 | Ga0495678_008281 | 3300049459 | Bacteria | 5265 |
| 1394 | Ga0495678_013283 | 3300049459 | Bacteria | 3873 |
| 1395 | Ga0495678_040918 | 3300049459 | Bacteria | 1858 |
| 1396 | Ga0495682_0005670 | 3300049460 | Bacteria | 5157 |
| 1397 | Ga0495682_0007712 | 3300049460 | Bacteria | 4267 |
| 1398 | Ga0495682_0013439 | 3300049460 | Bacteria | 3118 |
| 1399 | Ga0495682_0029551 | 3300049460 | Bacteria | 2030 |
| 1400 | Ga0501031_0000024 | 3300049568 | Bacteria | 89705 |
| 1401 | Ga0501031_0004592 | 3300049568 | Bacteria | 8954 |
| 1402 | Ga0501031_0014364 | 3300049568 | Bacteria | 5148 |
| 1403 | Ga0501031_0026503 | 3300049568 | Bacteria | 3779 |
| 1404 | Ga0501031_0060373 | 3300049568 | Bacteria | 2471 |
| 1405 | Ga0501032_0000007 | 3300049569 | Bacteria | 253881 |
| 1406 | Ga0501032_0000067 | 3300049569 | Bacteria | 89910 |
| 1407 | Ga0501032_0001002 | 3300049569 | Bacteria | 22752 |
| 1408 | Ga0501032_0006627 | 3300049569 | Bacteria | 8501 |
| 1409 | Ga0501032_0041213 | 3300049569 | Bacteria | 3136 |
| 1410 | Ga0501032_0155955 | 3300049569 | Bacteria | 1500 |
| 1411 | Ga0501033_0000051 | 3300049570 | Bacteria | 111291 |
| 1412 | Ga0501033_0000117 | 3300049570 | Bacteria | 75935 |
| 1413 | Ga0501033_0000349 | 3300049570 | Bacteria | 43927 |
| 1414 | Ga0501033_0004757 | 3300049570 | Bacteria | 10853 |
| 1415 | Ga0501033_0093682 | 3300049570 | Bacteria | 2197 |
| 1416 | Ga0501033_0094349 | 3300049570 | Bacteria | 2188 |
| 1417 | Ga0501033_0142634 | 3300049570 | Bacteria | 1732 |
| 1418 | Ga0501033_0199016 | 3300049570 | Bacteria | 1431 |
| 1419 | Ga0501033_0221602 | 3300049570 | Bacteria | 1346 |
| 1420 | Ga0501034_0000029 | 3300049571 | Bacteria | 253881 |
| 1421 | Ga0501034_0000153 | 3300049571 | Bacteria | 129892 |
| 1422 | Ga0501034_0000464 | 3300049571 | Bacteria | 67252 |
| 1423 | Ga0501034_0000732 | 3300049571 | Bacteria | 49733 |
| 1424 | Ga0501034_0000856 | 3300049571 | Bacteria | 45007 |
| 1425 | Ga0501034_0008570 | 3300049571 | Bacteria | 10791 |
| 1426 | Ga0501034_0027155 | 3300049571 | Bacteria | 5823 |
| 1427 | Ga0501034_0039601 | 3300049571 | Bacteria | 4774 |
| 1428 | Ga0501034_0045866 | 3300049571 | Bacteria | 4416 |
| 1429 | Ga0501034_0148126 | 3300049571 | Bacteria | 2323 |
| 1430 | Ga0501034_0158948 | 3300049571 | Bacteria | 2232 |
| 1431 | Ga0501034_0281830 | 3300049571 | Bacteria | 1601 |
| 1432 | Ga0501034_0303541 | 3300049571 | Bacteria | 1533 |
| 1433 | Ga0501034_0346230 | 3300049571 | Bacteria | 1415 |
| 1434 | Ga0501034_0452520 | 3300049571 | Bacteria | 1201 |
| 1435 | Ga0501036_0000004 | 3300049572 | Bacteria | 253881 |
| 1436 | Ga0501036_0000928 | 3300049572 | Bacteria | 21973 |
| 1437 | Ga0501036_0012091 | 3300049572 | Bacteria | 7155 |
| 1438 | Ga0501036_0013985 | 3300049572 | Bacteria | 6671 |
| 1439 | Ga0501036_0037538 | 3300049572 | Bacteria | 4098 |
| 1440 | Ga0501037_0000004 | 3300049573 | Bacteria | 253989 |
| 1441 | Ga0501037_0000007 | 3300049573 | Bacteria | 215187 |
| 1442 | Ga0501037_0000081 | 3300049573 | Bacteria | 86623 |
| 1443 | Ga0501037_0043652 | 3300049573 | Bacteria | 3294 |
| 1444 | Ga0501037_0214610 | 3300049573 | Bacteria | 1356 |
| 1445 | Ga0501037_0229568 | 3300049573 | Bacteria | 1303 |
| 1446 | Ga0501038_0000005 | 3300049574 | Bacteria | 253881 |
| 1447 | Ga0501038_0000033 | 3300049574 | Bacteria | 129840 |
| 1448 | Ga0501038_0000520 | 3300049574 | Bacteria | 33827 |
| 1449 | Ga0501038_0019048 | 3300049574 | Bacteria | 6191 |
| 1450 | Ga0501038_0030498 | 3300049574 | Bacteria | 4771 |
| 1451 | Ga0501038_0051192 | 3300049574 | Bacteria | 3566 |
| 1452 | Ga0501038_0094900 | 3300049574 | Bacteria | 2493 |
| 1453 | Ga0501038_0437373 | 3300049574 | Bacteria | 1007 |
| 1454 | Ga0501039_0000009 | 3300049575 | Bacteria | 253881 |
| 1455 | Ga0501039_0000031 | 3300049575 | Bacteria | 129814 |
| 1456 | Ga0501039_0014960 | 3300049575 | Bacteria | 5934 |
| 1457 | Ga0501039_0015253 | 3300049575 | Bacteria | 5881 |
| 1458 | Ga0501039_0044932 | 3300049575 | Bacteria | 3412 |
| 1459 | Ga0501039_0159140 | 3300049575 | Bacteria | 1775 |
| 1460 | Ga0501040_0009968 | 3300049576 | Bacteria | 6205 |
| 1461 | Ga0501040_0023407 | 3300049576 | Bacteria | 4142 |
| 1462 | Ga0501040_0036626 | 3300049576 | Bacteria | 3330 |
| 1463 | Ga0501040_0042264 | 3300049576 | Bacteria | 3104 |
| 1464 | Ga0501041_0006543 | 3300049577 | Bacteria | 6824 |
| 1465 | Ga0501041_0012239 | 3300049577 | Bacteria | 5082 |
| 1466 | Ga0501041_0081398 | 3300049577 | Bacteria | 1994 |
| 1467 | Ga0501041_0160012 | 3300049577 | Bacteria | 1408 |
| 1468 | Ga0501042_0019465 | 3300049578 | Bacteria | 4714 |
| 1469 | Ga0501042_0025815 | 3300049578 | Bacteria | 4129 |
| 1470 | Ga0501042_0038541 | 3300049578 | Bacteria | 3394 |
| 1471 | Ga0501042_0044684 | 3300049578 | Bacteria | 3157 |
| 1472 | Ga0501043_0000034 | 3300049579 | Bacteria | 133724 |
| 1473 | Ga0501043_0000044 | 3300049579 | Bacteria | 114304 |
| 1474 | Ga0501043_0001790 | 3300049579 | Bacteria | 18455 |
| 1475 | Ga0501043_0035499 | 3300049579 | Bacteria | 3921 |
| 1476 | Ga0501043_0048558 | 3300049579 | Bacteria | 3337 |
| 1477 | Ga0501043_0085182 | 3300049579 | Bacteria | 2483 |
| 1478 | Ga0501043_0115629 | 3300049579 | Bacteria | 2105 |
| 1479 | Ga0501046_0011042 | 3300049580 | Bacteria | 7738 |
| 1480 | Ga0501046_0035913 | 3300049580 | Bacteria | 3991 |
| 1481 | Ga0501046_0041626 | 3300049580 | Bacteria | 3665 |
| 1482 | Ga0501046_0052392 | 3300049580 | Bacteria | 3216 |
| 1483 | Ga0501046_0083875 | 3300049580 | Bacteria | 2459 |
| 1484 | Ga0501046_0107340 | 3300049580 | Bacteria | 2136 |
| 1485 | Ga0501047_0005769 | 3300049581 | Bacteria | 11658 |
| 1486 | Ga0501047_0008561 | 3300049581 | Bacteria | 9653 |
| 1487 | Ga0501047_0032505 | 3300049581 | Bacteria | 5036 |
| 1488 | Ga0501047_0041765 | 3300049581 | Bacteria | 4431 |
| 1489 | Ga0501047_0062853 | 3300049581 | Bacteria | 3581 |
| 1490 | Ga0501047_0063378 | 3300049581 | Bacteria | 3566 |
| 1491 | Ga0501047_0106266 | 3300049581 | Bacteria | 2687 |
| 1492 | Ga0501048_0022942 | 3300049582 | Bacteria | 4562 |
| 1493 | Ga0501048_0025003 | 3300049582 | Bacteria | 4356 |
| 1494 | Ga0501048_0059773 | 3300049582 | Bacteria | 2701 |
| 1495 | Ga0501048_0108592 | 3300049582 | Bacteria | 1959 |
| 1496 | Ga0501067_0045863 | 3300049583 | Bacteria | 2426 |
| 1497 | Ga0501068_0006004 | 3300049584 | Bacteria | 6671 |
| 1498 | Ga0501068_0036659 | 3300049584 | Bacteria | 2934 |
| 1499 | Ga0501068_0048843 | 3300049584 | Bacteria | 2555 |
| 1500 | Ga0501069_0000075 | 3300049585 | Bacteria | 48324 |
| 1501 | Ga0501069_0002889 | 3300049585 | Bacteria | 8818 |
| 1502 | Ga0501069_0006374 | 3300049585 | Bacteria | 6167 |
| 1503 | Ga0501069_0049686 | 3300049585 | Bacteria | 2331 |
| 1504 | Ga0501070_0000284 | 3300049586 | Bacteria | 47435 |
| 1505 | Ga0501070_0004793 | 3300049586 | Bacteria | 11571 |
| 1506 | Ga0501070_0005298 | 3300049586 | Bacteria | 11003 |
| 1507 | Ga0501070_0006011 | 3300049586 | Bacteria | 10337 |
| 1508 | Ga0501071_0000788 | 3300049587 | Bacteria | 16887 |
| 1509 | Ga0501071_0038242 | 3300049587 | Bacteria | 3428 |
| 1510 | Ga0501071_0047775 | 3300049587 | Bacteria | 3075 |
| 1511 | Ga0501071_0068628 | 3300049587 | Bacteria | 2580 |
| 1512 | Ga0501071_0069364 | 3300049587 | Bacteria | 2567 |
| 1513 | Ga0501071_0209729 | 3300049587 | Bacteria | 1465 |
| 1514 | Ga0501072_0006065 | 3300049588 | Bacteria | 9227 |
| 1515 | Ga0501072_0013019 | 3300049588 | Bacteria | 6367 |
| 1516 | Ga0501072_0042201 | 3300049588 | Bacteria | 3583 |
| 1517 | Ga0501073_0007771 | 3300049589 | Bacteria | 7962 |
| 1518 | Ga0501074_0000101 | 3300049590 | Bacteria | 41856 |
| 1519 | Ga0501074_0030410 | 3300049590 | Bacteria | 3913 |
| 1520 | Ga0501074_0034278 | 3300049590 | Bacteria | 3680 |
| 1521 | Ga0501074_0038952 | 3300049590 | Bacteria | 3443 |
| 1522 | Ga0501075_0030295 | 3300049591 | Bacteria | 4007 |
| 1523 | Ga0501075_0052526 | 3300049591 | Bacteria | 3064 |
| 1524 | Ga0501075_0282940 | 3300049591 | Bacteria | 1264 |
| 1525 | Ga0501076_0010182 | 3300049592 | Bacteria | 6967 |
| 1526 | Ga0501076_0014907 | 3300049592 | Bacteria | 5866 |
| 1527 | Ga0501076_0020166 | 3300049592 | Bacteria | 5101 |
| 1528 | Ga0501076_0062971 | 3300049592 | Bacteria | 2954 |
| 1529 | Ga0501076_0111709 | 3300049592 | Bacteria | 2209 |
| 1530 | Ga0501076_0116143 | 3300049592 | Bacteria | 2166 |
| 1531 | Ga0501076_0231944 | 3300049592 | Bacteria | 1509 |
| 1532 | Ga0501077_0007500 | 3300049593 | Bacteria | 6730 |
| 1533 | Ga0501077_0024389 | 3300049593 | Bacteria | 3841 |
| 1534 | Ga0501077_0044183 | 3300049593 | Bacteria | 2831 |
| 1535 | Ga0501077_0046334 | 3300049593 | Bacteria | 2762 |
| 1536 | Ga0501079_0020709 | 3300049741 | Bacteria | 5028 |
| 1537 | Ga0501079_0036801 | 3300049741 | Bacteria | 3769 |
| 1538 | Ga0501079_0041950 | 3300049741 | Bacteria | 3533 |
| 1539 | Ga0501079_0090439 | 3300049741 | Bacteria | 2371 |
| 1540 | Ga0501080_0000843 | 3300049742 | Bacteria | 25055 |
| 1541 | Ga0501080_0001651 | 3300049742 | Bacteria | 18961 |
| 1542 | Ga0501080_0026752 | 3300049742 | Bacteria | 5361 |
| 1543 | Ga0501080_0111895 | 3300049742 | Bacteria | 2531 |
| 1544 | Ga0501080_0127833 | 3300049742 | Bacteria | 2353 |
| 1545 | Ga0501081_0004251 | 3300049743 | Bacteria | 9176 |
| 1546 | Ga0501081_0026043 | 3300049743 | Bacteria | 3940 |
| 1547 | Ga0501081_0027775 | 3300049743 | Bacteria | 3815 |
| 1548 | Ga0501081_0113838 | 3300049743 | Bacteria | 1921 |
| 1549 | Ga0501083_0000191 | 3300049744 | Bacteria | 39326 |
| 1550 | Ga0501083_0011637 | 3300049744 | Bacteria | 6173 |
| 1551 | Ga0501083_0052796 | 3300049744 | Bacteria | 2730 |
| 1552 | Ga0501035_0000014 | 3300049822 | Bacteria | 253874 |
| 1553 | Ga0501035_0000469 | 3300049822 | Bacteria | 45211 |
| 1554 | Ga0501035_0000472 | 3300049822 | Bacteria | 45098 |
| 1555 | Ga0501035_0000546 | 3300049822 | Bacteria | 41848 |
| 1556 | Ga0501035_0003018 | 3300049822 | Bacteria | 16149 |
| 1557 | Ga0501035_0009851 | 3300049822 | Bacteria | 8873 |
| 1558 | Ga0501035_0048750 | 3300049822 | Bacteria | 3797 |
| 1559 | Ga0501035_0052261 | 3300049822 | Bacteria | 3657 |
| 1560 | Ga0501035_0065575 | 3300049822 | Bacteria | 3224 |
| 1561 | Ga0501035_0085804 | 3300049822 | Bacteria | 2774 |
| 1562 | Ga0501035_0090284 | 3300049822 | Bacteria | 2697 |
| 1563 | Ga0501035_0151917 | 3300049822 | Bacteria | 2009 |
| 1564 | Ga0501044_0000010 | 3300049823 | Bacteria | 260121 |
| 1565 | Ga0501044_0000012 | 3300049823 | Bacteria | 253881 |
| 1566 | Ga0501044_0003181 | 3300049823 | Bacteria | 18539 |
| 1567 | Ga0501044_0016120 | 3300049823 | Bacteria | 8032 |
| 1568 | Ga0501044_0023375 | 3300049823 | Bacteria | 6574 |
| 1569 | Ga0501044_0069596 | 3300049823 | Bacteria | 3582 |
| 1570 | Ga0501044_0085984 | 3300049823 | Bacteria | 3177 |
| 1571 | Ga0501044_0087979 | 3300049823 | Bacteria | 3136 |
| 1572 | Ga0501044_0114272 | 3300049823 | Bacteria | 2706 |
| 1573 | Ga0501044_0130873 | 3300049823 | Bacteria | 2503 |
| 1574 | Ga0501044_0157420 | 3300049823 | Bacteria | 2250 |
| 1575 | Ga0501044_0224941 | 3300049823 | Bacteria | 1826 |
| 1576 | Ga0501044_0234415 | 3300049823 | Bacteria | 1781 |
| 1577 | Ga0501045_0007600 | 3300049824 | Bacteria | 7534 |
| 1578 | Ga0501045_0007710 | 3300049824 | Bacteria | 7488 |
| 1579 | Ga0501045_0010155 | 3300049824 | Bacteria | 6588 |
| 1580 | Ga0501045_0034851 | 3300049824 | Bacteria | 3653 |
| 1581 | Ga0501045_0063244 | 3300049824 | Bacteria | 2715 |
| 1582 | Ga0501226_000002 | 3300049853 | Bacteria | 426935 |
| 1583 | nmdc:mga03683_3676_c1 | 3300050489 | Bacteria | 4696 |
| 1584 | nmdc:mga03683_58689_c1 | 3300050489 | Bacteria | 1622 |
| 1585 | nmdc:mga03683_61559_c1 | 3300050489 | Bacteria | 1588 |
| 1586 | nmdc:mga03683_7377_c2 | 3300050489 | Bacteria | 2876 |
| 1587 | nmdc:mga03n38_10080_c1 | 3300050490 | Bacteria | 3463 |
| 1588 | nmdc:mga03n38_59665_c1 | 3300050490 | Bacteria | 1732 |
| 1589 | nmdc:mga03n38_6071_c1 | 3300050490 | Bacteria | 4169 |
| 1590 | nmdc:mga00v17_10994_c1 | 3300050491 | Bacteria | 4961 |
| 1591 | nmdc:mga00v17_11669_c1 | 3300050491 | Bacteria | 4832 |
| 1592 | nmdc:mga00v17_1801_c1 | 3300050491 | Bacteria | 11100 |
| 1593 | nmdc:mga00v17_45_c1 | 3300050491 | Bacteria | 78686 |
| 1594 | nmdc:mga00v17_77929_c1 | 3300050491 | Bacteria | 2064 |
| 1595 | nmdc:mga0yw44_1411_c1 | 3300050492 | Bacteria | 9526 |
| 1596 | nmdc:mga0yw44_21763_c1 | 3300050492 | Bacteria | 3584 |
| 1597 | nmdc:mga0yw44_2560_c1 | 3300050492 | Bacteria | 7805 |
| 1598 | nmdc:mga0yw44_59184_c1 | 3300050492 | Bacteria | 2343 |
| 1599 | nmdc:mga0k408_122041_c1 | 3300050493 | Bacteria | 1544 |
| 1600 | nmdc:mga0k408_14605_c1 | 3300050493 | Bacteria | 4331 |
| 1601 | nmdc:mga06z11_11068_c1 | 3300050494 | Bacteria | 3874 |
| 1602 | nmdc:mga06z11_111037_c1 | 3300050494 | Bacteria | 1518 |
| 1603 | nmdc:mga06z11_1859_c1 | 3300050494 | Bacteria | 7959 |
| 1604 | nmdc:mga06z11_4728_c1 | 3300050494 | Bacteria | 5384 |
| 1605 | nmdc:mga06z11_72911_c1 | 3300050494 | Bacteria | 1822 |
| 1606 | nmdc:mga04h51_14377_c1 | 3300050495 | Bacteria | 2261 |
| 1607 | nmdc:mga04h51_17882_c1 | 3300050495 | Bacteria | 2080 |
| 1608 | nmdc:mga04h51_6329_c1 | 3300050495 | Bacteria | 3065 |
| 1609 | nmdc:mga07m45_31009_c1 | 3300050496 | Bacteria | 2962 |
| 1610 | nmdc:mga05p37_146_c2 | 3300050507 | Bacteria | 39342 |
| 1611 | nmdc:mga05p37_175331_c1 | 3300050507 | Bacteria | 2612 |
| 1612 | nmdc:mga05p37_193989_c1 | 3300050507 | Bacteria | 2464 |
| 1613 | nmdc:mga05p37_79974_c1 | 3300050507 | Bacteria | 4025 |
| 1614 | nmdc:mga09592_309_c1 | 3300050508 | Bacteria | 35745 |
| 1615 | nmdc:mga09592_330917_c1 | 3300050508 | Bacteria | 1319 |
| 1616 | nmdc:mga09592_44168_c1 | 3300050508 | Bacteria | 3750 |
| 1617 | nmdc:mga0qj67_201170_c1 | 3300050509 | Bacteria | 1618 |
| 1618 | nmdc:mga0qj67_6132_c1 | 3300050509 | Bacteria | 8813 |
| 1619 | nmdc:mga06r32_163486_c1 | 3300050510 | Bacteria | 2208 |
| 1620 | nmdc:mga06r32_296_c1 | 3300050510 | Bacteria | 41448 |
| 1621 | nmdc:mga06r32_3070_c1 | 3300050510 | Bacteria | 14944 |
| 1622 | nmdc:mga08y16_1223_c1 | 3300050511 | Bacteria | 25402 |
| 1623 | nmdc:mga08y16_144865_c1 | 3300050511 | Bacteria | 2469 |
| 1624 | nmdc:mga08y16_36156_c1 | 3300050511 | Bacteria | 5187 |
| 1625 | nmdc:mga08y16_41233_c1 | 3300050511 | Bacteria | 4837 |
| 1626 | nmdc:mga0n895_118237_c1 | 3300050512 | Bacteria | 2670 |
| 1627 | nmdc:mga0n895_171108_c1 | 3300050512 | Bacteria | 2204 |
| 1628 | nmdc:mga0n895_76619_c1 | 3300050512 | Bacteria | 3325 |
| 1629 | nmdc:mga0rr50_5670_c1 | 3300050513 | Bacteria | 7476 |
| 1630 | nmdc:mga08x19_26494_c1 | 3300050514 | Bacteria | 3618 |
| 1631 | nmdc:mga08x19_31582_c1 | 3300050514 | Bacteria | 3332 |
| 1632 | nmdc:mga08x19_59231_c1 | 3300050514 | Bacteria | 2478 |
| 1633 | nmdc:mga0a205_20791_c1 | 3300050515 | Bacteria | 6200 |
| 1634 | nmdc:mga0a205_218337_c1 | 3300050515 | Bacteria | 1793 |
| 1635 | nmdc:mga0sz30_3249_c1 | 3300050516 | Bacteria | 5842 |
| 1636 | nmdc:mga0sz30_6230_c1 | 3300050516 | Bacteria | 3395 |
| 1637 | Ga0500578_0021908 | 3300053086 | Bacteria | 4104 |
| 1638 | Ga0500643_000153 | 3300053087 | Bacteria | 69793 |
| 1639 | Ga0500555_004924 | 3300053103 | Bacteria | 3788 |
| 1640 | Ga0500595_000747 | 3300053119 | Bacteria | 19155 |
| 1641 | Ga0500608_021334 | 3300053122 | Bacteria | 2992 |
| 1642 | Ga0500658_0037029 | 3300053134 | Bacteria | 1938 |
| 1643 | Ga0500658_0091807 | 3300053134 | Bacteria | 1314 |
| 1644 | Ga0500568_0000202 | 3300053139 | Bacteria | 52432 |
| 1645 | Ga0500568_0051446 | 3300053139 | Bacteria | 1620 |
| 1646 | Ga0500573_0014865 | 3300053140 | Bacteria | 4409 |
| 1647 | Ga0500590_026998 | 3300053148 | Bacteria | 2977 |
| 1648 | Ga0500604_0000130 | 3300053151 | Bacteria | 22780 |
| 1649 | Ga0500616_0000102 | 3300053153 | Bacteria | 168834 |
| 1650 | Ga0500616_0001640 | 3300053153 | Bacteria | 20715 |
| 1651 | Ga0500624_001028 | 3300053157 | Bacteria | 5541 |
| 1652 | Ga0500627_0033440 | 3300053158 | Bacteria | 2173 |
| 1653 | Ga0500634_0000034 | 3300053161 | Bacteria | 74144 |
| 1654 | Ga0500634_0104226 | 3300053161 | Bacteria | 1413 |
| 1655 | Ga0500636_0000003 | 3300053177 | Bacteria | 240189 |
| 1656 | Ga0500609_005863 | 3300053731 | Bacteria | 1677 |
| 1657 | Ga0501084_0021979 | 3300054114 | Bacteria | 5321 |
| 1658 | Ga0501084_0025141 | 3300054114 | Bacteria | 4968 |
| 1659 | Ga0501084_0027937 | 3300054114 | Bacteria | 4714 |
| 1660 | Ga0501084_0086791 | 3300054114 | Bacteria | 2627 |
| 1661 | Ga0501084_0093697 | 3300054114 | Bacteria | 2522 |
| 1662 | Ga0501084_0323688 | 3300054114 | Bacteria | 1302 |
| 1663 | Ga0590071_002592 | 3300059421 | Bacteria | 4547 |
| 1664 | Ga0501082_0008290 | 3300060353 | Bacteria | 8961 |
| 1665 | Ga0501082_0024143 | 3300060353 | Bacteria | 5245 |
| 1666 | Ga0501082_0025691 | 3300060353 | Bacteria | 5075 |
| 1667 | Ga0501082_0029768 | 3300060353 | Bacteria | 4704 |
| 1668 | Ga0501082_0035257 | 3300060353 | Bacteria | 4313 |
| 1669 | Ga0501082_0069344 | 3300060353 | Bacteria | 3035 |
| 1670 | Ga0501082_0104368 | 3300060353 | Bacteria | 2452 |
| 1671 | Ga0501082_0189146 | 3300060353 | Bacteria | 1791 |
| 1672 | Ga0501082_0302900 | 3300060353 | Bacteria | 1392 |
| 1673 | Ga0530510_0001160 | 3300061734 | Bacteria | 17501 |
| 1674 | Ga0530510_0010708 | 3300061734 | Bacteria | 6433 |
| 1675 | Ga0530510_0014719 | 3300061734 | Bacteria | 5522 |
| 1676 | Ga0530510_0062198 | 3300061734 | Bacteria | 2703 |
| 1677 | Ga0530510_0082110 | 3300061734 | Bacteria | 2347 |
| 1678 | 2503199909 | 2503198000 | Bacteria | 6884444 |
| 1679 | 2508728831 | 2508501050 | Bacteria | 9633614 |
| 1680 | 2509075704 | 2508501114 | Bacteria | 7082538 |
| 1681 | 2509108366 | 2508501122 | Bacteria | 6292184 |
| 1682 | 2509114617 | 2508501123 | Bacteria | 6283661 |
| 1683 | 2509142635 | 2508501127 | Bacteria | 7037543 |
| 1684 | 2509369617 | 2509276018 | Bacteria | 6910194 |
| 1685 | 2509376501 | 2509276019 | Bacteria | 6802256 |
| 1686 | 2509392025 | 2509276021 | Bacteria | 7634384 |
| 1687 | 2509394831 | 2509276022 | Bacteria | 6200534 |
| 1688 | 2509445616 | 2509276033 | Bacteria | 7180565 |
| 1689 | 2509447083 | 2509276033 | Bacteria | 7180565 |
| 1690 | 2510133984 | 2510065019 | Bacteria | 6903379 |
| 1691 | 2510306484 | 2510065057 | Bacteria | 6649661 |
| 1692 | 2510318574 | 2510065059 | Bacteria | 6847884 |
| 1693 | 2510841240 | 2510461069 | Bacteria | 5505000 |
| 1694 | 2510895405 | 2510461076 | Bacteria | 8618824 |
| 1695 | 2511134004 | 2510917022 | Bacteria | 6504556 |
| 1696 | 2511172756 | 2510917026 | Bacteria | 7046020 |
| 1697 | 2511187084 | 2510917028 | Bacteria | 6185411 |
| 1698 | 2511199059 | 2510917030 | Bacteria | 7460662 |
| 1699 | 2511257459 | 2511231004 | Bacteria | 6669789 |
| 1700 | 2511274082 | 2511231007 | Bacteria | 6306603 |
| 1701 | 2511276593 | 2511231008 | Bacteria | 6624100 |
| 1702 | 2511304155 | 2511231012 | Bacteria | 6738011 |
| 1703 | 2511314752 | 2511231014 | Bacteria | 6462302 |
| 1704 | 2511322540 | 2511231015 | Bacteria | 6598026 |
| 1705 | 2511327815 | 2511231016 | Bacteria | 6704427 |
| 1706 | 2511331166 | 2511231017 | Bacteria | 6503007 |
| 1707 | 2511340611 | 2511231018 | Bacteria | 6436256 |
| 1708 | 2511344623 | 2511231019 | Bacteria | 6520662 |
| 1709 | 2511349948 | 2511231020 | Bacteria | 6115223 |
| 1710 | 2511358753 | 2511231021 | Bacteria | 7302637 |
| 1711 | 2511362454 | 2511231022 | Bacteria | 6719296 |
| 1712 | 2511390294 | 2511231027 | Bacteria | 5013807 |
| 1713 | 2511502274 | 2511231052 | Bacteria | 6974333 |
| 1714 | 2512533648 | 2512047086 | Bacteria | 6850303 |
| 1715 | 2512932616 | 2512875016 | Bacteria | 6529530 |
| 1716 | 2512960638 | 2512875024 | Bacteria | 7195110 |
| 1717 | 2512970652 | 2512875026 | Bacteria | 6861065 |
| 1718 | 2513567940 | 2513237084 | Bacteria | 7231967 |
| 1719 | 2513576975 | 2513237085 | Bacteria | 7695351 |
| 1720 | 2513584354 | 2513237086 | Bacteria | 7265287 |
| 1721 | 2513596505 | 2513237088 | Bacteria | 6927906 |
| 1722 | 2513601714 | 2513237089 | Bacteria | 6553624 |
| 1723 | 2513608735 | 2513237090 | Bacteria | 7096802 |
| 1724 | 2513618834 | 2513237091 | Bacteria | 6900273 |
| 1725 | 2513633355 | 2513237093 | Bacteria | 7545552 |
| 1726 | 2513707628 | 2513237103 | Bacteria | 7647401 |
| 1727 | 2513865629 | 2513237138 | Bacteria | 7368160 |
| 1728 | 2513884374 | 2513237140 | Bacteria | 7076289 |
| 1729 | 2513905041 | 2513237143 | Bacteria | 6664116 |
| 1730 | 2513908966 | 2513237144 | Bacteria | 7530820 |
| 1731 | 2513925355 | 2513237146 | Bacteria | 7166346 |
| 1732 | 2513984133 | 2513237156 | Bacteria | 6402557 |
| 1733 | 2514001471 | 2513237159 | Bacteria | 6810126 |
| 1734 | 2514002843 | 2513237160 | Bacteria | 6650282 |
| 1735 | 2514019976 | 2513237162 | Bacteria | 7468464 |
| 1736 | 2514036276 | 2513237164 | Bacteria | 7563725 |
| 1737 | 2514422823 | 2513237305 | Bacteria | 7293571 |
| 1738 | 2514587423 | 2513237351 | Bacteria | 6968952 |
| 1739 | 2515113033 | 2515075009 | Bacteria | 7288508 |
| 1740 | 2515609051 | 2515154107 | Bacteria | 6795637 |
| 1741 | 2515638312 | 2515154113 | Bacteria | 7807172 |
| 1742 | 2515640993 | 2515154114 | Bacteria | 7848616 |
| 1743 | 2515655324 | 2515154116 | Bacteria | 7552979 |
| 1744 | 2515739515 | 2515154134 | Bacteria | 7220242 |
| 1745 | 2516204175 | 2516143018 | Bacteria | 6951533 |
| 1746 | 2516893653 | 2516653046 | Bacteria | 6989037 |
| 1747 | 2517036735 | 2516653077 | Bacteria | 7555578 |
| 1748 | 2517077096 | 2516653085 | Bacteria | 7346596 |
| 1749 | 2517095862 | 2517093000 | Bacteria | 7412387 |
| 1750 | 2517407433 | 2517287029 | Bacteria | 6905599 |
| 1751 | 2517570377 | 2517487022 | Bacteria | 7227575 |
| 1752 | 2524448526 | 2524023207 | Bacteria | 6813453 |
| 1753 | 2524459618 | 2524023209 | Bacteria | 6679728 |
| 1754 | 2530645921 | 2529292951 | Bacteria | 6916614 |
| 1755 | 2535486687 | 2534681786 | Bacteria | 3308809 |
| 1756 | 2535516896 | 2534681796 | Bacteria | 7146037 |
| 1757 | 2537876042 | 2537561587 | Bacteria | 5425293 |
| 1758 | 2551678485 | 2551306084 | Bacteria | 8942552 |
| 1759 | 2551689787 | 2551306085 | Bacteria | 7347181 |
| 1760 | 2551694375 | 2551306086 | Bacteria | 6843938 |
| 1761 | 2551701991 | 2551306087 | Bacteria | 7351905 |
| 1762 | 2551715262 | 2551306089 | Bacteria | 7162724 |
| 1763 | 2551723698 | 2551306090 | Bacteria | 7953713 |
| 1764 | 2551738189 | 2551306092 | Bacteria | 6992595 |
| 1765 | 2551743399 | 2551306093 | Bacteria | 7064773 |
| 1766 | 2554248263 | 2554235003 | Bacteria | 5877155 |
| 1767 | 2558864431 | 2558860100 | Bacteria | 8458965 |
| 1768 | 2559295379 | 2558860242 | Bacteria | 5568029 |
| 1769 | 2585166384 | 2582581283 | Bacteria | 6030556 |
| 1770 | 2585202239 | 2582581294 | Bacteria | 6626667 |
| 1771 | 2585222862 | 2582581298 | Bacteria | 7315509 |
| 1772 | 2585231773 | 2582581299 | Bacteria | 6518058 |
| 1773 | 2585255117 | 2582581304 | Bacteria | 5831370 |
| 1774 | 2585267391 | 2582581306 | Bacteria | 6450535 |
| 1775 | 2585271167 | 2582581307 | Bacteria | 6597605 |
| 1776 | 2585277512 | 2582581308 | Bacteria | 7413247 |
| 1777 | 2585323304 | 2582581315 | Bacteria | 7318924 |
| 1778 | 2585331447 | 2582581316 | Bacteria | 7774528 |
| 1779 | 2585386459 | 2582581865 | Bacteria | 6644329 |
| 1780 | 2585393286 | 2582581866 | Bacteria | 6859583 |
| 1781 | 2585402368 | 2582581867 | Bacteria | 7184437 |
| 1782 | 2585527477 | 2585427526 | Bacteria | 7258840 |
| 1783 | 2585535139 | 2585427527 | Bacteria | 7273426 |
| 1784 | 2585538215 | 2585427528 | Bacteria | 6842387 |
| 1785 | 2585545445 | 2585427529 | Bacteria | 7395659 |
| 1786 | 2585555989 | 2585427530 | Bacteria | 7383882 |
| 1787 | 2585558891 | 2585427531 | Bacteria | 6992870 |
| 1788 | 2585822945 | 2585427590 | Bacteria | 6824633 |
| 1789 | 2585836164 | 2585427593 | Bacteria | 7141551 |
| 1790 | 2585843258 | 2585427594 | Bacteria | 6180594 |
| 1791 | 2585898272 | 2585427608 | Bacteria | 6544331 |
| 1792 | 2585904139 | 2585427609 | Bacteria | 6667127 |
| 1793 | 2585996232 | 2585427633 | Bacteria | 6413184 |
| 1794 | 2586000843 | 2585427634 | Bacteria | 6455027 |
| 1795 | 2587980744 | 2585428125 | Bacteria | 6662905 |
| 1796 | 2588518695 | 2588253730 | Bacteria | 6881675 |
| 1797 | 2597812084 | 2597489875 | Bacteria | 7010078 |
| 1798 | 2599331779 | 2599185156 | Bacteria | 5403036 |
| 1799 | 2599417271 | 2599185170 | Bacteria | 7295545 |
| 1800 | 2599601691 | 2599185210 | Bacteria | 5624189 |
| 1801 | 2599936480 | 2599185301 | Bacteria | 6161860 |
| 1802 | 2600195485 | 2599185352 | Bacteria | 7228948 |
| 1803 | 2601610049 | 2600255279 | Bacteria | 5605316 |
| 1804 | 2601746824 | 2600255308 | Bacteria | 5611129 |
| 1805 | 2616293331 | 2615840624 | Bacteria | 6557588 |
| 1806 | 2616308987 | 2615840626 | Bacteria | 7921970 |
| 1807 | 2616554258 | 2615840698 | Bacteria | 7319877 |
| 1808 | 2617383598 | 2617270742 | Bacteria | 6808054 |
| 1809 | 2624492827 | 2623620446 | Bacteria | 6500345 |
| 1810 | 2643754798 | 2643221547 | Bacteria | 4740017 |
| 1811 | 2643769871 | 2643221550 | Bacteria | 4619371 |
| 1812 | 2643803052 | 2643221557 | Bacteria | 7184309 |
| 1813 | 2643811503 | 2643221558 | Bacteria | 5460675 |
| 1814 | 2643837674 | 2643221564 | Bacteria | 4193379 |
| 1815 | 2643845851 | 2643221565 | Bacteria | 6216018 |
| 1816 | 2643856735 | 2643221568 | Bacteria | 5187270 |
| 1817 | 2643912693 | 2643221580 | Bacteria | 3816678 |
| 1818 | 2643920311 | 2643221582 | Bacteria | 5804683 |
| 1819 | 2643953778 | 2643221589 | Bacteria | 6250934 |
| 1820 | 2643966195 | 2643221591 | Bacteria | 4397626 |
| 1821 | 2643987406 | 2643221595 | Bacteria | 6565519 |
| 1822 | 2644003139 | 2643221599 | Bacteria | 6292121 |
| 1823 | 2644021712 | 2643221602 | Bacteria | 6249926 |
| 1824 | 2644050483 | 2643221607 | Bacteria | 6314006 |
| 1825 | 2644063414 | 2643221610 | Bacteria | 7480339 |
| 1826 | 2644107246 | 2643221618 | Bacteria | 7717186 |
| 1827 | 2644133310 | 2643221623 | Bacteria | 5239945 |
| 1828 | 2644150812 | 2643221626 | Bacteria | 8069654 |
| 1829 | 2644158074 | 2643221627 | Bacteria | 6761570 |
| 1830 | 2644169787 | 2643221629 | Bacteria | 5850260 |
| 1831 | 2644189435 | 2643221633 | Bacteria | 6733554 |
| 1832 | 2644193541 | 2643221634 | Bacteria | 6705461 |
| 1833 | 2644205711 | 2643221636 | Bacteria | 6583769 |
| 1834 | 2644208998 | 2643221637 | Bacteria | 5345260 |
| 1835 | 2644238647 | 2643221643 | Bacteria | 5749658 |
| 1836 | 2644298703 | 2643221653 | Bacteria | 4569637 |
| 1837 | 2644308641 | 2643221655 | Bacteria | 7722067 |
| 1838 | 2644335459 | 2643221659 | Bacteria | 7890716 |
| 1839 | 2644350422 | 2643221662 | Bacteria | 5851492 |
| 1840 | 2644374697 | 2643221668 | Bacteria | 7306521 |
| 1841 | 2644413304 | 2643221674 | Bacteria | 3919126 |
| 1842 | 2644414177 | 2643221675 | Bacteria | 7473456 |
| 1843 | 2644447705 | 2643221680 | Bacteria | 7473610 |
| 1844 | 2644483401 | 2643221686 | Bacteria | 6310811 |
| 1845 | 2644492060 | 2643221688 | Bacteria | 5260751 |
| 1846 | 2644499614 | 2643221689 | Bacteria | 6042950 |
| 1847 | 2644521927 | 2643221693 | Bacteria | 5513853 |
| 1848 | 2644539864 | 2643221698 | Bacteria | 7756764 |
| 1849 | 2644614582 | 2643221712 | Bacteria | 7729434 |
| 1850 | 2644652528 | 2643221718 | Bacteria | 5345506 |
| 1851 | 2644656932 | 2643221719 | Bacteria | 4568197 |
| 1852 | 2644676045 | 2643221723 | Bacteria | 7095460 |
| 1853 | 2644690178 | 2643221726 | Bacteria | 7455827 |
| 1854 | 2644732812 | 2643221733 | Bacteria | 5690728 |
| 1855 | 2644734594 | 2643221734 | Bacteria | 5365412 |
| 1856 | 2644743946 | 2643221736 | Bacteria | 6608466 |
| 1857 | 2657681593 | 2657244999 | Bacteria | 5946535 |
| 1858 | 2671111401 | 2667528174 | Bacteria | 6435400 |
| 1859 | 2688597164 | 2687453392 | Bacteria | 6880454 |
| 1860 | 2692315511 | 2690316117 | Bacteria | 6800650 |
| 1861 | 2694628770 | 2693429783 | Bacteria | 7019804 |
| 1862 | 2694637316 | 2693429784 | Bacteria | 7241525 |
| 1863 | 2719181836 | 2718217882 | Bacteria | 6556348 |
| 1864 | 2719386442 | 2718217927 | Bacteria | 6972593 |
| 1865 | 2719666188 | 2718217997 | Bacteria | 6740740 |
| 1866 | 2719732500 | 2718218009 | Bacteria | 6478651 |
| 1867 | 2720492608 | 2718218199 | Bacteria | 6740745 |
| 1868 | 2720614042 | 2718218232 | Bacteria | 6720332 |
| 1869 | 2720620849 | 2718218233 | Bacteria | 6662049 |
| 1870 | 2720632174 | 2718218235 | Bacteria | 6630699 |
| 1871 | 2720775902 | 2718218269 | Bacteria | 6906114 |
| 1872 | 2721147927 | 2718218363 | Bacteria | 6524337 |
| 1873 | 2721159378 | 2718218365 | Bacteria | 6274507 |
| 1874 | 2721164763 | 2718218366 | Bacteria | 6425255 |
| 1875 | 2721400146 | 2718218423 | Bacteria | 6438183 |
| 1876 | 2722840933 | 2721755514 | Bacteria | 6424414 |
| 1877 | 2723027504 | 2721755556 | Bacteria | 6745503 |
| 1878 | 2723561125 | 2721755684 | Bacteria | 6859907 |
| 1879 | 2723567721 | 2721755685 | Bacteria | 6704835 |
| 1880 | 2723574359 | 2721755686 | Bacteria | 7343952 |
| 1881 | 2724038959 | 2721755809 | Bacteria | 6438790 |
| 1882 | 2724045256 | 2721755810 | Bacteria | 6479005 |
| 1883 | 2724090509 | 2721755819 | Bacteria | 6906405 |
| 1884 | 2724104986 | 2721755822 | Bacteria | 6726041 |
| 1885 | 2724110843 | 2721755823 | Bacteria | 6752556 |
| 1886 | 2725952531 | 2724679232 | Bacteria | 7646494 |
| 1887 | 2730108440 | 2728369352 | Bacteria | 6745171 |
| 1888 | 2730165071 | 2728369365 | Bacteria | 6555560 |
| 1889 | 2730299010 | 2728369397 | Bacteria | 6274511 |
| 1890 | 2738800116 | 2738541293 | Bacteria | 7065685 |
| 1891 | 2738947302 | 2738541317 | Bacteria | 5340176 |
| 1892 | 2739032871 | 2738541333 | Bacteria | 7106503 |
| 1893 | 2739199949 | 2738543004 | Bacteria | 6381073 |
| 1894 | 2739260175 | 2738543015 | Bacteria | 6750701 |
| 1895 | 2739307562 | 2738543024 | Bacteria | 5603683 |
| 1896 | 2753357070 | 2751185800 | Bacteria | 5467370 |
| 1897 | 2753462057 | 2751185821 | Bacteria | 6189929 |
| 1898 | 2756671449 | 2756170246 | Bacteria | 7451806 |
| 1899 | 2757571298 | 2757320392 | Bacteria | 3737298 |
| 1900 | 2758639356 | 2758568016 | Bacteria | 5645291 |
| 1901 | 2765466383 | 2765235802 | Bacteria | 5618596 |
| 1902 | 2766065902 | 2765235942 | Bacteria | 7445910 |
| 1903 | 2770199013 | 2767802442 | Bacteria | 5747986 |
| 1904 | 2774118718 | 2773857670 | Bacteria | 6407454 |
| 1905 | 2774874315 | 2773857925 | Bacteria | 6472445 |
| 1906 | 2776261944 | 2775506901 | Bacteria | 9631051 |
| 1907 | 2776270281 | 2775506902 | Bacteria | 6208009 |
| 1908 | 2776284989 | 2775506904 | Bacteria | 5954060 |
| 1909 | 2776913973 | 2775507049 | Bacteria | 6284736 |
| 1910 | 2778175445 | 2775507266 | Bacteria | 7392367 |
| 1911 | 2784312355 | 2784132072 | Bacteria | 6596533 |
| 1912 | 2792585097 | 2791355082 | Bacteria | 5973319 |
| 1913 | 2792620741 | 2791355091 | Bacteria | 6135441 |
| 1914 | 2792626100 | 2791355092 | Bacteria | 6248105 |
| 1915 | 2792639037 | 2791355094 | Bacteria | 7011481 |
| 1916 | 2792748055 | 2791355123 | Bacteria | 8049106 |
| 1917 | 2793294407 | 2791355256 | Bacteria | 6798008 |
| 1918 | 2793314514 | 2791355259 | Bacteria | 7254731 |
| 1919 | 2793320341 | 2791355260 | Bacteria | 6598818 |
| 1920 | 2793331700 | 2791355261 | Bacteria | 6661293 |
| 1921 | 2793334520 | 2791355262 | Bacteria | 6774204 |
| 1922 | 2793339240 | 2791355263 | Bacteria | 6872478 |
| 1923 | 2793348910 | 2791355264 | Bacteria | 6429314 |
| 1924 | 2793351802 | 2791355265 | Bacteria | 6539969 |
| 1925 | 2793362550 | 2791355266 | Bacteria | 7116587 |
| 1926 | 2793368843 | 2791355267 | Bacteria | 7222458 |
| 1927 | 2802717006 | 2802428858 | Bacteria | 6636079 |
| 1928 | 2802725755 | 2802428859 | Bacteria | 6667919 |
| 1929 | 2802730156 | 2802428860 | Bacteria | 6525526 |
| 1930 | 2802737873 | 2802428861 | Bacteria | 6534206 |
| 1931 | 2802742673 | 2802428862 | Bacteria | 6633353 |
| 1932 | 2802750161 | 2802428863 | Bacteria | 6410669 |
| 1933 | 2804752782 | 2802429268 | Bacteria | 6094027 |
| 1934 | 2805928771 | 2802429605 | Bacteria | 6875453 |
| 1935 | 2805935053 | 2802429606 | Bacteria | 6346811 |
| 1936 | 2806043851 | 2802429633 | Bacteria | 7341974 |
| 1937 | 2806050218 | 2802429634 | Bacteria | 7083200 |
| 1938 | 2806057034 | 2802429635 | Bacteria | 7650140 |
| 1939 | 2806064415 | 2802429636 | Bacteria | 7597525 |
| 1940 | 2806071682 | 2802429637 | Bacteria | 7067217 |
| 1941 | 2808905340 | 2808606373 | Bacteria | 4423627 |
| 1942 | 2808933204 | 2808606377 | Bacteria | 6646337 |
| 1943 | 2808940170 | 2808606379 | Bacteria | 5022697 |
| 1944 | 2808955289 | 2808606381 | Bacteria | 6646461 |
| 1945 | 2808961781 | 2808606382 | Bacteria | 6841132 |
| 1946 | 2808987887 | 2808606387 | Bacteria | 5697198 |
| 1947 | 2819241372 | 2818991272 | Bacteria | 4622173 |
| 1948 | 2819559092 | 2818991439 | Bacteria | 6907412 |
| 1949 | 2819609177 | 2818991448 | Bacteria | 6772224 |
| 1950 | 2819637594 | 2818991453 | Bacteria | 7181617 |
| 1951 | 2819684942 | 2818991461 | Bacteria | 7026071 |
| 1952 | 2835320033 | 2835312727 | Bacteria | 7413381 |
| 1953 | 2837651168 | 2837651117 | Bacteria | 3772164 |
| 1954 | 2838017622 | 2838016132 | Bacteria | 6577831 |
| 1955 | 2838027578 | 2838022645 | Bacteria | 6494267 |
| 1956 | 2838029776 | 2838029111 | Bacteria | 6603031 |
| 1957 | 2838038530 | 2838035591 | Bacteria | 7166484 |
| 1958 | 2838044993 | 2838042994 | Bacteria | 6046894 |
| 1959 | 2838054332 | 2838048938 | Bacteria | 6044578 |
| 1960 | 2838067705 | 2838061910 | Bacteria | 6794874 |
| 1961 | 2838070112 | 2838068647 | Bacteria | 6208656 |
| 1962 | 2838076828 | 2838074704 | Bacteria | 6785777 |
| 1963 | 2838661559 | 2838661181 | Bacteria | 7385261 |
| 1964 | 2838670391 | 2838668709 | Bacteria | 6671819 |
| 1965 | 2838675740 | 2838675328 | Bacteria | 4909118 |
| 1966 | 2838683434 | 2838680041 | Bacteria | 6545511 |
| 1967 | 2838687021 | 2838686498 | Bacteria | 7807632 |
| 1968 | 2838697623 | 2838694306 | Bacteria | 6853137 |
| 1969 | 2838702762 | 2838701080 | Bacteria | 6669771 |
| 1970 | 2838710739 | 2838707686 | Bacteria | 6619912 |
| 1971 | 2838714622 | 2838714209 | Bacteria | 5525906 |
| 1972 | 2838721577 | 2838719591 | Bacteria | 5523910 |
| 1973 | 2838725382 | 2838724970 | Bacteria | 4908691 |
| 1974 | 2838730006 | 2838729681 | Bacteria | 7400765 |
| 1975 | 2838742979 | 2838742623 | Bacteria | 7396178 |
| 1976 | 2839998269 | 2839993093 | Bacteria | 5512535 |
| 1977 | 2840769105 | 2840764183 | Bacteria | 6358399 |
| 1978 | 2840882777 | 2840878972 | Bacteria | 5483153 |
| 1979 | 2841738074 | 2841734538 | Bacteria | 6784580 |
| 1980 | 2841848527 | 2841846520 | Bacteria | 5345850 |
| 1981 | 2841852465 | 2841851746 | Bacteria | 7532261 |
| 1982 | 2841862157 | 2841859092 | Bacteria | 5436171 |
| 1983 | 2841870813 | 2841864319 | Bacteria | 6742987 |
| 1984 | 2842078912 | 2842077413 | Bacteria | 6508645 |
| 1985 | 2842113235 | 2842110456 | Bacteria | 7656360 |
| 1986 | 2842118578 | 2842118031 | Bacteria | 7033875 |
| 1987 | 2842125442 | 2842124991 | Bacteria | 5346824 |
| 1988 | 2842130635 | 2842130223 | Bacteria | 4909145 |
| 1989 | 2842147980 | 2842146304 | Bacteria | 5957337 |
| 1990 | 2842154195 | 2842152218 | Bacteria | 4908957 |
| 1991 | 2842158076 | 2842156927 | Bacteria | 6894975 |
| 1992 | 2842168761 | 2842163707 | Bacteria | 6916235 |
| 1993 | 2842170866 | 2842170452 | Bacteria | 5525737 |
| 1994 | 2842177815 | 2842175837 | Bacteria | 4908771 |
| 1995 | 2842181695 | 2842180545 | Bacteria | 6888678 |
| 1996 | 2842187731 | 2842187318 | Bacteria | 5524014 |
| 1997 | 2842197388 | 2842192696 | Bacteria | 6147454 |
| 1998 | 2842203588 | 2842198810 | Bacteria | 6608673 |
| 1999 | 2842205450 | 2842205361 | Bacteria | 6340321 |
| 2000 | 2842212042 | 2842211629 | Bacteria | 5523832 |
| 2001 | 2842217967 | 2842217011 | Bacteria | 7497767 |
| 2002 | 2842226339 | 2842224351 | Bacteria | 5524473 |
| 2003 | 2842230254 | 2842229732 | Bacteria | 7475766 |
| 2004 | 2842240490 | 2842237096 | Bacteria | 6620661 |
| 2005 | 2842244157 | 2842243621 | Bacteria | 7421798 |
| 2006 | 2842253046 | 2842250916 | Bacteria | 6579627 |
| 2007 | 2842257757 | 2842257432 | Bacteria | 7401195 |
| 2008 | 2842266297 | 2842264693 | Bacteria | 6472963 |
| 2009 | 2842271441 | 2842271015 | Bacteria | 7807131 |
| 2010 | 2842278907 | 2842278818 | Bacteria | 6340002 |
| 2011 | 2842285569 | 2842285085 | Bacteria | 6011953 |
| 2012 | 2842292574 | 2842291075 | Bacteria | 7076806 |
| 2013 | 2842301400 | 2842298080 | Bacteria | 6123127 |
| 2014 | 2842305070 | 2842304105 | Bacteria | 7023636 |
| 2015 | 2842316973 | 2842311132 | Bacteria | 6616990 |
| 2016 | 2842320740 | 2842317721 | Bacteria | 6793725 |
| 2017 | 2842346489 | 2842341865 | Bacteria | 7003929 |
| 2018 | 2842357937 | 2842357229 | Bacteria | 6485165 |
| 2019 | 2842368928 | 2842363717 | Bacteria | 6844742 |
| 2020 | 2842374065 | 2842370503 | Bacteria | 7038661 |
| 2021 | 2842378972 | 2842377471 | Bacteria | 7140707 |
| 2022 | 2842385089 | 2842384541 | Bacteria | 7057858 |
| 2023 | 2842399849 | 2842395702 | Bacteria | 6780583 |
| 2024 | 2842402929 | 2842402390 | Bacteria | 6681310 |
| 2025 | 2842409699 | 2842409023 | Bacteria | 6687331 |
| 2026 | 2842416350 | 2842415677 | Bacteria | 6596907 |
| 2027 | 2842423726 | 2842422224 | Bacteria | 6239196 |
| 2028 | 2842430760 | 2842428310 | Bacteria | 6767288 |
| 2029 | 2842437253 | 2842434925 | Bacteria | 6502746 |
| 2030 | 2842443623 | 2842441272 | Bacteria | 6769273 |
| 2031 | 2842453871 | 2842447887 | Bacteria | 6754142 |
| 2032 | 2842464903 | 2842462802 | Bacteria | 6588055 |
| 2033 | 2842471871 | 2842469257 | Bacteria | 6752936 |
| 2034 | 2842476939 | 2842475841 | Bacteria | 6603183 |
| 2035 | 2842484531 | 2842482326 | Bacteria | 7212537 |
| 2036 | 2842492008 | 2842489311 | Bacteria | 6620893 |
| 2037 | 2842496796 | 2842495871 | Bacteria | 6820686 |
| 2038 | 2842503304 | 2842502639 | Bacteria | 6604161 |
| 2039 | 2842511099 | 2842509118 | Bacteria | 6850950 |
| 2040 | 2842518941 | 2842515876 | Bacteria | 5436280 |
| 2041 | 2842521847 | 2842521101 | Bacteria | 6569494 |
| 2042 | 2842695379 | 2842694124 | Bacteria | 4063419 |
| 2043 | 2842872263 | 2842871566 | Bacteria | 4827117 |
| 2044 | 2842924185 | 2842922631 | Bacteria | 5824079 |
| 2045 | 2844008643 | 2844002411 | Bacteria | 7168230 |
| 2046 | 2844012541 | 2844009547 | Bacteria | 6728125 |
| 2047 | 2844164609 | 2844163670 | Bacteria | 7266046 |
| 2048 | 2844458388 | 2844454524 | Bacteria | 7952546 |
| 2049 | 2844535307 | 2844533157 | Bacteria | 7517899 |
| 2050 | 2847419427 | 2847417321 | Bacteria | 6913799 |
| 2051 | 2847674964 | 2847670302 | Bacteria | 6165597 |
| 2052 | 2847691053 | 2847686936 | Bacteria | 6278406 |
| 2053 | 2848994455 | 2848992105 | Bacteria | 6810864 |
| 2054 | 2850081498 | 2850079185 | Bacteria | 6848280 |
| 2055 | 2852390256 | 2852387548 | Bacteria | 8025568 |
| 2056 | 2854684059 | 2854681122 | Bacteria | 4548679 |
| 2057 | 2854899620 | 2854896431 | Bacteria | 5869725 |
| 2058 | 2854916296 | 2854911287 | Bacteria | 5582813 |
| 2059 | 2854918445 | 2854916844 | Bacteria | 5725939 |
| 2060 | 2855826375 | 2855825444 | Bacteria | 6785811 |
| 2061 | 2855841764 | 2855839649 | Bacteria | 7135830 |
| 2062 | 2855872491 | 2855872281 | Bacteria | 6964271 |
| 2063 | 2856320682 | 2856314179 | Bacteria | 6477897 |
| 2064 | 2856323025 | 2856320880 | Bacteria | 7263508 |
| 2065 | 2856334784 | 2856328259 | Bacteria | 6528202 |
| 2066 | 2856336555 | 2856334872 | Bacteria | 7037011 |
| 2067 | 2856346523 | 2856342000 | Bacteria | 7176905 |
| 2068 | 2856359022 | 2856356410 | Bacteria | 6297484 |
| 2069 | 2856367984 | 2856364286 | Bacteria | 6939991 |
| 2070 | 2857351893 | 2857349434 | Bacteria | 7926032 |
| 2071 | 2857368859 | 2857367948 | Bacteria | 6965560 |
| 2072 | 2857517399 | 2857516855 | Bacteria | 7787325 |
| 2073 | 2858802549 | 2858800743 | Bacteria | 6603254 |
| 2074 | 2860344174 | 2860339153 | Bacteria | 6846989 |
| 2075 | 2869164738 | 2869162929 | Bacteria | 6399702 |
| 2076 | 2869173989 | 2869169390 | Bacteria | 6659796 |
| 2077 | 2869237841 | 2869234852 | Bacteria | 6654993 |
| 2078 | 2869247767 | 2869242130 | Bacteria | 6609239 |
| 2079 | 2869253176 | 2869249662 | Bacteria | 6868783 |
| 2080 | 2869263236 | 2869256925 | Bacteria | 6981691 |
| 2081 | 2869267594 | 2869264136 | Bacteria | 6880765 |
| 2082 | 2869277600 | 2869271264 | Bacteria | 6908218 |
| 2083 | 2869282576 | 2869278585 | Bacteria | 7077053 |
| 2084 | 2869283104 | 2869278585 | Bacteria | 7077053 |
| 2085 | 2869290397 | 2869285874 | Bacteria | 6901219 |
| 2086 | 2871432681 | 2871429161 | Bacteria | 6547891 |
| 2087 | 2871441035 | 2871435913 | Bacteria | 6880295 |
| 2088 | 2871447830 | 2871444079 | Bacteria | 6423508 |
| 2089 | 2871455734 | 2871451962 | Bacteria | 7336357 |
| 2090 | 2871460996 | 2871459585 | Bacteria | 6866887 |
| 2091 | 2871468238 | 2871466892 | Bacteria | 6923287 |
| 2092 | 2871475985 | 2871474448 | Bacteria | 6806570 |
| 2093 | 2871483428 | 2871481445 | Bacteria | 6700002 |
| 2094 | 2871493297 | 2871488783 | Bacteria | 6929816 |
| 2095 | 2871499115 | 2871495908 | Bacteria | 6935695 |
| 2096 | 2874108640 | 2874102143 | Bacteria | 6342645 |
| 2097 | 2874112238 | 2874109183 | Bacteria | 6517025 |
| 2098 | 2874117685 | 2874116593 | Bacteria | 6674494 |
| 2099 | 2874126673 | 2874123672 | Bacteria | 7238285 |
| 2100 | 2874133701 | 2874131515 | Bacteria | 6820270 |
| 2101 | 2874142232 | 2874139085 | Bacteria | 7021506 |
| 2102 | 2874152648 | 2874146452 | Bacteria | 7533118 |
| 2103 | 2874160048 | 2874155637 | Bacteria | 6724144 |
| 2104 | 2874168038 | 2874162495 | Bacteria | 6174670 |
| 2105 | 2874174866 | 2874168670 | Bacteria | 8062617 |
| 2106 | 2876365131 | 2876363079 | Bacteria | 6544991 |
| 2107 | 2876374499 | 2876369609 | Bacteria | 6807521 |
| 2108 | 2876388844 | 2876386047 | Bacteria | 6698674 |
| 2109 | 2876397946 | 2876392853 | Bacteria | 6660880 |
| 2110 | 2876402778 | 2876399893 | Bacteria | 6927900 |
| 2111 | 2876409011 | 2876406927 | Bacteria | 6191900 |
| 2112 | 2876418564 | 2876413966 | Bacteria | 6831344 |
| 2113 | 2876422280 | 2876420981 | Bacteria | 6687741 |
| 2114 | 2878036015 | 2878035449 | Bacteria | 6555736 |
| 2115 | 2878744584 | 2878738818 | Bacteria | 7136951 |
| 2116 | 2878750295 | 2878745973 | Bacteria | 6867388 |
| 2117 | 2878757342 | 2878753008 | Bacteria | 6922523 |
| 2118 | 2878763314 | 2878760144 | Bacteria | 6823465 |
| 2119 | 2878770302 | 2878767105 | Bacteria | 6898628 |
| 2120 | 2878774766 | 2878774303 | Bacteria | 6108671 |
| 2121 | 2878787687 | 2878781027 | Bacteria | 6834456 |
| 2122 | 2881149845 | 2881147464 | Bacteria | 7779814 |
| 2123 | 2881160992 | 2881155292 | Bacteria | 6461656 |
| 2124 | 2881166724 | 2881161766 | Bacteria | 7127907 |
| 2125 | 2881859184 | 2881853255 | Bacteria | 6698367 |
| 2126 | 2881868975 | 2881861095 | Bacteria | 7128710 |
| 2127 | 2882458511 | 2882456835 | Bacteria | 6863978 |
| 2128 | 2882632481 | 2882632389 | Bacteria | 8154593 |
| 2129 | 2882919256 | 2882912400 | Bacteria | 6801539 |
| 2130 | 2884299063 | 2884298095 | Bacteria | 3823049 |
| 2131 | 2885308245 | 2885305155 | Bacteria | 7348390 |
| 2132 | 2885312964 | 2885312484 | Bacteria | 6415165 |
| 2133 | 2885325829 | 2885318864 | Bacteria | 6729568 |
| 2134 | 2885332271 | 2885326080 | Bacteria | 7134805 |
| 2135 | 2885341270 | 2885334103 | Bacteria | 7216818 |
| 2136 | 2885353989 | 2885350715 | Bacteria | 6787678 |
| 2137 | 2888345853 | 2888343758 | Bacteria | 6611049 |
| 2138 | 2889010058 | 2889010040 | Bacteria | 6749192 |
| 2139 | 2889018269 | 2889016732 | Bacteria | 6700763 |
| 2140 | 2889795554 | 2889790730 | Bacteria | 5689708 |
| 2141 | 2889916115 | 2889914905 | Bacteria | 5702301 |
| 2142 | 2891050968 | 2891048133 | Bacteria | 4447501 |
| 2143 | 2891373381 | 2891373044 | Bacteria | 5202277 |
| 2144 | 2894235580 | 2894232714 | Bacteria | 8834183 |
| 2145 | 2894655609 | 2894652903 | Bacteria | 4587256 |
| 2146 | 2896388995 | 2896384573 | Bacteria | 7700774 |
| 2147 | 2898796042 | 2898795034 | Bacteria | 4294459 |
| 2148 | 2899796019 | 2899792073 | Bacteria | 4926588 |
| 2149 | 2899807234 | 2899803654 | Bacteria | 5577784 |
| 2150 | 2899850596 | 2899845264 | Bacteria | 5672268 |
| 2151 | 2903450131 | 2903448605 | Bacteria | 7357801 |
| 2152 | 2903500037 | 2903492973 | Bacteria | 13473544 |
| 2153 | 2903501069 | 2903492973 | Bacteria | 13473544 |
| 2154 | 2903520564 | 2903513507 | Bacteria | 6344008 |
| 2155 | 2903522134 | 2903521522 | Bacteria | 6525694 |
| 2156 | 2903528512 | 2903528002 | Bacteria | 6586099 |
| 2157 | 2903543917 | 2903540706 | Bacteria | 7062119 |
| 2158 | 2904553691 | 2904550169 | Bacteria | 6221258 |
| 2159 | 2904582229 | 2904578770 | Bacteria | 5302906 |
| 2160 | 2904664597 | 2904659560 | Bacteria | 6685615 |
| 2161 | 2906312653 | 2906308376 | Bacteria | 6841989 |
| 2162 | 2906325362 | 2906321335 | Bacteria | 6579571 |
| 2163 | 2906330754 | 2906328253 | Bacteria | 6585166 |
| 2164 | 2906362117 | 2906354277 | Bacteria | 6991324 |
| 2165 | 2906364504 | 2906363423 | Bacteria | 6856682 |
| 2166 | 2906373556 | 2906370794 | Bacteria | 6881062 |
| 2167 | 2906390267 | 2906386501 | Bacteria | 5977019 |
| 2168 | 2906395739 | 2906393657 | Bacteria | 6790866 |
| 2169 | 2906406159 | 2906401398 | Bacteria | 6693206 |
| 2170 | 2906411159 | 2906408224 | Bacteria | 6162342 |
| 2171 | 2906419869 | 2906414383 | Bacteria | 6580790 |
| 2172 | 2909043551 | 2909042592 | Bacteria | 6499737 |
| 2173 | 2913299281 | 2913295892 | Bacteria | 6333755 |
| 2174 | 2913312601 | 2913308742 | Bacteria | 5350706 |
| 2175 | 2915652801 | 2915650412 | Bacteria | 4288180 |
| 2176 | 2915982976 | 2915980308 | Bacteria | 6624279 |
| 2177 | 2915991477 | 2915986958 | Bacteria | 6739310 |
| 2178 | 2916000828 | 2915993759 | Bacteria | 7016183 |
| 2179 | 2916003452 | 2916000859 | Bacteria | 6865702 |
| 2180 | 2916008079 | 2916007675 | Bacteria | 6898660 |
| 2181 | 2916019574 | 2916014648 | Bacteria | 6946486 |
| 2182 | 2916022162 | 2916021584 | Bacteria | 6854472 |
| 2183 | 2916034221 | 2916028427 | Bacteria | 6748433 |
| 2184 | 2916037900 | 2916035215 | Bacteria | 6755766 |
| 2185 | 2916045300 | 2916041962 | Bacteria | 6820487 |
| 2186 | 2916049076 | 2916048683 | Bacteria | 6543552 |
| 2187 | 2916055686 | 2916055098 | Bacteria | 6758838 |
| 2188 | 2916062284 | 2916061851 | Bacteria | 6737736 |
| 2189 | 2916082288 | 2916076590 | Bacteria | 6596108 |
| 2190 | 2917557354 | 2917554339 | Bacteria | 4987857 |
| 2191 | 2919107626 | 2919100787 | Bacteria | 7710546 |
| 2192 | 2919114660 | 2919114240 | Bacteria | 5700270 |
| 2193 | 2919122990 | 2919119836 | Bacteria | 5208557 |
| 2194 | 2919169278 | 2919166419 | Bacteria | 4952238 |
| 2195 | 2919174679 | 2919171160 | Bacteria | 6499771 |
| 2196 | 2919410009 | 2919408235 | Bacteria | 6149349 |
| 2197 | 2919461216 | 2919456309 | Bacteria | 6586567 |
| 2198 | 2919682044 | 2919679072 | Bacteria | 4629602 |
| 2199 | 2919703485 | 2919697872 | Bacteria | 6553725 |
| 2200 | 2920761487 | 2920760137 | Bacteria | 7427611 |
| 2201 | 2920825252 | 2920822456 | Bacteria | 6897201 |
| 2202 | 2921208503 | 2921201388 | Bacteria | 6926299 |
| 2203 | 2921210958 | 2921208531 | Bacteria | 6745326 |
| 2204 | 2921240896 | 2921237296 | Bacteria | 6876710 |
| 2205 | 2921246740 | 2921244191 | Bacteria | 6568419 |
| 2206 | 2921253823 | 2921250672 | Bacteria | 6677771 |
| 2207 | 2921263079 | 2921257292 | Bacteria | 6808382 |
| 2208 | 2921266243 | 2921263974 | Bacteria | 6864552 |
| 2209 | 2921289162 | 2921282425 | Bacteria | 6826397 |
| 2210 | 2921296279 | 2921289301 | Bacteria | 7316391 |
| 2211 | 2921299071 | 2921296804 | Bacteria | 7176999 |
| 2212 | 2922136938 | 2922130491 | Bacteria | 7173936 |
| 2213 | 2922157196 | 2922151315 | Bacteria | 6902399 |
| 2214 | 2922160908 | 2922158528 | Bacteria | 6573167 |
| 2215 | 2922172817 | 2922172374 | Bacteria | 6167644 |
| 2216 | 2922188078 | 2922185730 | Bacteria | 7113964 |
| 2217 | 2923558603 | 2923556063 | Bacteria | 6793593 |
| 2218 | 2924146720 | 2924144063 | Bacteria | 6883928 |
| 2219 | 2924157958 | 2924150972 | Bacteria | 7169444 |
| 2220 | 2924159308 | 2924158325 | Bacteria | 7188855 |
| 2221 | 2924170518 | 2924165586 | Bacteria | 7260590 |
| 2222 | 2924174535 | 2924172951 | Bacteria | 6749356 |
| 2223 | 2924182966 | 2924179722 | Bacteria | 6843264 |
| 2224 | 2924193313 | 2924186466 | Bacteria | 6876637 |
| 2225 | 2924195418 | 2924193448 | Bacteria | 6955718 |
| 2226 | 2924203291 | 2924200457 | Bacteria | 6757188 |
| 2227 | 2924210710 | 2924207177 | Bacteria | 6917007 |
| 2228 | 2924217618 | 2924214083 | Bacteria | 7080103 |
| 2229 | 2924223260 | 2924221636 | Bacteria | 7113495 |
| 2230 | 2924230554 | 2924228884 | Bacteria | 6633132 |
| 2231 | 2924716922 | 2924710171 | Bacteria | 6752351 |
| 2232 | 2924726480 | 2924718760 | Bacteria | 6331356 |
| 2233 | 2924730920 | 2924726620 | Bacteria | 6271473 |
| 2234 | 2924737953 | 2924733363 | Bacteria | 7574837 |
| 2235 | 2924753435 | 2924748358 | Bacteria | 6154725 |
| 2236 | 2924760511 | 2924754689 | Bacteria | 6774424 |
| 2237 | 2924768352 | 2924762789 | Bacteria | 6561353 |
| 2238 | 2924782614 | 2924776078 | Bacteria | 7492003 |
| 2239 | 2924786648 | 2924784321 | Bacteria | 7416538 |
| 2240 | 2926755676 | 2926754445 | Bacteria | 5964435 |
| 2241 | 2926762796 | 2926760298 | Bacteria | 5505990 |
| 2242 | 2928524189 | 2928521798 | Bacteria | 4960112 |
| 2243 | 2929140906 | 2929138655 | Bacteria | 5810547 |
| 2244 | 2931402933 | 2931396565 | Bacteria | 7251677 |
| 2245 | 2932404846 | 2932401849 | Bacteria | 4262978 |
| 2246 | 2933008840 | 2933006813 | Bacteria | 4912075 |
| 2247 | 2933014885 | 2933011516 | Bacteria | 5439334 |
| 2248 | 2933022192 | 2933016740 | Bacteria | 6355406 |
| 2249 | 2933570878 | 2933570622 | Bacteria | 7023390 |
| 2250 | 2933588709 | 2933586486 | Bacteria | 7667493 |
| 2251 | 2933596563 | 2933594066 | Bacteria | 5594265 |
| 2252 | 2933600918 | 2933599457 | Bacteria | 5858799 |
| 2253 | 2935896991 | 2935894831 | Bacteria | 6620579 |
| 2254 | 2935901925 | 2935901341 | Bacteria | 7341747 |
| 2255 | 2936372004 | 2936367885 | Bacteria | 7324495 |
| 2256 | 2936379866 | 2936375103 | Bacteria | 6652732 |
| 2257 | 2936382770 | 2936381700 | Bacteria | 7006523 |
| 2258 | 2936998249 | 2936996657 | Bacteria | 6298727 |
| 2259 | 2937004525 | 2937002841 | Bacteria | 6934057 |
| 2260 | 2937011232 | 2937009748 | Bacteria | 6746052 |
| 2261 | 2937019790 | 2937016420 | Bacteria | 6782579 |
| 2262 | 2937024619 | 2937023124 | Bacteria | 6815156 |
| 2263 | 2937031107 | 2937029754 | Bacteria | 6424026 |
| 2264 | 2937037023 | 2937036028 | Bacteria | 6846469 |
| 2265 | 2937047977 | 2937042894 | Bacteria | 6741576 |
| 2266 | 2937056464 | 2937049772 | Bacteria | 6757901 |
| 2267 | 2937063537 | 2937056579 | Bacteria | 7107896 |
| 2268 | 2937067808 | 2937063883 | Bacteria | 7199456 |
| 2269 | 2937074425 | 2937071275 | Bacteria | 6984483 |
| 2270 | 2937081573 | 2937078374 | Bacteria | 6610289 |
| 2271 | 2937094579 | 2937091812 | Bacteria | 6979387 |
| 2272 | 2937105456 | 2937098957 | Bacteria | 7249374 |
| 2273 | 2937111291 | 2937106411 | Bacteria | 6947143 |
| 2274 | 2937116110 | 2937113482 | Bacteria | 6505872 |
| 2275 | 2937122019 | 2937119839 | Bacteria | 6597547 |
| 2276 | 2937128860 | 2937126314 | Bacteria | 6771275 |
| 2277 | 2937819202 | 2937813078 | Bacteria | 7783518 |
| 2278 | 2937827749 | 2937822353 | Bacteria | 7290551 |
| 2279 | 2937842074 | 2937836603 | Bacteria | 6811263 |
| 2280 | 2937846575 | 2937843397 | Bacteria | 5256375 |
| 2281 | 2937852081 | 2937848649 | Bacteria | 6983481 |
| 2282 | 2937864598 | 2937861824 | Bacteria | 6660327 |
| 2283 | 2937870805 | 2937868953 | Bacteria | 6639878 |
| 2284 | 2937881257 | 2937877337 | Bacteria | 7246526 |
| 2285 | 2937895662 | 2937891427 | Bacteria | 6357007 |
| 2286 | 2937977347 | 2937972304 | Bacteria | 7532020 |
| 2287 | 2937982633 | 2937980651 | Bacteria | 6517427 |
| 2288 | 2937997766 | 2937994558 | Bacteria | 7036190 |
| 2289 | 2939640228 | 2939636861 | Bacteria | 6297853 |
| 2290 | 2941502101 | 2941499720 | Bacteria | 7599444 |
| 2291 | 2952255286 | 2952252522 | Bacteria | 4171745 |
| 2292 | 2954013135 | 2954011201 | Bacteria | 4762601 |
| 2293 | 2957378373 | 2957375807 | Bacteria | 6425588 |
| 2294 | 2957384244 | 2957382221 | Bacteria | 6737050 |
| 2295 | 2957390707 | 2957388812 | Bacteria | 6778072 |
| 2296 | 2957401692 | 2957395598 | Bacteria | 6822399 |
| 2297 | 2957404469 | 2957402308 | Bacteria | 6741770 |
| 2298 | 2957414105 | 2957408893 | Bacteria | 6558585 |
| 2299 | 2957416211 | 2957415311 | Bacteria | 6991633 |
| 2300 | 2957431750 | 2957430029 | Bacteria | 7022557 |
| 2301 | 2957438185 | 2957437181 | Bacteria | 6568994 |
| 2302 | 2957446875 | 2957443900 | Bacteria | 6869977 |
| 2303 | 2957453717 | 2957450854 | Bacteria | 6765715 |
| 2304 | 2957461913 | 2957457609 | Bacteria | 6967680 |
| 2305 | 2957467011 | 2957464669 | Bacteria | 6568877 |
| 2306 | 2957471605 | 2957471148 | Bacteria | 6797643 |
| 2307 | 2957479571 | 2957478035 | Bacteria | 6756658 |
| 2308 | 2957490429 | 2957484790 | Bacteria | 6703082 |
| 2309 | 2957497368 | 2957491536 | Bacteria | 6695180 |
| 2310 | 2957503344 | 2957498199 | Bacteria | 7126688 |
| 2311 | 2957506239 | 2957505466 | Bacteria | 7253085 |
| 2312 | 2958039359 | 2958034702 | Bacteria | 6989922 |
| 2313 | 2958043241 | 2958041894 | Bacteria | 13082850 |
| 2314 | 2958051581 | 2958041894 | Bacteria | 13082850 |
| 2315 | 2958053013 | 2958041894 | Bacteria | 13082850 |
| 2316 | 2958070624 | 2958064165 | Bacteria | 7158582 |
| 2317 | 2958073708 | 2958071322 | Bacteria | 6815895 |
| 2318 | 2958088186 | 2958084443 | Bacteria | 7312792 |
| 2319 | 2958097466 | 2958092219 | Bacteria | 6861151 |
| 2320 | 2958107745 | 2958100919 | Bacteria | 6800575 |
| 2321 | 2958121122 | 2958115193 | Bacteria | 6923548 |
| 2322 | 2958127322 | 2958122699 | Bacteria | 7280457 |
| 2323 | 2958134785 | 2958130278 | Bacteria | 6897202 |
| 2324 | 2958147008 | 2958144490 | Bacteria | 6677056 |
| 2325 | 2958168239 | 2958165035 | Bacteria | 6906348 |
| 2326 | 2958178233 | 2958172287 | Bacteria | 6716688 |
| 2327 | 2958186435 | 2958179912 | Bacteria | 6874908 |
| 2328 | 2960590881 | 2960584000 | Bacteria | 6864594 |
| 2329 | 2960594247 | 2960591022 | Bacteria | 6622873 |
| 2330 | 2960599960 | 2960597568 | Bacteria | 6550735 |
| 2331 | 2960610624 | 2960603979 | Bacteria | 6898737 |
| 2332 | 2960614559 | 2960610863 | Bacteria | 6691244 |
| 2333 | 2960620498 | 2960617483 | Bacteria | 6727748 |
| 2334 | 2960624448 | 2960624210 | Bacteria | 6875384 |
| 2335 | 2960633629 | 2960631154 | Bacteria | 6732508 |
| 2336 | 2960645009 | 2960637947 | Bacteria | 7296468 |
| 2337 | 2960652446 | 2960645483 | Bacteria | 7211087 |
| 2338 | 2960654684 | 2960652885 | Bacteria | 7083688 |
| 2339 | 2960666528 | 2960660292 | Bacteria | 7041660 |
| 2340 | 2960669691 | 2960667422 | Bacteria | 6763020 |
| 2341 | 2960675127 | 2960674078 | Bacteria | 6609048 |
| 2342 | 2960681037 | 2960680706 | Bacteria | 6624464 |
| 2343 | 2960692502 | 2960687367 | Bacteria | 6535474 |
| 2344 | 2960698033 | 2960693952 | Bacteria | 6749742 |
| 2345 | 2961084934 | 2961077736 | Bacteria | 7079850 |
| 2346 | 2961119596 | 2961114664 | Bacteria | 6680456 |
| 2347 | 2961131238 | 2961127735 | Bacteria | 7196641 |
| 2348 | 2961140362 | 2961136820 | Bacteria | 6775228 |
| 2349 | 2961166705 | 2961163497 | Bacteria | 6901077 |
| 2350 | 2961175329 | 2961170736 | Bacteria | 7072258 |
| 2351 | 2961185676 | 2961183825 | Bacteria | 6688536 |
| 2352 | 2963646586 | 2963644680 | Bacteria | 6530403 |
| 2353 | 2964614159 | 2964607997 | Bacteria | 7101408 |
| 2354 | 2964618000 | 2964615318 | Bacteria | 6809089 |
| 2355 | 2964623600 | 2964621998 | Bacteria | 6834995 |
| 2356 | 2964632620 | 2964628898 | Bacteria | 7083044 |
| 2357 | 2964645652 | 2964643177 | Bacteria | 6820887 |
| 2358 | 2964651589 | 2964649959 | Bacteria | 6675118 |
| 2359 | 2964661778 | 2964656573 | Bacteria | 7100150 |
| 2360 | 2964666890 | 2964663802 | Bacteria | 7019362 |
| 2361 | 2964677605 | 2964670856 | Bacteria | 6851364 |
| 2362 | 2964682908 | 2964678106 | Bacteria | 6792020 |
| 2363 | 2964688516 | 2964685014 | Bacteria | 6839111 |
| 2364 | 2964692513 | 2964691889 | Bacteria | 6802758 |
| 2365 | 2964705353 | 2964698721 | Bacteria | 6765331 |
| 2366 | 2964710488 | 2964705432 | Bacteria | 7114648 |
| 2367 | 2964718362 | 2964712639 | Bacteria | 6695970 |
| 2368 | 2964720712 | 2964719344 | Bacteria | 7286602 |
| 2369 | 2965021528 | 2965018300 | Bacteria | 6883036 |
| 2370 | 2965027539 | 2965025482 | Bacteria | 6532201 |
| 2371 | 2965042216 | 2965040258 | Bacteria | 6855979 |
| 2372 | 2965051801 | 2965047637 | Bacteria | 6623551 |
| 2373 | 2965067609 | 2965062239 | Bacteria | 7412989 |
| 2374 | 2965095376 | 2965089291 | Bacteria | 6866420 |
| 2375 | 2965110338 | 2965102966 | Bacteria | 6800987 |
| 2376 | 2965118158 | 2965110997 | Bacteria | 6693150 |
| 2377 | 2965122438 | 2965119406 | Bacteria | 6956431 |
| 2378 | 2967670739 | 2967664464 | Bacteria | 6948836 |
| 2379 | 2967678381 | 2967671571 | Bacteria | 7021409 |
| 2380 | 2967684393 | 2967678726 | Bacteria | 7264382 |
| 2381 | 2967689964 | 2967686174 | Bacteria | 6678622 |
| 2382 | 2967694677 | 2967693043 | Bacteria | 6804451 |
| 2383 | 2967701364 | 2967699805 | Bacteria | 6854538 |
| 2384 | 2967708655 | 2967706974 | Bacteria | 7186053 |
| 2385 | 2967714908 | 2967714385 | Bacteria | 7000047 |
| 2386 | 2967727951 | 2967721400 | Bacteria | 7073753 |
| 2387 | 2967730033 | 2967728569 | Bacteria | 6641507 |
| 2388 | 2967737180 | 2967735183 | Bacteria | 6827012 |
| 2389 | 2967742290 | 2967742019 | Bacteria | 6794534 |
| 2390 | 2967751570 | 2967748971 | Bacteria | 6733771 |
| 2391 | 2967757879 | 2967755722 | Bacteria | 6814706 |
| 2392 | 2967767702 | 2967762386 | Bacteria | 6923502 |
| 2393 | 2967772088 | 2967769361 | Bacteria | 6587838 |
| 2394 | 2967779014 | 2967775926 | Bacteria | 6738189 |
| 2395 | 2967999669 | 2967996073 | Bacteria | 6787468 |
| 2396 | 2968008027 | 2968003550 | Bacteria | 6929263 |
| 2397 | 2968020686 | 2968016561 | Bacteria | 7022047 |
| 2398 | 2968090621 | 2968083720 | Bacteria | 7351627 |
| 2399 | 2968094700 | 2968091066 | Bacteria | 6052692 |
| 2400 | 2968100907 | 2968097103 | Bacteria | 6107094 |
| 2401 | 2968115851 | 2968110612 | Bacteria | 6814636 |
| 2402 | 2968119224 | 2968117919 | Bacteria | 6536078 |
| 2403 | 2968133729 | 2968128360 | Bacteria | 6270294 |
| 2404 | 2968142521 | 2968138860 | Bacteria | 6605449 |
| 2405 | 2968175110 | 2968171901 | Bacteria | 6894245 |
| 2406 | 2970021029 | 2970019648 | Bacteria | 7072033 |
| 2407 | 2970031742 | 2970026789 | Bacteria | 6785236 |
| 2408 | 2970034129 | 2970033650 | Bacteria | 7118744 |
| 2409 | 2970042521 | 2970040964 | Bacteria | 6731123 |
| 2410 | 2970054578 | 2970047711 | Bacteria | 7088379 |
| 2411 | 2970056734 | 2970054988 | Bacteria | 6611507 |
| 2412 | 2970067176 | 2970061556 | Bacteria | 7099761 |
| 2413 | 2970071620 | 2970068827 | Bacteria | 7123112 |
| 2414 | 2970078296 | 2970076120 | Bacteria | 6697332 |
| 2415 | 2970085277 | 2970082768 | Bacteria | 6183754 |
| 2416 | 2970092580 | 2970088815 | Bacteria | 6933825 |
| 2417 | 2970096151 | 2970095765 | Bacteria | 6936963 |
| 2418 | 2970107965 | 2970102677 | Bacteria | 6812532 |
| 2419 | 2970110742 | 2970109326 | Bacteria | 6863976 |
| 2420 | 2970117387 | 2970116247 | Bacteria | 6501857 |
| 2421 | 2970124911 | 2970122695 | Bacteria | 6625855 |
| 2422 | 2970131133 | 2970129317 | Bacteria | 6806560 |
| 2423 | 2970136326 | 2970136068 | Bacteria | 7207982 |
| 2424 | 2970145129 | 2970143518 | Bacteria | 6446480 |
| 2425 | 2970151583 | 2970149975 | Bacteria | 6779706 |
| 2426 | 2970159601 | 2970156795 | Bacteria | 7168044 |
| 2427 | 2970166945 | 2970164137 | Bacteria | 6861252 |
| 2428 | 2970174276 | 2970170962 | Bacteria | 6876229 |
| 2429 | 2970180857 | 2970177841 | Bacteria | 6768001 |
| 2430 | 2970189203 | 2970184632 | Bacteria | 7054431 |
| 2431 | 2970198839 | 2970191845 | Bacteria | 7032787 |
| 2432 | 2970473983 | 2970469710 | Bacteria | 6969209 |
| 2433 | 2970490628 | 2970489779 | Bacteria | 6517260 |
| 2434 | 2970507917 | 2970503327 | Bacteria | 7099517 |
| 2435 | 2970514286 | 2970510686 | Bacteria | 7006402 |
| 2436 | 2970527308 | 2970524798 | Bacteria | 6840927 |
| 2437 | 2970534681 | 2970532167 | Bacteria | 6553173 |
| 2438 | 2970543004 | 2970540015 | Bacteria | 6977556 |
| 2439 | 2970548602 | 2970547951 | Bacteria | 6931819 |
| 2440 | 2970558159 | 2970554993 | Bacteria | 6814252 |
| 2441 | 2970597185 | 2970593180 | Bacteria | 7073582 |
| 2442 | 2970597724 | 2970593180 | Bacteria | 7073582 |
| 2443 | 2970619484 | 2970619444 | Bacteria | 6986144 |
| 2444 | 2970629116 | 2970627176 | Bacteria | 6680862 |
| 2445 | 2977523719 | 2977516862 | Bacteria | 6940108 |
| 2446 | 2977528837 | 2977523885 | Bacteria | 6960446 |
| 2447 | 2977531451 | 2977530762 | Bacteria | 6951399 |
| 2448 | 2977539659 | 2977537788 | Bacteria | 6929320 |
| 2449 | 2977548342 | 2977544691 | Bacteria | 6875412 |
| 2450 | 2977558465 | 2977551784 | Bacteria | 7125765 |
| 2451 | 2977563206 | 2977558990 | Bacteria | 6863948 |
| 2452 | 2977567699 | 2977565890 | Bacteria | 6901543 |
| 2453 | 2977575714 | 2977572785 | Bacteria | 6763888 |
| 2454 | 2977581965 | 2977579622 | Bacteria | 6772100 |
| 2455 | 2977826501 | 2977821940 | Bacteria | 6906439 |
| 2456 | 2977831850 | 2977828996 | Bacteria | 7007971 |
| 2457 | 2977848441 | 2977843712 | Bacteria | 6753583 |
| 2458 | 2977855175 | 2977851361 | Bacteria | 6694324 |
| 2459 | 2977859417 | 2977858184 | Bacteria | 6215359 |
| 2460 | 2977865098 | 2977864932 | Bacteria | 7534097 |
| 2461 | 2977873542 | 2977872689 | Bacteria | 7270173 |
| 2462 | 2977903229 | 2977898635 | Bacteria | 6675551 |
| 2463 | 2977909123 | 2977907340 | Bacteria | 6577984 |
| 2464 | 2977922056 | 2977915119 | Bacteria | 6829656 |
| 2465 | 2977922906 | 2977922695 | Bacteria | 6956781 |
| 2466 | 2977938109 | 2977935797 | Bacteria | 6252826 |
| 2467 | 2977944849 | 2977942078 | Bacteria | 7570577 |
| 2468 | 2977956131 | 2977950692 | Bacteria | 6893264 |
| 2469 | 2977958419 | 2977957713 | Bacteria | 6877875 |
| 2470 | 2977978315 | 2977971508 | Bacteria | 7472917 |
| 2471 | 2977987854 | 2977986579 | Bacteria | 6581278 |
| 2472 | 2978974655 | 2978969890 | Bacteria | 5400756 |
| 2473 | 2979094714 | 2979089926 | Bacteria | 5670289 |
| 2474 | 2979100720 | 2979095461 | Bacteria | 5669583 |
| 2475 | 2979103946 | 2979100975 | Bacteria | 5423623 |
| 2476 | 2979715859 | 2979710463 | Bacteria | 6785254 |
| 2477 | 2979749880 | 2979742915 | Bacteria | 7301278 |
| 2478 | 2979771094 | 2979764755 | Bacteria | 6610066 |
| 2479 | 2979779750 | 2979772303 | Bacteria | 6618277 |
| 2480 | 2979783672 | 2979779861 | Bacteria | 6219781 |
| 2481 | 2979800949 | 2979793036 | Bacteria | 6808957 |
| 2482 | 2979813101 | 2979808191 | Bacteria | 7179355 |
| 2483 | 2984511486 | 2984509177 | Bacteria | 5274802 |
| 2484 | 2984522153 | 2984518228 | Bacteria | 5277463 |
| 2485 | 2984541451 | 2984537506 | Bacteria | 5277481 |
| 2486 | 2984589976 | 2984587000 | Bacteria | 5263363 |
| 2487 | 2984603729 | 2984601300 | Bacteria | 5455244 |
| 2488 | 2987639077 | 2987636660 | Bacteria | 8088555 |
| 2489 | 2987647903 | 2987645492 | Bacteria | 6117018 |
| 2490 | 2987659057 | 2987652177 | Bacteria | 6969023 |
| 2491 | 2987662717 | 2987659509 | Bacteria | 6966464 |
| 2492 | 2987671519 | 2987666974 | Bacteria | 6509233 |
| 2493 | 2987676826 | 2987673487 | Bacteria | 6884027 |
| 2494 | 2989349707 | 2989349275 | Bacteria | 6349068 |
| 2495 | 2989774323 | 2989771324 | Bacteria | 5605128 |
| 2496 | 2989779238 | 2989776772 | Bacteria | 4843317 |
| 2497 | 2995393172 | 2995392953 | Bacteria | 4539380 |
| 2498 | 2996312147 | 2996310559 | Bacteria | 6357320 |
| 2499 | 2996338591 | 2996336353 | Bacteria | 5511628 |
| 2500 | 2996344143 | 2996341866 | Bacteria | 6643098 |
| 2501 | 2996352697 | 2996348954 | Bacteria | 7239054 |
| 2502 | 2996389192 | 2996386984 | Bacteria | 6978667 |
| 2503 | 2996889007 | 2996887358 | Bacteria | 5795980 |
| 2504 | 2996894297 | 2996893221 | Bacteria | 5823108 |
| 2505 | 3000139548 | 3000135777 | Bacteria | 6891109 |
| 2506 | 3002145096 | 3002141150 | Bacteria | 5254435 |
| 2507 | 3003934104 | 3003930520 | Bacteria | 5667563 |
| 2508 | 3004167564 | 3004167301 | Bacteria | 8330599 |
| 2509 | 3004191767 | 3004188549 | Bacteria | 6952365 |
| 2510 | 3004202678 | 3004195979 | Bacteria | 6776956 |
| 2511 | 3004204680 | 3004203850 | Bacteria | 7307914 |
| 2512 | 3004217983 | 3004211236 | Bacteria | 7417683 |
| 2513 | 3004220969 | 3004218560 | Bacteria | 7421728 |
| 2514 | 3004233934 | 3004232784 | Bacteria | 6662140 |
| 2515 | 3004241010 | 3004239961 | Bacteria | 6892290 |
| 2516 | 3004255314 | 3004248173 | Bacteria | 6563236 |
| 2517 | 3004273975 | 3004268573 | Bacteria | 7043476 |
| 2518 | 3004279379 | 3004275668 | Bacteria | 7114440 |
| 2519 | 3004335839 | 3004334049 | Bacteria | 8449246 |
| 2520 | 3005414565 | 3005409236 | Bacteria | 7188837 |
| 2521 | 3005417405 | 3005416602 | Bacteria | 7064308 |
| 2522 | 3005448477 | 3005445848 | Bacteria | 6906074 |
| 2523 | 3005454655 | 3005452660 | Bacteria | 5889319 |
| 2524 | 3007515129 | 3007511990 | Bacteria | 6481491 |
| 2525 | 3007620619 | 3007619802 | Bacteria | 6411688 |
| 2526 | 637075711 | 637000159 | Bacteria | 7596297 |
| 2527 | 639649217 | 639633055 | Bacteria | 7751309 |
| 2528 | 643826341 | 643692032 | Bacteria | 6891900 |
| 2529 | 648739242 | 648276728 | Bacteria | 6968865 |
| 2530 | 649871719 | 649633066 | Bacteria | 6690028 |
| 2531 | 650740589 | 650716007 | Bacteria | 5573770 |
| 2532 | 8002291576 | 8002285264 | Bacteria | 6717907 |
| 2533 | 8003571656 | 8003570095 | Bacteria | 5747666 |
| 2534 | 8003994199 | 8003992118 | Bacteria | 7266902 |
| 2535 | 8004001841 | 8003999396 | Bacteria | 7063185 |
| 2536 | 8004306619 | 8004300914 | Bacteria | 6132239 |
| 2537 | 8004319058 | 8004312739 | Bacteria | 7444653 |
| 2538 | 8004368570 | 8004361976 | Bacteria | 6858373 |
| 2539 | 8004378917 | 8004374579 | Bacteria | 6898112 |
| 2540 | 8004392603 | 8004387939 | Bacteria | 7049250 |
| 2541 | 8004634488 | 8004633249 | Bacteria | 6723080 |
| 2542 | 8004645210 | 8004640170 | Bacteria | 6723001 |
| 2543 | 8004697608 | 8004695233 | Bacteria | 6731676 |
| 2544 | 8004712125 | 8004703790 | Bacteria | 8006957 |
| 2545 | 8004718912 | 8004714634 | Bacteria | 6776161 |
| 2546 | 8004729784 | 8004727605 | Bacteria | 6643904 |
| 2547 | 8005248799 | 8005246636 | Bacteria | 4933972 |
| 2548 | 8005260336 | 8005258706 | Bacteria | 6184835 |
| 2549 | 8005281240 | 8005275841 | Bacteria | 6929066 |
| 2550 | 8005286103 | 8005282627 | Bacteria | 6675747 |
| 2551 | 8005292238 | 8005289223 | Bacteria | 6634003 |
| 2552 | 8005303156 | 8005301065 | Bacteria | 6614431 |
| 2553 | 8005312864 | 8005307578 | Bacteria | 7395396 |
| 2554 | 8005315806 | 8005314921 | Bacteria | 7072929 |
| 2555 | 8005323534 | 8005321885 | Bacteria | 5795980 |
| 2556 | 8005380958 | 8005376324 | Bacteria | 6590079 |
| 2557 | 8005389091 | 8005382845 | Bacteria | 6732062 |
| 2558 | 8005396074 | 8005395548 | Bacteria | 6806915 |
| 2559 | 8005435184 | 8005430974 | Bacteria | 6689030 |
| 2560 | 8005463714 | 8005460587 | Bacteria | 7157962 |
| 2561 | 8005489158 | 8005484373 | Bacteria | 6297373 |
| 2562 | 8005500926 | 8005497431 | Bacteria | 6477605 |
| 2563 | 8005545650 | 8005542996 | Bacteria | 7077758 |
| 2564 | 8005556988 | 8005556819 | Bacteria | 6908598 |
| 2565 | 8005568020 | 8005563573 | Bacteria | 7153261 |
| 2566 | 8005573435 | 8005570704 | Bacteria | 6957481 |
| 2567 | 8005622299 | 8005619151 | Bacteria | 7030230 |
| 2568 | 8005629800 | 8005626139 | Bacteria | 6534237 |
| 2569 | 8005648167 | 8005645114 | Bacteria | 6950293 |
| 2570 | 8005672344 | 8005668836 | Bacteria | 6953162 |
| 2571 | 8005682860 | 8005682033 | Bacteria | 6726518 |
| 2572 | 8005692076 | 8005688590 | Bacteria | 6610080 |
| 2573 | 8005697430 | 8005695170 | Bacteria | 6912330 |
| 2574 | 8018134124 | 8018127388 | Bacteria | 7351159 |
| 2575 | 8018164599 | 8018163183 | Bacteria | 7277977 |
| 2576 | 8018181294 | 8018176218 | Bacteria | 6896178 |
| 2577 | 8019781786 | 8019775933 | Bacteria | 6858656 |
| 2578 | 8023683138 | 8023680758 | Bacteria | 7729763 |
| 2579 | 8024482836 | 8024479707 | Bacteria | 6954785 |
| 2580 | 8024488057 | 8024486573 | Bacteria | 6540512 |
| 2581 | 8024504450 | 8024501048 | Bacteria | 6427847 |
| 2582 | 8046771116 | 8046767195 | Bacteria | 7547379 |
| 2583 | 8049295353 | 8049293176 | Bacteria | 6128433 |
| 2584 | 8054463014 | 8054460903 | Bacteria | 4872905 |
| 2585 | 8054558610 | 8054558443 | Bacteria | 5204801 |
| 2586 | 8055619397 | 8055617313 | Bacteria | 7548464 |
| 2587 | 8056129665 | 8056125926 | Bacteria | 6228218 |
| 2588 | 8056156877 | 8056155041 | Bacteria | 6486948 |
| 2589 | 8056182596 | 8056177738 | Bacteria | 6748268 |
| 2590 | 8056375961 | 8056375014 | Bacteria | 7006639 |
| 2591 | 8056386753 | 8056382006 | Bacteria | 6408074 |
| 2592 | 8056877268 | 8056875544 | Bacteria | 4355797 |
| 2593 | 8057529699 | 8057529695 | Bacteria | 6306553 |
| 2594 | 8057575707 | 8057575449 | Bacteria | 7367519 |
| 2595 | 8057877646 | 8057874678 | Bacteria | 7494653 |
| 2596 | Ga0501048_0086242 | |||
| 2597 | MRS2a_Contig_8 | |||
| 2598 | JGI24740J21852_10000504 | |||
| 2599 | JGI24739J22299_10009479 | |||
| 2600 | JGI24738J21930_10007464 | |||
| 2601 | JGI25155J39150_1000001 | |||
| 2602 | JGI25156J39149_1000001 | |||
| 2603 | JGI25156J39149_1001987 | |||
| 2604 | JGI25156J39149_1002999 | |||
| 2605 | JGI25162J39368_1000304 | |||
| 2606 | JGI25162J39368_1000820 | |||
| 2607 | JGI25162J39368_1000825 | |||
| 2608 | JGI25154J39366_1000122 | |||
| 2609 | JGI25157J39369_1000044 | |||
| 2610 | JGI25157J39369_1000475 | |||
| 2611 | JGI25157J39369_1000502 | |||
| 2612 | JGI25163J39215_1000074 | |||
| 2613 | JGI25164J39214_1000223 | |||
| 2614 | JGI25152J39213_1002276 | |||
| 2615 | JGI25152J39213_1005176 | |||
| 2616 | JGI25150J39212_1000074 | |||
| 2617 | JGI25150J39212_1005822 | |||
| 2618 | JGI25159J45721_1000014 | |||
| 2619 | JGI25159J45721_1000411 | |||
| 2620 | JGI25159J45721_1004159 | |||
| 2621 | JGI25159J45721_1005892 | |||
| 2622 | JGI25151J46595_10000015 | |||
| 2623 | JGI25151J46595_10000414 | |||
| 2624 | JGI25151J46595_10000486 | |||
| 2625 | JGI25151J46595_10000628 | |||
| 2626 | JGI25151J46595_10001750 | |||
| 2627 | JGI25151J46595_10007168 | |||
| 2628 | JGI25406J46586_10003356 | |||
| 2629 | JGI25165J46597_1000042 | |||
| 2630 | JGI25165J46597_1000410 | |||
| 2631 | JGI25165J46597_1000910 | |||
| 2632 | JGI25165J46597_1000918 | |||
| 2633 | JGI25153J46596_10000267 | |||
| 2634 | JGI25160J50197_1000001 | |||
| 2635 | JGI25160J50197_1000020 | |||
| 2636 | JGI25160J50197_1000695 | |||
| 2637 | JGI25161J50226_1000001 | |||
| 2638 | JGI25161J50226_1001013 | |||
| 2639 | JGI25161J50226_1001697 | |||
| 2640 | Ga0055542_1000488 | |||
| 2641 | Ga0055529_1002050 | |||
| 2642 | Ga0055526_1000375 | |||
| 2643 | Ga0055526_1001939 | |||
| 2644 | Ga0055526_1002938 | |||
| 2645 | Ga0055526_1006372 | |||
| 2646 | Ga0055526_1009545 | |||
| 2647 | Ga0055524_1000064 | |||
| 2648 | Ga0055524_1001090 | |||
| 2649 | Ga0055524_1002653 | |||
| 2650 | Ga0055524_1008708 | |||
| 2651 | Ga0055524_1010743 | |||
| 2652 | Ga0055536_1003980 | |||
| 2653 | Ga0055528_1000234 | |||
| 2654 | Ga0055528_1000512 | |||
| 2655 | Ga0055528_1004264 | |||
| 2656 | Ga0055528_1005478 | |||
| 2657 | Ga0055528_1012612 | |||
| 2658 | Ga0055540_1000350 | |||
| 2659 | Ga0055540_1005671 | |||
| 2660 | Ga0055540_1010745 | |||
| 2661 | Ga0055531_10004086 | |||
| 2662 | Ga0055531_10004879 | |||
| 2663 | Ga0058692_1001739 | |||
| 2664 | Ga0055543_1000003 | |||
| 2665 | Ga0055543_1000047 | |||
| 2666 | Ga0055543_1000355 | |||
| 2667 | Ga0065165_1000013 | |||
| 2668 | Ga0065165_1000026 | |||
| 2669 | Ga0065165_1000068 | |||
| 2670 | Ga0065165_1003530 | |||
| 2671 | Ga0065714_10000178 | |||
| 2672 | Ga0065714_10012843 | |||
| 2673 | Ga0065714_10065762 | |||
| 2674 | Ga0065714_10070084 | |||
| 2675 | Ga0065714_10106726 | |||
| 2676 | Ga0065712_10007353 | |||
| 2677 | Ga0065715_10027883 | |||
| 2678 | Ga0070658_10000115 | |||
| 2679 | Ga0070658_10012728 | |||
| 2680 | Ga0070658_10038151 | |||
| 2681 | Ga0070658_10038361 | |||
| 2682 | Ga0070683_100028048 | |||
| 2683 | Ga0070683_100223864 | |||
| 2684 | Ga0070683_100262281 | |||
| 2685 | Ga0070690_100003585 | |||
| 2686 | Ga0070690_100005518 | |||
| 2687 | Ga0070690_100034720 | |||
| 2688 | Ga0070690_100096304 | |||
| 2689 | Ga0070670_100000515 | |||
| 2690 | Ga0070670_100008496 | |||
| 2691 | Ga0070670_100019091 | |||
| 2692 | Ga0070670_100076542 | |||
| 2693 | Ga0070666_10000544 | |||
| 2694 | Ga0070666_10002592 | |||
| 2695 | Ga0070680_100092799 | |||
| 2696 | Ga0070682_100000925 | |||
| 2697 | Ga0068868_100009860 | |||
| 2698 | Ga0070660_100010552 | |||
| 2699 | Ga0070660_100010563 | |||
| 2700 | Ga0070660_100010989 | |||
| 2701 | Ga0070660_100058511 | |||
| 2702 | Ga0070660_100184257 | |||
| 2703 | Ga0070689_100001087 | |||
| 2704 | Ga0070691_10002849 | |||
| 2705 | Ga0070687_100006424 | |||
| 2706 | Ga0070661_100001127 | |||
| 2707 | Ga0070661_100086529 | |||
| 2708 | Ga0070692_10004469 | |||
| 2709 | Ga0070692_10011484 | |||
| 2710 | Ga0070668_100001269 | |||
| 2711 | Ga0070668_100009332 | |||
| 2712 | Ga0070668_100011919 | |||
| 2713 | Ga0070668_100046733 | |||
| 2714 | Ga0070668_100068691 | |||
| 2715 | Ga0070668_100072494 | |||
| 2716 | Ga0070669_100000012 | |||
| 2717 | Ga0070669_100010577 | |||
| 2718 | Ga0070675_100086044 | |||
| 2719 | Ga0070671_100000006 | |||
| 2720 | Ga0070671_100008175 | |||
| 2721 | Ga0070671_100034405 | |||
| 2722 | Ga0070674_100211489 | |||
| 2723 | Ga0070673_100005483 | |||
| 2724 | Ga0070688_100001689 | |||
| 2725 | Ga0070659_100001552 | |||
| 2726 | Ga0070667_100005567 | |||
| 2727 | Ga0070667_100007827 | |||
| 2728 | Ga0070703_10010999 | |||
| 2729 | Ga0070709_10002492 | |||
| 2730 | Ga0070709_10028933 | |||
| 2731 | Ga0070709_10079269 | |||
| 2732 | Ga0070714_100023734 | |||
| 2733 | Ga0070714_100038414 | |||
| 2734 | Ga0070713_100035660 | |||
| 2735 | Ga0070710_10001696 | |||
| 2736 | Ga0070711_100017961 | |||
| 2737 | Ga0070711_100021276 | |||
| 2738 | Ga0070711_100215964 | |||
| 2739 | Ga0070705_100001003 | |||
| 2740 | Ga0070705_100018853 | |||
| 2741 | Ga0070700_100005734 | |||
| 2742 | Ga0070700_100009949 | |||
| 2743 | Ga0070694_100029953 | |||
| 2744 | Ga0070708_100164311 | |||
| 2745 | Ga0070663_100002743 | |||
| 2746 | Ga0070663_100149367 | |||
| 2747 | Ga0070678_100007142 | |||
| 2748 | Ga0070678_100130462 | |||
| 2749 | Ga0070662_100006832 | |||
| 2750 | Ga0070662_100074667 | |||
| 2751 | Ga0068867_100011024 | |||
| 2752 | Ga0070685_10030634 | |||
| 2753 | Ga0070679_100043670 | |||
| 2754 | Ga0070679_100087105 | |||
| 2755 | Ga0070684_100149525 | |||
| 2756 | Ga0070697_100002319 | |||
| 2757 | Ga0068853_100006365 | |||
| 2758 | Ga0068853_100011416 | |||
| 2759 | Ga0068853_100033238 | |||
| 2760 | Ga0068853_100042340 | |||
| 2761 | Ga0070686_100000175 | |||
| 2762 | Ga0070686_100009379 | |||
| 2763 | Ga0070695_100001902 | |||
| 2764 | Ga0070695_100003227 | |||
| 2765 | Ga0070696_100005973 | |||
| 2766 | Ga0070696_100315359 | |||
| 2767 | Ga0070693_100000527 | |||
| 2768 | Ga0070693_100054562 | |||
| 2769 | Ga0070693_100125349 | |||
| 2770 | Ga0070665_100002086 | |||
| 2771 | Ga0070665_100007051 | |||
| 2772 | Ga0070665_100015259 | |||
| 2773 | Ga0070665_100035091 | |||
| 2774 | Ga0070665_100052825 | |||
| 2775 | Ga0070665_100058389 | |||
| 2776 | Ga0070665_100067282 | |||
| 2777 | Ga0070665_100160239 | |||
| 2778 | Ga0070704_100003817 | |||
| 2779 | Ga0068855_100010084 | |||
| 2780 | Ga0068855_100037000 | |||
| 2781 | Ga0068855_100097741 | |||
| 2782 | Ga0068855_100123235 | |||
| 2783 | Ga0068855_100154117 | |||
| 2784 | Ga0068855_100230726 | |||
| 2785 | Ga0070664_100011523 | |||
| 2786 | Ga0068857_100002111 | |||
| 2787 | Ga0068857_100244163 | |||
| 2788 | Ga0068854_100022865 | |||
| 2789 | Ga0068854_100049011 | |||
| 2790 | Ga0068854_100072675 | |||
| 2791 | Ga0068854_100077792 | |||
| 2792 | Ga0068854_100227419 | |||
| 2793 | Ga0068854_100282419 | |||
| 2794 | Ga0068856_100012739 | |||
| 2795 | Ga0068856_100032737 | |||
| 2796 | Ga0068856_100301729 | |||
| 2797 | Ga0068856_100428139 | |||
| 2798 | Ga0070702_100001296 | |||
| 2799 | Ga0070702_100024869 | |||
| 2800 | Ga0068852_100013171 | |||
| 2801 | Ga0068852_100018126 | |||
| 2802 | Ga0068852_100037637 | |||
| 2803 | Ga0068852_100043421 | |||
| 2804 | Ga0068859_100000303 | |||
| 2805 | Ga0068859_100022477 | |||
| 2806 | Ga0068864_100002024 | |||
| 2807 | Ga0068864_100003487 | |||
| 2808 | Ga0068864_100046732 | |||
| 2809 | Ga0068861_100000068 | |||
| 2810 | Ga0068861_100006058 | |||
| 2811 | Ga0068861_100016621 | |||
| 2812 | Ga0068863_100015068 | |||
| 2813 | Ga0068863_100212413 | |||
| 2814 | Ga0068858_100002445 | |||
| 2815 | Ga0068858_100007331 | |||
| 2816 | Ga0068860_100003525 | |||
| 2817 | Ga0068860_100004219 | |||
| 2818 | Ga0068862_100000222 | |||
| 2819 | Ga0068862_100003748 | |||
| 2820 | Ga0068862_100064655 | |||
| 2821 | Ga0081455_10000085 | |||
| 2822 | Ga0081455_10002838 | |||
| 2823 | Ga0081455_10010430 | |||
| 2824 | Ga0081455_10086461 | |||
| 2825 | Ga0081455_10108216 | |||
| 2826 | Ga0081455_10130514 | |||
| 2827 | Ga0081538_10007329 | |||
| 2828 | Ga0081540_1000566 | |||
| 2829 | Ga0081540_1028435 | |||
| 2830 | Ga0081539_10001521 | |||
| 2831 | Ga0075365_10000068 | |||
| 2832 | Ga0075365_10001419 | |||
| 2833 | Ga0075365_10003339 | |||
| 2834 | Ga0075365_10022375 | |||
| 2835 | Ga0075365_10064544 | |||
| 2836 | Ga0075368_10002310 | |||
| 2837 | Ga0075368_10013155 | |||
| 2838 | Ga0075368_10031988 | |||
| 2839 | Ga0075363_100010518 | |||
| 2840 | Ga0075363_100028520 | |||
| 2841 | Ga0075363_100090054 | |||
| 2842 | Ga0075363_100097361 | |||
| 2843 | Ga0075364_10000023 | |||
| 2844 | Ga0075364_10001246 | |||
| 2845 | Ga0075364_10030904 | |||
| 2846 | Ga0075364_10067536 | |||
| 2847 | Ga0075432_10003110 | |||
| 2848 | Ga0075432_10003786 | |||
| 2849 | Ga0075432_10006500 | |||
| 2850 | Ga0070715_10002097 | |||
| 2851 | Ga0070716_100031664 | |||
| 2852 | Ga0070712_100004491 | |||
| 2853 | Ga0075362_10018143 | |||
| 2854 | Ga0075362_10031839 | |||
| 2855 | Ga0075367_10007206 | |||
| 2856 | Ga0075367_10014330 | |||
| 2857 | Ga0075367_10017282 | |||
| 2858 | Ga0075367_10020097 | |||
| 2859 | Ga0075367_10090870 | |||
| 2860 | Ga0075367_10094307 | |||
| 2861 | Ga0075367_10113637 | |||
| 2862 | Ga0075369_10001599 | |||
| 2863 | Ga0075369_10016859 | |||
| 2864 | Ga0075369_10063135 | |||
| 2865 | Ga0075366_10000495 | |||
| 2866 | Ga0075366_10082884 | |||
| 2867 | Ga0097621_100008926 | |||
| 2868 | Ga0075370_10003151 | |||
| 2869 | Ga0075370_10017904 | |||
| 2870 | Ga0068871_100012799 | |||
| 2871 | Ga0075428_100009932 | |||
| 2872 | Ga0075428_100014282 | |||
| 2873 | Ga0075428_100111329 | |||
| 2874 | Ga0075428_100154978 | |||
| 2875 | Ga0075428_100158062 | |||
| 2876 | Ga0075430_100060765 | |||
| 2877 | Ga0075430_100180111 | |||
| 2878 | Ga0075431_100001296 | |||
| 2879 | Ga0075431_100008939 | |||
| 2880 | Ga0075431_100031890 | |||
| 2881 | Ga0075431_100111026 | |||
| 2882 | Ga0075431_100347781 | |||
| 2883 | Ga0075433_10010455 | |||
| 2884 | Ga0075433_10022732 | |||
| 2885 | Ga0075434_100024485 | |||
| 2886 | Ga0075434_100037816 | |||
| 2887 | Ga0075434_100082433 | |||
| 2888 | Ga0075429_100002571 | |||
| 2889 | Ga0075429_100071754 | |||
| 2890 | Ga0075429_100103025 | |||
| 2891 | Ga0068865_100017949 | |||
| 2892 | Ga0075436_100013064 | |||
| 2893 | Ga0075436_100106952 | |||
| 2894 | Ga0097620_100000303 | |||
| 2895 | Ga0097620_100022477 | |||
| 2896 | Ga0079104_1000242 | |||
| 2897 | Ga0079104_1016712 | |||
| 2898 | Ga0099826_10000841 | |||
| 2899 | Ga0075435_100007536 | |||
| 2900 | Ga0099795_10000032 | |||
| 2901 | Ga0099795_10022242 | |||
| 2902 | Ga0105251_10032150 | |||
| 2903 | Ga0105244_10038974 | |||
| 2904 | Ga0105244_10067730 | |||
| 2905 | Ga0105250_10018806 | |||
| 2906 | Ga0105240_10000028 | |||
| 2907 | Ga0105240_10000076 | |||
| 2908 | Ga0105240_10036562 | |||
| 2909 | Ga0105240_10064551 | |||
| 2910 | Ga0105240_10115849 | |||
| 2911 | Ga0105240_10197548 | |||
| 2912 | Ga0105240_10258727 | |||
| 2913 | Ga0105240_10456874 | |||
| 2914 | Ga0111539_10001004 | |||
| 2915 | Ga0111539_10035026 | |||
| 2916 | Ga0111539_10125173 | |||
| 2917 | Ga0111539_10225320 | |||
| 2918 | Ga0111539_10276310 | |||
| 2919 | Ga0111539_10483727 | |||
| 2920 | Ga0111539_10563679 | |||
| 2921 | Ga0105245_10037358 | |||
| 2922 | Ga0105247_10003685 | |||
| 2923 | Ga0105247_10004179 | |||
| 2924 | Ga0114129_10000717 | |||
| 2925 | Ga0114129_10034862 | |||
| 2926 | Ga0114129_10222103 | |||
| 2927 | Ga0114129_10251576 | |||
| 2928 | Ga0114129_10326787 | |||
| 2929 | Ga0105243_10003392 | |||
| 2930 | Ga0105243_10004327 | |||
| 2931 | Ga0105243_10162824 | |||
| 2932 | Ga0105242_10018125 | |||
| 2933 | Ga0105248_10001946 | |||
| 2934 | Ga0105237_10000226 | |||
| 2935 | Ga0105237_10003921 | |||
| 2936 | Ga0105237_10006872 | |||
| 2937 | Ga0105237_10034855 | |||
| 2938 | Ga0105237_10064529 | |||
| 2939 | Ga0105237_10389291 | |||
| 2940 | Ga0105238_10005446 | |||
| 2941 | Ga0105238_10011069 | |||
| 2942 | Ga0105238_10445648 | |||
| 2943 | Ga0105249_10001500 | |||
| 2944 | Ga0105249_10001582 | |||
| 2945 | Ga0123341_1000007 | |||
| 2946 | Ga0099796_10000020 | |||
| 2947 | Ga0105239_10003384 | |||
| 2948 | Ga0105239_10004650 | |||
| 2949 | Ga0105239_10019613 | |||
| 2950 | Ga0105239_10030720 | |||
| 2951 | Ga0105239_10081150 | |||
| 2952 | Ga0105239_10130574 | |||
| 2953 | Ga0105239_10336056 | |||
| 2954 | Ga0105246_10004363 | |||
| 2955 | Ga0157373_10011394 | |||
| 2956 | Ga0157373_10109444 | |||
| 2957 | Ga0157371_10000017 | |||
| 2958 | Ga0157371_10000739 | |||
| 2959 | Ga0157371_10003248 | |||
| 2960 | Ga0157371_10006289 | |||
| 2961 | Ga0157370_10000494 | |||
| 2962 | Ga0157370_10001902 | |||
| 2963 | Ga0157370_10004750 | |||
| 2964 | Ga0157370_10034314 | |||
| 2965 | Ga0157370_10063008 | |||
| 2966 | Ga0157370_10069140 | |||
| 2967 | Ga0157370_10248826 | |||
| 2968 | Ga0157370_10416910 | |||
| 2969 | Ga0157369_10039677 | |||
| 2970 | Ga0157369_10116856 | |||
| 2971 | Ga0157369_10120642 | |||
| 2972 | Ga0157369_10236145 | |||
| 2973 | Ga0171463_1003 | |||
| 2974 | Ga0157374_10028786 | |||
| 2975 | Ga0157374_10072533 | |||
| 2976 | Ga0157378_10007872 | |||
| 2977 | Ga0157378_10089784 | |||
| 2978 | Ga0163162_10002906 | |||
| 2979 | Ga0163162_10008951 | |||
| 2980 | Ga0163162_10048385 | |||
| 2981 | Ga0157372_10028979 | |||
| 2982 | Ga0157372_10032223 | |||
| 2983 | Ga0157372_10032521 | |||
| 2984 | Ga0157375_10041224 | |||
| 2985 | Ga0157375_10284075 | |||
| 2986 | Ga0157375_10356042 | |||
| 2987 | Ga0163163_10029879 | |||
| 2988 | Ga0163163_10057034 | |||
| 2989 | Ga0163163_10083456 | |||
| 2990 | Ga0163163_10150353 | |||
| 2991 | Ga0163163_10340327 | |||
| 2992 | Ga0157380_10006541 | |||
| 2993 | Ga0157380_10261899 | |||
| 2994 | Ga0182008_10038707 | |||
| 2995 | Ga0157377_10008238 | |||
| 2996 | Ga0157379_10013267 | |||
| 2997 | Ga0157379_10019661 | |||
| 2998 | Ga0157379_10055415 | |||
| 2999 | Ga0157376_10002750 | |||
| 3000 | Ga0157376_10266996 | |||
| 3001 | Ga0182006_1000385 | |||
| 3002 | Ga0182006_1026757 | |||
| 3003 | Ga0182007_10000286 | |||
| 3004 | Ga0182007_10002059 | |||
| 3005 | Ga0182005_1003541 | |||
| 3006 | Ga0182005_1026178 | |||
| 3007 | Ga0183363_1085 | |||
| 3008 | Ga0163161_10002366 | |||
| 3009 | Ga0163161_10015581 | |||
| 3010 | Ga0163161_10034859 | |||
| 3011 | Ga0163161_10079586 | |||
| 3012 | Ga0163161_10091175 | |||
| 3013 | Ga0206356_11203268 | |||
| 3014 | Ga0214544_1003096 | |||
| 3015 | Ga0214542_1000012 | |||
| 3016 | Ga0214542_1013089 | |||
| 3017 | Ga0214543_1000024 | |||
| 3018 | Ga0214543_1000038 | |||
| 3019 | Ga0213876_10001237 | |||
| 3020 | Ga0213875_10000067 | |||
| 3021 | Ga0228711_1010496 | |||
| 3022 | Ga0228710_1010751 | |||
| 3023 | Ga0209435_100012 | |||
| 3024 | Ga0209760_100109 | |||
| 3025 | Ga0209436_100147 | |||
| 3026 | Ga0209436_103527 | |||
| 3027 | Ga0209436_109845 | |||
| 3028 | Ga0207427_100114 | |||
| 3029 | Ga0207427_100636 | |||
| 3030 | Ga0209437_100051 | |||
| 3031 | Ga0209437_100098 | |||
| 3032 | Ga0209437_100219 | |||
| 3033 | Ga0209437_106862 | |||
| 3034 | Ga0207425_1000075 | |||
| 3035 | Ga0207425_1001868 | |||
| 3036 | Ga0209646_1000026 | |||
| 3037 | Ga0209026_1000014 | |||
| 3038 | Ga0209026_1000023 | |||
| 3039 | Ga0209026_1000029 | |||
| 3040 | Ga0209677_101213 | |||
| 3041 | Ga0209148_1000080 | |||
| 3042 | Ga0209148_1003734 | |||
| 3043 | Ga0209759_1000012 | |||
| 3044 | Ga0209759_1000167 | |||
| 3045 | Ga0209759_1000393 | |||
| 3046 | Ga0209129_1000156 | |||
| 3047 | Ga0209129_1000218 | |||
| 3048 | Ga0209129_1000537 | |||
| 3049 | Ga0209129_1000876 | |||
| 3050 | Ga0209129_1008635 | |||
| 3051 | Ga0209233_1000012 | |||
| 3052 | Ga0209233_1000028 | |||
| 3053 | Ga0209233_1000095 | |||
| 3054 | Ga0209233_1000113 | |||
| 3055 | Ga0209233_1000148 | |||
| 3056 | Ga0209233_1000631 | |||
| 3057 | Ga0209455_1000171 | |||
| 3058 | Ga0209673_1000010 | |||
| 3059 | Ga0209673_1000117 | |||
| 3060 | Ga0209673_1000151 | |||
| 3061 | Ga0209673_1001898 | |||
| 3062 | Ga0209130_1000003 | |||
| 3063 | Ga0209130_1000020 | |||
| 3064 | Ga0209130_1000034 | |||
| 3065 | Ga0209130_1000150 | |||
| 3066 | Ga0209130_1000906 | |||
| 3067 | Ga0209675_1000529 | |||
| 3068 | Ga0209676_1001566 | |||
| 3069 | Ga0209676_1004814 | |||
| 3070 | Ga0209676_1011005 | |||
| 3071 | Ga0209025_1000010 | |||
| 3072 | Ga0209025_1000070 | |||
| 3073 | Ga0209025_1000099 | |||
| 3074 | Ga0209025_1000140 | |||
| 3075 | Ga0209025_1000213 | |||
| 3076 | Ga0209025_1000311 | |||
| 3077 | Ga0209025_1000571 | |||
| 3078 | Ga0209025_1001887 | |||
| 3079 | Ga0209025_1003502 | |||
| 3080 | Ga0209025_1009690 | |||
| 3081 | Ga0209025_1019714 | |||
| 3082 | Ga0209025_1038252 | |||
| 3083 | Ga0209025_1056162 | |||
| 3084 | Ga0209564_1000013 | |||
| 3085 | Ga0209564_1000048 | |||
| 3086 | Ga0209564_1000386 | |||
| 3087 | Ga0209564_1000424 | |||
| 3088 | Ga0209564_1003849 | |||
| 3089 | Ga0209564_1008813 | |||
| 3090 | Ga0209758_1000094 | |||
| 3091 | Ga0209758_1000405 | |||
| 3092 | Ga0209758_1000413 | |||
| 3093 | Ga0209758_1001271 | |||
| 3094 | Ga0209758_1004514 | |||
| 3095 | Ga0209758_1008701 | |||
| 3096 | Ga0209758_1009338 | |||
| 3097 | Ga0209758_1009734 | |||
| 3098 | Ga0209050_1000734 | |||
| 3099 | Ga0209050_1006356 | |||
| 3100 | Ga0209256_1000041 | |||
| 3101 | Ga0209256_1000396 | |||
| 3102 | Ga0209256_1000610 | |||
| 3103 | Ga0209256_1000717 | |||
| 3104 | Ga0209256_1000729 | |||
| 3105 | Ga0209256_1002535 | |||
| 3106 | Ga0209256_1003746 | |||
| 3107 | Ga0209256_1003980 | |||
| 3108 | Ga0207426_1000006 | |||
| 3109 | Ga0207426_1000008 | |||
| 3110 | Ga0207426_1000011 | |||
| 3111 | Ga0207426_1000065 | |||
| 3112 | Ga0207426_1000394 | |||
| 3113 | Ga0207426_1000449 | |||
| 3114 | Ga0209051_1000097 | |||
| 3115 | Ga0209051_1000314 | |||
| 3116 | Ga0209051_1003938 | |||
| 3117 | Ga0209051_1026414 | |||
| 3118 | Ga0209257_1000302 | |||
| 3119 | Ga0209257_1003955 | |||
| 3120 | Ga0209257_1006318 | |||
| 3121 | Ga0209257_1025324 | |||
| 3122 | Ga0209257_1038013 | |||
| 3123 | Ga0207697_10001617 | |||
| 3124 | Ga0207655_1010754 | |||
| 3125 | Ga0207655_1046058 | |||
| 3126 | Ga0207713_1013193 | |||
| 3127 | Ga0207713_1017718 | |||
| 3128 | Ga0207692_10043940 | |||
| 3129 | Ga0207710_10000638 | |||
| 3130 | Ga0207710_10001624 | |||
| 3131 | Ga0207680_10000023 | |||
| 3132 | Ga0207680_10044146 | |||
| 3133 | Ga0207647_10008196 | |||
| 3134 | Ga0207647_10059910 | |||
| 3135 | Ga0207685_10004327 | |||
| 3136 | Ga0207699_10012588 | |||
| 3137 | Ga0207699_10033136 | |||
| 3138 | Ga0207645_10171585 | |||
| 3139 | Ga0207705_10003682 | |||
| 3140 | Ga0207705_10031308 | |||
| 3141 | Ga0207705_10038810 | |||
| 3142 | Ga0207705_10084083 | |||
| 3143 | Ga0207695_10000011 | |||
| 3144 | Ga0207695_10000088 | |||
| 3145 | Ga0207695_10015356 | |||
| 3146 | Ga0207695_10148683 | |||
| 3147 | Ga0207695_10278669 | |||
| 3148 | Ga0207671_10000093 | |||
| 3149 | Ga0207671_10000368 | |||
| 3150 | Ga0207671_10024233 | |||
| 3151 | Ga0207671_10170518 | |||
| 3152 | Ga0207693_10002851 | |||
| 3153 | Ga0207663_10030938 | |||
| 3154 | Ga0207660_10016785 | |||
| 3155 | Ga0207660_10232795 | |||
| 3156 | Ga0207662_10002364 | |||
| 3157 | Ga0207657_10001218 | |||
| 3158 | Ga0207657_10004999 | |||
| 3159 | Ga0207657_10008223 | |||
| 3160 | Ga0207657_10057585 | |||
| 3161 | Ga0207649_10012372 | |||
| 3162 | Ga0207649_10016880 | |||
| 3163 | Ga0207649_10067350 | |||
| 3164 | Ga0207649_10073961 | |||
| 3165 | Ga0207649_10143927 | |||
| 3166 | Ga0207652_10057622 | |||
| 3167 | Ga0207652_10302574 | |||
| 3168 | Ga0207646_10279254 | |||
| 3169 | Ga0207681_10000004 | |||
| 3170 | Ga0207681_10014839 | |||
| 3171 | Ga0207681_10036835 | |||
| 3172 | Ga0207694_10040372 | |||
| 3173 | Ga0207694_10098828 | |||
| 3174 | Ga0207694_10308791 | |||
| 3175 | Ga0207650_10002272 | |||
| 3176 | Ga0207650_10008291 | |||
| 3177 | Ga0207650_10013146 | |||
| 3178 | Ga0207650_10042106 | |||
| 3179 | Ga0207659_10006123 | |||
| 3180 | Ga0207687_10007687 | |||
| 3181 | Ga0207700_10139893 | |||
| 3182 | Ga0207700_10173452 | |||
| 3183 | Ga0207664_10046042 | |||
| 3184 | Ga0207664_10154515 | |||
| 3185 | Ga0207644_10000009 | |||
| 3186 | Ga0207644_10010500 | |||
| 3187 | Ga0207644_10065896 | |||
| 3188 | Ga0207690_10011287 | |||
| 3189 | Ga0207690_10046314 | |||
| 3190 | Ga0207706_10002603 | |||
| 3191 | Ga0207706_10047395 | |||
| 3192 | Ga0207686_10243665 | |||
| 3193 | Ga0207709_10027572 | |||
| 3194 | Ga0207670_10003291 | |||
| 3195 | Ga0207669_10013036 | |||
| 3196 | Ga0207704_10010142 | |||
| 3197 | Ga0207704_10164837 | |||
| 3198 | Ga0207665_10003784 | |||
| 3199 | Ga0207691_10003385 | |||
| 3200 | Ga0207691_10140542 | |||
| 3201 | Ga0207711_10084358 | |||
| 3202 | Ga0207711_10135510 | |||
| 3203 | Ga0207661_10039077 | |||
| 3204 | Ga0207661_10351606 | |||
| 3205 | Ga0207679_10030316 | |||
| 3206 | Ga0207679_10085495 | |||
| 3207 | Ga0207679_10211714 | |||
| 3208 | Ga0207667_10007864 | |||
| 3209 | Ga0207667_10051811 | |||
| 3210 | Ga0207667_10062660 | |||
| 3211 | Ga0207667_10117255 | |||
| 3212 | Ga0207667_10197550 | |||
| 3213 | Ga0207651_10007136 | |||
| 3214 | Ga0207651_10257102 | |||
| 3215 | Ga0207712_10011208 | |||
| 3216 | Ga0207712_10037841 | |||
| 3217 | Ga0207712_10218850 | |||
| 3218 | Ga0207668_10000169 | |||
| 3219 | Ga0207668_10032057 | |||
| 3220 | Ga0207668_10048245 | |||
| 3221 | Ga0207668_10074744 | |||
| 3222 | Ga0207668_10098224 | |||
| 3223 | Ga0207640_10016981 | |||
| 3224 | Ga0207640_10049307 | |||
| 3225 | Ga0207640_10088697 | |||
| 3226 | Ga0207640_10128462 | |||
| 3227 | Ga0207640_10318481 | |||
| 3228 | Ga0207658_10020412 | |||
| 3229 | Ga0207658_10045699 | |||
| 3230 | Ga0207677_10126961 | |||
| 3231 | Ga0207703_10007713 | |||
| 3232 | Ga0207639_10001916 | |||
| 3233 | Ga0207639_10025379 | |||
| 3234 | Ga0207639_10040856 | |||
| 3235 | Ga0207678_10001222 | |||
| 3236 | Ga0207678_10066022 | |||
| 3237 | Ga0207678_10183948 | |||
| 3238 | Ga0207708_10000385 | |||
| 3239 | Ga0207708_10003153 | |||
| 3240 | Ga0207702_10013749 | |||
| 3241 | Ga0207702_10182589 | |||
| 3242 | Ga0207702_10274838 | |||
| 3243 | Ga0207702_10446373 | |||
| 3244 | Ga0207641_10005070 | |||
| 3245 | Ga0207641_10020177 | |||
| 3246 | Ga0207648_10009094 | |||
| 3247 | Ga0207676_10001820 | |||
| 3248 | Ga0207676_10039025 | |||
| 3249 | Ga0207674_10001584 | |||
| 3250 | Ga0207674_10021080 | |||
| 3251 | Ga0207674_10135331 | |||
| 3252 | Ga0207675_100000060 | |||
| 3253 | Ga0207675_100007201 | |||
| 3254 | Ga0207675_100175378 | |||
| 3255 | Ga0207683_10001503 | |||
| 3256 | Ga0207698_10009822 | |||
| 3257 | Ga0207698_10042092 | |||
| 3258 | Ga0207698_10068687 | |||
| 3259 | Ga0207698_10240238 | |||
| 3260 | Ga0207698_10476863 | |||
| 3261 | Ga0209281_1000245 | |||
| 3262 | Ga0209281_1000246 | |||
| 3263 | Ga0209281_1001017 | |||
| 3264 | Ga0209371_1000022 | |||
| 3265 | Ga0209371_1000173 | |||
| 3266 | Ga0209371_1001156 | |||
| 3267 | Ga0209179_1000063 | |||
| 3268 | Ga0209282_1000563 | |||
| 3269 | Ga0209282_1001720 | |||
| 3270 | Ga0209813_10005557 | |||
| 3271 | Ga0209813_10011809 | |||
| 3272 | Ga0209974_10020284 | |||
| 3273 | Ga0207428_10001431 | |||
| 3274 | Ga0207428_10027225 | |||
| 3275 | Ga0207428_10048219 | |||
| 3276 | Ga0207428_10067766 | |||
| 3277 | Ga0207428_10103303 | |||
| 3278 | Ga0268266_10000243 | |||
| 3279 | Ga0268266_10002745 | |||
| 3280 | Ga0268266_10030921 | |||
| 3281 | Ga0268266_10077476 | |||
| 3282 | Ga0268266_10272384 | |||
| 3283 | Ga0268265_10000576 | |||
| 3284 | Ga0268265_10022524 | |||
| 3285 | Ga0268264_10000069 | |||
| 3286 | Ga0268264_10006449 | |||
| 3287 | Ga0265318_10005250 | |||
| 3288 | Ga0307517_10044289 | |||
| 3289 | Ga0307515_10003171 | |||
| 3290 | Ga0307515_10006338 | |||
| 3291 | Ga0307515_10020078 | |||
| 3292 | Ga0307515_10174514 | |||
| 3293 | Ga0268256_1000019 | |||
| 3294 | Ga0307511_10092817 | |||
| 3295 | Ga0265330_10006061 | |||
| 3296 | Ga0265330_10045499 | |||
| 3297 | Ga0265330_10055314 | |||
| 3298 | Ga0265328_10006323 | |||
| 3299 | Ga0265325_10002139 | |||
| 3300 | Ga0265325_10027473 | |||
| 3301 | Ga0265339_10004708 | |||
| 3302 | Ga0265339_10011145 | |||
| 3303 | Ga0265327_10005132 | |||
| 3304 | Ga0265316_10048512 | |||
| 3305 | Ga0307513_10003757 | |||
| 3306 | Ga0307513_10012121 | |||
| 3307 | Ga0307513_10149430 | |||
| 3308 | Ga0307509_10106888 | |||
| 3309 | Ga0307408_100320037 | |||
| 3310 | Ga0265313_10000063 | |||
| 3311 | Ga0307508_10032271 | |||
| 3312 | Ga0316579_10000602 | |||
| 3313 | Ga0316579_10003046 | |||
| 3314 | Ga0265314_10015400 | |||
| 3315 | Ga0316576_10100109 | |||
| 3316 | Ga0316578_10034359 | |||
| 3317 | Ga0316578_10096736 | |||
| 3318 | Ga0307516_10001719 | |||
| 3319 | Ga0307516_10225238 | |||
| 3320 | Ga0307516_10243886 | |||
| 3321 | Ga0307405_10001594 | |||
| 3322 | Ga0307405_10060473 | |||
| 3323 | Ga0307405_10069996 | |||
| 3324 | Ga0307410_10004095 | |||
| 3325 | Ga0307406_10037380 | |||
| 3326 | Ga0307407_10147924 | |||
| 3327 | Ga0307412_10014053 | |||
| 3328 | Ga0315914_1000015 | |||
| 3329 | Ga0307414_10001368 | |||
| 3330 | Ga0307414_10051845 | |||
| 3331 | Ga0307411_10053700 | |||
| 3332 | Ga0316593_10046937 | |||
| 3333 | Ga0315913_1008719 | |||
| 3334 | Ga0315915_1000020 | |||
| 3335 | Ga0373940_0013654 | |||
| 3336 | Ga0373949_0029193 | |||
| 3337 | Ga0373939_0007086 | |||
| 3338 | Ga0373939_0035535 | |||
| 3339 | Ga0373941_0005225 | |||
| 3340 | Ga0373941_0055694 | |||
| 3341 | Ga0373960_0007893 | |||
| 3342 | Ga0373961_0007824 | |||
| 3343 | Ga0373962_0002300 | |||
| 3344 | Ga0373962_0003880 | |||
| 3345 | Ga0316574_0055341 | |||
| 3346 | Ga0316574_0137414 | |||
| 3347 | Ga0373931_0004634 | |||
| 3348 | Ga0373931_0010811 | |||
| 3349 | Ga0373931_0032593 | |||
| 3350 | Ga0373931_0051497 | |||
| 3351 | Ga0373931_0096025 | |||
| 3352 | Ga0373927_0000058 | |||
| 3353 | Ga0373937_0218965 | |||
| 3354 | Ga0316582_0006740 | |||
| 3355 | Ga0316584_0036814 | |||
| 3356 | Ga0373925_0005785 | |||
| 3357 | Ga0395899_0000044 | |||
| 3358 | Ga0395899_0099170 | |||
| 3359 | Ga0395900_0000042 | |||
| 3360 | Ga0395900_0013297 | |||
| 3361 | Ga0395900_0018704 | |||
| 3362 | Ga0395900_0105539 | |||
| 3363 | Ga0395898_0000080 | |||
| 3364 | Ga0395898_0096236 | |||
| 3365 | Ga0395898_0101483 | |||
| 3366 | Ga0395905_0000044 | |||
| 3367 | Ga0395905_0001069 | |||
| 3368 | Ga0395905_0012064 | |||
| 3369 | Ga0395905_0035395 | |||
| 3370 | Ga0395905_0036925 | |||
| 3371 | Ga0395905_0056748 | |||
| 3372 | Ga0395905_0059709 | |||
| 3373 | Ga0436364_0410392 | |||
| 3374 | Ga0395901_0000027 | |||
| 3375 | Ga0395901_0024093 | |||
| 3376 | Ga0395901_0064567 | |||
| 3377 | Ga0395901_0098115 | |||
| 3378 | Ga0400488_24627 | |||
| 3379 | Ga0242420_009488 | |||
| 3380 | Ga0400483_005361 | |||
| 3381 | Ga0400483_134363 | |||
| 3382 | Ga0400483_143286 | |||
| 3383 | Ga0400483_156554 | |||
| 3384 | Ga0400483_168664 | |||
| 3385 | Ga0400483_181996 | |||
| 3386 | Ga0400483_215517 | |||
| 3387 | Ga0400483_220054 | |||
| 3388 | Ga0400483_242580 | |||
| 3389 | Ga0400483_253791 | |||
| 3390 | Ga0400483_269816 | |||
| 3391 | Ga0436365_1382071 | |||
| 3392 | Ga0436365_1909219 | |||
| 3393 | Ga0436360_1174268 | |||
| 3394 | Ga0436363_0826910 | |||
| 3395 | Ga0436362_0327940 | |||
| 3396 | Ga0439436_0009616 | |||
| 3397 | Ga0439436_0021462 | |||
| 3398 | Ga0439438_000091 | |||
| 3399 | Ga0439438_003966 | |||
| 3400 | Ga0439447_000016 | |||
| 3401 | Ga0439447_000270 | |||
| 3402 | Ga0439447_002713 | |||
| 3403 | Ga0439447_006042 | |||
| 3404 | Ga0439466_0000324 | |||
| 3405 | Ga0439466_0012748 | |||
| 3406 | Ga0439466_0016319 | |||
| 3407 | Ga0439466_0041354 | |||
| 3408 | Ga0439466_0052910 | |||
| 3409 | Ga0439465_0000523 | |||
| 3410 | Ga0439465_0000778 | |||
| 3411 | Ga0439465_0006978 | |||
| 3412 | Ga0451787_281779 | |||
| 3413 | Ga0451793_0055025 | |||
| 3414 | Ga0451807_0079335 | |||
| 3415 | Ga0451839_0382298 | |||
| 3416 | Ga0451849_0157453 | |||
| 3417 | Ga0451850_10280 | |||
| 3418 | Ga0451855_0035652 | |||
| 3419 | Ga0451855_1331344 | |||
| 3420 | Ga0451853_1792368 | |||
| 3421 | Ga0439431_0026962 | |||
| 3422 | Ga0439445_0001308 | |||
| 3423 | Ga0439432_047291 | |||
| 3424 | Ga0439449_0000439 | |||
| 3425 | Ga0439449_0013003 | |||
| 3426 | Ga0439451_001654 | |||
| 3427 | Ga0439451_002285 | |||
| 3428 | Ga0439451_007893 | |||
| 3429 | Ga0439452_000046 | |||
| 3430 | Ga0439452_000163 | |||
| 3431 | Ga0439452_001028 | |||
| 3432 | Ga0439452_001433 | |||
| 3433 | Ga0439455_0009370 | |||
| 3434 | Ga0439456_002428 | |||
| 3435 | Ga0439456_010957 | |||
| 3436 | Ga0439456_016546 | |||
| 3437 | Ga0439463_004915 | |||
| 3438 | Ga0450911_001620 | |||
| 3439 | Ga0450919_001004 | |||
| 3440 | Ga0450920_001322 | |||
| 3441 | Ga0450922_000043 | |||
| 3442 | Ga0450922_001535 | |||
| 3443 | Ga0450923_001626 | |||
| 3444 | Ga0450902_001152 | |||
| 3445 | Ga0450902_005509 | |||
| 3446 | Ga0450903_000582 | |||
| 3447 | Ga0450903_002468 | |||
| 3448 | Ga0450903_011334 | |||
| 3449 | Ga0450906_000456 | |||
| 3450 | Ga0450907_000003 | |||
| 3451 | Ga0450907_000973 | |||
| 3452 | Ga0450907_002050 | |||
| 3453 | Ga0450907_013692 | |||
| 3454 | Ga0450910_001936 | |||
| 3455 | Ga0439446_0005478 | |||
| 3456 | Ga0450908_004701 | |||
| 3457 | Ga0450909_000170 | |||
| 3458 | Ga0439434_0000019 | |||
| 3459 | Ga0439434_0025096 | |||
| 3460 | Ga0439464_0005830 | |||
| 3461 | Ga0439460_0000388 | |||
| 3462 | Ga0439460_0002987 | |||
| 3463 | Ga0450916_000364 | |||
| 3464 | Ga0450918_002089 | |||
| 3465 | Ga0451577_0331336 | |||
| 3466 | Ga0439440_0000508 | |||
| 3467 | Ga0439440_0001836 | |||
| 3468 | Ga0466972_0050729 | |||
| 3469 | Ga0453684_0000136 | |||
| 3470 | Ga0453684_0117281 | |||
| 3471 | Ga0466970_0051098 | |||
| 3472 | Ga0466960_0144294 | |||
| 3473 | Ga0451576_0000025 | |||
| 3474 | Ga0451576_0023381 | |||
| 3475 | Ga0451576_0541263 | |||
| 3476 | Ga0495617_000282 | |||
| 3477 | Ga0495617_000613 | |||
| 3478 | Ga0495617_003080 | |||
| 3479 | Ga0495617_008507 | |||
| 3480 | Ga0495617_045186 | |||
| 3481 | Ga0495627_000010 | |||
| 3482 | Ga0495627_003377 | |||
| 3483 | Ga0495627_003483 | |||
| 3484 | Ga0495627_013990 | |||
| 3485 | Ga0495627_017194 | |||
| 3486 | Ga0495603_0000535 | |||
| 3487 | Ga0495603_0002140 | |||
| 3488 | Ga0495590_0000040 | |||
| 3489 | Ga0495590_0003390 | |||
| 3490 | Ga0495590_0004520 | |||
| 3491 | Ga0495590_0005815 | |||
| 3492 | Ga0495590_0022600 | |||
| 3493 | Ga0495590_0047473 | |||
| 3494 | Ga0495591_000016 | |||
| 3495 | Ga0495591_000143 | |||
| 3496 | Ga0495591_000736 | |||
| 3497 | Ga0495591_004102 | |||
| 3498 | Ga0495591_004844 | |||
| 3499 | Ga0495591_010620 | |||
| 3500 | Ga0495591_016244 | |||
| 3501 | Ga0495591_020149 | |||
| 3502 | Ga0495629_0066124 | |||
| 3503 | Ga0495629_0110708 | |||
| 3504 | Ga0495638_0000381 | |||
| 3505 | Ga0495638_0000906 | |||
| 3506 | Ga0495638_0001340 | |||
| 3507 | Ga0495638_0001770 | |||
| 3508 | Ga0495638_0002038 | |||
| 3509 | Ga0495638_0002185 | |||
| 3510 | Ga0495638_0002734 | |||
| 3511 | Ga0495638_0003287 | |||
| 3512 | Ga0495638_0008823 | |||
| 3513 | Ga0495638_0010217 | |||
| 3514 | Ga0495638_0014796 | |||
| 3515 | Ga0495638_0020752 | |||
| 3516 | Ga0495638_0044542 | |||
| 3517 | Ga0495638_0053148 | |||
| 3518 | Ga0495638_0104069 | |||
| 3519 | Ga0495650_0001536 | |||
| 3520 | Ga0495650_0001586 | |||
| 3521 | Ga0495650_0002125 | |||
| 3522 | Ga0495650_0003945 | |||
| 3523 | Ga0495650_0011227 | |||
| 3524 | Ga0495650_0011776 | |||
| 3525 | Ga0495582_0005973 | |||
| 3526 | Ga0495605_0000013 | |||
| 3527 | Ga0495605_0000244 | |||
| 3528 | Ga0495605_0000321 | |||
| 3529 | Ga0495605_0000751 | |||
| 3530 | Ga0495605_0001173 | |||
| 3531 | Ga0495605_0003344 | |||
| 3532 | Ga0495605_0006620 | |||
| 3533 | Ga0495605_0017540 | |||
| 3534 | Ga0495605_0018221 | |||
| 3535 | Ga0495605_0018907 | |||
| 3536 | Ga0495639_0000037 | |||
| 3537 | Ga0495639_0000553 | |||
| 3538 | Ga0495639_0021054 | |||
| 3539 | Ga0495584_0000019 | |||
| 3540 | Ga0495584_0000086 | |||
| 3541 | Ga0495584_0001430 | |||
| 3542 | Ga0495584_0005615 | |||
| 3543 | Ga0495584_0009593 | |||
| 3544 | Ga0495584_0020550 | |||
| 3545 | Ga0495584_0022419 | |||
| 3546 | Ga0495584_0031838 | |||
| 3547 | Ga0495584_0036443 | |||
| 3548 | Ga0495584_0046865 | |||
| 3549 | Ga0495584_0075776 | |||
| 3550 | Ga0495585_0000012 | |||
| 3551 | Ga0495585_0004015 | |||
| 3552 | Ga0495585_0005603 | |||
| 3553 | Ga0495585_0024800 | |||
| 3554 | Ga0495585_0041609 | |||
| 3555 | Ga0495594_0010177 | |||
| 3556 | Ga0495594_0012773 | |||
| 3557 | Ga0495594_0017998 | |||
| 3558 | Ga0495594_0037722 | |||
| 3559 | Ga0495596_0000050 | |||
| 3560 | Ga0495607_0000031 | |||
| 3561 | Ga0495607_0000637 | |||
| 3562 | Ga0495607_0001848 | |||
| 3563 | Ga0495607_0002549 | |||
| 3564 | Ga0495607_0005774 | |||
| 3565 | Ga0495607_0006918 | |||
| 3566 | Ga0495607_0008933 | |||
| 3567 | Ga0495607_0013112 | |||
| 3568 | Ga0495607_0024437 | |||
| 3569 | Ga0495607_0094305 | |||
| 3570 | Ga0495607_0111238 | |||
| 3571 | Ga0495583_0000042 | |||
| 3572 | Ga0495583_0000112 | |||
| 3573 | Ga0495583_0001014 | |||
| 3574 | Ga0495583_0008546 | |||
| 3575 | Ga0495583_0020181 | |||
| 3576 | Ga0495606_0001735 | |||
| 3577 | Ga0495606_0005023 | |||
| 3578 | Ga0495606_0011380 | |||
| 3579 | Ga0495610_0002479 | |||
| 3580 | Ga0495610_0004038 | |||
| 3581 | Ga0495610_0005663 | |||
| 3582 | Ga0495610_0010968 | |||
| 3583 | Ga0495610_0015724 | |||
| 3584 | Ga0495610_0018507 | |||
| 3585 | Ga0495610_0020528 | |||
| 3586 | Ga0495610_0021223 | |||
| 3587 | Ga0495610_0026983 | |||
| 3588 | Ga0495616_0000245 | |||
| 3589 | Ga0495616_0004681 | |||
| 3590 | Ga0495616_0018190 | |||
| 3591 | Ga0495616_0063293 | |||
| 3592 | Ga0495616_0093068 | |||
| 3593 | Ga0495620_0000005 | |||
| 3594 | Ga0495620_0001456 | |||
| 3595 | Ga0495620_0018086 | |||
| 3596 | Ga0495620_0022288 | |||
| 3597 | Ga0495620_0025085 | |||
| 3598 | Ga0495628_0148606 | |||
| 3599 | Ga0495630_0005993 | |||
| 3600 | Ga0495630_0032806 | |||
| 3601 | Ga0495630_0033080 | |||
| 3602 | Ga0495631_0000327 | |||
| 3603 | Ga0495631_0000336 | |||
| 3604 | Ga0495631_0004032 | |||
| 3605 | Ga0495631_0006054 | |||
| 3606 | Ga0495631_0007632 | |||
| 3607 | Ga0495631_0010474 | |||
| 3608 | Ga0495631_0039079 | |||
| 3609 | Ga0495632_0000058 | |||
| 3610 | Ga0495632_0001123 | |||
| 3611 | Ga0495632_0001410 | |||
| 3612 | Ga0495632_0002362 | |||
| 3613 | Ga0495632_0006229 | |||
| 3614 | Ga0495632_0013850 | |||
| 3615 | Ga0495632_0038353 | |||
| 3616 | Ga0495632_0038372 | |||
| 3617 | Ga0495632_0050064 | |||
| 3618 | Ga0495632_0052582 | |||
| 3619 | Ga0495632_0062245 | |||
| 3620 | Ga0495637_0000315 | |||
| 3621 | Ga0495637_0000493 | |||
| 3622 | Ga0495637_0000968 | |||
| 3623 | Ga0495637_0002855 | |||
| 3624 | Ga0495637_0004378 | |||
| 3625 | Ga0495637_0005273 | |||
| 3626 | Ga0495637_0013823 | |||
| 3627 | Ga0495637_0014825 | |||
| 3628 | Ga0495637_0016577 | |||
| 3629 | Ga0495637_0019639 | |||
| 3630 | Ga0495637_0048913 | |||
| 3631 | Ga0495643_0004441 | |||
| 3632 | Ga0495643_0004788 | |||
| 3633 | Ga0495643_0006068 | |||
| 3634 | Ga0495643_0011294 | |||
| 3635 | Ga0495643_0023187 | |||
| 3636 | Ga0495644_0000031 | |||
| 3637 | Ga0495644_0000217 | |||
| 3638 | Ga0495644_0002110 | |||
| 3639 | Ga0495644_0006236 | |||
| 3640 | Ga0495644_0008000 | |||
| 3641 | Ga0495648_0000884 | |||
| 3642 | Ga0495648_0001115 | |||
| 3643 | Ga0495648_0004068 | |||
| 3644 | Ga0495648_0010455 | |||
| 3645 | Ga0495648_0011307 | |||
| 3646 | Ga0495648_0016268 | |||
| 3647 | Ga0495648_0017141 | |||
| 3648 | Ga0495648_0018407 | |||
| 3649 | Ga0495648_0025638 | |||
| 3650 | Ga0495648_0034981 | |||
| 3651 | Ga0495648_0073026 | |||
| 3652 | Ga0495648_0118228 | |||
| 3653 | Ga0495663_0000180 | |||
| 3654 | Ga0495666_0000430 | |||
| 3655 | Ga0495666_0000574 | |||
| 3656 | Ga0495666_0031956 | |||
| 3657 | Ga0495666_0072715 | |||
| 3658 | Ga0495642_0000003 | |||
| 3659 | Ga0495642_0000165 | |||
| 3660 | Ga0495642_0001529 | |||
| 3661 | Ga0495654_0000253 | |||
| 3662 | Ga0495654_0000914 | |||
| 3663 | Ga0495654_0001303 | |||
| 3664 | Ga0495654_0005244 | |||
| 3665 | Ga0495654_0005849 | |||
| 3666 | Ga0495654_0007176 | |||
| 3667 | Ga0495654_0008468 | |||
| 3668 | Ga0495654_0017228 | |||
| 3669 | Ga0495654_0018606 | |||
| 3670 | Ga0495654_0040263 | |||
| 3671 | Ga0495654_0050553 | |||
| 3672 | Ga0495587_0001215 | |||
| 3673 | Ga0495587_0002012 | |||
| 3674 | Ga0495609_0000193 | |||
| 3675 | Ga0495609_0000517 | |||
| 3676 | Ga0495609_0001638 | |||
| 3677 | Ga0495609_0004786 | |||
| 3678 | Ga0495597_0000012 | |||
| 3679 | Ga0495597_0001398 | |||
| 3680 | Ga0495597_0002798 | |||
| 3681 | Ga0495597_0004197 | |||
| 3682 | Ga0495597_0008762 | |||
| 3683 | Ga0495597_0029401 | |||
| 3684 | Ga0495597_0040352 | |||
| 3685 | Ga0495597_0042732 | |||
| 3686 | Ga0495622_0000202 | |||
| 3687 | Ga0495622_0000446 | |||
| 3688 | Ga0495622_0066242 | |||
| 3689 | Ga0495633_0000013 | |||
| 3690 | Ga0495633_0002527 | |||
| 3691 | Ga0495633_0076000 | |||
| 3692 | Ga0495633_0084553 | |||
| 3693 | Ga0495656_0004408 | |||
| 3694 | Ga0495656_0026320 | |||
| 3695 | Ga0495668_0000424 | |||
| 3696 | Ga0495634_0000154 | |||
| 3697 | Ga0495611_0002162 | |||
| 3698 | Ga0495611_0002456 | |||
| 3699 | Ga0495611_0002693 | |||
| 3700 | Ga0495625_0002559 | |||
| 3701 | Ga0495625_0002784 | |||
| 3702 | Ga0495625_0002896 | |||
| 3703 | Ga0495625_0010204 | |||
| 3704 | Ga0495625_0010569 | |||
| 3705 | Ga0495625_0037088 | |||
| 3706 | Ga0495625_0039201 | |||
| 3707 | Ga0495625_0044542 | |||
| 3708 | Ga0495625_0046809 | |||
| 3709 | Ga0495625_0112011 | |||
| 3710 | Ga0495625_0151765 | |||
| 3711 | Ga0495625_0162358 | |||
| 3712 | Ga0495635_0000051 | |||
| 3713 | Ga0495635_0055550 | |||
| 3714 | Ga0495659_0000061 | |||
| 3715 | Ga0495659_0000978 | |||
| 3716 | Ga0495661_0000128 | |||
| 3717 | Ga0495661_0003829 | |||
| 3718 | Ga0495661_0004366 | |||
| 3719 | Ga0495661_0065155 | |||
| 3720 | Ga0495661_0068625 | |||
| 3721 | Ga0495588_0003387 | |||
| 3722 | Ga0495588_0012092 | |||
| 3723 | Ga0495623_0002213 | |||
| 3724 | Ga0495623_0005942 | |||
| 3725 | Ga0495669_0000263 | |||
| 3726 | Ga0495669_0045973 | |||
| 3727 | Ga0495613_0002488 | |||
| 3728 | Ga0495670_0000103 | |||
| 3729 | Ga0495670_0000179 | |||
| 3730 | Ga0495670_0000800 | |||
| 3731 | Ga0495670_0002654 | |||
| 3732 | Ga0495670_0005587 | |||
| 3733 | Ga0495670_0055726 | |||
| 3734 | Ga0495670_0058202 | |||
| 3735 | Ga0495670_0085888 | |||
| 3736 | Ga0495671_0000138 | |||
| 3737 | Ga0495671_0007182 | |||
| 3738 | Ga0495671_0009774 | |||
| 3739 | Ga0495671_0010690 | |||
| 3740 | Ga0495671_0014547 | |||
| 3741 | Ga0495671_0019479 | |||
| 3742 | Ga0495671_0022019 | |||
| 3743 | Ga0495671_0022611 | |||
| 3744 | Ga0495671_0032108 | |||
| 3745 | Ga0495671_0051021 | |||
| 3746 | Ga0495671_0054409 | |||
| 3747 | Ga0495671_0069211 | |||
| 3748 | Ga0495649_0000086 | |||
| 3749 | Ga0495649_0000393 | |||
| 3750 | Ga0495649_0002906 | |||
| 3751 | Ga0495649_0005630 | |||
| 3752 | Ga0495649_0018585 | |||
| 3753 | Ga0495649_0045133 | |||
| 3754 | Ga0495649_0064046 | |||
| 3755 | Ga0495649_0119454 | |||
| 3756 | Ga0495589_0000242 | |||
| 3757 | Ga0495589_0000583 | |||
| 3758 | Ga0495589_0000636 | |||
| 3759 | Ga0495589_0000758 | |||
| 3760 | Ga0495589_0008285 | |||
| 3761 | Ga0495589_0010820 | |||
| 3762 | Ga0495589_0029141 | |||
| 3763 | Ga0495589_0069497 | |||
| 3764 | Ga0495600_0070338 | |||
| 3765 | Ga0495660_0001195 | |||
| 3766 | Ga0495660_0002240 | |||
| 3767 | Ga0495660_0003894 | |||
| 3768 | Ga0495660_0007879 | |||
| 3769 | Ga0495660_0035887 | |||
| 3770 | Ga0495660_0044405 | |||
| 3771 | Ga0495660_0056933 | |||
| 3772 | Ga0495660_0073953 | |||
| 3773 | Ga0495581_0000262 | |||
| 3774 | Ga0495581_0056514 | |||
| 3775 | Ga0495604_0003245 | |||
| 3776 | Ga0495604_0021285 | |||
| 3777 | Ga0495604_0086447 | |||
| 3778 | Ga0495636_0001197 | |||
| 3779 | Ga0495672_0001126 | |||
| 3780 | Ga0495672_0002647 | |||
| 3781 | Ga0495672_0010412 | |||
| 3782 | Ga0495672_0010744 | |||
| 3783 | Ga0495672_0011293 | |||
| 3784 | Ga0495672_0013220 | |||
| 3785 | Ga0495672_0013711 | |||
| 3786 | Ga0495672_0016563 | |||
| 3787 | Ga0495672_0018174 | |||
| 3788 | Ga0495680_0005209 | |||
| 3789 | Ga0495683_0000002 | |||
| 3790 | Ga0495683_0000010 | |||
| 3791 | Ga0495683_0000116 | |||
| 3792 | Ga0495683_0001491 | |||
| 3793 | Ga0495683_0003259 | |||
| 3794 | Ga0495683_0007271 | |||
| 3795 | Ga0495683_0009520 | |||
| 3796 | Ga0495683_0024934 | |||
| 3797 | Ga0495683_0040402 | |||
| 3798 | Ga0495683_0041920 | |||
| 3799 | Ga0495687_000906 | |||
| 3800 | Ga0495687_001073 | |||
| 3801 | Ga0495687_004002 | |||
| 3802 | Ga0495687_012942 | |||
| 3803 | Ga0495687_022347 | |||
| 3804 | Ga0495675_0002774 | |||
| 3805 | Ga0495677_0000047 | |||
| 3806 | Ga0495679_000073 | |||
| 3807 | Ga0495679_001421 | |||
| 3808 | Ga0495679_002923 | |||
| 3809 | Ga0495679_004986 | |||
| 3810 | Ga0495673_0000077 | |||
| 3811 | Ga0495673_0000242 | |||
| 3812 | Ga0495673_0000426 | |||
| 3813 | Ga0495673_0001672 | |||
| 3814 | Ga0495673_0002266 | |||
| 3815 | Ga0495673_0002390 | |||
| 3816 | Ga0495673_0003183 | |||
| 3817 | Ga0495673_0003934 | |||
| 3818 | Ga0495673_0004107 | |||
| 3819 | Ga0495673_0006926 | |||
| 3820 | Ga0495673_0014495 | |||
| 3821 | Ga0495673_0040914 | |||
| 3822 | Ga0495673_0056600 | |||
| 3823 | Ga0495681_0000232 | |||
| 3824 | Ga0495681_0001247 | |||
| 3825 | Ga0495681_0001288 | |||
| 3826 | Ga0495681_0002295 | |||
| 3827 | Ga0495681_0002859 | |||
| 3828 | Ga0495681_0002891 | |||
| 3829 | Ga0495681_0005771 | |||
| 3830 | Ga0495681_0008830 | |||
| 3831 | Ga0495681_0010168 | |||
| 3832 | Ga0495681_0016446 | |||
| 3833 | Ga0495681_0028607 | |||
| 3834 | Ga0495681_0052971 | |||
| 3835 | Ga0495681_0101191 | |||
| 3836 | Ga0495686_0000556 | |||
| 3837 | Ga0495686_0001770 | |||
| 3838 | Ga0495686_0004878 | |||
| 3839 | Ga0495686_0021918 | |||
| 3840 | Ga0495686_0038906 | |||
| 3841 | Ga0495593_0002572 | |||
| 3842 | Ga0495593_0011099 | |||
| 3843 | Ga0495593_0012587 | |||
| 3844 | Ga0495593_0020449 | |||
| 3845 | Ga0495593_0046087 | |||
| 3846 | Ga0495614_0063673 | |||
| 3847 | Ga0495626_0000169 | |||
| 3848 | Ga0495626_0000198 | |||
| 3849 | Ga0495626_0000280 | |||
| 3850 | Ga0495626_0000345 | |||
| 3851 | Ga0495626_0000490 | |||
| 3852 | Ga0495626_0000531 | |||
| 3853 | Ga0496100_0017768 | |||
| 3854 | Ga0496101_0028888 | |||
| 3855 | Ga0496101_0108564 | |||
| 3856 | Ga0496101_0213915 | |||
| 3857 | Ga0496102_0000311 | |||
| 3858 | Ga0496102_0024513 | |||
| 3859 | Ga0496102_0034559 | |||
| 3860 | Ga0496102_0062555 | |||
| 3861 | Ga0496102_0119525 | |||
| 3862 | Ga0496102_0212709 | |||
| 3863 | Ga0496102_0237333 | |||
| 3864 | Ga0496103_0000272 | |||
| 3865 | Ga0496103_0009977 | |||
| 3866 | Ga0496103_0023618 | |||
| 3867 | Ga0496104_0002045 | |||
| 3868 | Ga0496104_0005566 | |||
| 3869 | Ga0496104_0015640 | |||
| 3870 | Ga0496104_0027111 | |||
| 3871 | Ga0496104_0071945 | |||
| 3872 | Ga0496104_0231979 | |||
| 3873 | Ga0496104_0318481 | |||
| 3874 | Ga0496105_0015796 | |||
| 3875 | Ga0496105_0050619 | |||
| 3876 | Ga0496105_0066696 | |||
| 3877 | Ga0496106_0002702 | |||
| 3878 | Ga0496106_0027233 | |||
| 3879 | Ga0496106_0034270 | |||
| 3880 | Ga0496106_0137564 | |||
| 3881 | Ga0496107_0042341 | |||
| 3882 | Ga0496107_0052099 | |||
| 3883 | Ga0496108_0004332 | |||
| 3884 | Ga0496108_0049723 | |||
| 3885 | Ga0496108_0070518 | |||
| 3886 | Ga0496108_0149952 | |||
| 3887 | Ga0496109_0007632 | |||
| 3888 | Ga0496109_0022579 | |||
| 3889 | Ga0496109_0077736 | |||
| 3890 | Ga0496109_0242504 | |||
| 3891 | Ga0496110_0000722 | |||
| 3892 | Ga0496110_0027042 | |||
| 3893 | Ga0496110_0045612 | |||
| 3894 | Ga0496110_0063470 | |||
| 3895 | Ga0496110_0146085 | |||
| 3896 | Ga0496110_0228657 | |||
| 3897 | Ga0496111_0013061 | |||
| 3898 | Ga0496111_0040756 | |||
| 3899 | Ga0496111_0042657 | |||
| 3900 | Ga0496111_0060316 | |||
| 3901 | Ga0496112_0005045 | |||
| 3902 | Ga0496112_0008175 | |||
| 3903 | Ga0496112_0061426 | |||
| 3904 | Ga0496112_0103931 | |||
| 3905 | Ga0496112_0231047 | |||
| 3906 | Ga0496113_0000237 | |||
| 3907 | Ga0496113_0007215 | |||
| 3908 | Ga0496113_0011759 | |||
| 3909 | Ga0496113_0021250 | |||
| 3910 | Ga0496113_0047481 | |||
| 3911 | Ga0496113_0169987 | |||
| 3912 | Ga0496114_0009944 | |||
| 3913 | Ga0496114_0178233 | |||
| 3914 | Ga0496115_0031772 | |||
| 3915 | Ga0496115_0047280 | |||
| 3916 | Ga0496116_0000142 | |||
| 3917 | Ga0496116_0005592 | |||
| 3918 | Ga0496116_0012847 | |||
| 3919 | Ga0496116_0058507 | |||
| 3920 | Ga0496117_0000002 | |||
| 3921 | Ga0496117_0001668 | |||
| 3922 | Ga0496117_0002159 | |||
| 3923 | Ga0496117_0002597 | |||
| 3924 | Ga0496117_0004903 | |||
| 3925 | Ga0496117_0034162 | |||
| 3926 | Ga0496117_0052729 | |||
| 3927 | Ga0496117_0070318 | |||
| 3928 | Ga0496118_0000087 | |||
| 3929 | Ga0496118_0003066 | |||
| 3930 | Ga0496118_0008151 | |||
| 3931 | Ga0496118_0027810 | |||
| 3932 | Ga0496119_0012549 | |||
| 3933 | Ga0496119_0043061 | |||
| 3934 | Ga0496119_0044559 | |||
| 3935 | Ga0496119_0063251 | |||
| 3936 | Ga0496119_0093667 | |||
| 3937 | Ga0496120_0000413 | |||
| 3938 | Ga0496120_0002399 | |||
| 3939 | Ga0496120_0004176 | |||
| 3940 | Ga0496120_0031474 | |||
| 3941 | Ga0496121_0000003 | |||
| 3942 | Ga0496121_0003720 | |||
| 3943 | Ga0496121_0014041 | |||
| 3944 | Ga0496122_0000004 | |||
| 3945 | Ga0496122_0000215 | |||
| 3946 | Ga0496122_0000840 | |||
| 3947 | Ga0496122_0001103 | |||
| 3948 | Ga0496122_0017685 | |||
| 3949 | Ga0496122_0018671 | |||
| 3950 | Ga0496122_0031306 | |||
| 3951 | Ga0496122_0054501 | |||
| 3952 | Ga0496122_0143343 | |||
| 3953 | Ga0496123_0000007 | |||
| 3954 | Ga0496123_0000306 | |||
| 3955 | Ga0496123_0000336 | |||
| 3956 | Ga0496123_0007538 | |||
| 3957 | Ga0496123_0016914 | |||
| 3958 | Ga0496123_0038132 | |||
| 3959 | Ga0496123_0047092 | |||
| 3960 | Ga0496123_0057637 | |||
| 3961 | Ga0496124_0000252 | |||
| 3962 | Ga0496124_0002136 | |||
| 3963 | Ga0496124_0002555 | |||
| 3964 | Ga0496124_0009734 | |||
| 3965 | Ga0496124_0038651 | |||
| 3966 | Ga0496124_0082442 | |||
| 3967 | Ga0496124_0120816 | |||
| 3968 | Ga0496124_0123127 | |||
| 3969 | Ga0496124_0216891 | |||
| 3970 | Ga0496125_0000039 | |||
| 3971 | Ga0496125_0000115 | |||
| 3972 | Ga0496125_0000248 | |||
| 3973 | Ga0496125_0004709 | |||
| 3974 | Ga0496125_0005054 | |||
| 3975 | Ga0496125_0006807 | |||
| 3976 | Ga0496125_0012178 | |||
| 3977 | Ga0496125_0040662 | |||
| 3978 | Ga0496125_0156958 | |||
| 3979 | Ga0496125_0167150 | |||
| 3980 | Ga0496126_0004507 | |||
| 3981 | Ga0496126_0089490 | |||
| 3982 | Ga0496126_0152247 | |||
| 3983 | Ga0495678_000005 | |||
| 3984 | Ga0495678_000437 | |||
| 3985 | Ga0495678_002064 | |||
| 3986 | Ga0495678_004456 | |||
| 3987 | Ga0495678_005290 | |||
| 3988 | Ga0495678_008281 | |||
| 3989 | Ga0495678_013283 | |||
| 3990 | Ga0495678_040918 | |||
| 3991 | Ga0495682_0005670 | |||
| 3992 | Ga0495682_0007712 | |||
| 3993 | Ga0495682_0013439 | |||
| 3994 | Ga0495682_0029551 | |||
| 3995 | Ga0501031_0000024 | |||
| 3996 | Ga0501031_0004592 | |||
| 3997 | Ga0501031_0014364 | |||
| 3998 | Ga0501031_0026503 | |||
| 3999 | Ga0501031_0060373 | |||
| 4000 | Ga0501032_0000007 | |||
| 4001 | Ga0501032_0000067 | |||
| 4002 | Ga0501032_0001002 | |||
| 4003 | Ga0501032_0006627 | |||
| 4004 | Ga0501032_0041213 | |||
| 4005 | Ga0501032_0155955 | |||
| 4006 | Ga0501033_0000051 | |||
| 4007 | Ga0501033_0000117 | |||
| 4008 | Ga0501033_0000349 | |||
| 4009 | Ga0501033_0004757 | |||
| 4010 | Ga0501033_0093682 | |||
| 4011 | Ga0501033_0094349 | |||
| 4012 | Ga0501033_0142634 | |||
| 4013 | Ga0501033_0199016 | |||
| 4014 | Ga0501033_0221602 | |||
| 4015 | Ga0501034_0000029 | |||
| 4016 | Ga0501034_0000153 | |||
| 4017 | Ga0501034_0000464 | |||
| 4018 | Ga0501034_0000732 | |||
| 4019 | Ga0501034_0000856 | |||
| 4020 | Ga0501034_0008570 | |||
| 4021 | Ga0501034_0027155 | |||
| 4022 | Ga0501034_0039601 | |||
| 4023 | Ga0501034_0045866 | |||
| 4024 | Ga0501034_0148126 | |||
| 4025 | Ga0501034_0158948 | |||
| 4026 | Ga0501034_0281830 | |||
| 4027 | Ga0501034_0303541 | |||
| 4028 | Ga0501034_0346230 | |||
| 4029 | Ga0501034_0452520 | |||
| 4030 | Ga0501036_0000004 | |||
| 4031 | Ga0501036_0000928 | |||
| 4032 | Ga0501036_0012091 | |||
| 4033 | Ga0501036_0013985 | |||
| 4034 | Ga0501036_0037538 | |||
| 4035 | Ga0501037_0000004 | |||
| 4036 | Ga0501037_0000007 | |||
| 4037 | Ga0501037_0000081 | |||
| 4038 | Ga0501037_0043652 | |||
| 4039 | Ga0501037_0214610 | |||
| 4040 | Ga0501037_0229568 | |||
| 4041 | Ga0501038_0000005 | |||
| 4042 | Ga0501038_0000033 | |||
| 4043 | Ga0501038_0000520 | |||
| 4044 | Ga0501038_0019048 | |||
| 4045 | Ga0501038_0030498 | |||
| 4046 | Ga0501038_0051192 | |||
| 4047 | Ga0501038_0094900 | |||
| 4048 | Ga0501038_0437373 | |||
| 4049 | Ga0501039_0000009 | |||
| 4050 | Ga0501039_0000031 | |||
| 4051 | Ga0501039_0014960 | |||
| 4052 | Ga0501039_0015253 | |||
| 4053 | Ga0501039_0044932 | |||
| 4054 | Ga0501039_0159140 | |||
| 4055 | Ga0501040_0009968 | |||
| 4056 | Ga0501040_0023407 | |||
| 4057 | Ga0501040_0036626 | |||
| 4058 | Ga0501040_0042264 | |||
| 4059 | Ga0501041_0006543 | |||
| 4060 | Ga0501041_0012239 | |||
| 4061 | Ga0501041_0081398 | |||
| 4062 | Ga0501041_0160012 | |||
| 4063 | Ga0501042_0019465 | |||
| 4064 | Ga0501042_0025815 | |||
| 4065 | Ga0501042_0038541 | |||
| 4066 | Ga0501042_0044684 | |||
| 4067 | Ga0501043_0000034 | |||
| 4068 | Ga0501043_0000044 | |||
| 4069 | Ga0501043_0001790 | |||
| 4070 | Ga0501043_0035499 | |||
| 4071 | Ga0501043_0048558 | |||
| 4072 | Ga0501043_0085182 | |||
| 4073 | Ga0501043_0115629 | |||
| 4074 | Ga0501046_0011042 | |||
| 4075 | Ga0501046_0035913 | |||
| 4076 | Ga0501046_0041626 | |||
| 4077 | Ga0501046_0052392 | |||
| 4078 | Ga0501046_0083875 | |||
| 4079 | Ga0501046_0107340 | |||
| 4080 | Ga0501047_0005769 | |||
| 4081 | Ga0501047_0008561 | |||
| 4082 | Ga0501047_0032505 | |||
| 4083 | Ga0501047_0041765 | |||
| 4084 | Ga0501047_0062853 | |||
| 4085 | Ga0501047_0063378 | |||
| 4086 | Ga0501047_0106266 | |||
| 4087 | Ga0501048_0022942 | |||
| 4088 | Ga0501048_0025003 | |||
| 4089 | Ga0501048_0059773 | |||
| 4090 | Ga0501048_0108592 | |||
| 4091 | Ga0501067_0045863 | |||
| 4092 | Ga0501068_0006004 | |||
| 4093 | Ga0501068_0036659 | |||
| 4094 | Ga0501068_0048843 | |||
| 4095 | Ga0501069_0000075 | |||
| 4096 | Ga0501069_0002889 | |||
| 4097 | Ga0501069_0006374 | |||
| 4098 | Ga0501069_0049686 | |||
| 4099 | Ga0501070_0000284 | |||
| 4100 | Ga0501070_0004793 | |||
| 4101 | Ga0501070_0005298 | |||
| 4102 | Ga0501070_0006011 | |||
| 4103 | Ga0501071_0000788 | |||
| 4104 | Ga0501071_0038242 | |||
| 4105 | Ga0501071_0047775 | |||
| 4106 | Ga0501071_0068628 | |||
| 4107 | Ga0501071_0069364 | |||
| 4108 | Ga0501071_0209729 | |||
| 4109 | Ga0501072_0006065 | |||
| 4110 | Ga0501072_0013019 | |||
| 4111 | Ga0501072_0042201 | |||
| 4112 | Ga0501073_0007771 | |||
| 4113 | Ga0501074_0000101 | |||
| 4114 | Ga0501074_0030410 | |||
| 4115 | Ga0501074_0034278 | |||
| 4116 | Ga0501074_0038952 | |||
| 4117 | Ga0501075_0030295 | |||
| 4118 | Ga0501075_0052526 | |||
| 4119 | Ga0501075_0282940 | |||
| 4120 | Ga0501076_0010182 | |||
| 4121 | Ga0501076_0014907 | |||
| 4122 | Ga0501076_0020166 | |||
| 4123 | Ga0501076_0062971 | |||
| 4124 | Ga0501076_0111709 | |||
| 4125 | Ga0501076_0116143 | |||
| 4126 | Ga0501076_0231944 | |||
| 4127 | Ga0501077_0007500 | |||
| 4128 | Ga0501077_0024389 | |||
| 4129 | Ga0501077_0044183 | |||
| 4130 | Ga0501077_0046334 | |||
| 4131 | Ga0501079_0020709 | |||
| 4132 | Ga0501079_0036801 | |||
| 4133 | Ga0501079_0041950 | |||
| 4134 | Ga0501079_0090439 | |||
| 4135 | Ga0501080_0000843 | |||
| 4136 | Ga0501080_0001651 | |||
| 4137 | Ga0501080_0026752 | |||
| 4138 | Ga0501080_0111895 | |||
| 4139 | Ga0501080_0127833 | |||
| 4140 | Ga0501081_0004251 | |||
| 4141 | Ga0501081_0026043 | |||
| 4142 | Ga0501081_0027775 | |||
| 4143 | Ga0501081_0113838 | |||
| 4144 | Ga0501083_0000191 | |||
| 4145 | Ga0501083_0011637 | |||
| 4146 | Ga0501083_0052796 | |||
| 4147 | Ga0501035_0000014 | |||
| 4148 | Ga0501035_0000469 | |||
| 4149 | Ga0501035_0000472 | |||
| 4150 | Ga0501035_0000546 | |||
| 4151 | Ga0501035_0003018 | |||
| 4152 | Ga0501035_0009851 | |||
| 4153 | Ga0501035_0048750 | |||
| 4154 | Ga0501035_0052261 | |||
| 4155 | Ga0501035_0065575 | |||
| 4156 | Ga0501035_0085804 | |||
| 4157 | Ga0501035_0090284 | |||
| 4158 | Ga0501035_0151917 | |||
| 4159 | Ga0501044_0000010 | |||
| 4160 | Ga0501044_0000012 | |||
| 4161 | Ga0501044_0003181 | |||
| 4162 | Ga0501044_0016120 | |||
| 4163 | Ga0501044_0023375 | |||
| 4164 | Ga0501044_0069596 | |||
| 4165 | Ga0501044_0085984 | |||
| 4166 | Ga0501044_0087979 | |||
| 4167 | Ga0501044_0114272 | |||
| 4168 | Ga0501044_0130873 | |||
| 4169 | Ga0501044_0157420 | |||
| 4170 | Ga0501044_0224941 | |||
| 4171 | Ga0501044_0234415 | |||
| 4172 | Ga0501045_0007600 | |||
| 4173 | Ga0501045_0007710 | |||
| 4174 | Ga0501045_0010155 | |||
| 4175 | Ga0501045_0034851 | |||
| 4176 | Ga0501045_0063244 | |||
| 4177 | Ga0501226_000002 | |||
| 4178 | nmdc:mga03683_3676_c1 | |||
| 4179 | nmdc:mga03683_58689_c1 | |||
| 4180 | nmdc:mga03683_61559_c1 | |||
| 4181 | nmdc:mga03683_7377_c2 | |||
| 4182 | nmdc:mga03n38_10080_c1 | |||
| 4183 | nmdc:mga03n38_59665_c1 | |||
| 4184 | nmdc:mga03n38_6071_c1 | |||
| 4185 | nmdc:mga00v17_10994_c1 | |||
| 4186 | nmdc:mga00v17_11669_c1 | |||
| 4187 | nmdc:mga00v17_1801_c1 | |||
| 4188 | nmdc:mga00v17_45_c1 | |||
| 4189 | nmdc:mga00v17_77929_c1 | |||
| 4190 | nmdc:mga0yw44_1411_c1 | |||
| 4191 | nmdc:mga0yw44_21763_c1 | |||
| 4192 | nmdc:mga0yw44_2560_c1 | |||
| 4193 | nmdc:mga0yw44_59184_c1 | |||
| 4194 | nmdc:mga0k408_122041_c1 | |||
| 4195 | nmdc:mga0k408_14605_c1 | |||
| 4196 | nmdc:mga06z11_11068_c1 | |||
| 4197 | nmdc:mga06z11_111037_c1 | |||
| 4198 | nmdc:mga06z11_1859_c1 | |||
| 4199 | nmdc:mga06z11_4728_c1 | |||
| 4200 | nmdc:mga06z11_72911_c1 | |||
| 4201 | nmdc:mga04h51_14377_c1 | |||
| 4202 | nmdc:mga04h51_17882_c1 | |||
| 4203 | nmdc:mga04h51_6329_c1 | |||
| 4204 | nmdc:mga07m45_31009_c1 | |||
| 4205 | nmdc:mga05p37_146_c2 | |||
| 4206 | nmdc:mga05p37_175331_c1 | |||
| 4207 | nmdc:mga05p37_193989_c1 | |||
| 4208 | nmdc:mga05p37_79974_c1 | |||
| 4209 | nmdc:mga09592_309_c1 | |||
| 4210 | nmdc:mga09592_330917_c1 | |||
| 4211 | nmdc:mga09592_44168_c1 | |||
| 4212 | nmdc:mga0qj67_201170_c1 | |||
| 4213 | nmdc:mga0qj67_6132_c1 | |||
| 4214 | nmdc:mga06r32_163486_c1 | |||
| 4215 | nmdc:mga06r32_296_c1 | |||
| 4216 | nmdc:mga06r32_3070_c1 | |||
| 4217 | nmdc:mga08y16_1223_c1 | |||
| 4218 | nmdc:mga08y16_144865_c1 | |||
| 4219 | nmdc:mga08y16_36156_c1 | |||
| 4220 | nmdc:mga08y16_41233_c1 | |||
| 4221 | nmdc:mga0n895_118237_c1 | |||
| 4222 | nmdc:mga0n895_171108_c1 | |||
| 4223 | nmdc:mga0n895_76619_c1 | |||
| 4224 | nmdc:mga0rr50_5670_c1 | |||
| 4225 | nmdc:mga08x19_26494_c1 | |||
| 4226 | nmdc:mga08x19_31582_c1 | |||
| 4227 | nmdc:mga08x19_59231_c1 | |||
| 4228 | nmdc:mga0a205_20791_c1 | |||
| 4229 | nmdc:mga0a205_218337_c1 | |||
| 4230 | nmdc:mga0sz30_3249_c1 | |||
| 4231 | nmdc:mga0sz30_6230_c1 | |||
| 4232 | Ga0500578_0021908 | |||
| 4233 | Ga0500643_000153 | |||
| 4234 | Ga0500555_004924 | |||
| 4235 | Ga0500595_000747 | |||
| 4236 | Ga0500608_021334 | |||
| 4237 | Ga0500658_0037029 | |||
| 4238 | Ga0500658_0091807 | |||
| 4239 | Ga0500568_0000202 | |||
| 4240 | Ga0500568_0051446 | |||
| 4241 | Ga0500573_0014865 | |||
| 4242 | Ga0500590_026998 | |||
| 4243 | Ga0500604_0000130 | |||
| 4244 | Ga0500616_0000102 | |||
| 4245 | Ga0500616_0001640 | |||
| 4246 | Ga0500624_001028 | |||
| 4247 | Ga0500627_0033440 | |||
| 4248 | Ga0500634_0000034 | |||
| 4249 | Ga0500634_0104226 | |||
| 4250 | Ga0500636_0000003 | |||
| 4251 | Ga0500609_005863 | |||
| 4252 | Ga0501084_0021979 | |||
| 4253 | Ga0501084_0025141 | |||
| 4254 | Ga0501084_0027937 | |||
| 4255 | Ga0501084_0086791 | |||
| 4256 | Ga0501084_0093697 | |||
| 4257 | Ga0501084_0323688 | |||
| 4258 | Ga0590071_002592 | |||
| 4259 | Ga0501082_0008290 | |||
| 4260 | Ga0501082_0024143 | |||
| 4261 | Ga0501082_0025691 | |||
| 4262 | Ga0501082_0029768 | |||
| 4263 | Ga0501082_0035257 | |||
| 4264 | Ga0501082_0069344 | |||
| 4265 | Ga0501082_0104368 | |||
| 4266 | Ga0501082_0189146 | |||
| 4267 | Ga0501082_0302900 | |||
| 4268 | Ga0530510_0001160 | |||
| 4269 | Ga0530510_0010708 | |||
| 4270 | Ga0530510_0014719 | |||
| 4271 | Ga0530510_0062198 | |||
| 4272 | Ga0530510_0082110 | |||
| 4273 | 2503199909 | |||
| 4274 | 2508728831 | |||
| 4275 | 2509075704 | |||
| 4276 | 2509108366 | |||
| 4277 | 2509114617 | |||
| 4278 | 2509142635 | |||
| 4279 | 2509369617 | |||
| 4280 | 2509376501 | |||
| 4281 | 2509392025 | |||
| 4282 | 2509394831 | |||
| 4283 | 2509445616 | |||
| 4284 | 2509447083 | |||
| 4285 | 2510133984 | |||
| 4286 | 2510306484 | |||
| 4287 | 2510318574 | |||
| 4288 | 2510841240 | |||
| 4289 | 2510895405 | |||
| 4290 | 2511134004 | |||
| 4291 | 2511172756 | |||
| 4292 | 2511187084 | |||
| 4293 | 2511199059 | |||
| 4294 | 2511257459 | |||
| 4295 | 2511274082 | |||
| 4296 | 2511276593 | |||
| 4297 | 2511304155 | |||
| 4298 | 2511314752 | |||
| 4299 | 2511322540 | |||
| 4300 | 2511327815 | |||
| 4301 | 2511331166 | |||
| 4302 | 2511340611 | |||
| 4303 | 2511344623 | |||
| 4304 | 2511349948 | |||
| 4305 | 2511358753 | |||
| 4306 | 2511362454 | |||
| 4307 | 2511390294 | |||
| 4308 | 2511502274 | |||
| 4309 | 2512533648 | |||
| 4310 | 2512932616 | |||
| 4311 | 2512960638 | |||
| 4312 | 2512970652 | |||
| 4313 | 2513567940 | |||
| 4314 | 2513576975 | |||
| 4315 | 2513584354 | |||
| 4316 | 2513596505 | |||
| 4317 | 2513601714 | |||
| 4318 | 2513608735 | |||
| 4319 | 2513618834 | |||
| 4320 | 2513633355 | |||
| 4321 | 2513707628 | |||
| 4322 | 2513865629 | |||
| 4323 | 2513884374 | |||
| 4324 | 2513905041 | |||
| 4325 | 2513908966 | |||
| 4326 | 2513925355 | |||
| 4327 | 2513984133 | |||
| 4328 | 2514001471 | |||
| 4329 | 2514002843 | |||
| 4330 | 2514019976 | |||
| 4331 | 2514036276 | |||
| 4332 | 2514422823 | |||
| 4333 | 2514587423 | |||
| 4334 | 2515113033 | |||
| 4335 | 2515609051 | |||
| 4336 | 2515638312 | |||
| 4337 | 2515640993 | |||
| 4338 | 2515655324 | |||
| 4339 | 2515739515 | |||
| 4340 | 2516204175 | |||
| 4341 | 2516893653 | |||
| 4342 | 2517036735 | |||
| 4343 | 2517077096 | |||
| 4344 | 2517095862 | |||
| 4345 | 2517407433 | |||
| 4346 | 2517570377 | |||
| 4347 | 2524448526 | |||
| 4348 | 2524459618 | |||
| 4349 | 2530645921 | |||
| 4350 | 2535486687 | |||
| 4351 | 2535516896 | |||
| 4352 | 2537876042 | |||
| 4353 | 2551678485 | |||
| 4354 | 2551689787 | |||
| 4355 | 2551694375 | |||
| 4356 | 2551701991 | |||
| 4357 | 2551715262 | |||
| 4358 | 2551723698 | |||
| 4359 | 2551738189 | |||
| 4360 | 2551743399 | |||
| 4361 | 2554248263 | |||
| 4362 | 2558864431 | |||
| 4363 | 2559295379 | |||
| 4364 | 2585166384 | |||
| 4365 | 2585202239 | |||
| 4366 | 2585222862 | |||
| 4367 | 2585231773 | |||
| 4368 | 2585255117 | |||
| 4369 | 2585267391 | |||
| 4370 | 2585271167 | |||
| 4371 | 2585277512 | |||
| 4372 | 2585323304 | |||
| 4373 | 2585331447 | |||
| 4374 | 2585386459 | |||
| 4375 | 2585393286 | |||
| 4376 | 2585402368 | |||
| 4377 | 2585527477 | |||
| 4378 | 2585535139 | |||
| 4379 | 2585538215 | |||
| 4380 | 2585545445 | |||
| 4381 | 2585555989 | |||
| 4382 | 2585558891 | |||
| 4383 | 2585822945 | |||
| 4384 | 2585836164 | |||
| 4385 | 2585843258 | |||
| 4386 | 2585898272 | |||
| 4387 | 2585904139 | |||
| 4388 | 2585996232 | |||
| 4389 | 2586000843 | |||
| 4390 | 2587980744 | |||
| 4391 | 2588518695 | |||
| 4392 | 2597812084 | |||
| 4393 | 2599331779 | |||
| 4394 | 2599417271 | |||
| 4395 | 2599601691 | |||
| 4396 | 2599936480 | |||
| 4397 | 2600195485 | |||
| 4398 | 2601610049 | |||
| 4399 | 2601746824 | |||
| 4400 | 2616293331 | |||
| 4401 | 2616308987 | |||
| 4402 | 2616554258 | |||
| 4403 | 2617383598 | |||
| 4404 | 2624492827 | |||
| 4405 | 2643754798 | |||
| 4406 | 2643769871 | |||
| 4407 | 2643803052 | |||
| 4408 | 2643811503 | |||
| 4409 | 2643837674 | |||
| 4410 | 2643845851 | |||
| 4411 | 2643856735 | |||
| 4412 | 2643912693 | |||
| 4413 | 2643920311 | |||
| 4414 | 2643953778 | |||
| 4415 | 2643966195 | |||
| 4416 | 2643987406 | |||
| 4417 | 2644003139 | |||
| 4418 | 2644021712 | |||
| 4419 | 2644050483 | |||
| 4420 | 2644063414 | |||
| 4421 | 2644107246 | |||
| 4422 | 2644133310 | |||
| 4423 | 2644150812 | |||
| 4424 | 2644158074 | |||
| 4425 | 2644169787 | |||
| 4426 | 2644189435 | |||
| 4427 | 2644193541 | |||
| 4428 | 2644205711 | |||
| 4429 | 2644208998 | |||
| 4430 | 2644238647 | |||
| 4431 | 2644298703 | |||
| 4432 | 2644308641 | |||
| 4433 | 2644335459 | |||
| 4434 | 2644350422 | |||
| 4435 | 2644374697 | |||
| 4436 | 2644413304 | |||
| 4437 | 2644414177 | |||
| 4438 | 2644447705 | |||
| 4439 | 2644483401 | |||
| 4440 | 2644492060 | |||
| 4441 | 2644499614 | |||
| 4442 | 2644521927 | |||
| 4443 | 2644539864 | |||
| 4444 | 2644614582 | |||
| 4445 | 2644652528 | |||
| 4446 | 2644656932 | |||
| 4447 | 2644676045 | |||
| 4448 | 2644690178 | |||
| 4449 | 2644732812 | |||
| 4450 | 2644734594 | |||
| 4451 | 2644743946 | |||
| 4452 | 2657681593 | |||
| 4453 | 2671111401 | |||
| 4454 | 2688597164 | |||
| 4455 | 2692315511 | |||
| 4456 | 2694628770 | |||
| 4457 | 2694637316 | |||
| 4458 | 2719181836 | |||
| 4459 | 2719386442 | |||
| 4460 | 2719666188 | |||
| 4461 | 2719732500 | |||
| 4462 | 2720492608 | |||
| 4463 | 2720614042 | |||
| 4464 | 2720620849 | |||
| 4465 | 2720632174 | |||
| 4466 | 2720775902 | |||
| 4467 | 2721147927 | |||
| 4468 | 2721159378 | |||
| 4469 | 2721164763 | |||
| 4470 | 2721400146 | |||
| 4471 | 2722840933 | |||
| 4472 | 2723027504 | |||
| 4473 | 2723561125 | |||
| 4474 | 2723567721 | |||
| 4475 | 2723574359 | |||
| 4476 | 2724038959 | |||
| 4477 | 2724045256 | |||
| 4478 | 2724090509 | |||
| 4479 | 2724104986 | |||
| 4480 | 2724110843 | |||
| 4481 | 2725952531 | |||
| 4482 | 2730108440 | |||
| 4483 | 2730165071 | |||
| 4484 | 2730299010 | |||
| 4485 | 2738800116 | |||
| 4486 | 2738947302 | |||
| 4487 | 2739032871 | |||
| 4488 | 2739199949 | |||
| 4489 | 2739260175 | |||
| 4490 | 2739307562 | |||
| 4491 | 2753357070 | |||
| 4492 | 2753462057 | |||
| 4493 | 2756671449 | |||
| 4494 | 2757571298 | |||
| 4495 | 2758639356 | |||
| 4496 | 2765466383 | |||
| 4497 | 2766065902 | |||
| 4498 | 2770199013 | |||
| 4499 | 2774118718 | |||
| 4500 | 2774874315 | |||
| 4501 | 2776261944 | |||
| 4502 | 2776270281 | |||
| 4503 | 2776284989 | |||
| 4504 | 2776913973 | |||
| 4505 | 2778175445 | |||
| 4506 | 2784312355 | |||
| 4507 | 2792585097 | |||
| 4508 | 2792620741 | |||
| 4509 | 2792626100 | |||
| 4510 | 2792639037 | |||
| 4511 | 2792748055 | |||
| 4512 | 2793294407 | |||
| 4513 | 2793314514 | |||
| 4514 | 2793320341 | |||
| 4515 | 2793331700 | |||
| 4516 | 2793334520 | |||
| 4517 | 2793339240 | |||
| 4518 | 2793348910 | |||
| 4519 | 2793351802 | |||
| 4520 | 2793362550 | |||
| 4521 | 2793368843 | |||
| 4522 | 2802717006 | |||
| 4523 | 2802725755 | |||
| 4524 | 2802730156 | |||
| 4525 | 2802737873 | |||
| 4526 | 2802742673 | |||
| 4527 | 2802750161 | |||
| 4528 | 2804752782 | |||
| 4529 | 2805928771 | |||
| 4530 | 2805935053 | |||
| 4531 | 2806043851 | |||
| 4532 | 2806050218 | |||
| 4533 | 2806057034 | |||
| 4534 | 2806064415 | |||
| 4535 | 2806071682 | |||
| 4536 | 2808905340 | |||
| 4537 | 2808933204 | |||
| 4538 | 2808940170 | |||
| 4539 | 2808955289 | |||
| 4540 | 2808961781 | |||
| 4541 | 2808987887 | |||
| 4542 | 2819241372 | |||
| 4543 | 2819559092 | |||
| 4544 | 2819609177 | |||
| 4545 | 2819637594 | |||
| 4546 | 2819684942 | |||
| 4547 | 2835320033 | |||
| 4548 | 2837651168 | |||
| 4549 | 2838017622 | |||
| 4550 | 2838027578 | |||
| 4551 | 2838029776 | |||
| 4552 | 2838038530 | |||
| 4553 | 2838044993 | |||
| 4554 | 2838054332 | |||
| 4555 | 2838067705 | |||
| 4556 | 2838070112 | |||
| 4557 | 2838076828 | |||
| 4558 | 2838661559 | |||
| 4559 | 2838670391 | |||
| 4560 | 2838675740 | |||
| 4561 | 2838683434 | |||
| 4562 | 2838687021 | |||
| 4563 | 2838697623 | |||
| 4564 | 2838702762 | |||
| 4565 | 2838710739 | |||
| 4566 | 2838714622 | |||
| 4567 | 2838721577 | |||
| 4568 | 2838725382 | |||
| 4569 | 2838730006 | |||
| 4570 | 2838742979 | |||
| 4571 | 2839998269 | |||
| 4572 | 2840769105 | |||
| 4573 | 2840882777 | |||
| 4574 | 2841738074 | |||
| 4575 | 2841848527 | |||
| 4576 | 2841852465 | |||
| 4577 | 2841862157 | |||
| 4578 | 2841870813 | |||
| 4579 | 2842078912 | |||
| 4580 | 2842113235 | |||
| 4581 | 2842118578 | |||
| 4582 | 2842125442 | |||
| 4583 | 2842130635 | |||
| 4584 | 2842147980 | |||
| 4585 | 2842154195 | |||
| 4586 | 2842158076 | |||
| 4587 | 2842168761 | |||
| 4588 | 2842170866 | |||
| 4589 | 2842177815 | |||
| 4590 | 2842181695 | |||
| 4591 | 2842187731 | |||
| 4592 | 2842197388 | |||
| 4593 | 2842203588 | |||
| 4594 | 2842205450 | |||
| 4595 | 2842212042 | |||
| 4596 | 2842217967 | |||
| 4597 | 2842226339 | |||
| 4598 | 2842230254 | |||
| 4599 | 2842240490 | |||
| 4600 | 2842244157 | |||
| 4601 | 2842253046 | |||
| 4602 | 2842257757 | |||
| 4603 | 2842266297 | |||
| 4604 | 2842271441 | |||
| 4605 | 2842278907 | |||
| 4606 | 2842285569 | |||
| 4607 | 2842292574 | |||
| 4608 | 2842301400 | |||
| 4609 | 2842305070 | |||
| 4610 | 2842316973 | |||
| 4611 | 2842320740 | |||
| 4612 | 2842346489 | |||
| 4613 | 2842357937 | |||
| 4614 | 2842368928 | |||
| 4615 | 2842374065 | |||
| 4616 | 2842378972 | |||
| 4617 | 2842385089 | |||
| 4618 | 2842399849 | |||
| 4619 | 2842402929 | |||
| 4620 | 2842409699 | |||
| 4621 | 2842416350 | |||
| 4622 | 2842423726 | |||
| 4623 | 2842430760 | |||
| 4624 | 2842437253 | |||
| 4625 | 2842443623 | |||
| 4626 | 2842453871 | |||
| 4627 | 2842464903 | |||
| 4628 | 2842471871 | |||
| 4629 | 2842476939 | |||
| 4630 | 2842484531 | |||
| 4631 | 2842492008 | |||
| 4632 | 2842496796 | |||
| 4633 | 2842503304 | |||
| 4634 | 2842511099 | |||
| 4635 | 2842518941 | |||
| 4636 | 2842521847 | |||
| 4637 | 2842695379 | |||
| 4638 | 2842872263 | |||
| 4639 | 2842924185 | |||
| 4640 | 2844008643 | |||
| 4641 | 2844012541 | |||
| 4642 | 2844164609 | |||
| 4643 | 2844458388 | |||
| 4644 | 2844535307 | |||
| 4645 | 2847419427 | |||
| 4646 | 2847674964 | |||
| 4647 | 2847691053 | |||
| 4648 | 2848994455 | |||
| 4649 | 2850081498 | |||
| 4650 | 2852390256 | |||
| 4651 | 2854684059 | |||
| 4652 | 2854899620 | |||
| 4653 | 2854916296 | |||
| 4654 | 2854918445 | |||
| 4655 | 2855826375 | |||
| 4656 | 2855841764 | |||
| 4657 | 2855872491 | |||
| 4658 | 2856320682 | |||
| 4659 | 2856323025 | |||
| 4660 | 2856334784 | |||
| 4661 | 2856336555 | |||
| 4662 | 2856346523 | |||
| 4663 | 2856359022 | |||
| 4664 | 2856367984 | |||
| 4665 | 2857351893 | |||
| 4666 | 2857368859 | |||
| 4667 | 2857517399 | |||
| 4668 | 2858802549 | |||
| 4669 | 2860344174 | |||
| 4670 | 2869164738 | |||
| 4671 | 2869173989 | |||
| 4672 | 2869237841 | |||
| 4673 | 2869247767 | |||
| 4674 | 2869253176 | |||
| 4675 | 2869263236 | |||
| 4676 | 2869267594 | |||
| 4677 | 2869277600 | |||
| 4678 | 2869282576 | |||
| 4679 | 2869283104 | |||
| 4680 | 2869290397 | |||
| 4681 | 2871432681 | |||
| 4682 | 2871441035 | |||
| 4683 | 2871447830 | |||
| 4684 | 2871455734 | |||
| 4685 | 2871460996 | |||
| 4686 | 2871468238 | |||
| 4687 | 2871475985 | |||
| 4688 | 2871483428 | |||
| 4689 | 2871493297 | |||
| 4690 | 2871499115 | |||
| 4691 | 2874108640 | |||
| 4692 | 2874112238 | |||
| 4693 | 2874117685 | |||
| 4694 | 2874126673 | |||
| 4695 | 2874133701 | |||
| 4696 | 2874142232 | |||
| 4697 | 2874152648 | |||
| 4698 | 2874160048 | |||
| 4699 | 2874168038 | |||
| 4700 | 2874174866 | |||
| 4701 | 2876365131 | |||
| 4702 | 2876374499 | |||
| 4703 | 2876388844 | |||
| 4704 | 2876397946 | |||
| 4705 | 2876402778 | |||
| 4706 | 2876409011 | |||
| 4707 | 2876418564 | |||
| 4708 | 2876422280 | |||
| 4709 | 2878036015 | |||
| 4710 | 2878744584 | |||
| 4711 | 2878750295 | |||
| 4712 | 2878757342 | |||
| 4713 | 2878763314 | |||
| 4714 | 2878770302 | |||
| 4715 | 2878774766 | |||
| 4716 | 2878787687 | |||
| 4717 | 2881149845 | |||
| 4718 | 2881160992 | |||
| 4719 | 2881166724 | |||
| 4720 | 2881859184 | |||
| 4721 | 2881868975 | |||
| 4722 | 2882458511 | |||
| 4723 | 2882632481 | |||
| 4724 | 2882919256 | |||
| 4725 | 2884299063 | |||
| 4726 | 2885308245 | |||
| 4727 | 2885312964 | |||
| 4728 | 2885325829 | |||
| 4729 | 2885332271 | |||
| 4730 | 2885341270 | |||
| 4731 | 2885353989 | |||
| 4732 | 2888345853 | |||
| 4733 | 2889010058 | |||
| 4734 | 2889018269 | |||
| 4735 | 2889795554 | |||
| 4736 | 2889916115 | |||
| 4737 | 2891050968 | |||
| 4738 | 2891373381 | |||
| 4739 | 2894235580 | |||
| 4740 | 2894655609 | |||
| 4741 | 2896388995 | |||
| 4742 | 2898796042 | |||
| 4743 | 2899796019 | |||
| 4744 | 2899807234 | |||
| 4745 | 2899850596 | |||
| 4746 | 2903450131 | |||
| 4747 | 2903500037 | |||
| 4748 | 2903501069 | |||
| 4749 | 2903520564 | |||
| 4750 | 2903522134 | |||
| 4751 | 2903528512 | |||
| 4752 | 2903543917 | |||
| 4753 | 2904553691 | |||
| 4754 | 2904582229 | |||
| 4755 | 2904664597 | |||
| 4756 | 2906312653 | |||
| 4757 | 2906325362 | |||
| 4758 | 2906330754 | |||
| 4759 | 2906362117 | |||
| 4760 | 2906364504 | |||
| 4761 | 2906373556 | |||
| 4762 | 2906390267 | |||
| 4763 | 2906395739 | |||
| 4764 | 2906406159 | |||
| 4765 | 2906411159 | |||
| 4766 | 2906419869 | |||
| 4767 | 2909043551 | |||
| 4768 | 2913299281 | |||
| 4769 | 2913312601 | |||
| 4770 | 2915652801 | |||
| 4771 | 2915982976 | |||
| 4772 | 2915991477 | |||
| 4773 | 2916000828 | |||
| 4774 | 2916003452 | |||
| 4775 | 2916008079 | |||
| 4776 | 2916019574 | |||
| 4777 | 2916022162 | |||
| 4778 | 2916034221 | |||
| 4779 | 2916037900 | |||
| 4780 | 2916045300 | |||
| 4781 | 2916049076 | |||
| 4782 | 2916055686 | |||
| 4783 | 2916062284 | |||
| 4784 | 2916082288 | |||
| 4785 | 2917557354 | |||
| 4786 | 2919107626 | |||
| 4787 | 2919114660 | |||
| 4788 | 2919122990 | |||
| 4789 | 2919169278 | |||
| 4790 | 2919174679 | |||
| 4791 | 2919410009 | |||
| 4792 | 2919461216 | |||
| 4793 | 2919682044 | |||
| 4794 | 2919703485 | |||
| 4795 | 2920761487 | |||
| 4796 | 2920825252 | |||
| 4797 | 2921208503 | |||
| 4798 | 2921210958 | |||
| 4799 | 2921240896 | |||
| 4800 | 2921246740 | |||
| 4801 | 2921253823 | |||
| 4802 | 2921263079 | |||
| 4803 | 2921266243 | |||
| 4804 | 2921289162 | |||
| 4805 | 2921296279 | |||
| 4806 | 2921299071 | |||
| 4807 | 2922136938 | |||
| 4808 | 2922157196 | |||
| 4809 | 2922160908 | |||
| 4810 | 2922172817 | |||
| 4811 | 2922188078 | |||
| 4812 | 2923558603 | |||
| 4813 | 2924146720 | |||
| 4814 | 2924157958 | |||
| 4815 | 2924159308 | |||
| 4816 | 2924170518 | |||
| 4817 | 2924174535 | |||
| 4818 | 2924182966 | |||
| 4819 | 2924193313 | |||
| 4820 | 2924195418 | |||
| 4821 | 2924203291 | |||
| 4822 | 2924210710 | |||
| 4823 | 2924217618 | |||
| 4824 | 2924223260 | |||
| 4825 | 2924230554 | |||
| 4826 | 2924716922 | |||
| 4827 | 2924726480 | |||
| 4828 | 2924730920 | |||
| 4829 | 2924737953 | |||
| 4830 | 2924753435 | |||
| 4831 | 2924760511 | |||
| 4832 | 2924768352 | |||
| 4833 | 2924782614 | |||
| 4834 | 2924786648 | |||
| 4835 | 2926755676 | |||
| 4836 | 2926762796 | |||
| 4837 | 2928524189 | |||
| 4838 | 2929140906 | |||
| 4839 | 2931402933 | |||
| 4840 | 2932404846 | |||
| 4841 | 2933008840 | |||
| 4842 | 2933014885 | |||
| 4843 | 2933022192 | |||
| 4844 | 2933570878 | |||
| 4845 | 2933588709 | |||
| 4846 | 2933596563 | |||
| 4847 | 2933600918 | |||
| 4848 | 2935896991 | |||
| 4849 | 2935901925 | |||
| 4850 | 2936372004 | |||
| 4851 | 2936379866 | |||
| 4852 | 2936382770 | |||
| 4853 | 2936998249 | |||
| 4854 | 2937004525 | |||
| 4855 | 2937011232 | |||
| 4856 | 2937019790 | |||
| 4857 | 2937024619 | |||
| 4858 | 2937031107 | |||
| 4859 | 2937037023 | |||
| 4860 | 2937047977 | |||
| 4861 | 2937056464 | |||
| 4862 | 2937063537 | |||
| 4863 | 2937067808 | |||
| 4864 | 2937074425 | |||
| 4865 | 2937081573 | |||
| 4866 | 2937094579 | |||
| 4867 | 2937105456 | |||
| 4868 | 2937111291 | |||
| 4869 | 2937116110 | |||
| 4870 | 2937122019 | |||
| 4871 | 2937128860 | |||
| 4872 | 2937819202 | |||
| 4873 | 2937827749 | |||
| 4874 | 2937842074 | |||
| 4875 | 2937846575 | |||
| 4876 | 2937852081 | |||
| 4877 | 2937864598 | |||
| 4878 | 2937870805 | |||
| 4879 | 2937881257 | |||
| 4880 | 2937895662 | |||
| 4881 | 2937977347 | |||
| 4882 | 2937982633 | |||
| 4883 | 2937997766 | |||
| 4884 | 2939640228 | |||
| 4885 | 2941502101 | |||
| 4886 | 2952255286 | |||
| 4887 | 2954013135 | |||
| 4888 | 2957378373 | |||
| 4889 | 2957384244 | |||
| 4890 | 2957390707 | |||
| 4891 | 2957401692 | |||
| 4892 | 2957404469 | |||
| 4893 | 2957414105 | |||
| 4894 | 2957416211 | |||
| 4895 | 2957431750 | |||
| 4896 | 2957438185 | |||
| 4897 | 2957446875 | |||
| 4898 | 2957453717 | |||
| 4899 | 2957461913 | |||
| 4900 | 2957467011 | |||
| 4901 | 2957471605 | |||
| 4902 | 2957479571 | |||
| 4903 | 2957490429 | |||
| 4904 | 2957497368 | |||
| 4905 | 2957503344 | |||
| 4906 | 2957506239 | |||
| 4907 | 2958039359 | |||
| 4908 | 2958043241 | |||
| 4909 | 2958051581 | |||
| 4910 | 2958053013 | |||
| 4911 | 2958070624 | |||
| 4912 | 2958073708 | |||
| 4913 | 2958088186 | |||
| 4914 | 2958097466 | |||
| 4915 | 2958107745 | |||
| 4916 | 2958121122 | |||
| 4917 | 2958127322 | |||
| 4918 | 2958134785 | |||
| 4919 | 2958147008 | |||
| 4920 | 2958168239 | |||
| 4921 | 2958178233 | |||
| 4922 | 2958186435 | |||
| 4923 | 2960590881 | |||
| 4924 | 2960594247 | |||
| 4925 | 2960599960 | |||
| 4926 | 2960610624 | |||
| 4927 | 2960614559 | |||
| 4928 | 2960620498 | |||
| 4929 | 2960624448 | |||
| 4930 | 2960633629 | |||
| 4931 | 2960645009 | |||
| 4932 | 2960652446 | |||
| 4933 | 2960654684 | |||
| 4934 | 2960666528 | |||
| 4935 | 2960669691 | |||
| 4936 | 2960675127 | |||
| 4937 | 2960681037 | |||
| 4938 | 2960692502 | |||
| 4939 | 2960698033 | |||
| 4940 | 2961084934 | |||
| 4941 | 2961119596 | |||
| 4942 | 2961131238 | |||
| 4943 | 2961140362 | |||
| 4944 | 2961166705 | |||
| 4945 | 2961175329 | |||
| 4946 | 2961185676 | |||
| 4947 | 2963646586 | |||
| 4948 | 2964614159 | |||
| 4949 | 2964618000 | |||
| 4950 | 2964623600 | |||
| 4951 | 2964632620 | |||
| 4952 | 2964645652 | |||
| 4953 | 2964651589 | |||
| 4954 | 2964661778 | |||
| 4955 | 2964666890 | |||
| 4956 | 2964677605 | |||
| 4957 | 2964682908 | |||
| 4958 | 2964688516 | |||
| 4959 | 2964692513 | |||
| 4960 | 2964705353 | |||
| 4961 | 2964710488 | |||
| 4962 | 2964718362 | |||
| 4963 | 2964720712 | |||
| 4964 | 2965021528 | |||
| 4965 | 2965027539 | |||
| 4966 | 2965042216 | |||
| 4967 | 2965051801 | |||
| 4968 | 2965067609 | |||
| 4969 | 2965095376 | |||
| 4970 | 2965110338 | |||
| 4971 | 2965118158 | |||
| 4972 | 2965122438 | |||
| 4973 | 2967670739 | |||
| 4974 | 2967678381 | |||
| 4975 | 2967684393 | |||
| 4976 | 2967689964 | |||
| 4977 | 2967694677 | |||
| 4978 | 2967701364 | |||
| 4979 | 2967708655 | |||
| 4980 | 2967714908 | |||
| 4981 | 2967727951 | |||
| 4982 | 2967730033 | |||
| 4983 | 2967737180 | |||
| 4984 | 2967742290 | |||
| 4985 | 2967751570 | |||
| 4986 | 2967757879 | |||
| 4987 | 2967767702 | |||
| 4988 | 2967772088 | |||
| 4989 | 2967779014 | |||
| 4990 | 2967999669 | |||
| 4991 | 2968008027 | |||
| 4992 | 2968020686 | |||
| 4993 | 2968090621 | |||
| 4994 | 2968094700 | |||
| 4995 | 2968100907 | |||
| 4996 | 2968115851 | |||
| 4997 | 2968119224 | |||
| 4998 | 2968133729 | |||
| 4999 | 2968142521 | |||
| 5000 | 2968175110 | |||
| 5001 | 2970021029 | |||
| 5002 | 2970031742 | |||
| 5003 | 2970034129 | |||
| 5004 | 2970042521 | |||
| 5005 | 2970054578 | |||
| 5006 | 2970056734 | |||
| 5007 | 2970067176 | |||
| 5008 | 2970071620 | |||
| 5009 | 2970078296 | |||
| 5010 | 2970085277 | |||
| 5011 | 2970092580 | |||
| 5012 | 2970096151 | |||
| 5013 | 2970107965 | |||
| 5014 | 2970110742 | |||
| 5015 | 2970117387 | |||
| 5016 | 2970124911 | |||
| 5017 | 2970131133 | |||
| 5018 | 2970136326 | |||
| 5019 | 2970145129 | |||
| 5020 | 2970151583 | |||
| 5021 | 2970159601 | |||
| 5022 | 2970166945 | |||
| 5023 | 2970174276 | |||
| 5024 | 2970180857 | |||
| 5025 | 2970189203 | |||
| 5026 | 2970198839 | |||
| 5027 | 2970473983 | |||
| 5028 | 2970490628 | |||
| 5029 | 2970507917 | |||
| 5030 | 2970514286 | |||
| 5031 | 2970527308 | |||
| 5032 | 2970534681 | |||
| 5033 | 2970543004 | |||
| 5034 | 2970548602 | |||
| 5035 | 2970558159 | |||
| 5036 | 2970597185 | |||
| 5037 | 2970597724 | |||
| 5038 | 2970619484 | |||
| 5039 | 2970629116 | |||
| 5040 | 2977523719 | |||
| 5041 | 2977528837 | |||
| 5042 | 2977531451 | |||
| 5043 | 2977539659 | |||
| 5044 | 2977548342 | |||
| 5045 | 2977558465 | |||
| 5046 | 2977563206 | |||
| 5047 | 2977567699 | |||
| 5048 | 2977575714 | |||
| 5049 | 2977581965 | |||
| 5050 | 2977826501 | |||
| 5051 | 2977831850 | |||
| 5052 | 2977848441 | |||
| 5053 | 2977855175 | |||
| 5054 | 2977859417 | |||
| 5055 | 2977865098 | |||
| 5056 | 2977873542 | |||
| 5057 | 2977903229 | |||
| 5058 | 2977909123 | |||
| 5059 | 2977922056 | |||
| 5060 | 2977922906 | |||
| 5061 | 2977938109 | |||
| 5062 | 2977944849 | |||
| 5063 | 2977956131 | |||
| 5064 | 2977958419 | |||
| 5065 | 2977978315 | |||
| 5066 | 2977987854 | |||
| 5067 | 2978974655 | |||
| 5068 | 2979094714 | |||
| 5069 | 2979100720 | |||
| 5070 | 2979103946 | |||
| 5071 | 2979715859 | |||
| 5072 | 2979749880 | |||
| 5073 | 2979771094 | |||
| 5074 | 2979779750 | |||
| 5075 | 2979783672 | |||
| 5076 | 2979800949 | |||
| 5077 | 2979813101 | |||
| 5078 | 2984511486 | |||
| 5079 | 2984522153 | |||
| 5080 | 2984541451 | |||
| 5081 | 2984589976 | |||
| 5082 | 2984603729 | |||
| 5083 | 2987639077 | |||
| 5084 | 2987647903 | |||
| 5085 | 2987659057 | |||
| 5086 | 2987662717 | |||
| 5087 | 2987671519 | |||
| 5088 | 2987676826 | |||
| 5089 | 2989349707 | |||
| 5090 | 2989774323 | |||
| 5091 | 2989779238 | |||
| 5092 | 2995393172 | |||
| 5093 | 2996312147 | |||
| 5094 | 2996338591 | |||
| 5095 | 2996344143 | |||
| 5096 | 2996352697 | |||
| 5097 | 2996389192 | |||
| 5098 | 2996889007 | |||
| 5099 | 2996894297 | |||
| 5100 | 3000139548 | |||
| 5101 | 3002145096 | |||
| 5102 | 3003934104 | |||
| 5103 | 3004167564 | |||
| 5104 | 3004191767 | |||
| 5105 | 3004202678 | |||
| 5106 | 3004204680 | |||
| 5107 | 3004217983 | |||
| 5108 | 3004220969 | |||
| 5109 | 3004233934 | |||
| 5110 | 3004241010 | |||
| 5111 | 3004255314 | |||
| 5112 | 3004273975 | |||
| 5113 | 3004279379 | |||
| 5114 | 3004335839 | |||
| 5115 | 3005414565 | |||
| 5116 | 3005417405 | |||
| 5117 | 3005448477 | |||
| 5118 | 3005454655 | |||
| 5119 | 3007515129 | |||
| 5120 | 3007620619 | |||
| 5121 | 637075711 | |||
| 5122 | 639649217 | |||
| 5123 | 643826341 | |||
| 5124 | 648739242 | |||
| 5125 | 649871719 | |||
| 5126 | 650740589 | |||
| 5127 | 8002291576 | |||
| 5128 | 8003571656 | |||
| 5129 | 8003994199 | |||
| 5130 | 8004001841 | |||
| 5131 | 8004306619 | |||
| 5132 | 8004319058 | |||
| 5133 | 8004368570 | |||
| 5134 | 8004378917 | |||
| 5135 | 8004392603 | |||
| 5136 | 8004634488 | |||
| 5137 | 8004645210 | |||
| 5138 | 8004697608 | |||
| 5139 | 8004712125 | |||
| 5140 | 8004718912 | |||
| 5141 | 8004729784 | |||
| 5142 | 8005248799 | |||
| 5143 | 8005260336 | |||
| 5144 | 8005281240 | |||
| 5145 | 8005286103 | |||
| 5146 | 8005292238 | |||
| 5147 | 8005303156 | |||
| 5148 | 8005312864 | |||
| 5149 | 8005315806 | |||
| 5150 | 8005323534 | |||
| 5151 | 8005380958 | |||
| 5152 | 8005389091 | |||
| 5153 | 8005396074 | |||
| 5154 | 8005435184 | |||
| 5155 | 8005463714 | |||
| 5156 | 8005489158 | |||
| 5157 | 8005500926 | |||
| 5158 | 8005545650 | |||
| 5159 | 8005556988 | |||
| 5160 | 8005568020 | |||
| 5161 | 8005573435 | |||
| 5162 | 8005622299 | |||
| 5163 | 8005629800 | |||
| 5164 | 8005648167 | |||
| 5165 | 8005672344 | |||
| 5166 | 8005682860 | |||
| 5167 | 8005692076 | |||
| 5168 | 8005697430 | |||
| 5169 | 8018134124 | |||
| 5170 | 8018164599 | |||
| 5171 | 8018181294 | |||
| 5172 | 8019781786 | |||
| 5173 | 8023683138 | |||
| 5174 | 8024482836 | |||
| 5175 | 8024488057 | |||
| 5176 | 8024504450 | |||
| 5177 | 8046771116 | |||
| 5178 | 8049295353 | |||
| 5179 | 8054463014 | |||
| 5180 | 8054558610 | |||
| 5181 | 8055619397 | |||
| 5182 | 8056129665 | |||
| 5183 | 8056156877 | |||
| 5184 | 8056182596 | |||
| 5185 | 8056375961 | |||
| 5186 | 8056386753 | |||
| 5187 | 8056877268 | |||
| 5188 | 8057529699 | |||
| 5189 | 8057575707 | |||
| 5190 | 8057877646 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3owo-assembly2.cif.gz_D | structures of iron-dependent alcohol dehydrogenase 2 from zymomonas mobilis zm4 with and without nad cofactor | 0.9497 | 4 | 378 |
| 5br4-assembly1.cif.gz_B | e. coli lactaldehyde reductase (fuco) m185c mutant | 0.9402 | 4 | 378 |
| 6scg-assembly1.cif.gz_B | structure of adhe form 1 | 0.9377 | 5 | 381 |
| 7qls-assembly1.cif.gz_BBB | crystal structure of e.coli alcohol dehydrogenase - fuco mutant n151g, l259v complexed with fe, nadh, and dimethoxyphenyl acetamide | 0.9357 | 4 | 378 |
| 7qlq-assembly1.cif.gz_BBB | crystal structure of e.coli alcohol dehydrogenase - fuco mutant n151g, l259v complexed with fe, nad, and dimethoxyphenyl acetamide | 0.9356 | 12 | 378 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q09669_229_422_1.20.1090.10 | Mainly Alpha;Up-down Bundle;Dehydroquinate synthase-like, alpha domain;Dehydroquinate synthase-like - alpha domain | 0.9706 | 193 | 377 | 1.20.1090.10 |
| af_P76553_203_395_1.20.1090.10 | Mainly Alpha;Up-down Bundle;Dehydroquinate synthase-like, alpha domain;Dehydroquinate synthase-like - alpha domain | 0.9596 | 191 | 377 | 1.20.1090.10 |
| af_P0A9Q7_645_865_1.20.1090.10 | Mainly Alpha;Up-down Bundle;Dehydroquinate synthase-like, alpha domain;Dehydroquinate synthase-like - alpha domain | 0.9529 | 193 | 381 | 1.20.1090.10 |
| 3zdrA02 | Mainly Alpha;Up-down Bundle;Dehydroquinate synthase-like, alpha domain;Dehydroquinate synthase-like - alpha domain | 0.9392 | 192 | 379 | 1.20.1090.10 |
| 3bfjA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9341 | 4 | 189 | 3.40.50.1970 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A528BYV0-F1-model_v4 | Iron-containing alcohol dehydrogenase | 0.9931 | 9 | 253 |
GO:0004022
GO:0046872 |
| AF-A0A7C1NZ22-F1-model_v4 | Iron-containing alcohol dehydrogenase | 0.9903 | 40 | 378 |
GO:0004022
GO:0046872 |
| AF-A0A0Q0DHR9-F1-model_v4 | deleted | 0.9854 | 2 | 380 |
|
| AF-A0A3M5PFU8-F1-model_v4 | Alcohol dehydrogenase | 0.9845 | 1 | 380 |
GO:0004022
GO:0046872 |
| AF-A0A528BYV0-F1-model_v4 | Iron-containing alcohol dehydrogenase | 0.9811 | 9 | 253 |
GO:0004022
GO:0046872 |