F496953

General Info

Members Datasets Scaffolds Average Seq Length
2613 993 2214 288

Family's Representative Sequence

Representative Sequence 3300049742|Ga0501080_0057864|Ga0501080_0057864_1049_2047
Length 332
Sequence MAQAPSAFMLARMAXXXXARVATMTDALAGKAANPKTILTGSSPEADHTEGMSYLQSLPRRLVTLYLPLGVILLVLLFPFYWMALTSVKPDEQLLDLDKYSPFWTWTPTLKHINKLLFDTEYPIWLWNTMFVAVCATALSIIASVLAAYAIVRLRYRGAQAVGGMIFLAYLVPPSILFIPLSTVVYQYGLFDTPFALILTYPTILIPFSTWLLMGYFKTIPYELEECALIDGASRWQILIKIVLPLAVHGLISAFIFCFTLCWNEFIYALTFISSTHYKTVPVAIVTALVDGDIYRWGSLMAGAMIGSLPLVILYAFFVEHYVSAMTGAVKE

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
3 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
4 2509276019 Ensifer aridi TW10 Isolate Nodule
5 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
6 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
7 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
8 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
9 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
10 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
11 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
12 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
13 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
14 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
15 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
16 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
17 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
18 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
19 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
20 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
21 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
22 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
23 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
24 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
25 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
26 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
27 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
28 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
29 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
30 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
31 2516143018 Ensifer sp. BR816 Isolate Nodule
32 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
33 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
34 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
35 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
36 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
37 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
38 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
39 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
40 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
41 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
42 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
43 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
44 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
45 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
46 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
47 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
48 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
49 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
50 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
51 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
52 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
53 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
54 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
55 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
56 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
57 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
58 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
59 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
60 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
61 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
62 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
63 2643221651 Afipia sp. Root123D2 Isolate Unclassified
64 2643221723 Ensifer sp. Root278 Isolate Unclassified
65 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
66 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
67 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
68 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
69 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
70 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
71 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
72 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
73 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
74 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
75 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
76 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
77 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
78 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
79 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
80 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
81 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
82 2791355199
83 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
84 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
85 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
86 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
87 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
88 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
89 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
90 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
91 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
92 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
93 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
94 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
95 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
96 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
97 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
98 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
99 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
100 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
101 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
102 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
103 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
104 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
105 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
106 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
107 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
108 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
109 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
110 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
111 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
112 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
113 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
114 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
115 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
116 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
117 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
118 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
119 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
120 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
121 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
122 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
123 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
124 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
125 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
126 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
127 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
128 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
129 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
130 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
131 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
132 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
133 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
134 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
135 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
136 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
137 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
138 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
139 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
140 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
141 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
142 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
143 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
144 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
145 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
146 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
147 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
148 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
149 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
150 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
151 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
152 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
153 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
154 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
155 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
156 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
157 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
158 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
159 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
160 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
161 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
162 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
163 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
164 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
165 2902330777 Methylobacterium sp. 2A Isolate Unclassified
166 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
167 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
168 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
169 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
170 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
171 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
172 2904699407
173 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
174 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
175 2906610324
176 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
177 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
178 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
179 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
180 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
181 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
182 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
183 2909042592 Labrys sp. LIt4 Isolate Nodule
184 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
185 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
186 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
187 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
188 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
189 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
190 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
191 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
192 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
193 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
194 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
195 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
196 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
197 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
198 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
199 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
200 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
201 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
202 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
203 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
204 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
205 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
206 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
207 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
208 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
209 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
210 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
211 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
212 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
213 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
214 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
215 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
216 2922425934
217 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
218 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
219 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
220 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
221 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
222 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
223 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
224 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
225 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
226 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
227 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
228 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
229 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
230 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
231 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
232 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
233 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
234 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
235 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
236 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
237 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
238 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
239 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
240 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
241 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
242 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
243 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
244 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
245 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
246 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
247 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
248 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
249 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
250 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
251 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
252 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
253 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
254 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
255 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
256 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
257 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
258 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
259 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
260 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
261 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
262 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
263 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
264 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
265 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
266 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
267 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
268 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
269 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
270 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
271 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
272 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
273 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
274 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
275 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
276 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
277 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
278 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
279 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
280 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
281 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
282 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
283 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
284 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
285 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
286 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
287 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
288 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
289 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
290 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
291 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
292 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
293 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
294 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
295 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
296 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
297 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
298 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
299 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
300 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
301 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
302 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
303 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
304 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
305 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
306 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
307 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
308 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
309 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
310 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
311 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
312 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
313 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
314 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
315 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
316 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
317 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
318 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
319 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
320 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
321 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
322 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
323 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
324 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
325 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
326 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
327 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
328 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
329 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
330 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
331 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
332 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
333 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
334 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
335 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
336 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
337 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
338 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
339 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
340 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
341 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
342 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
343 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
344 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
345 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
346 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
347 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
348 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
349 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
350 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
351 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
352 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
353 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
354 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
355 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
356 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
357 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
358 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
359 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
360 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
361 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
362 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
363 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
364 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
365 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
366 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
367 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
368 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
369 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
370 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
371 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
372 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
373 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
374 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
375 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
376 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
377 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
378 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
379 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
380 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
381 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
382 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
383 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
384 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
385 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
386 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
387 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
388 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
389 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
390 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
391 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
392 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
393 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
394 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
395 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
396 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
397 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
398 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
399 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
400 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
401 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
402 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
403 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
404 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
405 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
406 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
407 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
408 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
409 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
410 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
411 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
412 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
413 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
414 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
415 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
416 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
417 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
418 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
419 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
420 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
421 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
422 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
423 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
424 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
425 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
426 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
427 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
428 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
429 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
430 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
431 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
432 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
433 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
434 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
435 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
436 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
437 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
438 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
439 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
440 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
441 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
442 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
443 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
444 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
445 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
446 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
447 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
448 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
449 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
450 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
451 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
452 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
453 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
454 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
455 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
456 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
457 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
458 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
459 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
460 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
461 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
462 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
463 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
464 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
465 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
466 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
467 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
468 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
469 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
470 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
471 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
472 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
473 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
474 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
475 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
476 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
477 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
478 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
479 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
480 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
481 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
482 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
483 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
484 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
485 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
486 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
487 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
488 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
489 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
490 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
491 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
492 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
493 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
494 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
495 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
496 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
497 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
498 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
499 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
500 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
501 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
502 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
503 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
504 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
505 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
506 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
507 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
508 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
509 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
510 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
511 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
512 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
513 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
514 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
515 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
516 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
517 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
518 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
519 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
520 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
521 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
522 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
523 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
524 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
525 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
526 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
527 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
528 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
529 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
530 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
531 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
532 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
533 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
534 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
535 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
536 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
537 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
538 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
539 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
540 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
541 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
542 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
543 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
544 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
545 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
546 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
547 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
548 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
549 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
550 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
551 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
552 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
553 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
554 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
555 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
556 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
557 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
558 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
559 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
560 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
561 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
562 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
563 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
564 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
565 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
566 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
567 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
568 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
569 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
570 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
571 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
572 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
573 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
574 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
575 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
576 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
577 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
578 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
579 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
580 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
581 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
582 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
583 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
584 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
585 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
586 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
587 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
588 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
589 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
590 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
591 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
592 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
593 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
594 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
595 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
596 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
597 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
598 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
599 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
600 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
601 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
602 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
603 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
604 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
605 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
606 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
607 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
608 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
609 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
610 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
611 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
612 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
613 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
614 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
615 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
616 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
617 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
618 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
619 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
620 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
621 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
622 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
623 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
624 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
625 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
626 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
627 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
628 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
629 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
630 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
631 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
632 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
633 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
634 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
635 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
636 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
637 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
638 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
639 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
640 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
641 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
642 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
643 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
644 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
645 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
646 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
647 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
648 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
649 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
650 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
651 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
652 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
653 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
654 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
655 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
656 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
657 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
658 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
659 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
660 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
661 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
662 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
663 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
664 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
665 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
666 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
667 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
668 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
669 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
670 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
671 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
672 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
673 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
674 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
675 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
676 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
677 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
678 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
679 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
680 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
681 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
682 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
683 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
684 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
685 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
686 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
687 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
688 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
689 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
690 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
691 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
692 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
693 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
694 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
695 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
696 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
697 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
698 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
699 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
700 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
701 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
702 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
703 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
704 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
705 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
706 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
707 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
708 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
709 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
710 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
711 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
712 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
713 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
714 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
715 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
716 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
717 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
718 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
719 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
720 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
721 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
722 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
723 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
724 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
725 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
726 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
727 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
728 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
729 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
730 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
731 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
732 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
733 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
734 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
735 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
736 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
737 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
738 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
739 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
740 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
741 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
742 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
743 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
744 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
745 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
746 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
747 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
748 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
749 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
750 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
751 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
752 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
753 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
754 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
755 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
756 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
757 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
758 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
759 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
760 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
761 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
762 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
763 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
764 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
765 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
766 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
767 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
768 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
769 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
770 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
771 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
772 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
773 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
774 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
775 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
776 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
777 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
778 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
779 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
780 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
781 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
782 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
783 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
784 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
785 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
786 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
787 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
788 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
789 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
790 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
791 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
792 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
793 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
794 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
795 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
796 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
797 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
798 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
799 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
800 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
801 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
802 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
803 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
804 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
805 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
806 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
807 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
808 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
809 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
810 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
811 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
812 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
813 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
814 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
815 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
816 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
817 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
818 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
819 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
820 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
821 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
822 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
823 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
824 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
825 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
826 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
827 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
828 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
829 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
830 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
831 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
832 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
833 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
834 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
835 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
836 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
837 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
838 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
839 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
840 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
841 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
842 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
843 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
844 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
845 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
846 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
847 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
848 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
849 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
850 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
851 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
852 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
853 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
854 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
855 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
856 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
857 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
858 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
859 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
860 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
861 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
862 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
863 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
864 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
865 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
866 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
867 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
868 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
869 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
870 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
871 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
872 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
873 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
874 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
875 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
876 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
877 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
878 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
879 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
880 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
881 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
882 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
883 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
884 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
885 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
886 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
887 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
888 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
889 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
890 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
891 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
892 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
893 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
894 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
895 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
896 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
897 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
898 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
899 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
900 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
901 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
902 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
903 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
904 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
905 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
906 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
907 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
908 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
909 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
910 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
911 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
912 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
913 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
914 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
915 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
916 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
917 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
918 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
919 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
920 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
921 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
922 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
923 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
924 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
925 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
926 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
927 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
928 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
929 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
930 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
931 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
932 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
933 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
934 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
935 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
936 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
937 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
938 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
939 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
940 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
941 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
942 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
943 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
944 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
945 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
946 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
947 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
948 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
949 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
950 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
951 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
952 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
953 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
954 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
955 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
956 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
957 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
958 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
959 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
960 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
961 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
962 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
963 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
964 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
965 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
966 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
967 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
968 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
969 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
970 641522639 Methylobacterium sp. 4-46 Isolate Nodule
971 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
972 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
973 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
974 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
975 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
976 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
977 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
978 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
979 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
980 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
981 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
982 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
983 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
984 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
985 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
986 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
987 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
988 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
989 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
990 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
991 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
992 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
993 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 84.71
Metatranscriptomes 0.15
Isolates 15.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.69
Nodule 12.63
Rhizoplane 5.59
Rhizosphere 66.13
Stem 0
Stem Tuber 0
Unclassified 6.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214753561 2209111006 Bacteria 3189
2 ARcpr5oldR_c000103 3300000041 Bacteria 15394
3 ARSoilYngRDRAFT_c00128 3300000042 Bacteria 12742
4 ARcpr5yngRDRAFT_c000134 3300000043 Bacteria 11675
5 ARSoilOldRDRAFT_c000140 3300000044 Bacteria 12748
6 ARCol0oldRDRAFT_c00073 3300000045 Bacteria 8253
7 CNAas_1003176 3300000532 Bacteria 1101
8 ARCol0yngRDRAFT_1000069 3300000652 Bacteria 18965
9 JGI24746J21847_1000078 3300001977 Bacteria 10426
10 JGI24739J22299_10002225 3300001989 Bacteria 7452
11 JGI24739J22299_10018815 3300001989 Bacteria 2478
12 JGI24737J22298_10001972 3300001990 Bacteria 7332
13 JGI24737J22298_10016881 3300001990 Bacteria 2355
14 JGI24750J21931_1000188 3300002070 Bacteria 10321
15 JGI24750J21931_1003227 3300002070 Bacteria 1957
16 JGI24738J21930_10000068 3300002075 Bacteria 21789
17 JGI24738J21930_10031886 3300002075 Bacteria 1075
18 JGI24744J21845_10003094 3300002077 Bacteria 3409
19 JGI24744J21845_10016399 3300002077 Bacteria 1475
20 JGI24034J26672_10000731 3300002239 Bacteria 4229
21 JGI24742J22300_10000912 3300002244 Bacteria 4514
22 JGI24742J22300_10016148 3300002244 Bacteria 1259
23 JGI24751J29686_10011026 3300002459 Bacteria 1863
24 JGI25158J39367_1013253 3300002739 Bacteria 1080
25 JGI25159J45721_1000071 3300002987 Bacteria 48764
26 JGI25159J45721_1000191 3300002987 Bacteria 28445
27 JGI25406J46586_10000093 3300003203 Bacteria 41100
28 JGI25406J46586_10004407 3300003203 Bacteria 6557
29 JGI25406J46586_10019490 3300003203 Bacteria 2763
30 JGI25153J46596_10000462 3300003215 Bacteria 25965
31 JGI25153J46596_10002078 3300003215 Bacteria 11772
32 JGI25153J46596_10006690 3300003215 Bacteria 5794
33 JGI25153J46596_10034859 3300003215 Bacteria 1638
34 rootL2_10030665 3300003322 Bacteria 7946
35 rootH1_10102299 3300003323 Bacteria 3901
36 rootH1_10165105 3300003323 Bacteria 1466
37 JGI25160J50197_1000162 3300003354 Bacteria 57595
38 JGI25160J50197_1001585 3300003354 Bacteria 11209
39 JGI25160J50197_1005731 3300003354 Bacteria 5126
40 JGI25161J50226_1008671 3300003374 Bacteria 1540
41 Ga0006562J51391_1100436 3300003578 Bacteria 1874
42 JGI25404J52841_10001394 3300003659 Bacteria 4234
43 JGI25404J52841_10001507 3300003659 Bacteria 4118
44 JGI25404J52841_10002455 3300003659 Bacteria 3508
45 Ga0055529_1001031 3300003763 Bacteria 13246
46 Ga0055526_1001457 3300003771 Bacteria 16792
47 Ga0055536_1000667 3300003781 Bacteria 23117
48 Ga0055530_10016961 3300003791 Bacteria 2297
49 Ga0055531_10019699 3300003794 Bacteria 2713
50 Ga0055531_10029098 3300003794 Bacteria 1889
51 JGI25405J52794_10024759 3300003911 Bacteria 1227
52 Ga0055543_1001124 3300004625 Bacteria 11482
53 Ga0065165_1000535 3300005262 Bacteria 57606
54 Ga0065165_1028846 3300005262 Bacteria 1785
55 Ga0065165_1039207 3300005262 Bacteria 1421
56 Ga0065704_10084877 3300005289 Bacteria 3286
57 Ga0065712_10078559 3300005290 Bacteria 3331
58 Ga0065715_10089172 3300005293 Bacteria 13154
59 Ga0065715_10217763 3300005293 Bacteria 1285
60 Ga0065707_10009110 3300005295 Bacteria 3892
61 Ga0070658_10007428 3300005327 Bacteria 8847
62 Ga0070658_10010898 3300005327 Bacteria 7287
63 Ga0070658_10508686 3300005327 Bacteria 1041
64 Ga0070676_10000363 3300005328 Bacteria 20801
65 Ga0070676_10035087 3300005328 Bacteria 2883
66 Ga0070676_10087544 3300005328 Bacteria 1901
67 Ga0070676_10096227 3300005328 Bacteria 1822
68 Ga0070676_10150864 3300005328 Bacteria 1488
69 Ga0070683_100004718 3300005329 Bacteria 11267
70 Ga0070683_100020818 3300005329 Bacteria 5843
71 Ga0070683_100041212 3300005329 Bacteria 4246
72 Ga0070683_100158844 3300005329 Bacteria 2144
73 Ga0070683_100399579 3300005329 Bacteria 1310
74 Ga0070690_100001828 3300005330 Bacteria 11279
75 Ga0070690_100059415 3300005330 Bacteria 2458
76 Ga0070690_100156029 3300005330 Bacteria 1560
77 Ga0070690_100218651 3300005330 Bacteria 1334
78 Ga0070670_100001134 3300005331 Bacteria 21148
79 Ga0070670_100022469 3300005331 Bacteria 5429
80 Ga0070670_100063259 3300005331 Bacteria 3176
81 Ga0070670_100092630 3300005331 Bacteria 2598
82 Ga0070670_100247878 3300005331 Bacteria 1551
83 Ga0070677_10000301 3300005333 Bacteria 17280
84 Ga0070677_10000815 3300005333 Bacteria 10310
85 Ga0068869_100006712 3300005334 Bacteria 7314
86 Ga0068869_100027674 3300005334 Bacteria 3955
87 Ga0068869_100050471 3300005334 Bacteria 3015
88 Ga0068869_100076062 3300005334 Bacteria 2495
89 Ga0068869_100092338 3300005334 Bacteria 2278
90 Ga0070680_100014945 3300005336 Bacteria 6076
91 Ga0070680_100033544 3300005336 Bacteria 4139
92 Ga0070680_100049830 3300005336 Bacteria 3415
93 Ga0070680_100084720 3300005336 Bacteria 2618
94 Ga0070680_100132474 3300005336 Bacteria 2086
95 Ga0070680_100187852 3300005336 Bacteria 1741
96 Ga0070680_100262689 3300005336 Bacteria 1461
97 Ga0070680_100265194 3300005336 Bacteria 1454
98 Ga0070682_100000719 3300005337 Bacteria 19838
99 Ga0070682_100001130 3300005337 Bacteria 15253
100 Ga0070682_100045105 3300005337 Bacteria 2731
101 Ga0070682_100214343 3300005337 Bacteria 1366
102 Ga0068868_100020481 3300005338 Bacteria 4971
103 Ga0068868_100030926 3300005338 Bacteria 4108
104 Ga0068868_100043397 3300005338 Bacteria 3513
105 Ga0068868_100099040 3300005338 Bacteria 2357
106 Ga0068868_100119871 3300005338 Bacteria 2145
107 Ga0068868_100196694 3300005338 Bacteria 1679
108 Ga0070660_100000730 3300005339 Bacteria 21778
109 Ga0070660_100006450 3300005339 Bacteria 8133
110 Ga0070660_100039203 3300005339 Bacteria 3600
111 Ga0070689_100000601 3300005340 Bacteria 21783
112 Ga0070689_100009743 3300005340 Bacteria 6821
113 Ga0070689_100017131 3300005340 Bacteria 5316
114 Ga0070689_100033581 3300005340 Bacteria 3910
115 Ga0070691_10001015 3300005341 Bacteria 11523
116 Ga0070691_10030268 3300005341 Bacteria 2535
117 Ga0070691_10102586 3300005341 Bacteria 1422
118 Ga0070687_100000253 3300005343 Bacteria 18199
119 Ga0070687_100035296 3300005343 Bacteria 2482
120 Ga0070687_100036301 3300005343 Bacteria 2455
121 Ga0070661_100003564 3300005344 Bacteria 10720
122 Ga0070661_100121502 3300005344 Bacteria 1957
123 Ga0070661_100165290 3300005344 Bacteria 1678
124 Ga0070661_100207526 3300005344 Bacteria 1499
125 Ga0070692_10000060 3300005345 Bacteria 21392
126 Ga0070692_10005786 3300005345 Bacteria 5315
127 Ga0070692_10023283 3300005345 Bacteria 3033
128 Ga0070668_100028340 3300005347 Bacteria 4252
129 Ga0070668_100028662 3300005347 Bacteria 4225
130 Ga0070668_100047115 3300005347 Bacteria 3313
131 Ga0070668_100059039 3300005347 Bacteria 2969
132 Ga0070668_100099635 3300005347 Bacteria 2301
133 Ga0070668_100116199 3300005347 Bacteria 2133
134 Ga0070668_100261772 3300005347 Bacteria 1438
135 Ga0070668_100426999 3300005347 Bacteria 1135
136 Ga0070669_100000888 3300005353 Bacteria 21753
137 Ga0070669_100216613 3300005353 Bacteria 1513
138 Ga0070675_100000441 3300005354 Bacteria 28206
139 Ga0070675_100021486 3300005354 Bacteria 5160
140 Ga0070675_100157865 3300005354 Bacteria 1948
141 Ga0070675_100240283 3300005354 Bacteria 1582
142 Ga0070675_100337321 3300005354 Bacteria 1335
143 Ga0070671_100001180 3300005355 Bacteria 19534
144 Ga0070671_100015695 3300005355 Bacteria 6122
145 Ga0070671_100022517 3300005355 Bacteria 5145
146 Ga0070671_100028292 3300005355 Bacteria 4615
147 Ga0070671_100051541 3300005355 Bacteria 3423
148 Ga0070671_100134323 3300005355 Bacteria 2085
149 Ga0070674_100000723 3300005356 Bacteria 16855
150 Ga0070674_100015910 3300005356 Bacteria 4707
151 Ga0070674_100049702 3300005356 Bacteria 2884
152 Ga0070674_100204294 3300005356 Bacteria 1528
153 Ga0070673_100000456 3300005364 Bacteria 21637
154 Ga0070673_100242931 3300005364 Bacteria 1566
155 Ga0070688_100000483 3300005365 Bacteria 20204
156 Ga0070688_100004948 3300005365 Bacteria 6971
157 Ga0070688_100101778 3300005365 Bacteria 1895
158 Ga0070659_100001763 3300005366 Bacteria 15553
159 Ga0070659_100020321 3300005366 Bacteria 5042
160 Ga0070659_100062767 3300005366 Bacteria 2938
161 Ga0070659_100198716 3300005366 Bacteria 1650
162 Ga0070667_100004366 3300005367 Bacteria 11932
163 Ga0070667_100036320 3300005367 Bacteria 4131
164 Ga0070667_100421547 3300005367 Bacteria 1217
165 Ga0070667_100486970 3300005367 Bacteria 1130
166 Ga0070703_10043715 3300005406 Bacteria 1406
167 Ga0070709_10005929 3300005434 Bacteria 6630
168 Ga0070709_10007969 3300005434 Bacteria 5819
169 Ga0070709_10015645 3300005434 Bacteria 4320
170 Ga0070709_10044157 3300005434 Bacteria 2759
171 Ga0070709_10086130 3300005434 Bacteria 2062
172 Ga0070709_10172488 3300005434 Bacteria 1512
173 Ga0070709_10188625 3300005434 Bacteria 1453
174 Ga0070709_10188666 3300005434 Bacteria 1452
175 Ga0070709_10398850 3300005434 Bacteria 1027
176 Ga0070714_100005537 3300005435 Bacteria 9645
177 Ga0070714_100016855 3300005435 Bacteria 5909
178 Ga0070714_100018498 3300005435 Bacteria 5661
179 Ga0070714_100024828 3300005435 Bacteria 4939
180 Ga0070714_100039972 3300005435 Bacteria 3952
181 Ga0070714_100090121 3300005435 Bacteria 2685
182 Ga0070714_100261132 3300005435 Bacteria 1604
183 Ga0070714_100601790 3300005435 Bacteria 1056
184 Ga0070713_100000924 3300005436 Bacteria 18736
185 Ga0070713_100011400 3300005436 Bacteria 6474
186 Ga0070713_100017182 3300005436 Bacteria 5464
187 Ga0070713_100027421 3300005436 Bacteria 4484
188 Ga0070713_100064294 3300005436 Bacteria 3079
189 Ga0070713_100106979 3300005436 Bacteria 2432
190 Ga0070713_100110352 3300005436 Bacteria 2398
191 Ga0070713_100133501 3300005436 Bacteria 2191
192 Ga0070713_100358843 3300005436 Bacteria 1354
193 Ga0070713_100464422 3300005436 Bacteria 1190
194 Ga0070710_10000567 3300005437 Bacteria 17537
195 Ga0070710_10002939 3300005437 Bacteria 8095
196 Ga0070710_10022918 3300005437 Bacteria 3274
197 Ga0070701_10000150 3300005438 Bacteria 21357
198 Ga0070701_10033103 3300005438 Bacteria 2580
199 Ga0070711_100000801 3300005439 Bacteria 16448
200 Ga0070711_100006726 3300005439 Bacteria 6956
201 Ga0070711_100012369 3300005439 Bacteria 5329
202 Ga0070711_100033562 3300005439 Bacteria 3418
203 Ga0070711_100053361 3300005439 Bacteria 2786
204 Ga0070711_100089660 3300005439 Bacteria 2212
205 Ga0070711_100135095 3300005439 Bacteria 1842
206 Ga0070711_100156548 3300005439 Bacteria 1723
207 Ga0070705_100004791 3300005440 Bacteria 6583
208 Ga0070705_100049326 3300005440 Bacteria 2444
209 Ga0070705_100066936 3300005440 Bacteria 2156
210 Ga0070705_100071873 3300005440 Bacteria 2094
211 Ga0070705_100133617 3300005440 Bacteria 1622
212 Ga0070700_100001083 3300005441 Bacteria 13532
213 Ga0070700_100059945 3300005441 Bacteria 2397
214 Ga0070700_100173585 3300005441 Bacteria 1494
215 Ga0070700_100175340 3300005441 Bacteria 1487
216 Ga0070694_100005807 3300005444 Bacteria 7485
217 Ga0070694_100085044 3300005444 Bacteria 2208
218 Ga0070694_100096736 3300005444 Bacteria 2081
219 Ga0070663_100001801 3300005455 Bacteria 11920
220 Ga0070663_100029202 3300005455 Bacteria 3764
221 Ga0070663_100060550 3300005455 Bacteria 2724
222 Ga0070663_100088071 3300005455 Bacteria 2295
223 Ga0070663_100108070 3300005455 Bacteria 2086
224 Ga0070663_100156568 3300005455 Bacteria 1751
225 Ga0070678_100000199 3300005456 Bacteria 26434
226 Ga0070678_100040468 3300005456 Bacteria 3298
227 Ga0070678_100113809 3300005456 Bacteria 2122
228 Ga0070678_100128246 3300005456 Bacteria 2011
229 Ga0070678_100180925 3300005456 Bacteria 1726
230 Ga0070678_100289662 3300005456 Bacteria 1387
231 Ga0070662_100075487 3300005457 Bacteria 2496
232 Ga0070662_100120316 3300005457 Bacteria 2012
233 Ga0070662_100155756 3300005457 Bacteria 1783
234 Ga0070681_10001398 3300005458 Bacteria 21148
235 Ga0070681_10023087 3300005458 Bacteria 6255
236 Ga0070681_10031901 3300005458 Bacteria 5289
237 Ga0070681_10055231 3300005458 Bacteria 3955
238 Ga0070681_10098785 3300005458 Bacteria 2865
239 Ga0070681_10333822 3300005458 Bacteria 1425
240 Ga0068867_100001623 3300005459 Bacteria 15640
241 Ga0068867_100012724 3300005459 Bacteria 5953
242 Ga0068867_100191854 3300005459 Bacteria 1631
243 Ga0068867_100331798 3300005459 Bacteria 1264
244 Ga0068867_100415048 3300005459 Bacteria 1139
245 Ga0070685_10000782 3300005466 Bacteria 17256
246 Ga0070685_10038393 3300005466 Bacteria 2715
247 Ga0070706_100353896 3300005467 Bacteria 1369
248 Ga0070707_100075543 3300005468 Bacteria 3250
249 Ga0070707_100408249 3300005468 Bacteria 1318
250 Ga0070707_100585981 3300005468 Bacteria 1078
251 Ga0070679_100012363 3300005530 Bacteria 8154
252 Ga0070679_100018692 3300005530 Bacteria 6727
253 Ga0070679_100018995 3300005530 Bacteria 6676
254 Ga0070679_100020708 3300005530 Bacteria 6417
255 Ga0070679_100027519 3300005530 Bacteria 5597
256 Ga0070679_100163344 3300005530 Bacteria 2201
257 Ga0070679_100281259 3300005530 Bacteria 1616
258 Ga0070679_100399522 3300005530 Bacteria 1320
259 Ga0070679_100453750 3300005530 Bacteria 1227
260 Ga0070684_100008219 3300005535 Bacteria 8153
261 Ga0070684_100074644 3300005535 Bacteria 2989
262 Ga0070684_100087603 3300005535 Bacteria 2765
263 Ga0070684_100150456 3300005535 Bacteria 2108
264 Ga0070697_100020681 3300005536 Bacteria 5209
265 Ga0070697_100138029 3300005536 Bacteria 2049
266 Ga0070697_100264693 3300005536 Bacteria 1473
267 Ga0068853_100001448 3300005539 Bacteria 17189
268 Ga0068853_100002281 3300005539 Bacteria 14329
269 Ga0068853_100033214 3300005539 Bacteria 4376
270 Ga0068853_100098095 3300005539 Bacteria 2587
271 Ga0068853_100384310 3300005539 Bacteria 1311
272 Ga0070672_100001622 3300005543 Bacteria 13990
273 Ga0070672_100113094 3300005543 Bacteria 2215
274 Ga0070686_100000746 3300005544 Bacteria 18847
275 Ga0070686_100004148 3300005544 Bacteria 7974
276 Ga0070686_100038298 3300005544 Bacteria 2980
277 Ga0070686_100126051 3300005544 Bacteria 1764
278 Ga0070686_100364263 3300005544 Bacteria 1090
279 Ga0070695_100000553 3300005545 Bacteria 19808
280 Ga0070695_100015098 3300005545 Bacteria 4661
281 Ga0070695_100026376 3300005545 Bacteria 3595
282 Ga0070695_100380509 3300005545 Bacteria 1065
283 Ga0070696_100037740 3300005546 Bacteria 3333
284 Ga0070693_100000613 3300005547 Bacteria 15823
285 Ga0070693_100086725 3300005547 Bacteria 1878
286 Ga0070693_100115954 3300005547 Bacteria 1655
287 Ga0070665_100047493 3300005548 Bacteria 4309
288 Ga0070665_100053248 3300005548 Bacteria 4059
289 Ga0070665_100125278 3300005548 Bacteria 2571
290 Ga0070665_100142512 3300005548 Bacteria 2400
291 Ga0070665_100204428 3300005548 Bacteria 1975
292 Ga0070665_100223553 3300005548 Bacteria 1883
293 Ga0070665_100224604 3300005548 Bacteria 1878
294 Ga0070665_100237664 3300005548 Bacteria 1822
295 Ga0070665_100385262 3300005548 Bacteria 1409
296 Ga0070665_100473756 3300005548 Bacteria 1263
297 Ga0070704_100000423 3300005549 Bacteria 19666
298 Ga0068855_100004415 3300005563 Bacteria 17183
299 Ga0068855_100012826 3300005563 Bacteria 10111
300 Ga0068855_100016222 3300005563 Bacteria 8958
301 Ga0068855_100096977 3300005563 Bacteria 3396
302 Ga0068855_100116289 3300005563 Bacteria 3065
303 Ga0070664_100001312 3300005564 Bacteria 19866
304 Ga0070664_100036391 3300005564 Bacteria 4135
305 Ga0070664_100161518 3300005564 Bacteria 1983
306 Ga0070664_100181501 3300005564 Bacteria 1871
307 Ga0070664_100371058 3300005564 Bacteria 1304
308 Ga0068857_100010463 3300005577 Bacteria 8063
309 Ga0068857_100069506 3300005577 Bacteria 3136
310 Ga0068857_100340383 3300005577 Bacteria 1388
311 Ga0068854_100000827 3300005578 Bacteria 18476
312 Ga0068854_100095374 3300005578 Bacteria 2221
313 Ga0068854_100130570 3300005578 Bacteria 1918
314 Ga0068854_100168846 3300005578 Bacteria 1701
315 Ga0068854_100299927 3300005578 Bacteria 1299
316 Ga0068856_100000020 3300005614 Bacteria 146775
317 Ga0068856_100001340 3300005614 Bacteria 25903
318 Ga0068856_100061730 3300005614 Bacteria 3703
319 Ga0068856_100143713 3300005614 Bacteria 2394
320 Ga0068856_100194243 3300005614 Bacteria 2043
321 Ga0068856_100321872 3300005614 Bacteria 1563
322 Ga0068856_100380383 3300005614 Bacteria 1431
323 Ga0068856_100388311 3300005614 Bacteria 1415
324 Ga0070702_100000293 3300005615 Bacteria 17107
325 Ga0070702_100153280 3300005615 Bacteria 1482
326 Ga0068852_100013291 3300005616 Bacteria 6297
327 Ga0068852_100036557 3300005616 Bacteria 4111
328 Ga0068852_100048195 3300005616 Bacteria 3639
329 Ga0068852_100048450 3300005616 Bacteria 3631
330 Ga0068852_100052414 3300005616 Bacteria 3506
331 Ga0068852_100082644 3300005616 Bacteria 2854
332 Ga0068852_100337945 3300005616 Bacteria 1467
333 Ga0068859_100001767 3300005617 Bacteria 21986
334 Ga0068859_100112696 3300005617 Bacteria 2783
335 Ga0068859_100126726 3300005617 Bacteria 2622
336 Ga0068859_100172316 3300005617 Bacteria 2245
337 Ga0068859_100420413 3300005617 Bacteria 1433
338 Ga0068859_100824087 3300005617 Bacteria 1015
339 Ga0068864_100003544 3300005618 Bacteria 12907
340 Ga0068864_100029009 3300005618 Bacteria 4681
341 Ga0068864_100089871 3300005618 Bacteria 2707
342 Ga0068864_100191763 3300005618 Bacteria 1874
343 Ga0068864_100217763 3300005618 Bacteria 1760
344 Ga0068864_100261510 3300005618 Bacteria 1610
345 Ga0068866_10000372 3300005718 Bacteria 21128
346 Ga0068866_10191096 3300005718 Bacteria 1216
347 Ga0068861_100017595 3300005719 Bacteria 5078
348 Ga0068861_100147931 3300005719 Bacteria 1924
349 Ga0068861_100168444 3300005719 Bacteria 1813
350 Ga0068851_10095787 3300005834 Bacteria 1569
351 Ga0068851_10153168 3300005834 Bacteria 1262
352 Ga0068851_10187671 3300005834 Bacteria 1148
353 Ga0068870_10000207 3300005840 Bacteria 21125
354 Ga0068870_10012043 3300005840 Bacteria 4029
355 Ga0068870_10129127 3300005840 Bacteria 1466
356 Ga0068858_100004999 3300005842 Bacteria 12990
357 Ga0068858_100064347 3300005842 Bacteria 3394
358 Ga0068858_100086404 3300005842 Bacteria 2918
359 Ga0068858_100218511 3300005842 Bacteria 1804
360 Ga0068858_100408675 3300005842 Bacteria 1305
361 Ga0068860_100019087 3300005843 Bacteria 6656
362 Ga0068860_100053985 3300005843 Bacteria 3819
363 Ga0068860_100072707 3300005843 Bacteria 3269
364 Ga0068860_100130329 3300005843 Bacteria 2413
365 Ga0068860_100226954 3300005843 Bacteria 1814
366 Ga0068860_100379728 3300005843 Bacteria 1395
367 Ga0068862_100002236 3300005844 Bacteria 17352
368 Ga0068862_100042905 3300005844 Bacteria 3854
369 Ga0068862_100105223 3300005844 Bacteria 2473
370 Ga0068862_100451862 3300005844 Bacteria 1211
371 Ga0081455_10000627 3300005937 Bacteria 45850
372 Ga0081455_10005602 3300005937 Bacteria 13727
373 Ga0081455_10006534 3300005937 Bacteria 12482
374 Ga0081455_10012847 3300005937 Bacteria 8316
375 Ga0081455_10015462 3300005937 Bacteria 7413
376 Ga0081455_10039131 3300005937 Bacteria 4194
377 Ga0081455_10040490 3300005937 Bacteria 4108
378 Ga0081455_10046838 3300005937 Bacteria 3748
379 Ga0081455_10069190 3300005937 Bacteria 2936
380 Ga0081455_10106307 3300005937 Bacteria 2240
381 Ga0081455_10114199 3300005937 Bacteria 2140
382 Ga0081538_10004000 3300005981 Bacteria 13727
383 Ga0081538_10037684 3300005981 Bacteria 3131
384 Ga0081538_10084587 3300005981 Bacteria 1670
385 Ga0081540_1000178 3300005983 Bacteria 66386
386 Ga0081540_1000933 3300005983 Bacteria 26285
387 Ga0081540_1002057 3300005983 Bacteria 16782
388 Ga0081540_1002812 3300005983 Bacteria 14092
389 Ga0081540_1004176 3300005983 Bacteria 11116
390 Ga0081540_1006260 3300005983 Bacteria 8713
391 Ga0081540_1006330 3300005983 Bacteria 8647
392 Ga0081540_1008963 3300005983 Bacteria 6924
393 Ga0081540_1011886 3300005983 Bacteria 5779
394 Ga0081540_1019878 3300005983 Bacteria 4063
395 Ga0081540_1020629 3300005983 Bacteria 3955
396 Ga0081540_1028377 3300005983 Bacteria 3143
397 Ga0081540_1073559 3300005983 Bacteria 1570
398 Ga0081539_10000140 3300005985 Bacteria 166746
399 Ga0081539_10002801 3300005985 Bacteria 23305
400 Ga0081539_10003950 3300005985 Bacteria 17174
401 Ga0081539_10020891 3300005985 Bacteria 4399
402 Ga0070717_10000939 3300006028 Bacteria 19417
403 Ga0070717_10004566 3300006028 Bacteria 10020
404 Ga0070717_10012075 3300006028 Bacteria 6581
405 Ga0070717_10026518 3300006028 Bacteria 4622
406 Ga0070717_10117229 3300006028 Bacteria 2277
407 Ga0075365_10003342 3300006038 Bacteria 8245
408 Ga0075365_10008099 3300006038 Bacteria 5937
409 Ga0075365_10080196 3300006038 Bacteria 2210
410 Ga0075365_10095104 3300006038 Bacteria 2034
411 Ga0075365_10140945 3300006038 Bacteria 1673
412 Ga0075365_10165362 3300006038 Bacteria 1543
413 Ga0075365_10207076 3300006038 Bacteria 1375
414 Ga0075365_10242433 3300006038 Bacteria 1266
415 Ga0075365_10245809 3300006038 Bacteria 1257
416 Ga0075368_10001688 3300006042 Bacteria 7091
417 Ga0075368_10002671 3300006042 Bacteria 5866
418 Ga0075368_10003439 3300006042 Bacteria 5284
419 Ga0075368_10062768 3300006042 Bacteria 1490
420 Ga0075363_100033290 3300006048 Bacteria 2683
421 Ga0075363_100110970 3300006048 Bacteria 1524
422 Ga0075363_100125510 3300006048 Bacteria 1436
423 Ga0075363_100217517 3300006048 Bacteria 1094
424 Ga0075364_10007885 3300006051 Bacteria 6341
425 Ga0075364_10014381 3300006051 Bacteria 4889
426 Ga0075364_10017396 3300006051 Bacteria 4491
427 Ga0075364_10021153 3300006051 Bacteria 4097
428 Ga0075364_10080285 3300006051 Bacteria 2156
429 Ga0075364_10143068 3300006051 Bacteria 1609
430 Ga0070715_10004793 3300006163 Bacteria 4475
431 Ga0070715_10006442 3300006163 Bacteria 3993
432 Ga0070715_10018865 3300006163 Bacteria 2636
433 Ga0070716_100004945 3300006173 Bacteria 6414
434 Ga0070716_100075169 3300006173 Bacteria 1998
435 Ga0070716_100156597 3300006173 Bacteria 1471
436 Ga0070716_100282791 3300006173 Bacteria 1145
437 Ga0070712_100032737 3300006175 Bacteria 3512
438 Ga0070712_100097299 3300006175 Bacteria 2169
439 Ga0070712_100356218 3300006175 Bacteria 1199
440 Ga0075362_10008698 3300006177 Bacteria 3897
441 Ga0075362_10035740 3300006177 Bacteria 2170
442 Ga0075367_10010333 3300006178 Bacteria 4902
443 Ga0075367_10047833 3300006178 Bacteria 2518
444 Ga0075367_10064271 3300006178 Bacteria 2195
445 Ga0075367_10069862 3300006178 Bacteria 2109
446 Ga0075367_10080363 3300006178 Bacteria 1972
447 Ga0075367_10112628 3300006178 Bacteria 1671
448 Ga0075367_10152383 3300006178 Bacteria 1435
449 Ga0075367_10169287 3300006178 Bacteria 1360
450 Ga0075369_10002591 3300006186 Bacteria 6471
451 Ga0075369_10005033 3300006186 Bacteria 4922
452 Ga0075369_10007546 3300006186 Bacteria 4150
453 Ga0075369_10091716 3300006186 Bacteria 1356
454 Ga0075369_10095669 3300006186 Bacteria 1329
455 Ga0075366_10001372 3300006195 Bacteria 12184
456 Ga0075366_10009787 3300006195 Bacteria 5359
457 Ga0075366_10071082 3300006195 Bacteria 2073
458 Ga0097621_100002408 3300006237 Bacteria 12812
459 Ga0097621_100015591 3300006237 Bacteria 5724
460 Ga0097621_100020998 3300006237 Bacteria 5041
461 Ga0097621_100029090 3300006237 Bacteria 4361
462 Ga0097621_100079897 3300006237 Bacteria 2719
463 Ga0097621_100105935 3300006237 Bacteria 2371
464 Ga0097621_100302737 3300006237 Bacteria 1412
465 Ga0075370_10002663 3300006353 Bacteria 8347
466 Ga0075370_10042546 3300006353 Bacteria 2566
467 Ga0075370_10054598 3300006353 Bacteria 2269
468 Ga0075370_10064973 3300006353 Bacteria 2081
469 Ga0075370_10067560 3300006353 Bacteria 2041
470 Ga0068871_100002267 3300006358 Bacteria 13082
471 Ga0068871_100058331 3300006358 Bacteria 3142
472 Ga0068871_100058455 3300006358 Bacteria 3139
473 Ga0068871_100066088 3300006358 Bacteria 2963
474 Ga0068871_100067539 3300006358 Bacteria 2933
475 Ga0068871_100081739 3300006358 Bacteria 2677
476 Ga0068871_100282859 3300006358 Bacteria 1451
477 Ga0075428_100012659 3300006844 Bacteria 9381
478 Ga0075428_100032160 3300006844 Bacteria 5796
479 Ga0075428_100036724 3300006844 Bacteria 5395
480 Ga0075428_100161452 3300006844 Bacteria 2432
481 Ga0075430_100004728 3300006846 Bacteria 11452
482 Ga0075430_100007217 3300006846 Bacteria 9381
483 Ga0075430_100336624 3300006846 Bacteria 1247
484 Ga0075431_100007073 3300006847 Bacteria 11148
485 Ga0075431_100042672 3300006847 Bacteria 4679
486 Ga0075431_100080362 3300006847 Bacteria 3366
487 Ga0075431_100307894 3300006847 Bacteria 1599
488 Ga0075433_10025950 3300006852 Bacteria 4956
489 Ga0075433_10107189 3300006852 Bacteria 2477
490 Ga0075433_10236534 3300006852 Bacteria 1622
491 Ga0075434_100007264 3300006871 Bacteria 10249
492 Ga0075434_100016025 3300006871 Bacteria 7201
493 Ga0075434_100040259 3300006871 Bacteria 4628
494 Ga0075434_100059039 3300006871 Bacteria 3813
495 Ga0075434_100060094 3300006871 Bacteria 3780
496 Ga0075434_100076376 3300006871 Bacteria 3345
497 Ga0075434_100080778 3300006871 Bacteria 3249
498 Ga0075434_100470898 3300006871 Bacteria 1278
499 Ga0075434_100530469 3300006871 Bacteria 1197
500 Ga0075429_100007705 3300006880 Bacteria 9347
501 Ga0075429_100044200 3300006880 Bacteria 3875
502 Ga0068865_100000537 3300006881 Bacteria 21125
503 Ga0068865_100022614 3300006881 Bacteria 4104
504 Ga0068865_100219907 3300006881 Bacteria 1484
505 Ga0075436_100020856 3300006914 Bacteria 4495
506 Ga0075436_100106612 3300006914 Bacteria 1954
507 Ga0097620_100001767 3300006931 Bacteria 21986
508 Ga0097620_100112695 3300006931 Bacteria 2783
509 Ga0097620_100126724 3300006931 Bacteria 2622
510 Ga0097620_100172313 3300006931 Bacteria 2245
511 Ga0097620_100420403 3300006931 Bacteria 1433
512 Ga0097620_100554466 3300006931 Bacteria 1244
513 Ga0097620_100824091 3300006931 Bacteria 1015
514 Ga0099824_1011525 3300006942 Bacteria 9966
515 Ga0099824_1016950 3300006942 Bacteria 6464
516 Ga0099822_1002297 3300006943 Bacteria 23658
517 Ga0079104_1006482 3300006946 Bacteria 4418
518 Ga0079104_1006593 3300006946 Bacteria 4357
519 Ga0075435_100024058 3300007076 Bacteria 4721
520 Ga0075435_100030553 3300007076 Bacteria 4237
521 Ga0075435_100086734 3300007076 Bacteria 2578
522 Ga0075435_100102296 3300007076 Bacteria 2375
523 Ga0075435_100106562 3300007076 Bacteria 2327
524 Ga0075435_100402241 3300007076 Bacteria 1178
525 Ga0099794_10133703 3300007265 Bacteria 1254
526 Ga0099795_10076075 3300007788 Bacteria 1275
527 Ga0099795_10122381 3300007788 Bacteria 1042
528 Ga0105240_10010648 3300009093 Bacteria 12915
529 Ga0105240_10017062 3300009093 Bacteria 9804
530 Ga0105240_10091802 3300009093 Bacteria 3709
531 Ga0105240_10196633 3300009093 Bacteria 2367
532 Ga0111539_10000665 3300009094 Bacteria 44363
533 Ga0111539_10004508 3300009094 Bacteria 18213
534 Ga0111539_10008569 3300009094 Bacteria 12982
535 Ga0111539_10010943 3300009094 Bacteria 11418
536 Ga0111539_10011182 3300009094 Bacteria 11280
537 Ga0111539_10017014 3300009094 Bacteria 8999
538 Ga0111539_10085775 3300009094 Bacteria 3700
539 Ga0111539_10152809 3300009094 Bacteria 2702
540 Ga0111539_10400604 3300009094 Bacteria 1598
541 Ga0105245_10000888 3300009098 Bacteria 27206
542 Ga0105245_10016531 3300009098 Bacteria 6438
543 Ga0105245_10134656 3300009098 Bacteria 2321
544 Ga0105245_10172820 3300009098 Bacteria 2059
545 Ga0105245_10245012 3300009098 Bacteria 1739
546 Ga0105245_10339423 3300009098 Bacteria 1485
547 Ga0105245_10449832 3300009098 Bacteria 1296
548 Ga0105247_10001292 3300009101 Bacteria 18486
549 Ga0105247_10007990 3300009101 Bacteria 6464
550 Ga0105247_10096092 3300009101 Bacteria 1888
551 Ga0105247_10116923 3300009101 Bacteria 1723
552 Ga0114129_10011980 3300009147 Bacteria 12334
553 Ga0114129_10014380 3300009147 Bacteria 11281
554 Ga0114129_10023161 3300009147 Bacteria 8808
555 Ga0114129_10023548 3300009147 Bacteria 8728
556 Ga0114129_10201223 3300009147 Bacteria 2697
557 Ga0114129_10259532 3300009147 Bacteria 2330
558 Ga0114129_10538921 3300009147 Bacteria 1519
559 Ga0105243_10004807 3300009148 Bacteria 10615
560 Ga0105243_10021765 3300009148 Bacteria 4869
561 Ga0105243_10024180 3300009148 Bacteria 4633
562 Ga0105243_10164112 3300009148 Bacteria 1918
563 Ga0105241_10000662 3300009174 Bacteria 25854
564 Ga0105241_10041866 3300009174 Bacteria 3462
565 Ga0105241_10153154 3300009174 Bacteria 1888
566 Ga0105242_10001202 3300009176 Bacteria 20446
567 Ga0105242_10143341 3300009176 Bacteria 2076
568 Ga0105242_10415490 3300009176 Bacteria 1259
569 Ga0105242_10502911 3300009176 Bacteria 1153
570 Ga0105248_10002336 3300009177 Bacteria 21042
571 Ga0105248_10073744 3300009177 Bacteria 3835
572 Ga0105248_10123231 3300009177 Bacteria 2924
573 Ga0105248_10126333 3300009177 Bacteria 2885
574 Ga0105248_10173205 3300009177 Bacteria 2432
575 Ga0105248_10302045 3300009177 Bacteria 1802
576 Ga0105237_10010293 3300009545 Bacteria 9963
577 Ga0105237_10020331 3300009545 Bacteria 6847
578 Ga0105237_10045243 3300009545 Bacteria 4430
579 Ga0105237_10054038 3300009545 Bacteria 4025
580 Ga0105237_10122674 3300009545 Bacteria 2592
581 Ga0105237_10227063 3300009545 Bacteria 1867
582 Ga0105237_10299936 3300009545 Bacteria 1610
583 Ga0105238_10060439 3300009551 Bacteria 3794
584 Ga0105238_10134399 3300009551 Bacteria 2451
585 Ga0105238_10166238 3300009551 Bacteria 2182
586 Ga0105238_10369935 3300009551 Bacteria 1424
587 Ga0105238_10466702 3300009551 Bacteria 1260
588 Ga0105238_10485589 3300009551 Bacteria 1235
589 Ga0105249_10000711 3300009553 Bacteria 30203
590 Ga0105249_10001808 3300009553 Bacteria 18605
591 Ga0105249_10095560 3300009553 Bacteria 2786
592 Ga0105249_10627411 3300009553 Bacteria 1131
593 Ga0099796_10015878 3300010159 Bacteria 2212
594 Ga0105239_10018370 3300010375 Bacteria 7730
595 Ga0105239_10050388 3300010375 Bacteria 4567
596 Ga0105239_10060785 3300010375 Bacteria 4147
597 Ga0105239_10101033 3300010375 Bacteria 3190
598 Ga0105239_10126277 3300010375 Bacteria 2843
599 Ga0105239_10143258 3300010375 Bacteria 2664
600 Ga0105239_10264833 3300010375 Bacteria 1932
601 Ga0105239_10288540 3300010375 Bacteria 1848
602 Ga0105239_10356355 3300010375 Bacteria 1652
603 Ga0105239_10372853 3300010375 Bacteria 1613
604 Ga0105239_10508835 3300010375 Bacteria 1369
605 Ga0105246_10004623 3300011119 Bacteria 8378
606 Ga0105246_10053849 3300011119 Bacteria 2771
607 Ga0157316_1003925 3300012510 Bacteria 1100
608 Ga0157338_1004862 3300012515 Bacteria 1183
609 Ga0157373_10016616 3300013100 Bacteria 5365
610 Ga0157373_10169213 3300013100 Bacteria 1538
611 Ga0157371_10091223 3300013102 Bacteria 2158
612 Ga0157371_10216088 3300013102 Bacteria 1376
613 Ga0157370_10004885 3300013104 Bacteria 15203
614 Ga0157370_10004982 3300013104 Bacteria 15030
615 Ga0157370_10325767 3300013104 Bacteria 1417
616 Ga0157369_10016501 3300013105 Bacteria 8306
617 Ga0157369_10018324 3300013105 Bacteria 7851
618 Ga0157369_10051560 3300013105 Bacteria 4453
619 Ga0157369_10434397 3300013105 Bacteria 1360
620 Ga0157374_10005674 3300013296 Bacteria 10522
621 Ga0157374_10030713 3300013296 Bacteria 4881
622 Ga0157374_10112151 3300013296 Bacteria 2624
623 Ga0157374_10172666 3300013296 Bacteria 2109
624 Ga0157378_10022520 3300013297 Bacteria 5543
625 Ga0157378_10073506 3300013297 Bacteria 3074
626 Ga0157378_10143911 3300013297 Bacteria 2216
627 Ga0157378_10237215 3300013297 Bacteria 1741
628 Ga0157378_10368699 3300013297 Bacteria 1407
629 Ga0163162_10009182 3300013306 Bacteria 9623
630 Ga0163162_10015064 3300013306 Bacteria 7553
631 Ga0163162_10045343 3300013306 Bacteria 4405
632 Ga0163162_10126578 3300013306 Bacteria 2661
633 Ga0163162_10145249 3300013306 Bacteria 2488
634 Ga0163162_10268120 3300013306 Bacteria 1839
635 Ga0163162_10376905 3300013306 Bacteria 1552
636 Ga0163162_10523767 3300013306 Bacteria 1315
637 Ga0163162_10864671 3300013306 Bacteria 1019
638 Ga0157372_10005926 3300013307 Bacteria 12999
639 Ga0157372_10038501 3300013307 Bacteria 5277
640 Ga0157375_10001031 3300013308 Bacteria 24026
641 Ga0157375_10019981 3300013308 Bacteria 6108
642 Ga0157375_10043776 3300013308 Bacteria 4344
643 Ga0157375_10063970 3300013308 Bacteria 3662
644 Ga0163163_10003323 3300014325 Bacteria 13641
645 Ga0163163_10005237 3300014325 Bacteria 11186
646 Ga0163163_10005604 3300014325 Bacteria 10879
647 Ga0163163_10034596 3300014325 Bacteria 4895
648 Ga0163163_10049627 3300014325 Bacteria 4131
649 Ga0163163_10066264 3300014325 Bacteria 3586
650 Ga0163163_10091983 3300014325 Bacteria 3048
651 Ga0163163_10102773 3300014325 Bacteria 2882
652 Ga0163163_10473972 3300014325 Bacteria 1312
653 Ga0157380_10000726 3300014326 Bacteria 20528
654 Ga0157380_10244412 3300014326 Bacteria 1620
655 Ga0157377_10000324 3300014745 Bacteria 21481
656 Ga0157377_10006140 3300014745 Bacteria 5707
657 Ga0157379_10001193 3300014968 Bacteria 21154
658 Ga0157379_10013061 3300014968 Bacteria 7273
659 Ga0157379_10296922 3300014968 Bacteria 1472
660 Ga0157376_10049969 3300014969 Bacteria 3467
661 Ga0157376_10116078 3300014969 Bacteria 2364
662 Ga0163161_10001040 3300017792 Bacteria 21136
663 Ga0163161_10066765 3300017792 Bacteria 2627
664 Ga0163161_10308004 3300017792 Bacteria 1249
665 Ga0197907_10430121 3300020069 Bacteria 1372
666 Ga0206353_10475847 3300020082 Bacteria 1848
667 Ga0214544_1000002 3300021320 Bacteria 753857
668 Ga0214544_1001716 3300021320 Bacteria 46024
669 Ga0214542_1000001 3300021321 Bacteria 1018696
670 Ga0214542_1000082 3300021321 Bacteria 120825
671 Ga0214542_1029074 3300021321 Bacteria 2306
672 Ga0214545_1000001 3300021324 Bacteria 1092817
673 Ga0214543_1000001 3300021327 Bacteria 776921
674 Ga0214543_1000005 3300021327 Bacteria 454523
675 Ga0214543_1000075 3300021327 Bacteria 120861
676 Ga0213873_10004680 3300021358 Bacteria 2573
677 Ga0213874_10028898 3300021377 Bacteria 1587
678 Ga0213876_10008542 3300021384 Bacteria 5544
679 Ga0213876_10024584 3300021384 Bacteria 3180
680 Ga0213876_10031058 3300021384 Bacteria 2820
681 Ga0213876_10031688 3300021384 Bacteria 2788
682 Ga0213876_10059567 3300021384 Bacteria 2015
683 Ga0213871_10007614 3300021441 Bacteria 2352
684 Ga0224712_10000671 3300022467 Bacteria 7045
685 Ga0228711_1000045 3300022739 Bacteria 85435
686 Ga0228710_1000036 3300022740 Bacteria 91904
687 Ga0209436_101866 3300025208 Bacteria 6829
688 Ga0209677_106740 3300025253 Bacteria 2636
689 Ga0209233_1005356 3300025261 Bacteria 4263
690 Ga0207666_1000034 3300025271 Bacteria 28645
691 Ga0209455_1000841 3300025272 Bacteria 16532
692 Ga0209455_1015219 3300025272 Bacteria 1701
693 Ga0209673_1018859 3300025273 Bacteria 2494
694 Ga0209130_1000147 3300025284 Bacteria 109796
695 Ga0207673_1001005 3300025290 Bacteria 3029
696 Ga0209676_1001620 3300025292 Bacteria 19915
697 Ga0209025_1000240 3300025294 Bacteria 128397
698 Ga0209564_1001127 3300025295 Bacteria 31429
699 Ga0209564_1009452 3300025295 Bacteria 4636
700 Ga0209758_1000140 3300025297 Bacteria 174267
701 Ga0209758_1000267 3300025297 Bacteria 103340
702 Ga0209758_1001768 3300025297 Bacteria 23963
703 Ga0209758_1002072 3300025297 Bacteria 21375
704 Ga0209758_1003468 3300025297 Bacteria 14294
705 Ga0209758_1007360 3300025297 Bacteria 7527
706 Ga0209758_1042178 3300025297 Bacteria 1695
707 Ga0209050_1003004 3300025298 Bacteria 13099
708 Ga0209256_1001569 3300025299 Bacteria 22476
709 Ga0209256_1004348 3300025299 Bacteria 8979
710 Ga0207426_1000267 3300025302 Bacteria 109797
711 Ga0207426_1000855 3300025302 Bacteria 32019
712 Ga0209051_1004860 3300025303 Bacteria 8071
713 Ga0209257_1001932 3300025304 Bacteria 22369
714 Ga0209257_1002116 3300025304 Bacteria 20743
715 Ga0209257_1038868 3300025304 Bacteria 1436
716 Ga0207697_10000280 3300025315 Bacteria 28276
717 Ga0207697_10004919 3300025315 Bacteria 6298
718 Ga0207697_10017212 3300025315 Bacteria 2971
719 Ga0207697_10044361 3300025315 Bacteria 1830
720 Ga0207656_10005412 3300025321 Bacteria 4510
721 Ga0207653_10001427 3300025885 Bacteria 7746
722 Ga0207682_10000134 3300025893 Bacteria 33520
723 Ga0207682_10002016 3300025893 Bacteria 9198
724 Ga0207692_10000094 3300025898 Bacteria 26409
725 Ga0207692_10000504 3300025898 Bacteria 13779
726 Ga0207692_10002762 3300025898 Bacteria 6763
727 Ga0207692_10029647 3300025898 Bacteria 2602
728 Ga0207642_10002338 3300025899 Bacteria 5915
729 Ga0207642_10009925 3300025899 Bacteria 3333
730 Ga0207642_10059735 3300025899 Bacteria 1764
731 Ga0207642_10060606 3300025899 Bacteria 1756
732 Ga0207642_10082409 3300025899 Bacteria 1566
733 Ga0207710_10001541 3300025900 Bacteria 11350
734 Ga0207710_10014042 3300025900 Bacteria 3373
735 Ga0207710_10052142 3300025900 Bacteria 1839
736 Ga0207710_10072782 3300025900 Bacteria 1579
737 Ga0207710_10204023 3300025900 Bacteria 977
738 Ga0207688_10000498 3300025901 Bacteria 18852
739 Ga0207688_10000526 3300025901 Bacteria 18554
740 Ga0207688_10018403 3300025901 Bacteria 3801
741 Ga0207688_10024645 3300025901 Bacteria 3301
742 Ga0207688_10101938 3300025901 Bacteria 1658
743 Ga0207680_10006135 3300025903 Bacteria 5795
744 Ga0207680_10049455 3300025903 Bacteria 2502
745 Ga0207680_10276788 3300025903 Bacteria 1165
746 Ga0207647_10007263 3300025904 Bacteria 8019
747 Ga0207647_10113498 3300025904 Bacteria 1601
748 Ga0207685_10000908 3300025905 Bacteria 5639
749 Ga0207685_10003323 3300025905 Bacteria 3895
750 Ga0207699_10000508 3300025906 Bacteria 19334
751 Ga0207699_10003453 3300025906 Bacteria 7535
752 Ga0207699_10012564 3300025906 Bacteria 4310
753 Ga0207699_10067828 3300025906 Bacteria 2170
754 Ga0207699_10156368 3300025906 Bacteria 1513
755 Ga0207699_10336980 3300025906 Bacteria 1062
756 Ga0207645_10001617 3300025907 Bacteria 18370
757 Ga0207645_10007342 3300025907 Bacteria 7791
758 Ga0207645_10025421 3300025907 Bacteria 3831
759 Ga0207643_10000756 3300025908 Bacteria 19870
760 Ga0207643_10000808 3300025908 Bacteria 19021
761 Ga0207643_10025505 3300025908 Bacteria 3267
762 Ga0207684_10274023 3300025910 Bacteria 1456
763 Ga0207654_10008890 3300025911 Bacteria 5094
764 Ga0207654_10079072 3300025911 Bacteria 1974
765 Ga0207707_10001961 3300025912 Bacteria 18703
766 Ga0207707_10002112 3300025912 Bacteria 17984
767 Ga0207707_10003603 3300025912 Bacteria 13734
768 Ga0207707_10014009 3300025912 Bacteria 6991
769 Ga0207707_10039320 3300025912 Bacteria 4135
770 Ga0207707_10064296 3300025912 Bacteria 3193
771 Ga0207707_10075977 3300025912 Bacteria 2931
772 Ga0207707_10226759 3300025912 Bacteria 1626
773 Ga0207707_10259544 3300025912 Bacteria 1508
774 Ga0207707_10319158 3300025912 Bacteria 1341
775 Ga0207695_10042822 3300025913 Bacteria 4830
776 Ga0207695_10047086 3300025913 Bacteria 4566
777 Ga0207695_10077198 3300025913 Bacteria 3384
778 Ga0207695_10101877 3300025913 Bacteria 2865
779 Ga0207695_10324392 3300025913 Bacteria 1429
780 Ga0207695_10380657 3300025913 Bacteria 1297
781 Ga0207671_10198432 3300025914 Bacteria 1567
782 Ga0207671_10230838 3300025914 Bacteria 1452
783 Ga0207693_10000581 3300025915 Bacteria 32715
784 Ga0207693_10002467 3300025915 Bacteria 16076
785 Ga0207693_10003163 3300025915 Bacteria 14145
786 Ga0207693_10008856 3300025915 Bacteria 8220
787 Ga0207693_10022130 3300025915 Bacteria 5054
788 Ga0207693_10025038 3300025915 Bacteria 4734
789 Ga0207693_10074374 3300025915 Bacteria 2661
790 Ga0207693_10141462 3300025915 Bacteria 1892
791 Ga0207693_10305309 3300025915 Bacteria 1246
792 Ga0207663_10000084 3300025916 Bacteria 44454
793 Ga0207663_10000732 3300025916 Bacteria 14686
794 Ga0207663_10009234 3300025916 Bacteria 5202
795 Ga0207663_10030653 3300025916 Bacteria 3174
796 Ga0207663_10040304 3300025916 Bacteria 2838
797 Ga0207663_10081534 3300025916 Bacteria 2119
798 Ga0207663_10087968 3300025916 Bacteria 2053
799 Ga0207663_10104804 3300025916 Bacteria 1907
800 Ga0207663_10164206 3300025916 Bacteria 1571
801 Ga0207660_10001335 3300025917 Bacteria 16500
802 Ga0207660_10036684 3300025917 Bacteria 3409
803 Ga0207660_10077580 3300025917 Bacteria 2432
804 Ga0207662_10000341 3300025918 Bacteria 21083
805 Ga0207662_10007966 3300025918 Bacteria 5773
806 Ga0207662_10021026 3300025918 Bacteria 3725
807 Ga0207662_10041846 3300025918 Bacteria 2698
808 Ga0207662_10043821 3300025918 Bacteria 2640
809 Ga0207657_10002888 3300025919 Bacteria 18459
810 Ga0207657_10010043 3300025919 Bacteria 9470
811 Ga0207657_10069298 3300025919 Bacteria 2994
812 Ga0207657_10075630 3300025919 Bacteria 2842
813 Ga0207657_10092475 3300025919 Bacteria 2521
814 Ga0207657_10202318 3300025919 Bacteria 1597
815 Ga0207649_10000271 3300025920 Bacteria 40924
816 Ga0207649_10103952 3300025920 Bacteria 1885
817 Ga0207649_10151131 3300025920 Bacteria 1599
818 Ga0207652_10001830 3300025921 Bacteria 18431
819 Ga0207652_10005078 3300025921 Bacteria 10681
820 Ga0207652_10005325 3300025921 Bacteria 10432
821 Ga0207652_10009834 3300025921 Bacteria 7697
822 Ga0207652_10026846 3300025921 Bacteria 4798
823 Ga0207652_10040077 3300025921 Bacteria 3977
824 Ga0207652_10065653 3300025921 Bacteria 3143
825 Ga0207652_10186049 3300025921 Bacteria 1867
826 Ga0207652_10210434 3300025921 Bacteria 1751
827 Ga0207652_10362440 3300025921 Bacteria 1308
828 Ga0207652_10363433 3300025921 Bacteria 1306
829 Ga0207681_10000658 3300025923 Bacteria 22886
830 Ga0207681_10312241 3300025923 Bacteria 1247
831 Ga0207681_10339490 3300025923 Bacteria 1199
832 Ga0207694_10019649 3300025924 Bacteria 5110
833 Ga0207694_10089181 3300025924 Bacteria 2432
834 Ga0207694_10124725 3300025924 Bacteria 2059
835 Ga0207694_10163839 3300025924 Bacteria 1797
836 Ga0207694_10204892 3300025924 Bacteria 1605
837 Ga0207694_10268150 3300025924 Bacteria 1400
838 Ga0207650_10028994 3300025925 Bacteria 3974
839 Ga0207650_10048081 3300025925 Bacteria 3145
840 Ga0207650_10065615 3300025925 Bacteria 2721
841 Ga0207650_10069507 3300025925 Bacteria 2646
842 Ga0207659_10000177 3300025926 Bacteria 38217
843 Ga0207659_10073346 3300025926 Bacteria 2506
844 Ga0207659_10126994 3300025926 Bacteria 1963
845 Ga0207659_10359798 3300025926 Bacteria 1209
846 Ga0207687_10000495 3300025927 Bacteria 26551
847 Ga0207687_10006623 3300025927 Bacteria 7642
848 Ga0207687_10099514 3300025927 Bacteria 2137
849 Ga0207687_10213466 3300025927 Bacteria 1515
850 Ga0207687_10234310 3300025927 Bacteria 1452
851 Ga0207700_10003759 3300025928 Bacteria 8862
852 Ga0207700_10008693 3300025928 Bacteria 6308
853 Ga0207700_10032203 3300025928 Bacteria 3736
854 Ga0207700_10036446 3300025928 Bacteria 3553
855 Ga0207700_10057884 3300025928 Bacteria 2925
856 Ga0207700_10074501 3300025928 Bacteria 2626
857 Ga0207700_10089251 3300025928 Bacteria 2429
858 Ga0207700_10098190 3300025928 Bacteria 2329
859 Ga0207700_10114025 3300025928 Bacteria 2180
860 Ga0207700_10293125 3300025928 Bacteria 1403
861 Ga0207700_10353223 3300025928 Bacteria 1280
862 Ga0207700_10410988 3300025928 Bacteria 1187
863 Ga0207664_10001383 3300025929 Bacteria 15927
864 Ga0207664_10004401 3300025929 Bacteria 9540
865 Ga0207664_10018532 3300025929 Bacteria 5127
866 Ga0207664_10024409 3300025929 Bacteria 4543
867 Ga0207664_10054830 3300025929 Bacteria 3160
868 Ga0207664_10129467 3300025929 Bacteria 2123
869 Ga0207664_10356465 3300025929 Bacteria 1295
870 Ga0207644_10000279 3300025931 Bacteria 33969
871 Ga0207644_10031003 3300025931 Bacteria 3723
872 Ga0207644_10074409 3300025931 Bacteria 2493
873 Ga0207644_10087205 3300025931 Bacteria 2319
874 Ga0207644_10162032 3300025931 Bacteria 1739
875 Ga0207644_10374554 3300025931 Bacteria 1160
876 Ga0207690_10006785 3300025932 Bacteria 6789
877 Ga0207690_10008986 3300025932 Bacteria 5930
878 Ga0207706_10005939 3300025933 Bacteria 11357
879 Ga0207706_10012772 3300025933 Bacteria 7645
880 Ga0207706_10048856 3300025933 Bacteria 3741
881 Ga0207706_10067344 3300025933 Bacteria 3150
882 Ga0207686_10001383 3300025934 Bacteria 13773
883 Ga0207686_10002523 3300025934 Bacteria 9945
884 Ga0207686_10144815 3300025934 Bacteria 1647
885 Ga0207686_10388238 3300025934 Bacteria 1060
886 Ga0207709_10000952 3300025935 Bacteria 21659
887 Ga0207709_10025179 3300025935 Bacteria 3405
888 Ga0207709_10102163 3300025935 Bacteria 1898
889 Ga0207709_10105019 3300025935 Bacteria 1876
890 Ga0207670_10000491 3300025936 Bacteria 21793
891 Ga0207670_10113715 3300025936 Bacteria 1955
892 Ga0207670_10139115 3300025936 Bacteria 1788
893 Ga0207670_10294260 3300025936 Bacteria 1269
894 Ga0207669_10000649 3300025937 Bacteria 15064
895 Ga0207669_10014994 3300025937 Bacteria 3897
896 Ga0207669_10020145 3300025937 Bacteria 3490
897 Ga0207669_10053533 3300025937 Bacteria 2432
898 Ga0207669_10062571 3300025937 Bacteria 2293
899 Ga0207669_10183307 3300025937 Bacteria 1503
900 Ga0207669_10304028 3300025937 Bacteria 1213
901 Ga0207704_10149637 3300025938 Bacteria 1645
902 Ga0207704_10179274 3300025938 Bacteria 1529
903 Ga0207704_10215696 3300025938 Bacteria 1416
904 Ga0207704_10222906 3300025938 Bacteria 1397
905 Ga0207704_10282178 3300025938 Bacteria 1263
906 Ga0207665_10002422 3300025939 Bacteria 12617
907 Ga0207665_10003511 3300025939 Bacteria 10469
908 Ga0207665_10004210 3300025939 Bacteria 9576
909 Ga0207665_10039306 3300025939 Bacteria 3154
910 Ga0207665_10057351 3300025939 Bacteria 2631
911 Ga0207665_10074153 3300025939 Bacteria 2329
912 Ga0207665_10150489 3300025939 Bacteria 1666
913 Ga0207665_10155098 3300025939 Bacteria 1643
914 Ga0207691_10002815 3300025940 Bacteria 16961
915 Ga0207691_10108657 3300025940 Bacteria 2468
916 Ga0207711_10001570 3300025941 Bacteria 21117
917 Ga0207711_10022846 3300025941 Bacteria 5234
918 Ga0207711_10032424 3300025941 Bacteria 4417
919 Ga0207711_10038301 3300025941 Bacteria 4076
920 Ga0207711_10044683 3300025941 Bacteria 3782
921 Ga0207711_10174201 3300025941 Bacteria 1954
922 Ga0207689_10002449 3300025942 Bacteria 17292
923 Ga0207689_10010214 3300025942 Bacteria 8089
924 Ga0207689_10022970 3300025942 Bacteria 5238
925 Ga0207689_10101891 3300025942 Bacteria 2358
926 Ga0207689_10200764 3300025942 Bacteria 1646
927 Ga0207661_10000642 3300025944 Bacteria 22523
928 Ga0207661_10003486 3300025944 Bacteria 10927
929 Ga0207661_10158303 3300025944 Bacteria 1963
930 Ga0207679_10000046 3300025945 Bacteria 119975
931 Ga0207679_10054019 3300025945 Bacteria 2955
932 Ga0207679_10291809 3300025945 Bacteria 1402
933 Ga0207667_10007962 3300025949 Bacteria 12641
934 Ga0207667_10010221 3300025949 Bacteria 10990
935 Ga0207667_10017447 3300025949 Bacteria 8076
936 Ga0207667_10040700 3300025949 Bacteria 4948
937 Ga0207667_10066932 3300025949 Bacteria 3743
938 Ga0207667_10082391 3300025949 Bacteria 3333
939 Ga0207667_10234942 3300025949 Bacteria 1877
940 Ga0207667_10375713 3300025949 Bacteria 1448
941 Ga0207667_10434574 3300025949 Bacteria 1335
942 Ga0207667_10548729 3300025949 Bacteria 1169
943 Ga0207651_10000214 3300025960 Bacteria 24891
944 Ga0207651_10128464 3300025960 Bacteria 1935
945 Ga0207651_10211543 3300025960 Bacteria 1561
946 Ga0207651_10315307 3300025960 Bacteria 1305
947 Ga0207712_10003297 3300025961 Bacteria 10236
948 Ga0207712_10004055 3300025961 Bacteria 9249
949 Ga0207712_10134831 3300025961 Bacteria 1887
950 Ga0207712_10226556 3300025961 Bacteria 1498
951 Ga0207668_10000537 3300025972 Bacteria 23803
952 Ga0207668_10039496 3300025972 Bacteria 3177
953 Ga0207668_10044036 3300025972 Bacteria 3033
954 Ga0207668_10090905 3300025972 Bacteria 2242
955 Ga0207668_10181776 3300025972 Bacteria 1659
956 Ga0207668_10199961 3300025972 Bacteria 1590
957 Ga0207640_10000765 3300025981 Bacteria 18401
958 Ga0207640_10071437 3300025981 Bacteria 2338
959 Ga0207640_10147933 3300025981 Bacteria 1722
960 Ga0207640_10301041 3300025981 Bacteria 1268
961 Ga0207658_10001147 3300025986 Bacteria 21223
962 Ga0207658_10084764 3300025986 Bacteria 2439
963 Ga0207658_10152688 3300025986 Bacteria 1883
964 Ga0207658_10172046 3300025986 Bacteria 1785
965 Ga0207658_10195155 3300025986 Bacteria 1686
966 Ga0207658_10214465 3300025986 Bacteria 1615
967 Ga0207677_10003377 3300026023 Bacteria 8450
968 Ga0207677_10076075 3300026023 Bacteria 2388
969 Ga0207677_10187035 3300026023 Bacteria 1634
970 Ga0207677_10397030 3300026023 Bacteria 1168
971 Ga0207703_10000940 3300026035 Bacteria 28248
972 Ga0207703_10092292 3300026035 Bacteria 2548
973 Ga0207703_10300748 3300026035 Bacteria 1463
974 Ga0207703_10312268 3300026035 Bacteria 1437
975 Ga0207639_10000852 3300026041 Bacteria 20713
976 Ga0207639_10005764 3300026041 Bacteria 8386
977 Ga0207639_10008102 3300026041 Bacteria 7185
978 Ga0207639_10044998 3300026041 Bacteria 3323
979 Ga0207639_10132397 3300026041 Bacteria 2066
980 Ga0207639_10145600 3300026041 Bacteria 1979
981 Ga0207639_10253911 3300026041 Bacteria 1534
982 Ga0207639_10332978 3300026041 Bacteria 1351
983 Ga0207678_10011036 3300026067 Bacteria 7935
984 Ga0207678_10021117 3300026067 Bacteria 5706
985 Ga0207678_10021682 3300026067 Bacteria 5634
986 Ga0207678_10041626 3300026067 Bacteria 3983
987 Ga0207678_10057311 3300026067 Bacteria 3353
988 Ga0207678_10063804 3300026067 Bacteria 3166
989 Ga0207678_10079023 3300026067 Bacteria 2817
990 Ga0207678_10236964 3300026067 Bacteria 1563
991 Ga0207678_10472202 3300026067 Bacteria 1092
992 Ga0207708_10001006 3300026075 Bacteria 21086
993 Ga0207708_10005549 3300026075 Bacteria 9308
994 Ga0207708_10026576 3300026075 Bacteria 4383
995 Ga0207708_10263666 3300026075 Bacteria 1391
996 Ga0207702_10002642 3300026078 Bacteria 16821
997 Ga0207702_10116988 3300026078 Bacteria 2380
998 Ga0207702_10183275 3300026078 Bacteria 1929
999 Ga0207702_10266355 3300026078 Bacteria 1615
1000 Ga0207702_10478851 3300026078 Bacteria 1211
1001 Ga0207702_10571670 3300026078 Bacteria 1107
1002 Ga0207641_10001370 3300026088 Bacteria 24094
1003 Ga0207641_10175994 3300026088 Bacteria 1956
1004 Ga0207648_10002036 3300026089 Bacteria 22064
1005 Ga0207648_10013101 3300026089 Bacteria 7732
1006 Ga0207648_10383813 3300026089 Bacteria 1270
1007 Ga0207676_10004314 3300026095 Bacteria 10058
1008 Ga0207676_10019503 3300026095 Bacteria 4949
1009 Ga0207676_10070874 3300026095 Bacteria 2796
1010 Ga0207676_10105104 3300026095 Bacteria 2350
1011 Ga0207676_10181011 3300026095 Bacteria 1845
1012 Ga0207674_10002956 3300026116 Bacteria 21106
1013 Ga0207674_10046689 3300026116 Bacteria 4445
1014 Ga0207674_10089783 3300026116 Bacteria 3065
1015 Ga0207674_10183850 3300026116 Bacteria 2041
1016 Ga0207675_100006209 3300026118 Bacteria 11346
1017 Ga0207675_100036100 3300026118 Bacteria 4609
1018 Ga0207675_100117104 3300026118 Bacteria 2518
1019 Ga0207675_100506354 3300026118 Bacteria 1202
1020 Ga0207683_10001099 3300026121 Bacteria 24626
1021 Ga0207683_10001904 3300026121 Bacteria 18455
1022 Ga0207683_10004971 3300026121 Bacteria 11437
1023 Ga0207683_10072155 3300026121 Bacteria 3053
1024 Ga0207683_10112684 3300026121 Bacteria 2436
1025 Ga0207683_10212720 3300026121 Bacteria 1760
1026 Ga0207683_10286337 3300026121 Bacteria 1506
1027 Ga0207698_10001980 3300026142 Bacteria 12051
1028 Ga0207698_10045535 3300026142 Bacteria 3306
1029 Ga0207698_10067119 3300026142 Bacteria 2827
1030 Ga0207698_10098475 3300026142 Bacteria 2416
1031 Ga0207698_10276933 3300026142 Bacteria 1550
1032 Ga0209281_1000178 3300027111 Bacteria 148152
1033 Ga0209281_1000417 3300027111 Bacteria 64228
1034 Ga0209389_1000040 3300027296 Bacteria 124256
1035 Ga0209389_1000123 3300027296 Bacteria 70041
1036 Ga0209371_1004784 3300027312 Bacteria 5704
1037 Ga0209589_1000001 3300027357 Bacteria 794224
1038 Ga0209589_1000036 3300027357 Bacteria 131278
1039 Ga0209489_100001 3300027361 Bacteria 794224
1040 Ga0209489_100006 3300027361 Bacteria 475698
1041 Ga0209489_111662 3300027361 Bacteria 8752
1042 Ga0209700_100001 3300027363 Bacteria 794224
1043 Ga0209700_100005 3300027363 Bacteria 573969
1044 Ga0209179_1011737 3300027512 Bacteria 1559
1045 Ga0210002_1000843 3300027617 Bacteria 4185
1046 Ga0209282_1000023 3300027666 Bacteria 173309
1047 Ga0209588_1013551 3300027671 Bacteria 2487
1048 Ga0209588_1028894 3300027671 Bacteria 1766
1049 Ga0209971_1002102 3300027682 Bacteria 4846
1050 Ga0209966_1003376 3300027695 Bacteria 2683
1051 Ga0209998_10003074 3300027717 Bacteria 3696
1052 Ga0209813_10004104 3300027866 Bacteria 3456
1053 Ga0209813_10041690 3300027866 Bacteria 1400
1054 Ga0209974_10000502 3300027876 Bacteria 13050
1055 Ga0209974_10030788 3300027876 Bacteria 1777
1056 Ga0207428_10001117 3300027907 Bacteria 29185
1057 Ga0207428_10002104 3300027907 Bacteria 20069
1058 Ga0207428_10002830 3300027907 Bacteria 17218
1059 Ga0207428_10002977 3300027907 Bacteria 16750
1060 Ga0207428_10005357 3300027907 Bacteria 11969
1061 Ga0207428_10094099 3300027907 Bacteria 2324
1062 Ga0268266_10011342 3300028379 Bacteria 7751
1063 Ga0268266_10020054 3300028379 Bacteria 5698
1064 Ga0268266_10049262 3300028379 Bacteria 3612
1065 Ga0268266_10099081 3300028379 Bacteria 2565
1066 Ga0268266_10120593 3300028379 Bacteria 2333
1067 Ga0268265_10000817 3300028380 Bacteria 29538
1068 Ga0268265_10011486 3300028380 Bacteria 5987
1069 Ga0268265_10090068 3300028380 Bacteria 2449
1070 Ga0268265_10106303 3300028380 Bacteria 2279
1071 Ga0268265_10152422 3300028380 Bacteria 1951
1072 Ga0268265_10510200 3300028380 Bacteria 1134
1073 Ga0268264_10001227 3300028381 Bacteria 24655
1074 Ga0268264_10085103 3300028381 Bacteria 2713
1075 Ga0268264_10086177 3300028381 Bacteria 2698
1076 Ga0268264_10090404 3300028381 Bacteria 2638
1077 Ga0268264_10146311 3300028381 Bacteria 2113
1078 Ga0268264_10331187 3300028381 Bacteria 1443
1079 Ga0268264_10487287 3300028381 Bacteria 1200
1080 Ga0265337_1001372 3300028556 Bacteria 11994
1081 Ga0265337_1002249 3300028556 Bacteria 8967
1082 Ga0265319_1004129 3300028563 Bacteria 7301
1083 Ga0265334_10001756 3300028573 Bacteria 10354
1084 Ga0265334_10040747 3300028573 Bacteria 1818
1085 Ga0265318_10004183 3300028577 Bacteria 7049
1086 Ga0265323_10001892 3300028653 Bacteria 9875
1087 Ga0265322_10031463 3300028654 Bacteria 1514
1088 Ga0265336_10001788 3300028666 Bacteria 9401
1089 Ga0307517_10000008 3300028786 Bacteria 243202
1090 Ga0307517_10007459 3300028786 Bacteria 15925
1091 Ga0307515_10000145 3300028794 Bacteria 170814
1092 Ga0307515_10024560 3300028794 Bacteria 10497
1093 Ga0307515_10026041 3300028794 Bacteria 10090
1094 Ga0307515_10170183 3300028794 Bacteria 2176
1095 Ga0307515_10365862 3300028794 Bacteria 1081
1096 Ga0265338_10000321 3300028800 Bacteria 87046
1097 Ga0265338_10067886 3300028800 Bacteria 3076
1098 Ga0265324_10002078 3300029957 Bacteria 10605
1099 Ga0268256_1004561 3300030500 Bacteria 5704
1100 Ga0307511_10049052 3300030521 Bacteria 3424
1101 Ga0265330_10058226 3300031235 Bacteria 1685
1102 Ga0265330_10058685 3300031235 Bacteria 1677
1103 Ga0265332_10000310 3300031238 Bacteria 37390
1104 Ga0265332_10047913 3300031238 Bacteria 1839
1105 Ga0265328_10063721 3300031239 Bacteria 1354
1106 Ga0265325_10000043 3300031241 Bacteria 89158
1107 Ga0265325_10000675 3300031241 Bacteria 24875
1108 Ga0265325_10033851 3300031241 Bacteria 2723
1109 Ga0265325_10060067 3300031241 Bacteria 1932
1110 Ga0265325_10087215 3300031241 Bacteria 1543
1111 Ga0265329_10029574 3300031242 Bacteria 1789
1112 Ga0265329_10051696 3300031242 Bacteria 1308
1113 Ga0265340_10000573 3300031247 Bacteria 20425
1114 Ga0265340_10005245 3300031247 Bacteria 7193
1115 Ga0265339_10006075 3300031249 Bacteria 7972
1116 Ga0265339_10009592 3300031249 Bacteria 6066
1117 Ga0265331_10023268 3300031250 Bacteria 3149
1118 Ga0265316_10053501 3300031344 Bacteria 3163
1119 Ga0307513_10014467 3300031456 Bacteria 9627
1120 Ga0307513_10261000 3300031456 Bacteria 1522
1121 Ga0307513_10316604 3300031456 Bacteria 1320
1122 Ga0307513_10337812 3300031456 Bacteria 1258
1123 Ga0307513_10389947 3300031456 Bacteria 1130
1124 Ga0307509_10022940 3300031507 Bacteria 7019
1125 Ga0307509_10049198 3300031507 Bacteria 4521
1126 Ga0307509_10111136 3300031507 Bacteria 2743
1127 Ga0307408_100024163 3300031548 Bacteria 4147
1128 Ga0265313_10001257 3300031595 Bacteria 24112
1129 Ga0265313_10027292 3300031595 Bacteria 2990
1130 Ga0307508_10000018 3300031616 Bacteria 202701
1131 Ga0307508_10041944 3300031616 Bacteria 4107
1132 Ga0307508_10075361 3300031616 Bacteria 2951
1133 Ga0265314_10005924 3300031711 Bacteria 10935
1134 Ga0265314_10009137 3300031711 Bacteria 8412
1135 Ga0265314_10010227 3300031711 Bacteria 7848
1136 Ga0265314_10011261 3300031711 Bacteria 7398
1137 Ga0265314_10015978 3300031711 Bacteria 5944
1138 Ga0265314_10149818 3300031711 Bacteria 1432
1139 Ga0265342_10000175 3300031712 Bacteria 71083
1140 Ga0265342_10001015 3300031712 Bacteria 27629
1141 Ga0265342_10015115 3300031712 Bacteria 5091
1142 Ga0265342_10096945 3300031712 Bacteria 1684
1143 Ga0316576_10065065 3300031727 Bacteria 2679
1144 Ga0307516_10014561 3300031730 Bacteria 8313
1145 Ga0307516_10033440 3300031730 Bacteria 5173
1146 Ga0307516_10097870 3300031730 Bacteria 2753
1147 Ga0307516_10138472 3300031730 Bacteria 2206
1148 Ga0307410_10144101 3300031852 Bacteria 1766
1149 Ga0307407_10296346 3300031903 Bacteria 1126
1150 Ga0315914_1000016 3300031967 Bacteria 126814
1151 Ga0307409_100125096 3300031995 Bacteria 2185
1152 Ga0307409_100453900 3300031995 Bacteria 1238
1153 Ga0307416_100027300 3300032002 Bacteria 4225
1154 Ga0307416_100430734 3300032002 Bacteria 1366
1155 Ga0307411_10014692 3300032005 Bacteria 4367
1156 Ga0307411_10121284 3300032005 Bacteria 1892
1157 Ga0307415_100075619 3300032126 Bacteria 2384
1158 Ga0307507_10024914 3300033179 Bacteria 6503
1159 Ga0307510_10020196 3300033180 Bacteria 7791
1160 Ga0307510_10045128 3300033180 Bacteria 4763
1161 Ga0315913_1000027 3300033430 Bacteria 83484
1162 Ga0315911_1000006 3300033442 Bacteria 414563
1163 Ga0315915_1000007 3300033464 Bacteria 319225
1164 Ga0373930_0002558 3300034816 Bacteria 2823
1165 Ga0373948_0000454 3300034817 Bacteria 5101
1166 Ga0373958_0005293 3300034819 Bacteria 1954
1167 Ga0373959_0000553 3300034820 Bacteria 6642
1168 Ga0373938_0000334 3300034957 Bacteria 7467
1169 Ga0373938_0000998 3300034957 Bacteria 4548
1170 Ga0373938_0001269 3300034957 Bacteria 4055
1171 Ga0373928_0001960 3300035084 Bacteria 4011
1172 Ga0373929_0000456 3300035085 Bacteria 7768
1173 Ga0373929_0007251 3300035085 Bacteria 2022
1174 Ga0373934_0005990 3300035086 Bacteria 4500
1175 Ga0373934_0078183 3300035086 Bacteria 1327
1176 Ga0373944_0008447 3300035089 Bacteria 2782
1177 Ga0373944_0010709 3300035089 Bacteria 2504
1178 Ga0373949_0002975 3300035090 Bacteria 4167
1179 Ga0373949_0003442 3300035090 Bacteria 3767
1180 Ga0373951_0001619 3300035091 Bacteria 5914
1181 Ga0373951_0001763 3300035091 Bacteria 5630
1182 Ga0373951_0006155 3300035091 Bacteria 2754
1183 Ga0373952_0000133 3300035092 Bacteria 10703
1184 Ga0373952_0001046 3300035092 Bacteria 5047
1185 Ga0373952_0005686 3300035092 Bacteria 2284
1186 Ga0373923_0002909 3300035111 Bacteria 5379
1187 Ga0373923_0025196 3300035111 Bacteria 2355
1188 Ga0373923_0068612 3300035111 Bacteria 1518
1189 Ga0373932_0000255 3300035112 Bacteria 16212
1190 Ga0373932_0000703 3300035112 Bacteria 10116
1191 Ga0373932_0008188 3300035112 Bacteria 2497
1192 Ga0373936_0000167 3300035113 Bacteria 21970
1193 Ga0373936_0004333 3300035113 Bacteria 5364
1194 Ga0373936_0019710 3300035113 Bacteria 2615
1195 Ga0373936_0059083 3300035113 Bacteria 1562
1196 Ga0373936_0070851 3300035113 Bacteria 1437
1197 Ga0373939_0002148 3300035114 Bacteria 4683
1198 Ga0373941_0000664 3300035115 Bacteria 6968
1199 Ga0373941_0000845 3300035115 Bacteria 6311
1200 Ga0373941_0060981 3300035115 Bacteria 1227
1201 Ga0373945_0009492 3300035116 Bacteria 3189
1202 Ga0373945_0023152 3300035116 Bacteria 2144
1203 Ga0373953_0000383 3300035117 Bacteria 11974
1204 Ga0373953_0004749 3300035117 Bacteria 4357
1205 Ga0373953_0014317 3300035117 Bacteria 2850
1206 Ga0373953_0036060 3300035117 Bacteria 1946
1207 Ga0373954_0002285 3300035118 Bacteria 7983
1208 Ga0373954_0003393 3300035118 Bacteria 6745
1209 Ga0373954_0005654 3300035118 Bacteria 5418
1210 Ga0373954_0010627 3300035118 Bacteria 4065
1211 Ga0373954_0017874 3300035118 Bacteria 3188
1212 Ga0373956_0039118 3300035119 Bacteria 2101
1213 Ga0373956_0060243 3300035119 Bacteria 1718
1214 Ga0373957_0002675 3300035120 Bacteria 5115
1215 Ga0373957_0004743 3300035120 Bacteria 4162
1216 Ga0373957_0037462 3300035120 Bacteria 1812
1217 Ga0373960_0001740 3300035121 Bacteria 4876
1218 Ga0373960_0004833 3300035121 Bacteria 3102
1219 Ga0373943_0023082 3300035170 Bacteria 2890
1220 Ga0373943_0026560 3300035170 Bacteria 2713
1221 Ga0373943_0028976 3300035170 Bacteria 2613
1222 Ga0373946_0012381 3300035171 Bacteria 3192
1223 Ga0373946_0015917 3300035171 Bacteria 2859
1224 Ga0373946_0027952 3300035171 Bacteria 2234
1225 Ga0373955_0000048 3300035172 Bacteria 48012
1226 Ga0373955_0005963 3300035172 Bacteria 5521
1227 Ga0373955_0027195 3300035172 Bacteria 2954
1228 Ga0373955_0065116 3300035172 Bacteria 2022
1229 Ga0373942_0007790 3300035207 Bacteria 2490
1230 Ga0373942_0024739 3300035207 Bacteria 1542
1231 Ga0373961_0003634 3300035241 Bacteria 3787
1232 Ga0373961_0003644 3300035241 Bacteria 3782
1233 Ga0373961_0021710 3300035241 Bacteria 1710
1234 Ga0373962_0000253 3300035242 Bacteria 11386
1235 Ga0373962_0000351 3300035242 Bacteria 10123
1236 Ga0373962_0006379 3300035242 Bacteria 2858
1237 Ga0373962_0028456 3300035242 Bacteria 1516
1238 Ga0373924_0008840 3300035410 Bacteria 3674
1239 Ga0373924_0017315 3300035410 Bacteria 2763
1240 Ga0373924_0018891 3300035410 Bacteria 2664
1241 Ga0373924_0048031 3300035410 Bacteria 1762
1242 Ga0373924_0056636 3300035410 Bacteria 1633
1243 Ga0373931_0001610 3300035691 Bacteria 9775
1244 Ga0373931_0002892 3300035691 Bacteria 7657
1245 Ga0373931_0036695 3300035691 Bacteria 2556
1246 Ga0373931_0044012 3300035691 Bacteria 2353
1247 Ga0373935_0000382 3300035692 Bacteria 22745
1248 Ga0373935_0000886 3300035692 Bacteria 16159
1249 Ga0373935_0004984 3300035692 Bacteria 7813
1250 Ga0373935_0097201 3300035692 Bacteria 1936
1251 Ga0373935_0110180 3300035692 Bacteria 1826
1252 Ga0373935_0270463 3300035692 Bacteria 1194
1253 Ga0373927_0002885 3300035695 Bacteria 12521
1254 Ga0373927_0003772 3300035695 Bacteria 10756
1255 Ga0373927_0003898 3300035695 Bacteria 10583
1256 Ga0373927_0011174 3300035695 Bacteria 5979
1257 Ga0373927_0028419 3300035695 Bacteria 3647
1258 Ga0373927_0029904 3300035695 Bacteria 3553
1259 Ga0373927_0099336 3300035695 Bacteria 1892
1260 Ga0373927_0134087 3300035695 Bacteria 1618
1261 Ga0373933_0000110 3300035724 Bacteria 52519
1262 Ga0373933_0000648 3300035724 Bacteria 21697
1263 Ga0373933_0001224 3300035724 Bacteria 15196
1264 Ga0373933_0005081 3300035724 Bacteria 7174
1265 Ga0373933_0027733 3300035724 Bacteria 3264
1266 Ga0373947_0001850 3300035725 Bacteria 12909
1267 Ga0373947_0002875 3300035725 Bacteria 10288
1268 Ga0373947_0004860 3300035725 Bacteria 7855
1269 Ga0373947_0030704 3300035725 Bacteria 3159
1270 Ga0373947_0045834 3300035725 Bacteria 2617
1271 Ga0373947_0158669 3300035725 Bacteria 1461
1272 Ga0373947_0211751 3300035725 Bacteria 1271
1273 Ga0373947_0338229 3300035725 Bacteria 1008
1274 Ga0373937_0000019 3300036401 Bacteria 138568
1275 Ga0373937_0000849 3300036401 Bacteria 26229
1276 Ga0373937_0004998 3300036401 Bacteria 11284
1277 Ga0373937_0005174 3300036401 Bacteria 11127
1278 Ga0373937_0027190 3300036401 Bacteria 5171
1279 Ga0373937_0041072 3300036401 Bacteria 4219
1280 Ga0373937_0048939 3300036401 Bacteria 3870
1281 Ga0373937_0073809 3300036401 Bacteria 3148
1282 Ga0373937_0100457 3300036401 Bacteria 2685
1283 Ga0373937_0222527 3300036401 Bacteria 1777
1284 Ga0373925_0000026 3300037068 Bacteria 154713
1285 Ga0373925_0002634 3300037068 Bacteria 14243
1286 Ga0373925_0007329 3300037068 Bacteria 8054
1287 Ga0373925_0021091 3300037068 Bacteria 4746
1288 Ga0373925_0043229 3300037068 Bacteria 3343
1289 Ga0373925_0044559 3300037068 Bacteria 3294
1290 Ga0373925_0061697 3300037068 Bacteria 2816
1291 Ga0373925_0086890 3300037068 Bacteria 2386
1292 Ga0373925_0176387 3300037068 Bacteria 1689
1293 Ga0373925_0339935 3300037068 Bacteria 1217
1294 Ga0373925_0475179 3300037068 Bacteria 1025
1295 Ga0395899_0008367 3300037312 Bacteria 7963
1296 Ga0395899_0151413 3300037312 Bacteria 1644
1297 Ga0395899_0186456 3300037312 Bacteria 1454
1298 Ga0395900_0000940 3300037418 Bacteria 38072
1299 Ga0395900_0005495 3300037418 Bacteria 13263
1300 Ga0395900_0018516 3300037418 Bacteria 7103
1301 Ga0395900_0024104 3300037418 Bacteria 6229
1302 Ga0395900_0138201 3300037418 Bacteria 2496
1303 Ga0395900_0353237 3300037418 Bacteria 1443
1304 Ga0395900_0523299 3300037418 Bacteria 1133
1305 Ga0395898_0011929 3300037466 Bacteria 9001
1306 Ga0395898_0030991 3300037466 Bacteria 5348
1307 Ga0395898_0053954 3300037466 Bacteria 3924
1308 Ga0395898_0129930 3300037466 Bacteria 2413
1309 Ga0395898_0245165 3300037466 Bacteria 1709
1310 Ga0395905_0004739 3300037471 Bacteria 14053
1311 Ga0395905_0005715 3300037471 Bacteria 12643
1312 Ga0395905_0148370 3300037471 Bacteria 2206
1313 Ga0436364_0006639 3300037853 Bacteria 3443
1314 Ga0436364_0210909 3300037853 Bacteria 2103
1315 Ga0436364_1233379 3300037853 Bacteria 4376
1316 Ga0395901_0008887 3300038443 Bacteria 10173
1317 Ga0395901_0013824 3300038443 Bacteria 8211
1318 Ga0395901_0020828 3300038443 Bacteria 6713
1319 Ga0395901_0024243 3300038443 Bacteria 6225
1320 Ga0395901_0093707 3300038443 Bacteria 3145
1321 Ga0395901_0099947 3300038443 Bacteria 3042
1322 Ga0395901_0114391 3300038443 Bacteria 2834
1323 Ga0395901_0249577 3300038443 Bacteria 1849
1324 Ga0436365_1332159 3300039437 Bacteria 25414
1325 Ga0436365_1696695 3300039437 Bacteria 3426
1326 Ga0436365_1728616 3300039437 Bacteria 15819
1327 Ga0436365_1779964 3300039437 Bacteria 1836
1328 Ga0436365_1789795 3300039437 Bacteria 2234
1329 Ga0436365_1923442 3300039437 Bacteria 6320
1330 Ga0436365_1935471 3300039437 Bacteria 3687
1331 Ga0436360_0062365 3300039438 Bacteria 1331
1332 Ga0436360_0089382 3300039438 Bacteria 3285
1333 Ga0436360_0397761 3300039438 Bacteria 1501
1334 Ga0436360_0865156 3300039438 Bacteria 2755
1335 Ga0436361_0130708 3300039447 Bacteria 6055
1336 Ga0436361_0170540 3300039447 Bacteria 1917
1337 Ga0436361_0258392 3300039447 Bacteria 10669
1338 Ga0436361_0619802 3300039447 Bacteria 3210
1339 Ga0436361_0655620 3300039447 Bacteria 1933
1340 Ga0436361_0686048 3300039447 Bacteria 2741
1341 Ga0436361_0952418 3300039447 Bacteria 1660
1342 Ga0436361_1085109 3300039447 Bacteria 7859
1343 Ga0436363_0050593 3300039450 Bacteria 1512
1344 Ga0436363_0180757 3300039450 Bacteria 3214
1345 Ga0436363_1249879 3300039450 Bacteria 1462
1346 Ga0436363_1398067 3300039450 Bacteria 932
1347 Ga0436362_0706806 3300039453 Bacteria 1880
1348 Ga0451853_2997487 3300041512 Bacteria 1118
1349 Ga0439449_0029019 3300042007 Bacteria 2062
1350 Ga0439464_0015850 3300042439 Bacteria 2037
1351 Ga0466972_0001455 3300044658 Bacteria 11506
1352 Ga0466972_0102909 3300044658 Bacteria 1351
1353 Ga0466972_0164057 3300044658 Bacteria 1043
1354 Ga0453683_0153663 3300044673 Bacteria 1455
1355 Ga0466966_0062758 3300044684 Bacteria 2342
1356 Ga0466961_0097965 3300044693 Bacteria 1849
1357 Ga0466963_0051192 3300044694 Bacteria 2737
1358 Ga0466963_0058421 3300044694 Bacteria 2571
1359 Ga0453684_0099668 3300044712 Bacteria 3558
1360 Ga0453684_0168135 3300044712 Bacteria 2587
1361 Ga0453684_0663370 3300044712 Bacteria 1137
1362 Ga0466960_0244132 3300044901 Bacteria 995
1363 Ga0451576_0249067 3300045051 Bacteria 1856
1364 Ga0466958_0077809 3300045836 Bacteria 2038
1365 Ga0466967_0012742 3300045976 Bacteria 6455
1366 Ga0466967_0056649 3300045976 Bacteria 3457
1367 Ga0466967_0144164 3300045976 Bacteria 2221
1368 Ga0495617_009193 3300046452 Bacteria 3397
1369 Ga0495592_0000017 3300046454 Bacteria 142442
1370 Ga0495592_0003334 3300046454 Bacteria 11496
1371 Ga0495592_0008439 3300046454 Bacteria 7728
1372 Ga0495592_0040706 3300046454 Bacteria 3486
1373 Ga0495592_0124845 3300046454 Bacteria 1807
1374 Ga0495603_0000191 3300046455 Bacteria 32052
1375 Ga0495603_0019978 3300046455 Bacteria 4058
1376 Ga0495603_0022508 3300046455 Bacteria 3815
1377 Ga0495603_0057360 3300046455 Bacteria 2304
1378 Ga0495590_0047805 3300046457 Bacteria 1492
1379 Ga0495629_0000500 3300046459 Bacteria 32861
1380 Ga0495629_0001281 3300046459 Bacteria 19758
1381 Ga0495629_0002009 3300046459 Bacteria 15810
1382 Ga0495629_0065212 3300046459 Bacteria 2542
1383 Ga0495629_0179824 3300046459 Bacteria 1466
1384 Ga0495629_0213745 3300046459 Bacteria 1331
1385 Ga0495638_0007358 3300046460 Bacteria 7903
1386 Ga0495638_0147300 3300046460 Bacteria 1368
1387 Ga0495641_0001436 3300046461 Bacteria 20225
1388 Ga0495641_0016503 3300046461 Bacteria 3890
1389 Ga0495641_0034301 3300046461 Bacteria 2400
1390 Ga0495651_0000821 3300046462 Bacteria 24117
1391 Ga0495651_0001618 3300046462 Bacteria 17445
1392 Ga0495651_0009095 3300046462 Bacteria 7624
1393 Ga0495651_0020012 3300046462 Bacteria 5192
1394 Ga0495651_0025519 3300046462 Bacteria 4600
1395 Ga0495653_0000033 3300046463 Bacteria 131680
1396 Ga0495653_0002307 3300046463 Bacteria 15112
1397 Ga0495653_0004970 3300046463 Bacteria 10793
1398 Ga0495653_0010292 3300046463 Bacteria 7654
1399 Ga0495653_0162695 3300046463 Bacteria 1548
1400 Ga0495653_0172605 3300046463 Bacteria 1491
1401 Ga0495650_0055284 3300046471 Bacteria 1616
1402 Ga0495580_0004694 3300046472 Bacteria 11461
1403 Ga0495580_0009608 3300046472 Bacteria 7596
1404 Ga0495580_0047099 3300046472 Bacteria 3057
1405 Ga0495580_0293085 3300046472 Bacteria 1109
1406 Ga0495582_0000251 3300046473 Bacteria 29816
1407 Ga0495582_0012202 3300046473 Bacteria 4735
1408 Ga0495582_0027980 3300046473 Bacteria 3092
1409 Ga0495582_0097618 3300046473 Bacteria 1643
1410 Ga0495582_0365998 3300046473 Bacteria 830
1411 Ga0495639_0000077 3300046475 Bacteria 46394
1412 Ga0495639_0006383 3300046475 Bacteria 5069
1413 Ga0495662_0002681 3300046476 Bacteria 8989
1414 Ga0495662_0005023 3300046476 Bacteria 6628
1415 Ga0495662_0014574 3300046476 Bacteria 3822
1416 Ga0495664_0000008 3300046477 Bacteria 307158
1417 Ga0495664_0028466 3300046477 Bacteria 3263
1418 Ga0495664_0103614 3300046477 Bacteria 1715
1419 Ga0495664_0167418 3300046477 Bacteria 1333
1420 Ga0495594_0000648 3300046499 Bacteria 17955
1421 Ga0495594_0005302 3300046499 Bacteria 6621
1422 Ga0495594_0049124 3300046499 Bacteria 2318
1423 Ga0495594_0056316 3300046499 Bacteria 2169
1424 Ga0495594_0158741 3300046499 Bacteria 1285
1425 Ga0495607_0148620 3300046501 Bacteria 1201
1426 Ga0495606_0134615 3300046507 Bacteria 1465
1427 Ga0495608_0000014 3300046511 Bacteria 221042
1428 Ga0495608_0004206 3300046511 Bacteria 10314
1429 Ga0495608_0016085 3300046511 Bacteria 5176
1430 Ga0495608_0024535 3300046511 Bacteria 4121
1431 Ga0495608_0097145 3300046511 Bacteria 1902
1432 Ga0495610_0038350 3300046512 Bacteria 2433
1433 Ga0495618_0000027 3300046514 Bacteria 112522
1434 Ga0495618_0004363 3300046514 Bacteria 8701
1435 Ga0495618_0073738 3300046514 Bacteria 2173
1436 Ga0495620_0060262 3300046515 Bacteria 1583
1437 Ga0495628_0000008 3300046516 Bacteria 284313
1438 Ga0495628_0007652 3300046516 Bacteria 9339
1439 Ga0495628_0015917 3300046516 Bacteria 6275
1440 Ga0495628_0020992 3300046516 Bacteria 5380
1441 Ga0495628_0055119 3300046516 Bacteria 3132
1442 Ga0495628_0058528 3300046516 Bacteria 3027
1443 Ga0495628_0060134 3300046516 Bacteria 2982
1444 Ga0495628_0095552 3300046516 Bacteria 2296
1445 Ga0495630_0000293 3300046517 Bacteria 40084
1446 Ga0495630_0001279 3300046517 Bacteria 17334
1447 Ga0495630_0032100 3300046517 Bacteria 3911
1448 Ga0495630_0081797 3300046517 Bacteria 2437
1449 Ga0495630_0110694 3300046517 Bacteria 2080
1450 Ga0495630_0120932 3300046517 Bacteria 1986
1451 Ga0495630_0340117 3300046517 Bacteria 1148
1452 Ga0495644_0051618 3300046523 Bacteria 1544
1453 Ga0495644_0075430 3300046523 Bacteria 1270
1454 Ga0495648_0004264 3300046524 Bacteria 12265
1455 Ga0495648_0049210 3300046524 Bacteria 2586
1456 Ga0495666_0006830 3300046526 Bacteria 5730
1457 Ga0495666_0033183 3300046526 Bacteria 2523
1458 Ga0495652_0000005 3300046529 Bacteria 524368
1459 Ga0495652_0005063 3300046529 Bacteria 12476
1460 Ga0495652_0009266 3300046529 Bacteria 8947
1461 Ga0495652_0023802 3300046529 Bacteria 5426
1462 Ga0495652_0036766 3300046529 Bacteria 4254
1463 Ga0495652_0086038 3300046529 Bacteria 2582
1464 Ga0495652_0139524 3300046529 Bacteria 1908
1465 Ga0495654_0108789 3300046530 Bacteria 1267
1466 Ga0495665_0010232 3300046531 Bacteria 5079
1467 Ga0495665_0013496 3300046531 Bacteria 4415
1468 Ga0495665_0041442 3300046531 Bacteria 2451
1469 Ga0495665_0086664 3300046531 Bacteria 1646
1470 Ga0495665_0161237 3300046531 Bacteria 1169
1471 Ga0495640_0000017 3300046533 Bacteria 138688
1472 Ga0495640_0004102 3300046533 Bacteria 11651
1473 Ga0495640_0016685 3300046533 Bacteria 5491
1474 Ga0495640_0021160 3300046533 Bacteria 4778
1475 Ga0495640_0036563 3300046533 Bacteria 3469
1476 Ga0495640_0044489 3300046533 Bacteria 3086
1477 Ga0495640_0101176 3300046533 Bacteria 1891
1478 Ga0495640_0129381 3300046533 Bacteria 1635
1479 Ga0495586_0005929 3300046535 Bacteria 6541
1480 Ga0495587_0000005 3300046536 Bacteria 358412
1481 Ga0495587_0003095 3300046536 Bacteria 11115
1482 Ga0495587_0009149 3300046536 Bacteria 6354
1483 Ga0495587_0011112 3300046536 Bacteria 5711
1484 Ga0495587_0093075 3300046536 Bacteria 1740
1485 Ga0495587_0118854 3300046536 Bacteria 1514
1486 Ga0495621_0022017 3300046539 Bacteria 2108
1487 Ga0495645_0000007 3300046543 Bacteria 376299
1488 Ga0495645_0003434 3300046543 Bacteria 10742
1489 Ga0495645_0010291 3300046543 Bacteria 6556
1490 Ga0495645_0027661 3300046543 Bacteria 4120
1491 Ga0495645_0052732 3300046543 Bacteria 2958
1492 Ga0495645_0057762 3300046543 Bacteria 2815
1493 Ga0495645_0108745 3300046543 Bacteria 1963
1494 Ga0495622_0029121 3300046557 Bacteria 2580
1495 Ga0495622_0047072 3300046557 Bacteria 2004
1496 Ga0495622_0059628 3300046557 Bacteria 1767
1497 Ga0495667_0000012 3300046559 Bacteria 220967
1498 Ga0495667_0001067 3300046559 Bacteria 17817
1499 Ga0495667_0002892 3300046559 Bacteria 11514
1500 Ga0495667_0011827 3300046559 Bacteria 5912
1501 Ga0495667_0038530 3300046559 Bacteria 3182
1502 Ga0495667_0038742 3300046559 Bacteria 3173
1503 Ga0495667_0074683 3300046559 Bacteria 2207
1504 Ga0495667_0096965 3300046559 Bacteria 1909
1505 Ga0495656_0040172 3300046615 Bacteria 1948
1506 Ga0495634_0001489 3300046642 Bacteria 20720
1507 Ga0495634_0001976 3300046642 Bacteria 17475
1508 Ga0495634_0022134 3300046642 Bacteria 4481
1509 Ga0495634_0028188 3300046642 Bacteria 3900
1510 Ga0495634_0061549 3300046642 Bacteria 2495
1511 Ga0495634_0094410 3300046642 Bacteria 1938
1512 Ga0495634_0095298 3300046642 Bacteria 1928
1513 Ga0495634_0152570 3300046642 Bacteria 1460
1514 Ga0495625_0226549 3300046660 Bacteria 1222
1515 Ga0495635_0000010 3300046663 Bacteria 246385
1516 Ga0495635_0004431 3300046663 Bacteria 9729
1517 Ga0495635_0006383 3300046663 Bacteria 8216
1518 Ga0495635_0011539 3300046663 Bacteria 6192
1519 Ga0495659_0060730 3300046664 Bacteria 1395
1520 Ga0495661_0042055 3300046665 Bacteria 2820
1521 Ga0495661_0064610 3300046665 Bacteria 2159
1522 Ga0495588_0004422 3300046674 Bacteria 6213
1523 Ga0495588_0004700 3300046674 Bacteria 6032
1524 Ga0495588_0008434 3300046674 Bacteria 4729
1525 Ga0495588_0137964 3300046674 Bacteria 1288
1526 Ga0495657_0000108 3300046675 Bacteria 74508
1527 Ga0495657_0007463 3300046675 Bacteria 8451
1528 Ga0495657_0015882 3300046675 Bacteria 5497
1529 Ga0495657_0016060 3300046675 Bacteria 5461
1530 Ga0495657_0016840 3300046675 Bacteria 5315
1531 Ga0495599_0000015 3300046678 Bacteria 175055
1532 Ga0495599_0002462 3300046678 Bacteria 10788
1533 Ga0495599_0006005 3300046678 Bacteria 7306
1534 Ga0495599_0075833 3300046678 Bacteria 2100
1535 Ga0495623_0000102 3300046679 Bacteria 52100
1536 Ga0495623_0004291 3300046679 Bacteria 9385
1537 Ga0495623_0006077 3300046679 Bacteria 7851
1538 Ga0495646_0000066 3300046680 Bacteria 50048
1539 Ga0495646_0002070 3300046680 Bacteria 12167
1540 Ga0495646_0006456 3300046680 Bacteria 7438
1541 Ga0495646_0013938 3300046680 Bacteria 5108
1542 Ga0495647_0006505 3300046681 Bacteria 3874
1543 Ga0495647_0010062 3300046681 Bacteria 3216
1544 Ga0495647_0077526 3300046681 Bacteria 1342
1545 Ga0495658_0001615 3300046683 Bacteria 11744
1546 Ga0495658_0005461 3300046683 Bacteria 6249
1547 Ga0495658_0039855 3300046683 Bacteria 2609
1548 Ga0495669_0091255 3300046684 Bacteria 1407
1549 Ga0495669_0096315 3300046684 Bacteria 1371
1550 Ga0495613_0013924 3300046689 Bacteria 5968
1551 Ga0495613_0022371 3300046689 Bacteria 4711
1552 Ga0495613_0033991 3300046689 Bacteria 3787
1553 Ga0495613_0037445 3300046689 Bacteria 3596
1554 Ga0495613_0059388 3300046689 Bacteria 2804
1555 Ga0495624_0002021 3300046690 Bacteria 15445
1556 Ga0495624_0016569 3300046690 Bacteria 4960
1557 Ga0495624_0047635 3300046690 Bacteria 2724
1558 Ga0495624_0117310 3300046690 Bacteria 1635
1559 Ga0495624_0131427 3300046690 Bacteria 1535
1560 Ga0495624_0167822 3300046690 Bacteria 1339
1561 Ga0495670_0043395 3300046691 Bacteria 2244
1562 Ga0495670_0123536 3300046691 Bacteria 1346
1563 Ga0495670_0185838 3300046691 Bacteria 1098
1564 Ga0495670_0227481 3300046691 Bacteria 991
1565 Ga0495600_0000128 3300046809 Bacteria 42559
1566 Ga0495600_0001546 3300046809 Bacteria 12799
1567 Ga0495600_0004625 3300046809 Bacteria 8248
1568 Ga0495600_0012562 3300046809 Bacteria 5298
1569 Ga0495600_0037163 3300046809 Bacteria 3165
1570 Ga0495600_0174564 3300046809 Bacteria 1386
1571 Ga0495600_0206286 3300046809 Bacteria 1260
1572 Ga0495581_0000503 3300047315 Bacteria 19983
1573 Ga0495581_0038390 3300047315 Bacteria 2771
1574 Ga0495581_0043724 3300047315 Bacteria 2591
1575 Ga0495604_0000001 3300047317 Bacteria 708627
1576 Ga0495604_0000702 3300047317 Bacteria 28428
1577 Ga0495604_0003694 3300047317 Bacteria 12194
1578 Ga0495604_0009091 3300047317 Bacteria 7862
1579 Ga0495604_0011558 3300047317 Bacteria 7015
1580 Ga0495604_0043017 3300047317 Bacteria 3538
1581 Ga0495604_0074255 3300047317 Bacteria 2563
1582 Ga0495604_0397328 3300047317 Bacteria 908
1583 Ga0495636_0044727 3300047318 Bacteria 1844
1584 Ga0495674_0000012 3300047319 Bacteria 270651
1585 Ga0495674_0009848 3300047319 Bacteria 9072
1586 Ga0495674_0020453 3300047319 Bacteria 6125
1587 Ga0495674_0056755 3300047319 Bacteria 3428
1588 Ga0495674_0061451 3300047319 Bacteria 3274
1589 Ga0495674_0064670 3300047319 Bacteria 3179
1590 Ga0495674_0077210 3300047319 Bacteria 2863
1591 Ga0495674_0115449 3300047319 Bacteria 2272
1592 Ga0495672_0122665 3300047320 Bacteria 1379
1593 Ga0495676_0024072 3300047321 Bacteria 5276
1594 Ga0495676_0044830 3300047321 Bacteria 3605
1595 Ga0495676_0067865 3300047321 Bacteria 2758
1596 Ga0495676_0086955 3300047321 Bacteria 2350
1597 Ga0495676_0325275 3300047321 Bacteria 1032
1598 Ga0495680_0000409 3300047322 Bacteria 47939
1599 Ga0495680_0007750 3300047322 Bacteria 9806
1600 Ga0495680_0013445 3300047322 Bacteria 7139
1601 Ga0495680_0022767 3300047322 Bacteria 5217
1602 Ga0495680_0034583 3300047322 Bacteria 4078
1603 Ga0495680_0059751 3300047322 Bacteria 2941
1604 Ga0495680_0145363 3300047322 Bacteria 1732
1605 Ga0495680_0173749 3300047322 Bacteria 1559
1606 Ga0495680_0227130 3300047322 Bacteria 1330
1607 Ga0495683_0090589 3300047323 Bacteria 1482
1608 Ga0495687_016858 3300047443 Bacteria 3663
1609 Ga0495675_0000152 3300047444 Bacteria 48625
1610 Ga0495675_0001338 3300047444 Bacteria 14916
1611 Ga0495675_0011479 3300047444 Bacteria 5561
1612 Ga0495679_042121 3300047446 Bacteria 1410
1613 Ga0495684_0000022 3300047471 Bacteria 139507
1614 Ga0495684_0000994 3300047471 Bacteria 23076
1615 Ga0495684_0002991 3300047471 Bacteria 13304
1616 Ga0495684_0009241 3300047471 Bacteria 7612
1617 Ga0495684_0016455 3300047471 Bacteria 5695
1618 Ga0495684_0216359 3300047471 Bacteria 1407
1619 Ga0495686_0014825 3300047472 Bacteria 5354
1620 Ga0495686_0156285 3300047472 Bacteria 1335
1621 Ga0495686_0194325 3300047472 Bacteria 1168
1622 Ga0495593_0000192 3300047673 Bacteria 32140
1623 Ga0495593_0001200 3300047673 Bacteria 15172
1624 Ga0495593_0028799 3300047673 Bacteria 3049
1625 Ga0495593_0043803 3300047673 Bacteria 2396
1626 Ga0495602_0000106 3300048088 Bacteria 79677
1627 Ga0495602_0002373 3300048088 Bacteria 19095
1628 Ga0495602_0002392 3300048088 Bacteria 19051
1629 Ga0495602_0017778 3300048088 Bacteria 7118
1630 Ga0495602_0082663 3300048088 Bacteria 2694
1631 Ga0495602_0153840 3300048088 Bacteria 1804
1632 Ga0495602_0160448 3300048088 Bacteria 1756
1633 Ga0495602_0193937 3300048088 Bacteria 1555
1634 Ga0496100_0003962 3300048903 Bacteria 7781
1635 Ga0496100_0021053 3300048903 Bacteria 3921
1636 Ga0496101_0001738 3300048904 Bacteria 13045
1637 Ga0496101_0001972 3300048904 Bacteria 12437
1638 Ga0496101_0014484 3300048904 Bacteria 5301
1639 Ga0496101_0048269 3300048904 Bacteria 3059
1640 Ga0496101_0078520 3300048904 Bacteria 2435
1641 Ga0496101_0107664 3300048904 Bacteria 2094
1642 Ga0496102_0001427 3300048905 Bacteria 21201
1643 Ga0496102_0005027 3300048905 Bacteria 11199
1644 Ga0496102_0010740 3300048905 Bacteria 7887
1645 Ga0496102_0021189 3300048905 Bacteria 5747
1646 Ga0496102_0130971 3300048905 Bacteria 2347
1647 Ga0496102_0241721 3300048905 Bacteria 1702
1648 Ga0496102_0385121 3300048905 Bacteria 1319
1649 Ga0496103_0001145 3300048906 Bacteria 18320
1650 Ga0496103_0034943 3300048906 Bacteria 3075
1651 Ga0496103_0074579 3300048906 Bacteria 2127
1652 Ga0496103_0154925 3300048906 Bacteria 1468
1653 Ga0496104_0000372 3300048907 Bacteria 39686
1654 Ga0496104_0000800 3300048907 Bacteria 27054
1655 Ga0496104_0004653 3300048907 Bacteria 11941
1656 Ga0496104_0005554 3300048907 Bacteria 11045
1657 Ga0496104_0016485 3300048907 Bacteria 6713
1658 Ga0496104_0024050 3300048907 Bacteria 5605
1659 Ga0496104_0025260 3300048907 Bacteria 5476
1660 Ga0496104_0053959 3300048907 Bacteria 3798
1661 Ga0496104_0068592 3300048907 Bacteria 3369
1662 Ga0496104_0200024 3300048907 Bacteria 1910
1663 Ga0496104_0344300 3300048907 Bacteria 1403
1664 Ga0496105_0002481 3300048908 Bacteria 13361
1665 Ga0496105_0014128 3300048908 Bacteria 6353
1666 Ga0496105_0021631 3300048908 Bacteria 5205
1667 Ga0496105_0034743 3300048908 Bacteria 4147
1668 Ga0496105_0041034 3300048908 Bacteria 3814
1669 Ga0496105_0044582 3300048908 Bacteria 3658
1670 Ga0496105_0059963 3300048908 Bacteria 3139
1671 Ga0496105_0060346 3300048908 Bacteria 3129
1672 Ga0496105_0115950 3300048908 Bacteria 2209
1673 Ga0496105_0180521 3300048908 Bacteria 1729
1674 Ga0496105_0232230 3300048908 Bacteria 1499
1675 Ga0496106_0000644 3300048909 Bacteria 24997
1676 Ga0496106_0001140 3300048909 Bacteria 19677
1677 Ga0496106_0015891 3300048909 Bacteria 5568
1678 Ga0496106_0029886 3300048909 Bacteria 4062
1679 Ga0496106_0035303 3300048909 Bacteria 3738
1680 Ga0496106_0057267 3300048909 Bacteria 2947
1681 Ga0496106_0062487 3300048909 Bacteria 2828
1682 Ga0496106_0086090 3300048909 Bacteria 2420
1683 Ga0496106_0086806 3300048909 Bacteria 2410
1684 Ga0496106_0101477 3300048909 Bacteria 2232
1685 Ga0496106_0172014 3300048909 Bacteria 1717
1686 Ga0496106_0181503 3300048909 Bacteria 1671
1687 Ga0496107_0000844 3300048910 Bacteria 17921
1688 Ga0496107_0002006 3300048910 Bacteria 12986
1689 Ga0496107_0005355 3300048910 Bacteria 8778
1690 Ga0496107_0013296 3300048910 Bacteria 5751
1691 Ga0496107_0014646 3300048910 Bacteria 5491
1692 Ga0496107_0028349 3300048910 Bacteria 3978
1693 Ga0496107_0099743 3300048910 Bacteria 2128
1694 Ga0496107_0138464 3300048910 Bacteria 1799
1695 Ga0496107_0161471 3300048910 Bacteria 1661
1696 Ga0496108_0000515 3300048911 Bacteria 30277
1697 Ga0496108_0002310 3300048911 Bacteria 15266
1698 Ga0496108_0002624 3300048911 Bacteria 14402
1699 Ga0496108_0022495 3300048911 Bacteria 5184
1700 Ga0496108_0034097 3300048911 Bacteria 4229
1701 Ga0496108_0039305 3300048911 Bacteria 3944
1702 Ga0496108_0042195 3300048911 Bacteria 3808
1703 Ga0496108_0074605 3300048911 Bacteria 2864
1704 Ga0496108_0296791 3300048911 Bacteria 1407
1705 Ga0496108_0301193 3300048911 Bacteria 1396
1706 Ga0496108_0416720 3300048911 Bacteria 1173
1707 Ga0496109_0000766 3300048912 Bacteria 26715
1708 Ga0496109_0002891 3300048912 Bacteria 14365
1709 Ga0496109_0010936 3300048912 Bacteria 7775
1710 Ga0496109_0023577 3300048912 Bacteria 5464
1711 Ga0496109_0030701 3300048912 Bacteria 4817
1712 Ga0496109_0047382 3300048912 Bacteria 3908
1713 Ga0496109_0050639 3300048912 Bacteria 3782
1714 Ga0496109_0056823 3300048912 Bacteria 3571
1715 Ga0496109_0060169 3300048912 Bacteria 3470
1716 Ga0496109_0114108 3300048912 Bacteria 2513
1717 Ga0496109_0159363 3300048912 Bacteria 2114
1718 Ga0496109_0196619 3300048912 Bacteria 1895
1719 Ga0496109_0337880 3300048912 Bacteria 1422
1720 Ga0496109_0351675 3300048912 Bacteria 1392
1721 Ga0496109_0383480 3300048912 Bacteria 1328
1722 Ga0496110_0002024 3300048913 Bacteria 15093
1723 Ga0496110_0006680 3300048913 Bacteria 9168
1724 Ga0496110_0017791 3300048913 Bacteria 5948
1725 Ga0496110_0059437 3300048913 Bacteria 3369
1726 Ga0496110_0066950 3300048913 Bacteria 3177
1727 Ga0496110_0075442 3300048913 Bacteria 2996
1728 Ga0496110_0079165 3300048913 Bacteria 2925
1729 Ga0496110_0378148 3300048913 Bacteria 1290
1730 Ga0496111_0001863 3300048914 Bacteria 12453
1731 Ga0496111_0007689 3300048914 Bacteria 7089
1732 Ga0496111_0016639 3300048914 Bacteria 5071
1733 Ga0496111_0030059 3300048914 Bacteria 3862
1734 Ga0496111_0049355 3300048914 Bacteria 3034
1735 Ga0496112_0000004 3300048915 Bacteria 553294
1736 Ga0496112_0001055 3300048915 Bacteria 20328
1737 Ga0496112_0013933 3300048915 Bacteria 7438
1738 Ga0496112_0015385 3300048915 Bacteria 7138
1739 Ga0496112_0028755 3300048915 Bacteria 5369
1740 Ga0496112_0029057 3300048915 Bacteria 5344
1741 Ga0496112_0054974 3300048915 Bacteria 3912
1742 Ga0496112_0057233 3300048915 Bacteria 3838
1743 Ga0496112_0081175 3300048915 Bacteria 3206
1744 Ga0496112_0089544 3300048915 Bacteria 3045
1745 Ga0496112_0095564 3300048915 Bacteria 2942
1746 Ga0496112_0248644 3300048915 Bacteria 1730
1747 Ga0496113_0000323 3300048916 Bacteria 22774
1748 Ga0496113_0006037 3300048916 Bacteria 7631
1749 Ga0496113_0010146 3300048916 Bacteria 6216
1750 Ga0496113_0026630 3300048916 Bacteria 4136
1751 Ga0496113_0033171 3300048916 Bacteria 3757
1752 Ga0496113_0038211 3300048916 Bacteria 3529
1753 Ga0496113_0048221 3300048916 Bacteria 3169
1754 Ga0496113_0069765 3300048916 Bacteria 2670
1755 Ga0496113_0221634 3300048916 Bacteria 1507
1756 Ga0496113_0540734 3300048916 Bacteria 935
1757 Ga0496114_0009321 3300048917 Bacteria 7791
1758 Ga0496114_0014349 3300048917 Bacteria 6355
1759 Ga0496114_0037960 3300048917 Bacteria 3984
1760 Ga0496114_0042196 3300048917 Bacteria 3781
1761 Ga0496114_0051106 3300048917 Bacteria 3441
1762 Ga0496114_0139573 3300048917 Bacteria 2097
1763 Ga0496114_0149233 3300048917 Bacteria 2028
1764 Ga0496115_0010097 3300048918 Bacteria 7040
1765 Ga0496115_0010848 3300048918 Bacteria 6817
1766 Ga0496115_0011545 3300048918 Bacteria 6621
1767 Ga0496115_0020836 3300048918 Bacteria 5060
1768 Ga0496115_0036375 3300048918 Bacteria 3898
1769 Ga0496115_0037242 3300048918 Bacteria 3854
1770 Ga0496115_0087561 3300048918 Bacteria 2541
1771 Ga0496115_0096383 3300048918 Bacteria 2422
1772 Ga0496115_0102568 3300048918 Bacteria 2347
1773 Ga0496115_0203322 3300048918 Bacteria 1636
1774 Ga0496115_0367682 3300048918 Bacteria 1171
1775 Ga0496116_0001829 3300048919 Bacteria 23026
1776 Ga0496117_0012904 3300048920 Bacteria 7324
1777 Ga0496117_0032448 3300048920 Bacteria 3967
1778 Ga0496117_0032569 3300048920 Bacteria 3958
1779 Ga0496117_0140800 3300048920 Bacteria 1445
1780 Ga0496118_0003337 3300048921 Bacteria 20313
1781 Ga0496118_0020646 3300048921 Bacteria 5834
1782 Ga0496118_0186348 3300048921 Bacteria 1247
1783 Ga0496118_0234163 3300048921 Bacteria 1057
1784 Ga0496119_0026329 3300048922 Bacteria 4035
1785 Ga0496121_0000239 3300048924 Bacteria 118051
1786 Ga0496121_0000458 3300048924 Bacteria 80207
1787 Ga0496121_0000668 3300048924 Bacteria 64093
1788 Ga0496121_0016457 3300048924 Bacteria 7634
1789 Ga0496121_0038165 3300048924 Bacteria 4258
1790 Ga0496121_0046153 3300048924 Bacteria 3732
1791 Ga0496121_0053188 3300048924 Bacteria 3394
1792 Ga0496121_0056335 3300048924 Bacteria 3265
1793 Ga0496121_0065262 3300048924 Bacteria 2963
1794 Ga0496122_0022144 3300048925 Bacteria 5659
1795 Ga0496122_0032207 3300048925 Bacteria 4341
1796 Ga0496122_0069612 3300048925 Bacteria 2519
1797 Ga0496123_0084542 3300048926 Bacteria 1913
1798 Ga0496124_0018892 3300048927 Bacteria 6435
1799 Ga0496124_0038332 3300048927 Bacteria 4163
1800 Ga0496124_0071042 3300048927 Bacteria 2887
1801 Ga0496124_0079218 3300048927 Bacteria 2706
1802 Ga0496124_0284248 3300048927 Bacteria 1204
1803 Ga0496125_0000060 3300048928 Bacteria 264143
1804 Ga0496125_0001496 3300048928 Bacteria 33472
1805 Ga0496125_0008272 3300048928 Bacteria 10924
1806 Ga0496125_0034560 3300048928 Bacteria 4453
1807 Ga0496125_0107876 3300048928 Bacteria 2027
1808 Ga0496125_0117088 3300048928 Bacteria 1912
1809 Ga0496125_0117830 3300048928 Bacteria 1903
1810 Ga0496125_0129292 3300048928 Bacteria 1782
1811 Ga0496126_0003422 3300048929 Bacteria 20029
1812 Ga0496126_0004802 3300048929 Bacteria 15878
1813 Ga0496126_0014201 3300048929 Bacteria 8059
1814 Ga0496126_0015313 3300048929 Bacteria 7717
1815 Ga0496126_0015822 3300048929 Bacteria 7575
1816 Ga0496126_0022450 3300048929 Bacteria 6140
1817 Ga0496126_0046943 3300048929 Bacteria 3956
1818 Ga0496126_0064619 3300048929 Bacteria 3277
1819 Ga0496126_0147080 3300048929 Bacteria 2022
1820 Ga0496126_0157137 3300048929 Bacteria 1945
1821 Ga0496126_0185688 3300048929 Bacteria 1763
1822 Ga0495682_0039571 3300049460 Bacteria 1731
1823 Ga0501031_0001597 3300049568 Bacteria 14151
1824 Ga0501031_0033847 3300049568 Bacteria 3335
1825 Ga0501032_0000619 3300049569 Bacteria 28816
1826 Ga0501032_0002871 3300049569 Bacteria 13397
1827 Ga0501032_0005134 3300049569 Bacteria 9765
1828 Ga0501032_0011956 3300049569 Bacteria 6217
1829 Ga0501032_0065700 3300049569 Bacteria 2425
1830 Ga0501032_0326011 3300049569 Bacteria 991
1831 Ga0501033_0000108 3300049570 Bacteria 79903
1832 Ga0501033_0002505 3300049570 Bacteria 15563
1833 Ga0501033_0008940 3300049570 Bacteria 7736
1834 Ga0501033_0053507 3300049570 Bacteria 2989
1835 Ga0501034_0000100 3300049571 Bacteria 159536
1836 Ga0501034_0001160 3300049571 Bacteria 36511
1837 Ga0501034_0005371 3300049571 Bacteria 14024
1838 Ga0501034_0019951 3300049571 Bacteria 6844
1839 Ga0501034_0045623 3300049571 Bacteria 4428
1840 Ga0501034_0052759 3300049571 Bacteria 4096
1841 Ga0501034_0082306 3300049571 Bacteria 3220
1842 Ga0501034_0227469 3300049571 Bacteria 1815
1843 Ga0501034_0256361 3300049571 Bacteria 1693
1844 Ga0501036_0003243 3300049572 Bacteria 12966
1845 Ga0501036_0004308 3300049572 Bacteria 11493
1846 Ga0501036_0005602 3300049572 Bacteria 10187
1847 Ga0501036_0008108 3300049572 Bacteria 8608
1848 Ga0501036_0010290 3300049572 Bacteria 7716
1849 Ga0501036_0018536 3300049572 Bacteria 5834
1850 Ga0501036_0031300 3300049572 Bacteria 4496
1851 Ga0501037_0000153 3300049573 Bacteria 64239
1852 Ga0501037_0002178 3300049573 Bacteria 14167
1853 Ga0501037_0007559 3300049573 Bacteria 7956
1854 Ga0501037_0016410 3300049573 Bacteria 5450
1855 Ga0501037_0048469 3300049573 Bacteria 3112
1856 Ga0501037_0063903 3300049573 Bacteria 2683
1857 Ga0501037_0139621 3300049573 Bacteria 1734
1858 Ga0501038_0000138 3300049574 Bacteria 62493
1859 Ga0501038_0000575 3300049574 Bacteria 32506
1860 Ga0501038_0013935 3300049574 Bacteria 7327
1861 Ga0501038_0046125 3300049574 Bacteria 3779
1862 Ga0501038_0127279 3300049574 Bacteria 2095
1863 Ga0501038_0151532 3300049574 Bacteria 1890
1864 Ga0501038_0198440 3300049574 Bacteria 1611
1865 Ga0501038_0274435 3300049574 Bacteria 1329
1866 Ga0501038_0409868 3300049574 Bacteria 1047
1867 Ga0501039_0001334 3300049575 Bacteria 18048
1868 Ga0501039_0005778 3300049575 Bacteria 9373
1869 Ga0501039_0009687 3300049575 Bacteria 7341
1870 Ga0501039_0009695 3300049575 Bacteria 7338
1871 Ga0501039_0025267 3300049575 Bacteria 4563
1872 Ga0501039_0066627 3300049575 Bacteria 2795
1873 Ga0501040_0180904 3300049576 Bacteria 1495
1874 Ga0501042_0126384 3300049578 Bacteria 1841
1875 Ga0501042_0239800 3300049578 Bacteria 1308
1876 Ga0501043_0000085 3300049579 Bacteria 83544
1877 Ga0501043_0002821 3300049579 Bacteria 14532
1878 Ga0501043_0007305 3300049579 Bacteria 8770
1879 Ga0501043_0013532 3300049579 Bacteria 6385
1880 Ga0501043_0018418 3300049579 Bacteria 5476
1881 Ga0501043_0042607 3300049579 Bacteria 3567
1882 Ga0501043_0196420 3300049579 Bacteria 1567
1883 Ga0501043_0225196 3300049579 Bacteria 1449
1884 Ga0501046_0000267 3300049580 Bacteria 53185
1885 Ga0501046_0001536 3300049580 Bacteria 22030
1886 Ga0501046_0002308 3300049580 Bacteria 17982
1887 Ga0501046_0009020 3300049580 Bacteria 8649
1888 Ga0501046_0128499 3300049580 Bacteria 1923
1889 Ga0501047_0000221 3300049581 Bacteria 68563
1890 Ga0501047_0001508 3300049581 Bacteria 22710
1891 Ga0501047_0006890 3300049581 Bacteria 10679
1892 Ga0501047_0007706 3300049581 Bacteria 10142
1893 Ga0501047_0014013 3300049581 Bacteria 7619
1894 Ga0501047_0017518 3300049581 Bacteria 6861
1895 Ga0501047_0025811 3300049581 Bacteria 5650
1896 Ga0501047_0073014 3300049581 Bacteria 3303
1897 Ga0501048_0000151 3300049582 Bacteria 42561
1898 Ga0501048_0022170 3300049582 Bacteria 4647
1899 Ga0501048_0023873 3300049582 Bacteria 4466
1900 Ga0501048_0061726 3300049582 Bacteria 2653
1901 Ga0501067_0014096 3300049583 Bacteria 4429
1902 Ga0501067_0022104 3300049583 Bacteria 3520
1903 Ga0501067_0071797 3300049583 Bacteria 1917
1904 Ga0501068_0000689 3300049584 Bacteria 17292
1905 Ga0501068_0007123 3300049584 Bacteria 6188
1906 Ga0501068_0041994 3300049584 Bacteria 2749
1907 Ga0501068_0046133 3300049584 Bacteria 2627
1908 Ga0501069_0003185 3300049585 Bacteria 8404
1909 Ga0501069_0013747 3300049585 Bacteria 4318
1910 Ga0501069_0088781 3300049585 Bacteria 1747
1911 Ga0501070_0000601 3300049586 Bacteria 32926
1912 Ga0501070_0002192 3300049586 Bacteria 17163
1913 Ga0501070_0004589 3300049586 Bacteria 11839
1914 Ga0501070_0008817 3300049586 Bacteria 8528
1915 Ga0501070_0024927 3300049586 Bacteria 5016
1916 Ga0501070_0050511 3300049586 Bacteria 3452
1917 Ga0501070_0053406 3300049586 Bacteria 3352
1918 Ga0501071_0036317 3300049587 Bacteria 3514
1919 Ga0501071_0056607 3300049587 Bacteria 2833
1920 Ga0501072_0001591 3300049588 Bacteria 16965
1921 Ga0501072_0054662 3300049588 Bacteria 3146
1922 Ga0501072_0114754 3300049588 Bacteria 2144
1923 Ga0501073_0000290 3300049589 Bacteria 33072
1924 Ga0501073_0001103 3300049589 Bacteria 19577
1925 Ga0501073_0011467 3300049589 Bacteria 6483
1926 Ga0501073_0019444 3300049589 Bacteria 4905
1927 Ga0501073_0041083 3300049589 Bacteria 3268
1928 Ga0501074_0000094 3300049590 Bacteria 42565
1929 Ga0501074_0001626 3300049590 Bacteria 15235
1930 Ga0501074_0010639 3300049590 Bacteria 6679
1931 Ga0501074_0011115 3300049590 Bacteria 6538
1932 Ga0501074_0013976 3300049590 Bacteria 5835
1933 Ga0501074_0018336 3300049590 Bacteria 5083
1934 Ga0501074_0048367 3300049590 Bacteria 3072
1935 Ga0501075_0005436 3300049591 Bacteria 8712
1936 Ga0501076_0009771 3300049592 Bacteria 7087
1937 Ga0501076_0030224 3300049592 Bacteria 4220
1938 Ga0501076_0056597 3300049592 Bacteria 3113
1939 Ga0501076_0240406 3300049592 Bacteria 1481
1940 Ga0501077_0048243 3300049593 Bacteria 2705
1941 Ga0501077_0159883 3300049593 Bacteria 1430
1942 Ga0501079_0011578 3300049741 Bacteria 6733
1943 Ga0501079_0021362 3300049741 Bacteria 4951
1944 Ga0501079_0031572 3300049741 Bacteria 4071
1945 Ga0501079_0188704 3300049741 Bacteria 1609
1946 Ga0501080_0000104 3300049742 Bacteria 57865
1947 Ga0501080_0000130 3300049742 Bacteria 53465
1948 Ga0501080_0001592 3300049742 Bacteria 19267
1949 Ga0501080_0004806 3300049742 Bacteria 12047
1950 Ga0501080_0018278 3300049742 Bacteria 6487
1951 Ga0501080_0047654 3300049742 Bacteria 3990
1952 Ga0501080_0048231 3300049742 Bacteria 3964
1953 Ga0501080_0057864 3300049742 Bacteria 3608
1954 Ga0501080_0083130 3300049742 Bacteria 2974
1955 Ga0501080_0128611 3300049742 Bacteria 2345
1956 Ga0501081_0016051 3300049743 Bacteria 4946
1957 Ga0501081_0016540 3300049743 Bacteria 4876
1958 Ga0501081_0080512 3300049743 Bacteria 2280
1959 Ga0501081_0264680 3300049743 Bacteria 1257
1960 Ga0501081_0322235 3300049743 Bacteria 1136
1961 Ga0501083_0000087 3300049744 Bacteria 62691
1962 Ga0501083_0002779 3300049744 Bacteria 12096
1963 Ga0501083_0004063 3300049744 Bacteria 10295
1964 Ga0501083_0005997 3300049744 Bacteria 8607
1965 Ga0501083_0009036 3300049744 Bacteria 7034
1966 Ga0501083_0103991 3300049744 Bacteria 1871
1967 Ga0501083_0134073 3300049744 Bacteria 1623
1968 Ga0501035_0000016 3300049822 Bacteria 243412
1969 Ga0501035_0000127 3300049822 Bacteria 92397
1970 Ga0501035_0000223 3300049822 Bacteria 67732
1971 Ga0501035_0006474 3300049822 Bacteria 11001
1972 Ga0501035_0016134 3300049822 Bacteria 6892
1973 Ga0501035_0235751 3300049822 Bacteria 1558
1974 Ga0501035_0266080 3300049822 Bacteria 1452
1975 Ga0501044_0000369 3300049823 Bacteria 56363
1976 Ga0501044_0000636 3300049823 Bacteria 42394
1977 Ga0501044_0008397 3300049823 Bacteria 11327
1978 Ga0501044_0018664 3300049823 Bacteria 7429
1979 Ga0501044_0052219 3300049823 Bacteria 4213
1980 Ga0501044_0058326 3300049823 Bacteria 3959
1981 Ga0501044_0074528 3300049823 Bacteria 3447
1982 Ga0501044_0121984 3300049823 Bacteria 2606
1983 Ga0501044_0127991 3300049823 Bacteria 2536
1984 Ga0501044_0259159 3300049823 Bacteria 1678
1985 Ga0501044_0271852 3300049823 Bacteria 1630
1986 Ga0501044_0329185 3300049823 Bacteria 1451
1987 Ga0501045_0011049 3300049824 Bacteria 6329
1988 Ga0501045_0021131 3300049824 Bacteria 4654
1989 Ga0501045_0023111 3300049824 Bacteria 4455
1990 nmdc:mga03683_103245_c1 3300050489 Bacteria 1254
1991 nmdc:mga03683_114447_c1 3300050489 Bacteria 1195
1992 nmdc:mga03683_49264_c1 3300050489 Bacteria 1753
1993 nmdc:mga03683_6799_c1 3300050489 Bacteria 3937
1994 nmdc:mga03n38_114742_c1 3300050490 Bacteria 1317
1995 nmdc:mga03n38_31356_c1 3300050490 Bacteria 2242
1996 nmdc:mga03n38_31544_c1 3300050490 Bacteria 2237
1997 nmdc:mga03n38_35386_c1 3300050490 Bacteria 2139
1998 nmdc:mga03n38_4227_c1 3300050490 Bacteria 4723
1999 nmdc:mga03n38_42327_c1 3300050490 Bacteria 1990
2000 nmdc:mga03n38_46919_c1 3300050490 Bacteria 1909
2001 nmdc:mga03n38_59491_c1 3300050490 Bacteria 1734
2002 nmdc:mga00v17_17953_c1 3300050491 Bacteria 4014
2003 nmdc:mga00v17_250510_c1 3300050491 Bacteria 1148
2004 nmdc:mga00v17_289087_c1 3300050491 Bacteria 1064
2005 nmdc:mga00v17_45010_c1 3300050491 Bacteria 2664
2006 nmdc:mga00v17_74993_c1 3300050491 Bacteria 2103
2007 nmdc:mga0yw44_210923_c1 3300050492 Bacteria 1285
2008 nmdc:mga0yw44_24791_c1 3300050492 Bacteria 3400
2009 nmdc:mga0yw44_27462_c1 3300050492 Bacteria 3260
2010 nmdc:mga0yw44_28739_c1 3300050492 Bacteria 3203
2011 nmdc:mga0yw44_33951_c1 3300050492 Bacteria 2986
2012 nmdc:mga0yw44_4056_c1 3300050492 Bacteria 6630
2013 nmdc:mga0yw44_85308_c1 3300050492 Bacteria 1987
2014 nmdc:mga06z11_12315_c1 3300050494 Bacteria 3717
2015 nmdc:mga06z11_181561_c1 3300050494 Bacteria 1214
2016 nmdc:mga06z11_24927_c1 3300050494 Bacteria 2828
2017 nmdc:mga06z11_254071_c1 3300050494 Bacteria 1036
2018 nmdc:mga06z11_26216_c1 3300050494 Bacteria 2772
2019 nmdc:mga06z11_32554_c1 3300050494 Bacteria 2544
2020 nmdc:mga06z11_8844_c1 3300050494 Bacteria 4219
2021 nmdc:mga04h51_24534_c1 3300050495 Bacteria 1847
2022 nmdc:mga04h51_3722_c1 3300050495 Bacteria 3733
2023 nmdc:mga07m45_128147_c1 3300050496 Bacteria 1468
2024 nmdc:mga07m45_138577_c1 3300050496 Bacteria 1409
2025 nmdc:mga07m45_147027_c1 3300050496 Bacteria 1366
2026 nmdc:mga07m45_15706_c2 3300050496 Bacteria 3134
2027 nmdc:mga07m45_23167_c1 3300050496 Bacteria 3393
2028 nmdc:mga07m45_81890_c1 3300050496 Bacteria 1843
2029 nmdc:mga05p37_1028616_c1 3300050507 Bacteria 871
2030 nmdc:mga05p37_177737_c1 3300050507 Bacteria 2592
2031 nmdc:mga05p37_4809_c1 3300050507 Bacteria 15796
2032 nmdc:mga05p37_49364_c1 3300050507 Bacteria 5176
2033 nmdc:mga05p37_6528_c1 3300050507 Bacteria 10109
2034 nmdc:mga05p37_9682_c1 3300050507 Bacteria 11423
2035 nmdc:mga09592_2996_c1 3300050508 Bacteria 13695
2036 nmdc:mga09592_3717_c1 3300050508 Bacteria 12298
2037 nmdc:mga0qj67_3244_c1 3300050509 Bacteria 11709
2038 nmdc:mga0qj67_4177_c1 3300050509 Bacteria 10461
2039 nmdc:mga0qj67_62845_c1 3300050509 Bacteria 2951
2040 nmdc:mga06r32_181747_c1 3300050510 Bacteria 2089
2041 nmdc:mga06r32_47250_c1 3300050510 Bacteria 4110
2042 nmdc:mga06r32_4964_c1 3300050510 Bacteria 11991
2043 nmdc:mga06r32_5210_c1 3300050510 Bacteria 11684
2044 nmdc:mga08y16_134092_c1 3300050511 Bacteria 2574
2045 nmdc:mga08y16_149666_c1 3300050511 Bacteria 2427
2046 nmdc:mga08y16_440137_c1 3300050511 Bacteria 1330
2047 nmdc:mga08y16_4659_c1 3300050511 Bacteria 14281
2048 nmdc:mga08y16_5147_c1 3300050511 Bacteria 13664
2049 nmdc:mga08y16_6181_c1 3300050511 Bacteria 12563
2050 nmdc:mga08y16_75341_c1 3300050511 Bacteria 3518
2051 nmdc:mga08y16_84041_c1 3300050511 Bacteria 3318
2052 nmdc:mga0n895_11200_c1 3300050512 Bacteria 7987
2053 nmdc:mga0n895_13164_c1 3300050512 Bacteria 7450
2054 nmdc:mga0n895_146281_c1 3300050512 Bacteria 2393
2055 nmdc:mga0n895_1698_c1 3300050512 Bacteria 16639
2056 nmdc:mga0n895_214685_c1 3300050512 Bacteria 1954
2057 nmdc:mga0n895_226641_c1 3300050512 Bacteria 1897
2058 nmdc:mga0n895_501674_c1 3300050512 Bacteria 1222
2059 nmdc:mga0rr50_115989_c1 3300050513 Bacteria 2126
2060 nmdc:mga0rr50_120978_c1 3300050513 Bacteria 2084
2061 nmdc:mga0rr50_16958_c1 3300050513 Bacteria 4851
2062 nmdc:mga0rr50_224889_c1 3300050513 Bacteria 1551
2063 nmdc:mga0rr50_332802_c1 3300050513 Bacteria 1275
2064 nmdc:mga0rr50_478826_c1 3300050513 Bacteria 1057
2065 nmdc:mga0rr50_78012_c1 3300050513 Bacteria 2547
2066 nmdc:mga08x19_307936_c1 3300050514 Bacteria 1101
2067 nmdc:mga08x19_36649_c1 3300050514 Bacteria 3107
2068 nmdc:mga08x19_6_c1 3300050514 Bacteria 405679
2069 nmdc:mga0a205_128879_c1 3300050515 Bacteria 2430
2070 nmdc:mga0a205_186895_c1 3300050515 Bacteria 1964
2071 nmdc:mga0a205_253208_c1 3300050515 Bacteria 1640
2072 nmdc:mga0a205_302467_c1 3300050515 Bacteria 1472
2073 nmdc:mga0a205_43920_c1 3300050515 Bacteria 4307
2074 nmdc:mga0a205_5270_c1 3300050515 Bacteria 11646
2075 nmdc:mga0a205_7853_c1 3300050515 Bacteria 9691
2076 nmdc:mga0a205_85003_c1 3300050515 Bacteria 3056
2077 nmdc:mga0sz30_100242_c1 3300050516 Bacteria 1265
2078 nmdc:mga0sz30_110459_c1 3300050516 Bacteria 1205
2079 nmdc:mga0sz30_63608_c1 3300050516 Bacteria 1580
2080 nmdc:mga0sz30_69089_c1 3300050516 Bacteria 1519
2081 nmdc:mga0sz30_82870_c1 3300050516 Bacteria 1389
2082 Ga0495601_0000011 3300053077 Bacteria 264937
2083 Ga0495601_0000069 3300053077 Bacteria 56291
2084 Ga0495601_0002007 3300053077 Bacteria 11424
2085 Ga0495601_0006824 3300053077 Bacteria 6688
2086 Ga0495601_0011998 3300053077 Bacteria 5192
2087 Ga0495601_0015995 3300053077 Bacteria 4539
2088 Ga0495601_0024571 3300053077 Bacteria 3712
2089 Ga0495601_0025496 3300053077 Bacteria 3646
2090 Ga0495601_0027153 3300053077 Bacteria 3539
2091 Ga0495601_0049540 3300053077 Bacteria 2648
2092 Ga0495601_0141663 3300053077 Bacteria 1568
2093 Ga0495601_0264609 3300053077 Bacteria 1122
2094 Ga0495612_0000006 3300053078 Bacteria 269278
2095 Ga0495612_0001538 3300053078 Bacteria 9512
2096 Ga0495612_0002794 3300053078 Bacteria 7219
2097 Ga0495612_0022203 3300053078 Bacteria 2544
2098 Ga0495612_0058965 3300053078 Bacteria 1587
2099 Ga0495612_0094592 3300053078 Bacteria 1268
2100 Ga0495612_0098030 3300053078 Bacteria 1246
2101 Ga0500635_0000553 3300053080 Bacteria 9959
2102 Ga0495595_0000021 3300053084 Bacteria 115921
2103 Ga0495595_0002192 3300053084 Bacteria 7589
2104 Ga0495595_0010780 3300053084 Bacteria 3808
2105 Ga0495595_0013074 3300053084 Bacteria 3501
2106 Ga0495595_0014466 3300053084 Bacteria 3349
2107 Ga0495595_0021717 3300053084 Bacteria 2807
2108 Ga0495619_0000013 3300053085 Bacteria 264865
2109 Ga0495619_0000510 3300053085 Bacteria 25902
2110 Ga0495619_0000546 3300053085 Bacteria 24865
2111 Ga0495619_0001245 3300053085 Bacteria 16673
2112 Ga0495619_0003732 3300053085 Bacteria 9816
2113 Ga0495619_0006319 3300053085 Bacteria 7516
2114 Ga0495619_0029780 3300053085 Bacteria 3529
2115 Ga0495619_0030373 3300053085 Bacteria 3498
2116 Ga0495619_0054428 3300053085 Bacteria 2648
2117 Ga0495619_0236081 3300053085 Bacteria 1267
2118 Ga0495619_0254861 3300053085 Bacteria 1216
2119 Ga0500643_001421 3300053087 Bacteria 13818
2120 Ga0500644_0000877 3300053088 Bacteria 9814
2121 Ga0500644_0128570 3300053088 Bacteria 995
2122 Ga0500646_0037473 3300053090 Bacteria 1355
2123 Ga0500647_0042911 3300053091 Bacteria 2172
2124 Ga0500647_0099288 3300053091 Bacteria 1390
2125 Ga0500583_0010336 3300053092 Bacteria 3459
2126 Ga0500651_0001657 3300053093 Bacteria 11350
2127 Ga0500566_0000006 3300053094 Bacteria 153632
2128 Ga0500566_0006605 3300053094 Bacteria 6873
2129 Ga0500566_0010087 3300053094 Bacteria 5570
2130 Ga0500566_0059491 3300053094 Bacteria 2166
2131 Ga0500641_0002427 3300053096 Bacteria 6612
2132 Ga0500641_0011077 3300053096 Bacteria 3269
2133 Ga0500650_0000139 3300053098 Bacteria 18956
2134 Ga0500554_034066 3300053102 Bacteria 1522
2135 Ga0500556_0000002 3300053104 Bacteria 773626
2136 Ga0500562_025476 3300053108 Bacteria 1548
2137 Ga0500569_072340 3300053109 Bacteria 1087
2138 Ga0500569_086131 3300053109 Bacteria 1011
2139 Ga0500572_000205 3300053111 Bacteria 20946
2140 Ga0500591_023887 3300053115 Bacteria 2967
2141 Ga0500592_003487 3300053116 Bacteria 2511
2142 Ga0500593_001955 3300053117 Bacteria 7445
2143 Ga0500595_000003 3300053119 Bacteria 419332
2144 Ga0500595_000152 3300053119 Bacteria 45452
2145 Ga0500595_002016 3300053119 Bacteria 10397
2146 Ga0500595_002270 3300053119 Bacteria 9692
2147 Ga0500595_022201 3300053119 Bacteria 2251
2148 Ga0500595_060614 3300053119 Bacteria 1144
2149 Ga0500608_000349 3300053122 Bacteria 17817
2150 Ga0500608_147527 3300053122 Bacteria 1035
2151 Ga0500621_084533 3300053126 Bacteria 1269
2152 Ga0500642_0000016 3300053130 Bacteria 176560
2153 Ga0500642_0001946 3300053130 Bacteria 5992
2154 Ga0500642_0133023 3300053130 Bacteria 1166
2155 Ga0500652_143600 3300053131 Bacteria 992
2156 Ga0500658_0006747 3300053134 Bacteria 4246
2157 Ga0500658_0040668 3300053134 Bacteria 1862
2158 Ga0500559_0001029 3300053136 Bacteria 17100
2159 Ga0500559_0001124 3300053136 Bacteria 16108
2160 Ga0500559_0001576 3300053136 Bacteria 12756
2161 Ga0500559_0026426 3300053136 Bacteria 2472
2162 Ga0500561_0054580 3300053137 Bacteria 1101
2163 Ga0500564_126899 3300053138 Bacteria 1107
2164 Ga0500568_0000436 3300053139 Bacteria 31383
2165 Ga0500568_0001161 3300053139 Bacteria 17597
2166 Ga0500568_0008676 3300053139 Bacteria 4878
2167 Ga0500568_0031295 3300053139 Bacteria 2197
2168 Ga0500573_0018673 3300053140 Bacteria 3955
2169 Ga0500573_0162455 3300053140 Bacteria 1215
2170 Ga0500577_0004713 3300053142 Bacteria 3624
2171 Ga0500577_0022636 3300053142 Bacteria 2088
2172 Ga0500589_086646 3300053147 Bacteria 1388
2173 Ga0500590_051391 3300053148 Bacteria 2094
2174 Ga0500590_107826 3300053148 Bacteria 1327
2175 Ga0500603_000352 3300053150 Bacteria 12039
2176 Ga0500603_011115 3300053150 Bacteria 2042
2177 Ga0500604_0000600 3300053151 Bacteria 9877
2178 Ga0500616_0000002 3300053153 Bacteria 1611257
2179 Ga0500616_0000034 3300053153 Bacteria 396651
2180 Ga0500616_0000061 3300053153 Bacteria 249158
2181 Ga0500622_0000916 3300053156 Bacteria 25118
2182 Ga0500622_0005196 3300053156 Bacteria 7880
2183 Ga0500627_0027158 3300053158 Bacteria 2367
2184 Ga0500627_0041339 3300053158 Bacteria 1982
2185 Ga0500630_000954 3300053159 Bacteria 13513
2186 Ga0500634_0096280 3300053161 Bacteria 1491
2187 Ga0500638_000921 3300053162 Bacteria 8347
2188 Ga0500639_000016 3300053163 Bacteria 118099
2189 Ga0500636_0000963 3300053177 Bacteria 15483
2190 Ga0500636_0006350 3300053177 Bacteria 6783
2191 Ga0500636_0030320 3300053177 Bacteria 3197
2192 Ga0500636_0102161 3300053177 Bacteria 1629
2193 Ga0500636_0127566 3300053177 Bacteria 1420
2194 Ga0500637_0004557 3300053178 Bacteria 6592
2195 Ga0500637_0108590 3300053178 Bacteria 1609
2196 Ga0500637_0181350 3300053178 Bacteria 1206
2197 Ga0500576_094607 3300053725 Bacteria 1233
2198 Ga0500657_083349 3300053728 Bacteria 1367
2199 Ga0500645_000226 3300053730 Bacteria 42982
2200 Ga0500645_009286 3300053730 Bacteria 3310
2201 Ga0500645_028057 3300053730 Bacteria 1705
2202 Ga0500552_001721 3300053733 Bacteria 2092
2203 Ga0500596_001459 3300053735 Bacteria 4790
2204 Ga0501084_0020017 3300054114 Bacteria 5579
2205 Ga0501084_0033512 3300054114 Bacteria 4297
2206 Ga0501084_0043679 3300054114 Bacteria 3749
2207 Ga0501084_0139843 3300054114 Bacteria 2038
2208 Ga0501084_0205344 3300054114 Bacteria 1663
2209 Ga0501084_0379774 3300054114 Bacteria 1194
2210 Ga0500661_000959 3300055283 Bacteria 5395
2211 Ga0501082_0030927 3300060353 Bacteria 4615
2212 Ga0501082_0054346 3300060353 Bacteria 3452
2213 Ga0501082_0275401 3300060353 Bacteria 1465
2214 Ga0530510_0138247 3300061734 Bacteria 1794

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046473 Ga0495582_0365998 Ga0495582_0365998_14_802 225
2 3300047317 Ga0495604_0397328 Ga0495604_0397328_115_894 225
3 3300009551 Ga0105238_10466702 Ga0105238_104667022 228
4 3300039437 Ga0436365_1789795 Ga0436365_1789795_1464_2216 228
5 3300035116 Ga0373945_0023152 Ga0373945_0023152_1311_2126 235
6 3300046514 Ga0495618_0073738 Ga0495618_0073738_11_838 238
7 3300005331 Ga0070670_100247878 Ga0070670_1002478782 244
8 3300005367 Ga0070667_100421547 Ga0070667_1004215471 244
9 3300006871 Ga0075434_100076376 Ga0075434_1000763763 244
10 3300009094 Ga0111539_10085775 Ga0111539_100857752 244
11 3300009147 Ga0114129_10023548 Ga0114129_100235486 244
12 3300013306 Ga0163162_10864671 Ga0163162_108646711 244
13 3300014325 Ga0163163_10005237 Ga0163163_1000523710 244
14 3300025925 Ga0207650_10069507 Ga0207650_100695072 244
15 3300046517 Ga0495630_0032100 Ga0495630_0032100_2054_2965 244
16 3300046642 Ga0495634_0095298 Ga0495634_0095298_187_1098 244
17 3300046683 Ga0495658_0039855 Ga0495658_0039855_129_1040 244
18 3300046689 Ga0495613_0059388 Ga0495613_0059388_59_970 244
19 3300048904 Ga0496101_0048269 Ga0496101_0048269_918_1829 244
20 3300048905 Ga0496102_0130971 Ga0496102_0130971_561_1472 244
21 3300048907 Ga0496104_0344300 Ga0496104_0344300_434_1345 244
22 3300048908 Ga0496105_0021631 Ga0496105_0021631_3191_4102 244
23 3300048909 Ga0496106_0035303 Ga0496106_0035303_640_1551 244
24 3300048910 Ga0496107_0099743 Ga0496107_0099743_675_1586 244
25 3300048912 Ga0496109_0000766 Ga0496109_0000766_4394_5305 244
26 3300048913 Ga0496110_0079165 Ga0496110_0079165_1111_2022 244
27 3300048915 Ga0496112_0001055 Ga0496112_0001055_7789_8700 244
28 3300048916 Ga0496113_0000323 Ga0496113_0000323_5134_6045 244
29 3300048916 Ga0496113_0540734 Ga0496113_0540734_66_911 244
30 3300048918 Ga0496115_0020836 Ga0496115_0020836_747_1658 244
31 3300050507 nmdc:mga05p37_49364_c1 nmdc:mga05p37_49364_c1_2393_3304 244
32 3300050510 nmdc:mga06r32_47250_c1 nmdc:mga06r32_47250_c1_1559_2470 244
33 3300050511 nmdc:mga08y16_84041_c1 nmdc:mga08y16_84041_c1_869_1780 244
34 3300050512 nmdc:mga0n895_146281_c1 nmdc:mga0n895_146281_c1_617_1528 244
35 3300050515 nmdc:mga0a205_302467_c1 nmdc:mga0a205_302467_c1_413_1324 244
36 3300003763 Ga0055529_1001031 Ga0055529_10010315 245
37 3300025272 Ga0209455_1000841 Ga0209455_10008415 245
38 3300035119 Ga0373956_0039118 Ga0373956_0039118_14_859 245
39 3300050507 nmdc:mga05p37_1028616_c1 nmdc:mga05p37_1028616_c1_10_855 245
40 3300044658 Ga0466972_0164057 Ga0466972_0164057_173_1018 246
41 3300053138 Ga0500564_126899 Ga0500564_126899_16_861 246
42 3300044712 Ga0453684_0663370 Ga0453684_0663370_311_1123 248
43 3300046531 Ga0495665_0161237 Ga0495665_0161237_35_961 249
44 3300053148 Ga0500590_107826 Ga0500590_107826_182_1105 249
45 3300048918 Ga0496115_0102568 Ga0496115_0102568_14_859 250
46 3300049580 Ga0501046_0128499 Ga0501046_0128499_927_1838 250
47 3300049743 Ga0501081_0016051 Ga0501081_0016051_3636_4547 250
48 3300049824 Ga0501045_0023111 Ga0501045_0023111_2870_3781 250
49 3300054114 Ga0501084_0139843 Ga0501084_0139843_808_1719 250
50 3300005435 Ga0070714_100261132 Ga0070714_1002611322 251
51 3300025929 Ga0207664_10129467 Ga0207664_101294672 251
52 3300005563 Ga0068855_100012826 Ga0068855_1000128262 256
53 3300025949 Ga0207667_10010221 Ga0207667_100102212 256
54 3300026142 Ga0207698_10098475 Ga0207698_100984752 256
55 3300050511 nmdc:mga08y16_440137_c1 nmdc:mga08y16_440137_c1_99_983 256
56 3300035111 Ga0373923_0068612 Ga0373923_0068612_647_1489 258
57 3300037068 Ga0373925_0339935 Ga0373925_0339935_346_1188 258
58 3300009545 Ga0105237_10045243 Ga0105237_100452432 259
59 3300025914 Ga0207671_10198432 Ga0207671_101984321 259
60 3300037068 Ga0373925_0176387 Ga0373925_0176387_796_1641 259
61 3300039450 Ga0436363_1398067 Ga0436363_1398067_22_867 259
62 3300047322 Ga0495680_0145363 Ga0495680_0145363_51_896 259
63 3300048924 Ga0496121_0038165 Ga0496121_0038165_3379_4224 259
64 3300048924 Ga0496121_0065262 Ga0496121_0065262_2101_2946 259
65 3300048929 Ga0496126_0064619 Ga0496126_0064619_20_865 259
66 3300026121 Ga0207683_10212720 Ga0207683_102127202 261
67 3300031235 Ga0265330_10058685 Ga0265330_100586852 261
68 3300037853 Ga0436364_0006639 Ga0436364_0006639_662_1567 261
69 3300048917 Ga0496114_0051106 Ga0496114_0051106_362_1366 261
70 3300050490 nmdc:mga03n38_59491_c1 nmdc:mga03n38_59491_c1_114_1025 261
71 3300053078 Ga0495612_0098030 Ga0495612_0098030_54_980 261
72 3300006042 Ga0075368_10003439 Ga0075368_100034392 262
73 3300027866 Ga0209813_10004104 Ga0209813_100041043 262
74 3300048909 Ga0496106_0181503 Ga0496106_0181503_542_1465 262
75 3300050490 nmdc:mga03n38_46919_c1 nmdc:mga03n38_46919_c1_252_1175 262
76 3300050495 nmdc:mga04h51_3722_c1 nmdc:mga04h51_3722_c1_661_1584 262
77 3300046517 Ga0495630_0340117 Ga0495630_0340117_216_1127 263
78 3300005614 Ga0068856_100000020 Ga0068856_10000002072 264
79 3300006177 Ga0075362_10035740 Ga0075362_100357401 264
80 3300006195 Ga0075366_10001372 Ga0075366_100013722 264
81 3300028573 Ga0265334_10040747 Ga0265334_100407472 264
82 3300031995 Ga0307409_100453900 Ga0307409_1004539001 264
83 3300035113 Ga0373936_0070851 Ga0373936_0070851_67_978 264
84 3300049589 Ga0501073_0011467 Ga0501073_0011467_1587_2495 264
85 3300049592 Ga0501076_0056597 Ga0501076_0056597_1438_2373 264
86 3300049593 Ga0501077_0048243 Ga0501077_0048243_978_1892 264
87 3300054114 Ga0501084_0020017 Ga0501084_0020017_1882_2796 264
88 3300060353 Ga0501082_0030927 Ga0501082_0030927_1010_1924 264
89 iso_pu_bacteria 2545555834 2545673436 264
90 iso_pu_bacteria 641522639 641641134 264
91 3300000532 CNAas_1003176 CNAas_10031761 265
92 3300002070 JGI24750J21931_1003227 JGI24750J21931_10032273 265
93 3300002075 JGI24738J21930_10031886 JGI24738J21930_100318861 265
94 3300002077 JGI24744J21845_10016399 JGI24744J21845_100163992 265
95 3300002244 JGI24742J22300_10016148 JGI24742J22300_100161481 265
96 3300002459 JGI24751J29686_10011026 JGI24751J29686_100110263 265
97 3300005329 Ga0070683_100399579 Ga0070683_1003995791 265
98 3300005334 Ga0068869_100092338 Ga0068869_1000923382 265
99 3300005338 Ga0068868_100119871 Ga0068868_1001198713 265
100 3300005340 Ga0070689_100017131 Ga0070689_1000171315 265
101 3300005341 Ga0070691_10102586 Ga0070691_101025862 265
102 3300005344 Ga0070661_100121502 Ga0070661_1001215022 265
103 3300005345 Ga0070692_10023283 Ga0070692_100232834 265
104 3300005347 Ga0070668_100261772 Ga0070668_1002617722 265
105 3300005353 Ga0070669_100216613 Ga0070669_1002166131 265
106 3300005354 Ga0070675_100240283 Ga0070675_1002402831 265
107 3300005355 Ga0070671_100028292 Ga0070671_1000282925 265
108 3300005364 Ga0070673_100242931 Ga0070673_1002429312 265
109 3300005365 Ga0070688_100101778 Ga0070688_1001017783 265
110 3300005434 Ga0070709_10172488 Ga0070709_101724882 265
111 3300005441 Ga0070700_100173585 Ga0070700_1001735852 265
112 3300005455 Ga0070663_100088071 Ga0070663_1000880713 265
113 3300005456 Ga0070678_100180925 Ga0070678_1001809252 265
114 3300005457 Ga0070662_100120316 Ga0070662_1001203163 265
115 3300005459 Ga0068867_100331798 Ga0068867_1003317981 265
116 3300005466 Ga0070685_10038393 Ga0070685_100383932 265
117 3300005548 Ga0070665_100237664 Ga0070665_1002376642 265
118 3300005618 Ga0068864_100089871 Ga0068864_1000898712 265
119 3300005618 Ga0068864_100217763 Ga0068864_1002177632 265
120 3300005718 Ga0068866_10191096 Ga0068866_101910962 265
121 3300005719 Ga0068861_100168444 Ga0068861_1001684443 265
122 3300005840 Ga0068870_10012043 Ga0068870_100120434 265
123 3300005842 Ga0068858_100408675 Ga0068858_1004086751 265
124 3300005844 Ga0068862_100451862 Ga0068862_1004518621 265
125 3300006195 Ga0075366_10071082 Ga0075366_100710822 265
126 3300006237 Ga0097621_100105935 Ga0097621_1001059353 265
127 3300006358 Ga0068871_100066088 Ga0068871_1000660884 265
128 3300006881 Ga0068865_100219907 Ga0068865_1002199072 265
129 3300009094 Ga0111539_10400604 Ga0111539_104006042 265
130 3300009101 Ga0105247_10096092 Ga0105247_100960922 265
131 3300009101 Ga0105247_10116923 Ga0105247_101169232 265
132 3300009176 Ga0105242_10502911 Ga0105242_105029112 265
133 3300009177 Ga0105248_10126333 Ga0105248_101263334 265
134 3300010375 Ga0105239_10356355 Ga0105239_103563552 265
135 3300011119 Ga0105246_10053849 Ga0105246_100538494 265
136 3300013297 Ga0157378_10143911 Ga0157378_101439113 265
137 3300013306 Ga0163162_10045343 Ga0163162_100453433 265
138 3300013306 Ga0163162_10145249 Ga0163162_101452492 265
139 3300013308 Ga0157375_10063970 Ga0157375_100639702 265
140 3300014325 Ga0163163_10005604 Ga0163163_100056041 265
141 3300014325 Ga0163163_10102773 Ga0163163_101027732 265
142 3300014745 Ga0157377_10006140 Ga0157377_100061405 265
143 3300025261 Ga0209233_1005356 Ga0209233_10053563 265
144 3300025899 Ga0207642_10009925 Ga0207642_100099254 265
145 3300025900 Ga0207710_10052142 Ga0207710_100521422 265
146 3300025900 Ga0207710_10072782 Ga0207710_100727822 265
147 3300025901 Ga0207688_10000498 Ga0207688_1000049820 265
148 3300025907 Ga0207645_10007342 Ga0207645_100073428 265
149 3300025908 Ga0207643_10000808 Ga0207643_100008089 265
150 3300025915 Ga0207693_10022130 Ga0207693_100221302 265
151 3300025918 Ga0207662_10041846 Ga0207662_100418463 265
152 3300025920 Ga0207649_10151131 Ga0207649_101511311 265
153 3300025923 Ga0207681_10339490 Ga0207681_103394901 265
154 3300025926 Ga0207659_10073346 Ga0207659_100733461 265
155 3300025927 Ga0207687_10234310 Ga0207687_102343102 265
156 3300025931 Ga0207644_10162032 Ga0207644_101620322 265
157 3300025933 Ga0207706_10067344 Ga0207706_100673441 265
158 3300025937 Ga0207669_10014994 Ga0207669_100149943 265
159 3300025938 Ga0207704_10179274 Ga0207704_101792741 265
160 3300025941 Ga0207711_10044683 Ga0207711_100446831 265
161 3300025942 Ga0207689_10101891 Ga0207689_101018911 265
162 3300025949 Ga0207667_10434574 Ga0207667_104345741 265
163 3300025960 Ga0207651_10315307 Ga0207651_103153072 265
164 3300025972 Ga0207668_10199961 Ga0207668_101999612 265
165 3300025981 Ga0207640_10301041 Ga0207640_103010412 265
166 3300025986 Ga0207658_10084764 Ga0207658_100847641 265
167 3300026023 Ga0207677_10076075 Ga0207677_100760753 265
168 3300026035 Ga0207703_10312268 Ga0207703_103122682 265
169 3300026041 Ga0207639_10332978 Ga0207639_103329782 265
170 3300026067 Ga0207678_10021682 Ga0207678_100216825 265
171 3300026078 Ga0207702_10478851 Ga0207702_104788511 265
172 3300026089 Ga0207648_10383813 Ga0207648_103838131 265
173 3300026095 Ga0207676_10019503 Ga0207676_100195031 265
174 3300026095 Ga0207676_10105104 Ga0207676_101051042 265
175 3300026118 Ga0207675_100117104 Ga0207675_1001171042 265
176 3300026142 Ga0207698_10276933 Ga0207698_102769332 265
177 3300027907 Ga0207428_10094099 Ga0207428_100940992 265
178 3300028379 Ga0268266_10099081 Ga0268266_100990813 265
179 3300028380 Ga0268265_10011486 Ga0268265_100114866 265
180 3300035170 Ga0373943_0023082 Ga0373943_0023082_216_1139 265
181 3300035172 Ga0373955_0027195 Ga0373955_0027195_1829_2752 265
182 3300037312 Ga0395899_0186456 Ga0395899_0186456_577_1443 265
183 3300046472 Ga0495580_0047099 Ga0495580_0047099_1872_2795 265
184 3300046515 Ga0495620_0060262 Ga0495620_0060262_102_1013 265
185 3300048904 Ga0496101_0014484 Ga0496101_0014484_4371_5282 265
186 3300048905 Ga0496102_0010740 Ga0496102_0010740_4583_5494 265
187 3300048906 Ga0496103_0034943 Ga0496103_0034943_2068_2979 265
188 3300048907 Ga0496104_0053959 Ga0496104_0053959_2054_2962 265
189 3300048907 Ga0496104_0068592 Ga0496104_0068592_179_1090 265
190 3300048908 Ga0496105_0014128 Ga0496105_0014128_5158_6066 265
191 3300048908 Ga0496105_0044582 Ga0496105_0044582_2522_3433 265
192 3300048909 Ga0496106_0015891 Ga0496106_0015891_4482_5393 265
193 3300048910 Ga0496107_0013296 Ga0496107_0013296_3502_4413 265
194 3300048910 Ga0496107_0138464 Ga0496107_0138464_850_1758 265
195 3300048911 Ga0496108_0022495 Ga0496108_0022495_1496_2404 265
196 3300048911 Ga0496108_0301193 Ga0496108_0301193_351_1262 265
197 3300048912 Ga0496109_0023577 Ga0496109_0023577_1062_1970 265
198 3300048912 Ga0496109_0060169 Ga0496109_0060169_1267_2178 265
199 3300048913 Ga0496110_0006680 Ga0496110_0006680_6271_7179 265
200 3300048913 Ga0496110_0378148 Ga0496110_0378148_232_1143 265
201 3300048914 Ga0496111_0049355 Ga0496111_0049355_857_1768 265
202 3300048915 Ga0496112_0081175 Ga0496112_0081175_424_1335 265
203 3300048916 Ga0496113_0026630 Ga0496113_0026630_209_1120 265
204 3300048916 Ga0496113_0038211 Ga0496113_0038211_2573_3481 265
205 3300048917 Ga0496114_0009321 Ga0496114_0009321_3452_4363 265
206 3300048918 Ga0496115_0037242 Ga0496115_0037242_422_1333 265
207 3300049742 Ga0501080_0128611 Ga0501080_0128611_1086_1994 265
208 3300050511 nmdc:mga08y16_134092_c1 nmdc:mga08y16_134092_c1_1556_2467 265
209 iso_pu_bacteria 643348564 643599156 265
210 3300005327 Ga0070658_10007428 Ga0070658_100074284 266
211 3300005336 Ga0070680_100033544 Ga0070680_1000335442 266
212 3300005347 Ga0070668_100059039 Ga0070668_1000590392 266
213 3300005444 Ga0070694_100085044 Ga0070694_1000850442 266
214 3300005457 Ga0070662_100075487 Ga0070662_1000754872 266
215 3300005530 Ga0070679_100027519 Ga0070679_1000275192 266
216 3300005548 Ga0070665_100385262 Ga0070665_1003852622 266
217 3300005578 Ga0068854_100168846 Ga0068854_1001688462 266
218 3300005719 Ga0068861_100017595 Ga0068861_1000175957 266
219 3300005719 Ga0068861_100147931 Ga0068861_1001479312 266
220 3300006942 Ga0099824_1011525 Ga0099824_10115253 266
221 3300006942 Ga0099824_1016950 Ga0099824_10169502 266
222 3300006943 Ga0099822_1002297 Ga0099822_100229714 266
223 3300009093 Ga0105240_10017062 Ga0105240_100170625 266
224 3300009147 Ga0114129_10538921 Ga0114129_105389212 266
225 3300009148 Ga0105243_10164112 Ga0105243_101641121 266
226 3300013104 Ga0157370_10004982 Ga0157370_100049823 266
227 3300014969 Ga0157376_10116078 Ga0157376_101160783 266
228 3300025315 Ga0207697_10017212 Ga0207697_100172123 266
229 3300025901 Ga0207688_10101938 Ga0207688_101019381 266
230 3300025904 Ga0207647_10113498 Ga0207647_101134981 266
231 3300025913 Ga0207695_10047086 Ga0207695_100470863 266
232 3300025921 Ga0207652_10005325 Ga0207652_100053252 266
233 3300025924 Ga0207694_10163839 Ga0207694_101638392 266
234 3300025931 Ga0207644_10374554 Ga0207644_103745541 266
235 3300025960 Ga0207651_10211543 Ga0207651_102115432 266
236 3300025961 Ga0207712_10134831 Ga0207712_101348312 266
237 3300025972 Ga0207668_10181776 Ga0207668_101817761 266
238 3300025981 Ga0207640_10071437 Ga0207640_100714373 266
239 3300026067 Ga0207678_10236964 Ga0207678_102369642 266
240 3300026075 Ga0207708_10026576 Ga0207708_100265762 266
241 3300026118 Ga0207675_100506354 Ga0207675_1005063542 266
242 3300027296 Ga0209389_1000123 Ga0209389_100012341 266
243 3300027357 Ga0209589_1000001 Ga0209589_1000001212 266
244 3300027357 Ga0209589_1000036 Ga0209589_100003641 266
245 3300027361 Ga0209489_100001 Ga0209489_100001212 266
246 3300027361 Ga0209489_100006 Ga0209489_100006369 266
247 3300027363 Ga0209700_100001 Ga0209700_100001212 266
248 3300033442 Ga0315911_1000006 Ga0315911_1000006318 266
249 3300035113 Ga0373936_0004333 Ga0373936_0004333_1787_2713 266
250 3300035118 Ga0373954_0005654 Ga0373954_0005654_189_1115 266
251 3300035410 Ga0373924_0018891 Ga0373924_0018891_1548_2474 266
252 3300035692 Ga0373935_0097201 Ga0373935_0097201_825_1751 266
253 3300035725 Ga0373947_0211751 Ga0373947_0211751_39_965 266
254 3300037068 Ga0373925_0021091 Ga0373925_0021091_3088_4014 266
255 3300039438 Ga0436360_0865156 Ga0436360_0865156_64_930 266
256 3300044693 Ga0466961_0097965 Ga0466961_0097965_715_1638 266
257 3300044694 Ga0466963_0058421 Ga0466963_0058421_766_1689 266
258 3300045836 Ga0466958_0077809 Ga0466958_0077809_258_1181 266
259 3300045976 Ga0466967_0012742 Ga0466967_0012742_4197_5120 266
260 3300046642 Ga0495634_0022134 Ga0495634_0022134_1457_2383 266
261 3300047315 Ga0495581_0043724 Ga0495581_0043724_1345_2271 266
262 3300047319 Ga0495674_0077210 Ga0495674_0077210_623_1549 266
263 3300047471 Ga0495684_0016455 Ga0495684_0016455_4378_5304 266
264 3300048910 Ga0496107_0161471 Ga0496107_0161471_704_1639 266
265 3300048917 Ga0496114_0149233 Ga0496114_0149233_552_1487 266
266 3300049585 Ga0501069_0013747 Ga0501069_0013747_2798_3721 266
267 3300049586 Ga0501070_0004589 Ga0501070_0004589_8389_9312 266
268 3300049822 Ga0501035_0000127 Ga0501035_0000127_78704_79627 266
269 3300050494 nmdc:mga06z11_12315_c1 nmdc:mga06z11_12315_c1_2612_3589 266
270 3300003354 JGI25160J50197_1001585 JGI25160J50197_10015859 267
271 3300003911 JGI25405J52794_10024759 JGI25405J52794_100247592 267
272 3300005336 Ga0070680_100262689 Ga0070680_1002626892 267
273 3300005467 Ga0070706_100353896 Ga0070706_1003538962 267
274 3300005577 Ga0068857_100069506 Ga0068857_1000695062 267
275 3300005614 Ga0068856_100388311 Ga0068856_1003883112 267
276 3300005616 Ga0068852_100052414 Ga0068852_1000524142 267
277 3300005617 Ga0068859_100420413 Ga0068859_1004204132 267
278 3300005937 Ga0081455_10000627 Ga0081455_1000062714 267
279 3300005937 Ga0081455_10005602 Ga0081455_100056026 267
280 3300005937 Ga0081455_10039131 Ga0081455_100391315 267
281 3300005981 Ga0081538_10037684 Ga0081538_100376842 267
282 3300005985 Ga0081539_10020891 Ga0081539_100208914 267
283 3300006038 Ga0075365_10080196 Ga0075365_100801962 267
284 3300006048 Ga0075363_100125510 Ga0075363_1001255102 267
285 3300006186 Ga0075369_10091716 Ga0075369_100917162 267
286 3300006931 Ga0097620_100420403 Ga0097620_1004204032 267
287 3300009545 Ga0105237_10227063 Ga0105237_102270632 267
288 3300009545 Ga0105237_10299936 Ga0105237_102999361 267
289 3300009551 Ga0105238_10134399 Ga0105238_101343991 267
290 3300010375 Ga0105239_10264833 Ga0105239_102648331 267
291 3300021377 Ga0213874_10028898 Ga0213874_100288982 267
292 3300021441 Ga0213871_10007614 Ga0213871_100076143 267
293 3300025297 Ga0209758_1001768 Ga0209758_100176821 267
294 3300025297 Ga0209758_1007360 Ga0209758_10073605 267
295 3300025302 Ga0207426_1000855 Ga0207426_100085524 267
296 3300025304 Ga0209257_1038868 Ga0209257_10388682 267
297 3300025910 Ga0207684_10274023 Ga0207684_102740232 267
298 3300025924 Ga0207694_10089181 Ga0207694_100891811 267
299 3300025949 Ga0207667_10082391 Ga0207667_100823913 267
300 3300026116 Ga0207674_10183850 Ga0207674_101838501 267
301 3300027296 Ga0209389_1000040 Ga0209389_100004060 267
302 3300027361 Ga0209489_111662 Ga0209489_1116622 267
303 3300027363 Ga0209700_100005 Ga0209700_100005239 267
304 3300028786 Ga0307517_10000008 Ga0307517_100000086 267
305 3300031616 Ga0307508_10000018 Ga0307508_10000018111 267
306 3300035117 Ga0373953_0004749 Ga0373953_0004749_3283_4206 267
307 3300035118 Ga0373954_0002285 Ga0373954_0002285_1007_1930 267
308 3300035119 Ga0373956_0060243 Ga0373956_0060243_604_1527 267
309 3300035410 Ga0373924_0048031 Ga0373924_0048031_600_1523 267
310 3300036401 Ga0373937_0048939 Ga0373937_0048939_2592_3515 267
311 3300037418 Ga0395900_0000940 Ga0395900_0000940_7487_8410 267
312 3300037466 Ga0395898_0053954 Ga0395898_0053954_1067_1990 267
313 3300038443 Ga0395901_0249577 Ga0395901_0249577_41_964 267
314 3300039437 Ga0436365_1696695 Ga0436365_1696695_1191_2114 267
315 3300039438 Ga0436360_0062365 Ga0436360_0062365_330_1253 267
316 3300039447 Ga0436361_0686048 Ga0436361_0686048_1746_2669 267
317 3300039447 Ga0436361_0952418 Ga0436361_0952418_208_1131 267
318 3300046454 Ga0495592_0003334 Ga0495592_0003334_796_1719 267
319 3300046459 Ga0495629_0001281 Ga0495629_0001281_4439_5362 267
320 3300046462 Ga0495651_0009095 Ga0495651_0009095_5097_6020 267
321 3300046463 Ga0495653_0002307 Ga0495653_0002307_9777_10700 267
322 3300046516 Ga0495628_0007652 Ga0495628_0007652_590_1513 267
323 3300046529 Ga0495652_0023802 Ga0495652_0023802_3690_4613 267
324 3300046533 Ga0495640_0004102 Ga0495640_0004102_2004_2927 267
325 3300046536 Ga0495587_0093075 Ga0495587_0093075_15_938 267
326 3300046543 Ga0495645_0010291 Ga0495645_0010291_204_1127 267
327 3300046559 Ga0495667_0002892 Ga0495667_0002892_9778_10701 267
328 3300046663 Ga0495635_0004431 Ga0495635_0004431_639_1562 267
329 3300046675 Ga0495657_0016840 Ga0495657_0016840_4037_4960 267
330 3300046678 Ga0495599_0006005 Ga0495599_0006005_5571_6494 267
331 3300046680 Ga0495646_0013938 Ga0495646_0013938_3756_4679 267
332 3300046689 Ga0495613_0022371 Ga0495613_0022371_3626_4549 267
333 3300046690 Ga0495624_0016569 Ga0495624_0016569_2347_3270 267
334 3300046690 Ga0495624_0131427 Ga0495624_0131427_289_1218 267
335 3300046809 Ga0495600_0001546 Ga0495600_0001546_1099_2022 267
336 3300047317 Ga0495604_0011558 Ga0495604_0011558_5097_6020 267
337 3300047319 Ga0495674_0056755 Ga0495674_0056755_2237_3160 267
338 3300047471 Ga0495684_0002991 Ga0495684_0002991_1605_2528 267
339 3300047673 Ga0495593_0001200 Ga0495593_0001200_4579_5502 267
340 3300048088 Ga0495602_0017778 Ga0495602_0017778_1099_2022 267
341 3300048911 Ga0496108_0296791 Ga0496108_0296791_19_930 267
342 3300050489 nmdc:mga03683_114447_c1 nmdc:mga03683_114447_c1_67_990 267
343 3300050490 nmdc:mga03n38_42327_c1 nmdc:mga03n38_42327_c1_833_1744 267
344 3300050492 nmdc:mga0yw44_33951_c1 nmdc:mga0yw44_33951_c1_1303_2214 267
345 3300050494 nmdc:mga06z11_24927_c1 nmdc:mga06z11_24927_c1_1353_2264 267
346 3300050496 nmdc:mga07m45_138577_c1 nmdc:mga07m45_138577_c1_292_1215 267
347 3300050516 nmdc:mga0sz30_63608_c1 nmdc:mga0sz30_63608_c1_31_954 267
348 3300053085 Ga0495619_0001245 Ga0495619_0001245_7390_8313 267
349 3300053094 Ga0500566_0010087 Ga0500566_0010087_1615_2544 267
350 3300053119 Ga0500595_000152 Ga0500595_000152_23096_24025 267
351 3300053140 Ga0500573_0018673 Ga0500573_0018673_2576_3499 267
352 3300053162 Ga0500638_000921 Ga0500638_000921_4569_5498 267
353 3300053177 Ga0500636_0030320 Ga0500636_0030320_2168_3091 267
354 3300053178 Ga0500637_0004557 Ga0500637_0004557_3027_3956 267
355 3300053735 Ga0500596_001459 Ga0500596_001459_2836_3759 267
356 3300055283 Ga0500661_000959 Ga0500661_000959_2959_3888 267
357 iso_pu_bacteria 2728368998 2728752370 267
358 3300001989 JGI24739J22299_10018815 JGI24739J22299_100188152 268
359 3300003215 JGI25153J46596_10002078 JGI25153J46596_100020784 268
360 3300003354 JGI25160J50197_1005731 JGI25160J50197_10057316 268
361 3300003659 JGI25404J52841_10001394 JGI25404J52841_100013942 268
362 3300003659 JGI25404J52841_10002455 JGI25404J52841_100024551 268
363 3300003794 Ga0055531_10019699 Ga0055531_100196993 268
364 3300005262 Ga0065165_1028846 Ga0065165_10288462 268
365 3300005328 Ga0070676_10035087 Ga0070676_100350873 268
366 3300005331 Ga0070670_100063259 Ga0070670_1000632593 268
367 3300005340 Ga0070689_100009743 Ga0070689_1000097432 268
368 3300005343 Ga0070687_100036301 Ga0070687_1000363012 268
369 3300005354 Ga0070675_100337321 Ga0070675_1003373211 268
370 3300005355 Ga0070671_100015695 Ga0070671_1000156955 268
371 3300005355 Ga0070671_100051541 Ga0070671_1000515413 268
372 3300005365 Ga0070688_100004948 Ga0070688_1000049485 268
373 3300005367 Ga0070667_100036320 Ga0070667_1000363204 268
374 3300005435 Ga0070714_100024828 Ga0070714_1000248284 268
375 3300005435 Ga0070714_100601790 Ga0070714_1006017901 268
376 3300005436 Ga0070713_100011400 Ga0070713_1000114004 268
377 3300005436 Ga0070713_100464422 Ga0070713_1004644221 268
378 3300005439 Ga0070711_100089660 Ga0070711_1000896602 268
379 3300005459 Ga0068867_100191854 Ga0068867_1001918542 268
380 3300005548 Ga0070665_100224604 Ga0070665_1002246042 268
381 3300005564 Ga0070664_100371058 Ga0070664_1003710582 268
382 3300005614 Ga0068856_100143713 Ga0068856_1001437132 268
383 3300005618 Ga0068864_100191763 Ga0068864_1001917631 268
384 3300005843 Ga0068860_100072707 Ga0068860_1000727072 268
385 3300005937 Ga0081455_10015462 Ga0081455_100154624 268
386 3300005983 Ga0081540_1000933 Ga0081540_100093317 268
387 3300005983 Ga0081540_1002057 Ga0081540_100205713 268
388 3300005983 Ga0081540_1020629 Ga0081540_10206293 268
389 3300006042 Ga0075368_10001688 Ga0075368_100016884 268
390 3300006051 Ga0075364_10021153 Ga0075364_100211534 268
391 3300006881 Ga0068865_100022614 Ga0068865_1000226142 268
392 3300007265 Ga0099794_10133703 Ga0099794_101337031 268
393 3300009093 Ga0105240_10010648 Ga0105240_100106489 268
394 3300009098 Ga0105245_10245012 Ga0105245_102450122 268
395 3300009545 Ga0105237_10054038 Ga0105237_100540384 268
396 3300009545 Ga0105237_10122674 Ga0105237_101226742 268
397 3300009551 Ga0105238_10369935 Ga0105238_103699351 268
398 3300014326 Ga0157380_10244412 Ga0157380_102444122 268
399 3300021320 Ga0214544_1000002 Ga0214544_1000002165 268
400 3300021321 Ga0214542_1000001 Ga0214542_1000001515 268
401 3300021324 Ga0214545_1000001 Ga0214545_1000001581 268
402 3300021327 Ga0214543_1000001 Ga0214543_1000001615 268
403 3300025272 Ga0209455_1015219 Ga0209455_10152192 268
404 3300025273 Ga0209673_1018859 Ga0209673_10188592 268
405 3300025295 Ga0209564_1009452 Ga0209564_10094524 268
406 3300025297 Ga0209758_1000140 Ga0209758_10001404 268
407 3300025299 Ga0209256_1004348 Ga0209256_10043482 268
408 3300025304 Ga0209257_1001932 Ga0209257_100193219 268
409 3300025315 Ga0207697_10044361 Ga0207697_100443612 268
410 3300025904 Ga0207647_10007263 Ga0207647_100072636 268
411 3300025913 Ga0207695_10101877 Ga0207695_101018772 268
412 3300025915 Ga0207693_10002467 Ga0207693_100024678 268
413 3300025923 Ga0207681_10312241 Ga0207681_103122411 268
414 3300025928 Ga0207700_10036446 Ga0207700_100364464 268
415 3300025929 Ga0207664_10024409 Ga0207664_100244092 268
416 3300025931 Ga0207644_10087205 Ga0207644_100872053 268
417 3300025937 Ga0207669_10020145 Ga0207669_100201452 268
418 3300025940 Ga0207691_10108657 Ga0207691_101086574 268
419 3300025986 Ga0207658_10172046 Ga0207658_101720462 268
420 3300026041 Ga0207639_10253911 Ga0207639_102539112 268
421 3300026067 Ga0207678_10079023 Ga0207678_100790232 268
422 3300026078 Ga0207702_10183275 Ga0207702_101832752 268
423 3300026095 Ga0207676_10181011 Ga0207676_101810111 268
424 3300026121 Ga0207683_10112684 Ga0207683_101126842 268
425 3300028379 Ga0268266_10120593 Ga0268266_101205932 268
426 3300028381 Ga0268264_10086177 Ga0268264_100861772 268
427 3300028786 Ga0307517_10007459 Ga0307517_1000745912 268
428 3300030521 Ga0307511_10049052 Ga0307511_100490522 268
429 3300031507 Ga0307509_10111136 Ga0307509_101111362 268
430 3300031616 Ga0307508_10075361 Ga0307508_100753613 268
431 3300031711 Ga0265314_10149818 Ga0265314_101498182 268
432 3300031730 Ga0307516_10033440 Ga0307516_100334403 268
433 3300031903 Ga0307407_10296346 Ga0307407_102963462 268
434 3300033179 Ga0307507_10024914 Ga0307507_100249144 268
435 3300035089 Ga0373944_0010709 Ga0373944_0010709_128_1063 268
436 3300035691 Ga0373931_0036695 Ga0373931_0036695_1617_2546 268
437 3300035692 Ga0373935_0004984 Ga0373935_0004984_4799_5722 268
438 3300035695 Ga0373927_0029904 Ga0373927_0029904_602_1525 268
439 3300035724 Ga0373933_0000110 Ga0373933_0000110_12688_13614 268
440 3300037853 Ga0436364_1233379 Ga0436364_1233379_1590_2513 268
441 3300039437 Ga0436365_1779964 Ga0436365_1779964_447_1370 268
442 3300039447 Ga0436361_0130708 Ga0436361_0130708_4948_5871 268
443 3300039450 Ga0436363_0050593 Ga0436363_0050593_80_1003 268
444 3300044658 Ga0466972_0001455 Ga0466972_0001455_4513_5439 268
445 3300044684 Ga0466966_0062758 Ga0466966_0062758_653_1624 268
446 3300044901 Ga0466960_0244132 Ga0466960_0244132_38_964 268
447 3300046462 Ga0495651_0000821 Ga0495651_0000821_11786_12661 268
448 3300046473 Ga0495582_0012202 Ga0495582_0012202_593_1528 268
449 3300046512 Ga0495610_0038350 Ga0495610_0038350_144_1067 268
450 3300046516 Ga0495628_0095552 Ga0495628_0095552_1271_2146 268
451 3300046523 Ga0495644_0051618 Ga0495644_0051618_550_1485 268
452 3300046523 Ga0495644_0075430 Ga0495644_0075430_250_1173 268
453 3300046529 Ga0495652_0005063 Ga0495652_0005063_341_1216 268
454 3300046529 Ga0495652_0139524 Ga0495652_0139524_855_1793 268
455 3300046533 Ga0495640_0129381 Ga0495640_0129381_342_1217 268
456 3300046536 Ga0495587_0009149 Ga0495587_0009149_4117_4992 268
457 3300046543 Ga0495645_0108745 Ga0495645_0108745_235_1110 268
458 3300046557 Ga0495622_0029121 Ga0495622_0029121_578_1501 268
459 3300046679 Ga0495623_0006077 Ga0495623_0006077_5974_6849 268
460 3300046684 Ga0495669_0096315 Ga0495669_0096315_276_1199 268
461 3300046691 Ga0495670_0227481 Ga0495670_0227481_31_966 268
462 3300047317 Ga0495604_0000702 Ga0495604_0000702_24105_24980 268
463 3300047322 Ga0495680_0007750 Ga0495680_0007750_302_1177 268
464 3300047323 Ga0495683_0090589 Ga0495683_0090589_106_1029 268
465 3300047443 Ga0495687_016858 Ga0495687_016858_995_1918 268
466 3300047444 Ga0495675_0011479 Ga0495675_0011479_218_1093 268
467 3300047472 Ga0495686_0156285 Ga0495686_0156285_79_1002 268
468 3300048088 Ga0495602_0002373 Ga0495602_0002373_13193_14068 268
469 3300048905 Ga0496102_0021189 Ga0496102_0021189_4164_5087 268
470 3300048907 Ga0496104_0000372 Ga0496104_0000372_13937_14866 268
471 3300048907 Ga0496104_0016485 Ga0496104_0016485_3977_4906 268
472 3300048907 Ga0496104_0200024 Ga0496104_0200024_569_1504 268
473 3300048908 Ga0496105_0060346 Ga0496105_0060346_707_1630 268
474 3300048909 Ga0496106_0172014 Ga0496106_0172014_597_1526 268
475 3300048911 Ga0496108_0034097 Ga0496108_0034097_428_1351 268
476 3300048912 Ga0496109_0030701 Ga0496109_0030701_1911_2834 268
477 3300048914 Ga0496111_0030059 Ga0496111_0030059_2500_3423 268
478 3300048915 Ga0496112_0028755 Ga0496112_0028755_1450_2373 268
479 3300048916 Ga0496113_0069765 Ga0496113_0069765_1508_2437 268
480 3300048920 Ga0496117_0032569 Ga0496117_0032569_354_1277 268
481 3300048922 Ga0496119_0026329 Ga0496119_0026329_1985_2908 268
482 3300048927 Ga0496124_0071042 Ga0496124_0071042_338_1261 268
483 3300048928 Ga0496125_0117088 Ga0496125_0117088_438_1361 268
484 3300049460 Ga0495682_0039571 Ga0495682_0039571_420_1343 268
485 3300049569 Ga0501032_0005134 Ga0501032_0005134_3007_3930 268
486 3300049569 Ga0501032_0011956 Ga0501032_0011956_1897_2820 268
487 3300049570 Ga0501033_0053507 Ga0501033_0053507_1527_2450 268
488 3300049571 Ga0501034_0227469 Ga0501034_0227469_466_1389 268
489 3300049572 Ga0501036_0003243 Ga0501036_0003243_3006_3929 268
490 3300049572 Ga0501036_0031300 Ga0501036_0031300_1061_1984 268
491 3300049573 Ga0501037_0048469 Ga0501037_0048469_1709_2632 268
492 3300049574 Ga0501038_0127279 Ga0501038_0127279_797_1720 268
493 3300049574 Ga0501038_0198440 Ga0501038_0198440_304_1227 268
494 3300049575 Ga0501039_0005778 Ga0501039_0005778_648_1571 268
495 3300049579 Ga0501043_0002821 Ga0501043_0002821_638_1561 268
496 3300049579 Ga0501043_0007305 Ga0501043_0007305_978_1901 268
497 3300049581 Ga0501047_0001508 Ga0501047_0001508_14248_15171 268
498 3300049581 Ga0501047_0025811 Ga0501047_0025811_1075_1998 268
499 3300049582 Ga0501048_0000151 Ga0501048_0000151_29205_30128 268
500 3300049583 Ga0501067_0014096 Ga0501067_0014096_81_1010 268
501 3300049583 Ga0501067_0071797 Ga0501067_0071797_276_1199 268
502 3300049584 Ga0501068_0041994 Ga0501068_0041994_428_1351 268
503 3300049586 Ga0501070_0008817 Ga0501070_0008817_5088_6011 268
504 3300049586 Ga0501070_0050511 Ga0501070_0050511_1524_2453 268
505 3300049588 Ga0501072_0114754 Ga0501072_0114754_322_1245 268
506 3300049589 Ga0501073_0041083 Ga0501073_0041083_1399_2322 268
507 3300049590 Ga0501074_0011115 Ga0501074_0011115_1433_2356 268
508 3300049590 Ga0501074_0018336 Ga0501074_0018336_1303_2232 268
509 3300049590 Ga0501074_0048367 Ga0501074_0048367_1159_2082 268
510 3300049742 Ga0501080_0000130 Ga0501080_0000130_33908_34831 268
511 3300049742 Ga0501080_0083130 Ga0501080_0083130_456_1385 268
512 3300049744 Ga0501083_0002779 Ga0501083_0002779_11096_12019 268
513 3300049823 Ga0501044_0000636 Ga0501044_0000636_29233_30156 268
514 3300049823 Ga0501044_0121984 Ga0501044_0121984_1478_2407 268
515 3300050491 nmdc:mga00v17_289087_c1 nmdc:mga00v17_289087_c1_66_989 268
516 3300050492 nmdc:mga0yw44_28739_c1 nmdc:mga0yw44_28739_c1_475_1398 268
517 3300050494 nmdc:mga06z11_181561_c1 nmdc:mga06z11_181561_c1_307_1191 268
518 3300050496 nmdc:mga07m45_147027_c1 nmdc:mga07m45_147027_c1_229_1215 268
519 3300050496 nmdc:mga07m45_15706_c2 nmdc:mga07m45_15706_c2_905_1828 268
520 3300053077 Ga0495601_0024571 Ga0495601_0024571_625_1554 268
521 3300053085 Ga0495619_0236081 Ga0495619_0236081_92_1018 268
522 3300053085 Ga0495619_0254861 Ga0495619_0254861_95_970 268
523 3300053091 Ga0500647_0099288 Ga0500647_0099288_240_1163 268
524 3300053108 Ga0500562_025476 Ga0500562_025476_120_1052 268
525 3300053117 Ga0500593_001955 Ga0500593_001955_1902_2843 268
526 3300053119 Ga0500595_060614 Ga0500595_060614_164_1087 268
527 3300053122 Ga0500608_147527 Ga0500608_147527_38_937 268
528 3300053131 Ga0500652_143600 Ga0500652_143600_10_882 268
529 3300053177 Ga0500636_0006350 Ga0500636_0006350_1999_2898 268
530 3300053177 Ga0500636_0102161 Ga0500636_0102161_216_1145 268
531 3300053177 Ga0500636_0127566 Ga0500636_0127566_299_1222 268
532 3300053178 Ga0500637_0181350 Ga0500637_0181350_169_1092 268
533 3300053728 Ga0500657_083349 Ga0500657_083349_341_1264 268
534 3300053733 Ga0500552_001721 Ga0500552_001721_1144_2067 268
535 3300003659 JGI25404J52841_10001507 JGI25404J52841_100015074 269
536 3300005328 Ga0070676_10096227 Ga0070676_100962272 269
537 3300005329 Ga0070683_100020818 Ga0070683_1000208182 269
538 3300005329 Ga0070683_100158844 Ga0070683_1001588443 269
539 3300005334 Ga0068869_100076062 Ga0068869_1000760622 269
540 3300005336 Ga0070680_100132474 Ga0070680_1001324742 269
541 3300005337 Ga0070682_100214343 Ga0070682_1002143432 269
542 3300005338 Ga0068868_100030926 Ga0068868_1000309264 269
543 3300005338 Ga0068868_100043397 Ga0068868_1000433972 269
544 3300005339 Ga0070660_100006450 Ga0070660_1000064506 269
545 3300005344 Ga0070661_100207526 Ga0070661_1002075262 269
546 3300005347 Ga0070668_100426999 Ga0070668_1004269991 269
547 3300005366 Ga0070659_100198716 Ga0070659_1001987162 269
548 3300005367 Ga0070667_100486970 Ga0070667_1004869701 269
549 3300005434 Ga0070709_10005929 Ga0070709_100059293 269
550 3300005434 Ga0070709_10188625 Ga0070709_101886251 269
551 3300005434 Ga0070709_10188666 Ga0070709_101886662 269
552 3300005435 Ga0070714_100016855 Ga0070714_1000168552 269
553 3300005435 Ga0070714_100039972 Ga0070714_1000399722 269
554 3300005437 Ga0070710_10022918 Ga0070710_100229182 269
555 3300005439 Ga0070711_100000801 Ga0070711_10000080112 269
556 3300005439 Ga0070711_100012369 Ga0070711_1000123694 269
557 3300005439 Ga0070711_100156548 Ga0070711_1001565482 269
558 3300005440 Ga0070705_100133617 Ga0070705_1001336172 269
559 3300005441 Ga0070700_100175340 Ga0070700_1001753402 269
560 3300005458 Ga0070681_10031901 Ga0070681_100319014 269
561 3300005458 Ga0070681_10098785 Ga0070681_100987853 269
562 3300005530 Ga0070679_100018995 Ga0070679_1000189953 269
563 3300005530 Ga0070679_100020708 Ga0070679_1000207082 269
564 3300005530 Ga0070679_100453750 Ga0070679_1004537502 269
565 3300005535 Ga0070684_100087603 Ga0070684_1000876032 269
566 3300005535 Ga0070684_100150456 Ga0070684_1001504561 269
567 3300005536 Ga0070697_100138029 Ga0070697_1001380292 269
568 3300005539 Ga0068853_100033214 Ga0068853_1000332143 269
569 3300005539 Ga0068853_100098095 Ga0068853_1000980952 269
570 3300005539 Ga0068853_100384310 Ga0068853_1003843102 269
571 3300005548 Ga0070665_100204428 Ga0070665_1002044282 269
572 3300005563 Ga0068855_100016222 Ga0068855_1000162224 269
573 3300005563 Ga0068855_100096977 Ga0068855_1000969772 269
574 3300005563 Ga0068855_100116289 Ga0068855_1001162893 269
575 3300005564 Ga0070664_100036391 Ga0070664_1000363912 269
576 3300005577 Ga0068857_100340383 Ga0068857_1003403831 269
577 3300005578 Ga0068854_100130570 Ga0068854_1001305702 269
578 3300005614 Ga0068856_100194243 Ga0068856_1001942432 269
579 3300005614 Ga0068856_100321872 Ga0068856_1003218721 269
580 3300005616 Ga0068852_100036557 Ga0068852_1000365573 269
581 3300005616 Ga0068852_100048450 Ga0068852_1000484502 269
582 3300005617 Ga0068859_100172316 Ga0068859_1001723162 269
583 3300005617 Ga0068859_100824087 Ga0068859_1008240871 269
584 3300005618 Ga0068864_100029009 Ga0068864_1000290093 269
585 3300005834 Ga0068851_10153168 Ga0068851_101531682 269
586 3300005840 Ga0068870_10129127 Ga0068870_101291272 269
587 3300005842 Ga0068858_100064347 Ga0068858_1000643473 269
588 3300005843 Ga0068860_100226954 Ga0068860_1002269541 269
589 3300005844 Ga0068862_100105223 Ga0068862_1001052232 269
590 3300005937 Ga0081455_10106307 Ga0081455_101063072 269
591 3300005983 Ga0081540_1002812 Ga0081540_10028128 269
592 3300005983 Ga0081540_1006260 Ga0081540_10062605 269
593 3300005983 Ga0081540_1006330 Ga0081540_10063302 269
594 3300005983 Ga0081540_1011886 Ga0081540_10118866 269
595 3300005983 Ga0081540_1019878 Ga0081540_10198784 269
596 3300006028 Ga0070717_10004566 Ga0070717_100045665 269
597 3300006038 Ga0075365_10003342 Ga0075365_100033426 269
598 3300006038 Ga0075365_10008099 Ga0075365_100080993 269
599 3300006042 Ga0075368_10002671 Ga0075368_100026713 269
600 3300006048 Ga0075363_100110970 Ga0075363_1001109701 269
601 3300006051 Ga0075364_10007885 Ga0075364_100078853 269
602 3300006178 Ga0075367_10080363 Ga0075367_100803632 269
603 3300006178 Ga0075367_10112628 Ga0075367_101126282 269
604 3300006186 Ga0075369_10005033 Ga0075369_100050334 269
605 3300006237 Ga0097621_100029090 Ga0097621_1000290902 269
606 3300006237 Ga0097621_100079897 Ga0097621_1000798972 269
607 3300006353 Ga0075370_10054598 Ga0075370_100545982 269
608 3300006358 Ga0068871_100058331 Ga0068871_1000583313 269
609 3300006358 Ga0068871_100081739 Ga0068871_1000817392 269
610 3300006871 Ga0075434_100040259 Ga0075434_1000402593 269
611 3300006871 Ga0075434_100059039 Ga0075434_1000590393 269
612 3300006931 Ga0097620_100172313 Ga0097620_1001723132 269
613 3300006931 Ga0097620_100554466 Ga0097620_1005544661 269
614 3300006931 Ga0097620_100824091 Ga0097620_1008240911 269
615 3300007076 Ga0075435_100106562 Ga0075435_1001065622 269
616 3300007788 Ga0099795_10076075 Ga0099795_100760752 269
617 3300009093 Ga0105240_10196633 Ga0105240_101966333 269
618 3300009176 Ga0105242_10415490 Ga0105242_104154902 269
619 3300009177 Ga0105248_10123231 Ga0105248_101232312 269
620 3300009545 Ga0105237_10010293 Ga0105237_100102934 269
621 3300009551 Ga0105238_10060439 Ga0105238_100604393 269
622 3300009553 Ga0105249_10000711 Ga0105249_1000071121 269
623 3300009553 Ga0105249_10627411 Ga0105249_106274111 269
624 3300010159 Ga0099796_10015878 Ga0099796_100158782 269
625 3300010375 Ga0105239_10126277 Ga0105239_101262772 269
626 3300010375 Ga0105239_10372853 Ga0105239_103728532 269
627 3300013102 Ga0157371_10216088 Ga0157371_102160882 269
628 3300013104 Ga0157370_10325767 Ga0157370_103257672 269
629 3300013105 Ga0157369_10016501 Ga0157369_100165015 269
630 3300013105 Ga0157369_10018324 Ga0157369_100183248 269
631 3300013105 Ga0157369_10051560 Ga0157369_100515604 269
632 3300013296 Ga0157374_10005674 Ga0157374_100056745 269
633 3300013296 Ga0157374_10112151 Ga0157374_101121512 269
634 3300013297 Ga0157378_10368699 Ga0157378_103686992 269
635 3300013308 Ga0157375_10019981 Ga0157375_100199813 269
636 3300014325 Ga0163163_10049627 Ga0163163_100496273 269
637 3300014325 Ga0163163_10091983 Ga0163163_100919831 269
638 3300014968 Ga0157379_10296922 Ga0157379_102969221 269
639 3300014969 Ga0157376_10049969 Ga0157376_100499693 269
640 3300020069 Ga0197907_10430121 Ga0197907_104301212 269
641 3300020082 Ga0206353_10475847 Ga0206353_104758472 269
642 3300021358 Ga0213873_10004680 Ga0213873_100046803 269
643 3300021384 Ga0213876_10024584 Ga0213876_100245843 269
644 3300021384 Ga0213876_10059567 Ga0213876_100595672 269
645 3300022467 Ga0224712_10000671 Ga0224712_100006716 269
646 3300025321 Ga0207656_10005412 Ga0207656_100054122 269
647 3300025898 Ga0207692_10000504 Ga0207692_100005042 269
648 3300025899 Ga0207642_10059735 Ga0207642_100597352 269
649 3300025899 Ga0207642_10060606 Ga0207642_100606062 269
650 3300025899 Ga0207642_10082409 Ga0207642_100824092 269
651 3300025906 Ga0207699_10000508 Ga0207699_1000050812 269
652 3300025906 Ga0207699_10067828 Ga0207699_100678282 269
653 3300025908 Ga0207643_10025505 Ga0207643_100255052 269
654 3300025912 Ga0207707_10003603 Ga0207707_100036032 269
655 3300025912 Ga0207707_10014009 Ga0207707_100140098 269
656 3300025912 Ga0207707_10039320 Ga0207707_100393204 269
657 3300025912 Ga0207707_10075977 Ga0207707_100759772 269
658 3300025912 Ga0207707_10259544 Ga0207707_102595442 269
659 3300025913 Ga0207695_10077198 Ga0207695_100771982 269
660 3300025913 Ga0207695_10324392 Ga0207695_103243922 269
661 3300025914 Ga0207671_10230838 Ga0207671_102308382 269
662 3300025915 Ga0207693_10074374 Ga0207693_100743741 269
663 3300025916 Ga0207663_10000732 Ga0207663_100007324 269
664 3300025916 Ga0207663_10104804 Ga0207663_101048042 269
665 3300025916 Ga0207663_10164206 Ga0207663_101642061 269
666 3300025917 Ga0207660_10077580 Ga0207660_100775802 269
667 3300025919 Ga0207657_10069298 Ga0207657_100692982 269
668 3300025920 Ga0207649_10103952 Ga0207649_101039522 269
669 3300025921 Ga0207652_10009834 Ga0207652_100098342 269
670 3300025921 Ga0207652_10040077 Ga0207652_100400772 269
671 3300025921 Ga0207652_10065653 Ga0207652_100656531 269
672 3300025921 Ga0207652_10186049 Ga0207652_101860491 269
673 3300025921 Ga0207652_10362440 Ga0207652_103624402 269
674 3300025921 Ga0207652_10363433 Ga0207652_103634332 269
675 3300025924 Ga0207694_10019649 Ga0207694_100196492 269
676 3300025924 Ga0207694_10204892 Ga0207694_102048922 269
677 3300025925 Ga0207650_10048081 Ga0207650_100480813 269
678 3300025928 Ga0207700_10074501 Ga0207700_100745013 269
679 3300025928 Ga0207700_10353223 Ga0207700_103532232 269
680 3300025929 Ga0207664_10018532 Ga0207664_100185323 269
681 3300025931 Ga0207644_10074409 Ga0207644_100744092 269
682 3300025938 Ga0207704_10215696 Ga0207704_102156962 269
683 3300025938 Ga0207704_10282178 Ga0207704_102821781 269
684 3300025939 Ga0207665_10002422 Ga0207665_1000242211 269
685 3300025939 Ga0207665_10057351 Ga0207665_100573512 269
686 3300025941 Ga0207711_10032424 Ga0207711_100324242 269
687 3300025942 Ga0207689_10010214 Ga0207689_100102147 269
688 3300025944 Ga0207661_10003486 Ga0207661_100034863 269
689 3300025944 Ga0207661_10158303 Ga0207661_101583031 269
690 3300025945 Ga0207679_10054019 Ga0207679_100540192 269
691 3300025945 Ga0207679_10291809 Ga0207679_102918091 269
692 3300025949 Ga0207667_10017447 Ga0207667_100174472 269
693 3300025949 Ga0207667_10066932 Ga0207667_100669324 269
694 3300025949 Ga0207667_10548729 Ga0207667_105487292 269
695 3300025961 Ga0207712_10004055 Ga0207712_100040559 269
696 3300025981 Ga0207640_10147933 Ga0207640_101479332 269
697 3300026041 Ga0207639_10008102 Ga0207639_100081024 269
698 3300026041 Ga0207639_10132397 Ga0207639_101323972 269
699 3300026067 Ga0207678_10057311 Ga0207678_100573113 269
700 3300026067 Ga0207678_10472202 Ga0207678_104722021 269
701 3300026078 Ga0207702_10116988 Ga0207702_101169882 269
702 3300026088 Ga0207641_10175994 Ga0207641_101759942 269
703 3300026095 Ga0207676_10070874 Ga0207676_100708743 269
704 3300026116 Ga0207674_10046689 Ga0207674_100466892 269
705 3300026116 Ga0207674_10089783 Ga0207674_100897832 269
706 3300026121 Ga0207683_10072155 Ga0207683_100721553 269
707 3300027671 Ga0209588_1028894 Ga0209588_10288942 269
708 3300028380 Ga0268265_10510200 Ga0268265_105102001 269
709 3300028381 Ga0268264_10090404 Ga0268264_100904042 269
710 3300028381 Ga0268264_10487287 Ga0268264_104872872 269
711 3300031241 Ga0265325_10000675 Ga0265325_1000067517 269
712 3300031249 Ga0265339_10009592 Ga0265339_100095922 269
713 3300031456 Ga0307513_10261000 Ga0307513_102610002 269
714 3300031456 Ga0307513_10316604 Ga0307513_103166042 269
715 3300031595 Ga0265313_10001257 Ga0265313_100012572 269
716 3300031711 Ga0265314_10005924 Ga0265314_100059243 269
717 3300035113 Ga0373936_0019710 Ga0373936_0019710_523_1458 269
718 3300035115 Ga0373941_0000845 Ga0373941_0000845_64_990 269
719 3300035170 Ga0373943_0028976 Ga0373943_0028976_1433_2368 269
720 3300035171 Ga0373946_0012381 Ga0373946_0012381_34_969 269
721 3300035410 Ga0373924_0056636 Ga0373924_0056636_622_1557 269
722 3300035692 Ga0373935_0000382 Ga0373935_0000382_12809_13744 269
723 3300035695 Ga0373927_0002885 Ga0373927_0002885_4779_5714 269
724 3300035695 Ga0373927_0011174 Ga0373927_0011174_2987_3922 269
725 3300035725 Ga0373947_0001850 Ga0373947_0001850_5597_6532 269
726 3300037068 Ga0373925_0002634 Ga0373925_0002634_438_1373 269
727 3300037312 Ga0395899_0151413 Ga0395899_0151413_15_941 269
728 3300037418 Ga0395900_0024104 Ga0395900_0024104_4840_5763 269
729 3300037471 Ga0395905_0005715 Ga0395905_0005715_3181_4107 269
730 3300038443 Ga0395901_0008887 Ga0395901_0008887_265_1188 269
731 3300039437 Ga0436365_1332159 Ga0436365_1332159_10229_11152 269
732 3300039438 Ga0436360_0397761 Ga0436360_0397761_552_1475 269
733 3300044658 Ga0466972_0102909 Ga0466972_0102909_379_1314 269
734 3300045976 Ga0466967_0056649 Ga0466967_0056649_602_1525 269
735 3300046455 Ga0495603_0000191 Ga0495603_0000191_30171_31106 269
736 3300046455 Ga0495603_0057360 Ga0495603_0057360_613_1542 269
737 3300046459 Ga0495629_0000500 Ga0495629_0000500_2428_3363 269
738 3300046459 Ga0495629_0213745 Ga0495629_0213745_300_1229 269
739 3300046460 Ga0495638_0007358 Ga0495638_0007358_768_1703 269
740 3300046461 Ga0495641_0001436 Ga0495641_0001436_17346_18281 269
741 3300046461 Ga0495641_0034301 Ga0495641_0034301_1126_2049 269
742 3300046471 Ga0495650_0055284 Ga0495650_0055284_512_1447 269
743 3300046472 Ga0495580_0004694 Ga0495580_0004694_7352_8287 269
744 3300046473 Ga0495582_0000251 Ga0495582_0000251_3377_4312 269
745 3300046473 Ga0495582_0097618 Ga0495582_0097618_478_1401 269
746 3300046475 Ga0495639_0000077 Ga0495639_0000077_30448_31383 269
747 3300046476 Ga0495662_0005023 Ga0495662_0005023_531_1466 269
748 3300046477 Ga0495664_0103614 Ga0495664_0103614_153_1088 269
749 3300046499 Ga0495594_0000648 Ga0495594_0000648_2109_3044 269
750 3300046499 Ga0495594_0158741 Ga0495594_0158741_211_1140 269
751 3300046507 Ga0495606_0134615 Ga0495606_0134615_487_1422 269
752 3300046514 Ga0495618_0004363 Ga0495618_0004363_65_994 269
753 3300046516 Ga0495628_0058528 Ga0495628_0058528_299_1234 269
754 3300046517 Ga0495630_0001279 Ga0495630_0001279_9987_10922 269
755 3300046517 Ga0495630_0081797 Ga0495630_0081797_834_1757 269
756 3300046526 Ga0495666_0006830 Ga0495666_0006830_4272_5207 269
757 3300046529 Ga0495652_0086038 Ga0495652_0086038_486_1415 269
758 3300046530 Ga0495654_0108789 Ga0495654_0108789_178_1113 269
759 3300046531 Ga0495665_0010232 Ga0495665_0010232_1220_2155 269
760 3300046531 Ga0495665_0041442 Ga0495665_0041442_361_1284 269
761 3300046533 Ga0495640_0036563 Ga0495640_0036563_2469_3404 269
762 3300046533 Ga0495640_0101176 Ga0495640_0101176_345_1274 269
763 3300046543 Ga0495645_0052732 Ga0495645_0052732_255_1178 269
764 3300046557 Ga0495622_0047072 Ga0495622_0047072_136_1071 269
765 3300046559 Ga0495667_0011827 Ga0495667_0011827_90_1025 269
766 3300046642 Ga0495634_0001976 Ga0495634_0001976_9019_9954 269
767 3300046642 Ga0495634_0028188 Ga0495634_0028188_1243_2172 269
768 3300046674 Ga0495588_0004422 Ga0495588_0004422_873_1808 269
769 3300046674 Ga0495588_0137964 Ga0495588_0137964_246_1175 269
770 3300046681 Ga0495647_0006505 Ga0495647_0006505_2924_3859 269
771 3300046683 Ga0495658_0001615 Ga0495658_0001615_5616_6551 269
772 3300046689 Ga0495613_0013924 Ga0495613_0013924_4377_5312 269
773 3300046690 Ga0495624_0002021 Ga0495624_0002021_8985_9920 269
774 3300047315 Ga0495581_0000503 Ga0495581_0000503_10049_10984 269
775 3300047318 Ga0495636_0044727 Ga0495636_0044727_739_1674 269
776 3300047319 Ga0495674_0009848 Ga0495674_0009848_7548_8483 269
777 3300047319 Ga0495674_0115449 Ga0495674_0115449_529_1458 269
778 3300047321 Ga0495676_0024072 Ga0495676_0024072_4141_5076 269
779 3300047321 Ga0495676_0086955 Ga0495676_0086955_1048_1989 269
780 3300047471 Ga0495684_0009241 Ga0495684_0009241_777_1712 269
781 3300047673 Ga0495593_0000192 Ga0495593_0000192_807_1742 269
782 3300048904 Ga0496101_0078520 Ga0496101_0078520_1469_2404 269
783 3300048904 Ga0496101_0107664 Ga0496101_0107664_988_1914 269
784 3300048905 Ga0496102_0005027 Ga0496102_0005027_9269_10195 269
785 3300048905 Ga0496102_0385121 Ga0496102_0385121_62_997 269
786 3300048906 Ga0496103_0154925 Ga0496103_0154925_314_1249 269
787 3300048907 Ga0496104_0024050 Ga0496104_0024050_145_1071 269
788 3300048908 Ga0496105_0059963 Ga0496105_0059963_893_1819 269
789 3300048909 Ga0496106_0029886 Ga0496106_0029886_874_1800 269
790 3300048909 Ga0496106_0062487 Ga0496106_0062487_80_1009 269
791 3300048909 Ga0496106_0086806 Ga0496106_0086806_534_1469 269
792 3300048909 Ga0496106_0101477 Ga0496106_0101477_1255_2190 269
793 3300048910 Ga0496107_0002006 Ga0496107_0002006_9998_10924 269
794 3300048911 Ga0496108_0074605 Ga0496108_0074605_1132_2058 269
795 3300048912 Ga0496109_0050639 Ga0496109_0050639_197_1132 269
796 3300048914 Ga0496111_0007689 Ga0496111_0007689_992_1918 269
797 3300048915 Ga0496112_0089544 Ga0496112_0089544_1443_2369 269
798 3300048915 Ga0496112_0095564 Ga0496112_0095564_707_1642 269
799 3300048915 Ga0496112_0248644 Ga0496112_0248644_76_999 269
800 3300048917 Ga0496114_0139573 Ga0496114_0139573_334_1260 269
801 3300048918 Ga0496115_0010097 Ga0496115_0010097_369_1295 269
802 3300048918 Ga0496115_0087561 Ga0496115_0087561_465_1394 269
803 3300048924 Ga0496121_0046153 Ga0496121_0046153_1365_2300 269
804 3300048924 Ga0496121_0053188 Ga0496121_0053188_1068_1991 269
805 3300048927 Ga0496124_0038332 Ga0496124_0038332_2738_3673 269
806 3300048928 Ga0496125_0129292 Ga0496125_0129292_95_1030 269
807 3300048929 Ga0496126_0015822 Ga0496126_0015822_4045_4980 269
808 3300048929 Ga0496126_0046943 Ga0496126_0046943_124_1059 269
809 3300048929 Ga0496126_0147080 Ga0496126_0147080_1038_1973 269
810 3300049590 Ga0501074_0010639 Ga0501074_0010639_300_1223 269
811 3300049742 Ga0501080_0047654 Ga0501080_0047654_2310_3233 269
812 3300050489 nmdc:mga03683_6799_c1 nmdc:mga03683_6799_c1_373_1308 269
813 3300050490 nmdc:mga03n38_35386_c1 nmdc:mga03n38_35386_c1_634_1569 269
814 3300050491 nmdc:mga00v17_17953_c1 nmdc:mga00v17_17953_c1_1669_2604 269
815 3300050491 nmdc:mga00v17_74993_c1 nmdc:mga00v17_74993_c1_462_1397 269
816 3300050492 nmdc:mga0yw44_27462_c1 nmdc:mga0yw44_27462_c1_1333_2268 269
817 3300050492 nmdc:mga0yw44_4056_c1 nmdc:mga0yw44_4056_c1_1089_2024 269
818 3300050494 nmdc:mga06z11_32554_c1 nmdc:mga06z11_32554_c1_935_1870 269
819 3300050512 nmdc:mga0n895_501674_c1 nmdc:mga0n895_501674_c1_253_1182 269
820 3300050513 nmdc:mga0rr50_224889_c1 nmdc:mga0rr50_224889_c1_557_1492 269
821 3300050515 nmdc:mga0a205_128879_c1 nmdc:mga0a205_128879_c1_98_1033 269
822 3300050515 nmdc:mga0a205_186895_c1 nmdc:mga0a205_186895_c1_127_1056 269
823 3300050516 nmdc:mga0sz30_100242_c1 nmdc:mga0sz30_100242_c1_210_1145 269
824 3300050516 nmdc:mga0sz30_69089_c1 nmdc:mga0sz30_69089_c1_508_1443 269
825 3300053077 Ga0495601_0002007 Ga0495601_0002007_8797_9726 269
826 3300053077 Ga0495601_0011998 Ga0495601_0011998_36_959 269
827 3300053078 Ga0495612_0058965 Ga0495612_0058965_483_1406 269
828 3300053090 Ga0500646_0037473 Ga0500646_0037473_326_1261 269
829 3300053092 Ga0500583_0010336 Ga0500583_0010336_503_1438 269
830 3300053096 Ga0500641_0002427 Ga0500641_0002427_5190_6125 269
831 3300053126 Ga0500621_084533 Ga0500621_084533_307_1242 269
832 3300053142 Ga0500577_0022636 Ga0500577_0022636_155_1090 269
833 3300053147 Ga0500589_086646 Ga0500589_086646_274_1209 269
834 3300053148 Ga0500590_051391 Ga0500590_051391_1080_2015 269
835 3300005293 Ga0065715_10217763 Ga0065715_102177631 270
836 3300005329 Ga0070683_100041212 Ga0070683_1000412123 270
837 3300005334 Ga0068869_100050471 Ga0068869_1000504712 270
838 3300005340 Ga0070689_100033581 Ga0070689_1000335814 270
839 3300005344 Ga0070661_100165290 Ga0070661_1001652902 270
840 3300005347 Ga0070668_100099635 Ga0070668_1000996353 270
841 3300005347 Ga0070668_100116199 Ga0070668_1001161993 270
842 3300005355 Ga0070671_100022517 Ga0070671_1000225173 270
843 3300005356 Ga0070674_100049702 Ga0070674_1000497022 270
844 3300005356 Ga0070674_100204294 Ga0070674_1002042942 270
845 3300005434 Ga0070709_10015645 Ga0070709_100156452 270
846 3300005436 Ga0070713_100017182 Ga0070713_1000171823 270
847 3300005436 Ga0070713_100027421 Ga0070713_1000274212 270
848 3300005436 Ga0070713_100133501 Ga0070713_1001335012 270
849 3300005439 Ga0070711_100053361 Ga0070711_1000533612 270
850 3300005440 Ga0070705_100049326 Ga0070705_1000493263 270
851 3300005455 Ga0070663_100029202 Ga0070663_1000292022 270
852 3300005456 Ga0070678_100128246 Ga0070678_1001282462 270
853 3300005456 Ga0070678_100289662 Ga0070678_1002896621 270
854 3300005468 Ga0070707_100408249 Ga0070707_1004082492 270
855 3300005468 Ga0070707_100585981 Ga0070707_1005859811 270
856 3300005536 Ga0070697_100264693 Ga0070697_1002646932 270
857 3300005547 Ga0070693_100086725 Ga0070693_1000867252 270
858 3300005547 Ga0070693_100115954 Ga0070693_1001159542 270
859 3300005548 Ga0070665_100047493 Ga0070665_1000474933 270
860 3300005548 Ga0070665_100125278 Ga0070665_1001252782 270
861 3300005578 Ga0068854_100095374 Ga0068854_1000953742 270
862 3300005614 Ga0068856_100061730 Ga0068856_1000617303 270
863 3300005616 Ga0068852_100013291 Ga0068852_1000132915 270
864 3300005617 Ga0068859_100126726 Ga0068859_1001267263 270
865 3300005981 Ga0081538_10084587 Ga0081538_100845872 270
866 3300006028 Ga0070717_10012075 Ga0070717_100120755 270
867 3300006038 Ga0075365_10095104 Ga0075365_100951042 270
868 3300006038 Ga0075365_10245809 Ga0075365_102458092 270
869 3300006048 Ga0075363_100033290 Ga0075363_1000332903 270
870 3300006173 Ga0070716_100282791 Ga0070716_1002827911 270
871 3300006177 Ga0075362_10008698 Ga0075362_100086984 270
872 3300006237 Ga0097621_100015591 Ga0097621_1000155912 270
873 3300006237 Ga0097621_100302737 Ga0097621_1003027372 270
874 3300006353 Ga0075370_10042546 Ga0075370_100425463 270
875 3300006358 Ga0068871_100058455 Ga0068871_1000584557 270
876 3300006358 Ga0068871_100282859 Ga0068871_1002828592 270
877 3300006847 Ga0075431_100080362 Ga0075431_1000803623 270
878 3300006914 Ga0075436_100106612 Ga0075436_1001066122 270
879 3300006931 Ga0097620_100126724 Ga0097620_1001267242 270
880 3300007076 Ga0075435_100086734 Ga0075435_1000867342 270
881 3300009094 Ga0111539_10152809 Ga0111539_101528093 270
882 3300009098 Ga0105245_10016531 Ga0105245_1001653110 270
883 3300009147 Ga0114129_10259532 Ga0114129_102595322 270
884 3300009148 Ga0105243_10024180 Ga0105243_100241802 270
885 3300009176 Ga0105242_10143341 Ga0105242_101433412 270
886 3300009177 Ga0105248_10173205 Ga0105248_101732052 270
887 3300009545 Ga0105237_10020331 Ga0105237_100203313 270
888 3300010375 Ga0105239_10050388 Ga0105239_100503884 270
889 3300013296 Ga0157374_10030713 Ga0157374_100307132 270
890 3300013297 Ga0157378_10073506 Ga0157378_100735062 270
891 3300013306 Ga0163162_10126578 Ga0163162_101265781 270
892 3300014968 Ga0157379_10013061 Ga0157379_100130616 270
893 3300021384 Ga0213876_10008542 Ga0213876_100085424 270
894 3300025898 Ga0207692_10002762 Ga0207692_100027625 270
895 3300025903 Ga0207680_10049455 Ga0207680_100494553 270
896 3300025915 Ga0207693_10008856 Ga0207693_100088565 270
897 3300025915 Ga0207693_10025038 Ga0207693_100250384 270
898 3300025915 Ga0207693_10141462 Ga0207693_101414621 270
899 3300025916 Ga0207663_10030653 Ga0207663_100306532 270
900 3300025916 Ga0207663_10081534 Ga0207663_100815342 270
901 3300025916 Ga0207663_10087968 Ga0207663_100879682 270
902 3300025917 Ga0207660_10036684 Ga0207660_100366843 270
903 3300025918 Ga0207662_10021026 Ga0207662_100210264 270
904 3300025919 Ga0207657_10202318 Ga0207657_102023182 270
905 3300025927 Ga0207687_10006623 Ga0207687_100066235 270
906 3300025928 Ga0207700_10008693 Ga0207700_100086934 270
907 3300025928 Ga0207700_10114025 Ga0207700_101140251 270
908 3300025928 Ga0207700_10410988 Ga0207700_104109882 270
909 3300025929 Ga0207664_10356465 Ga0207664_103564651 270
910 3300025931 Ga0207644_10031003 Ga0207644_100310032 270
911 3300025933 Ga0207706_10048856 Ga0207706_100488562 270
912 3300025934 Ga0207686_10002523 Ga0207686_1000252315 270
913 3300025934 Ga0207686_10388238 Ga0207686_103882382 270
914 3300025936 Ga0207670_10139115 Ga0207670_101391152 270
915 3300025937 Ga0207669_10053533 Ga0207669_100535332 270
916 3300025937 Ga0207669_10183307 Ga0207669_101833072 270
917 3300025939 Ga0207665_10004210 Ga0207665_100042101 270
918 3300025939 Ga0207665_10074153 Ga0207665_100741532 270
919 3300025941 Ga0207711_10174201 Ga0207711_101742012 270
920 3300025961 Ga0207712_10226556 Ga0207712_102265562 270
921 3300025986 Ga0207658_10152688 Ga0207658_101526882 270
922 3300026035 Ga0207703_10092292 Ga0207703_100922922 270
923 3300026078 Ga0207702_10571670 Ga0207702_105716701 270
924 3300026121 Ga0207683_10286337 Ga0207683_102863372 270
925 3300026142 Ga0207698_10067119 Ga0207698_100671193 270
926 3300028379 Ga0268266_10011342 Ga0268266_100113424 270
927 3300028379 Ga0268266_10020054 Ga0268266_100200545 270
928 3300028380 Ga0268265_10152422 Ga0268265_101524222 270
929 3300028794 Ga0307515_10026041 Ga0307515_100260415 270
930 3300031241 Ga0265325_10000043 Ga0265325_1000004376 270
931 3300031507 Ga0307509_10022940 Ga0307509_100229404 270
932 3300031507 Ga0307509_10049198 Ga0307509_100491982 270
933 3300031616 Ga0307508_10041944 Ga0307508_100419441 270
934 3300031730 Ga0307516_10014561 Ga0307516_100145614 270
935 3300033180 Ga0307510_10020196 Ga0307510_100201964 270
936 3300033180 Ga0307510_10045128 Ga0307510_100451282 270
937 3300034957 Ga0373938_0001269 Ga0373938_0001269_2153_3082 270
938 3300035085 Ga0373929_0007251 Ga0373929_0007251_809_1738 270
939 3300035091 Ga0373951_0001763 Ga0373951_0001763_2443_3372 270
940 3300035112 Ga0373932_0008188 Ga0373932_0008188_164_1093 270
941 3300035117 Ga0373953_0014317 Ga0373953_0014317_561_1490 270
942 3300035117 Ga0373953_0036060 Ga0373953_0036060_275_1204 270
943 3300035118 Ga0373954_0003393 Ga0373954_0003393_2188_3117 270
944 3300035120 Ga0373957_0002675 Ga0373957_0002675_2706_3635 270
945 3300035120 Ga0373957_0037462 Ga0373957_0037462_586_1515 270
946 3300035121 Ga0373960_0004833 Ga0373960_0004833_27_956 270
947 3300035171 Ga0373946_0027952 Ga0373946_0027952_274_1200 270
948 3300035172 Ga0373955_0005963 Ga0373955_0005963_3587_4516 270
949 3300035207 Ga0373942_0007790 Ga0373942_0007790_981_1910 270
950 3300035241 Ga0373961_0003644 Ga0373961_0003644_2530_3459 270
951 3300035242 Ga0373962_0006379 Ga0373962_0006379_501_1430 270
952 3300035242 Ga0373962_0028456 Ga0373962_0028456_105_1034 270
953 3300035691 Ga0373931_0001610 Ga0373931_0001610_7902_8831 270
954 3300035691 Ga0373931_0002892 Ga0373931_0002892_6544_7479 270
955 3300035692 Ga0373935_0270463 Ga0373935_0270463_52_987 270
956 3300035724 Ga0373933_0001224 Ga0373933_0001224_7569_8498 270
957 3300035724 Ga0373933_0027733 Ga0373933_0027733_1492_2421 270
958 3300035725 Ga0373947_0004860 Ga0373947_0004860_1054_1989 270
959 3300035725 Ga0373947_0045834 Ga0373947_0045834_1223_2152 270
960 3300035725 Ga0373947_0338229 Ga0373947_0338229_56_985 270
961 3300036401 Ga0373937_0000849 Ga0373937_0000849_3608_4537 270
962 3300036401 Ga0373937_0005174 Ga0373937_0005174_6499_7428 270
963 3300037068 Ga0373925_0007329 Ga0373925_0007329_4164_5093 270
964 3300037068 Ga0373925_0043229 Ga0373925_0043229_922_1851 270
965 3300037068 Ga0373925_0061697 Ga0373925_0061697_618_1544 270
966 3300037068 Ga0373925_0086890 Ga0373925_0086890_900_1835 270
967 3300037068 Ga0373925_0475179 Ga0373925_0475179_21_950 270
968 3300037312 Ga0395899_0008367 Ga0395899_0008367_746_1669 270
969 3300037418 Ga0395900_0005495 Ga0395900_0005495_11840_12763 270
970 3300037466 Ga0395898_0011929 Ga0395898_0011929_5265_6188 270
971 3300037466 Ga0395898_0030991 Ga0395898_0030991_599_1519 270
972 3300038443 Ga0395901_0013824 Ga0395901_0013824_3001_3921 270
973 3300038443 Ga0395901_0024243 Ga0395901_0024243_3278_4201 270
974 3300039437 Ga0436365_1728616 Ga0436365_1728616_11086_12015 270
975 3300039447 Ga0436361_0170540 Ga0436361_0170540_723_1601 270
976 3300039447 Ga0436361_0258392 Ga0436361_0258392_9303_10181 270
977 3300039447 Ga0436361_1085109 Ga0436361_1085109_3667_4545 270
978 3300039453 Ga0436362_0706806 Ga0436362_0706806_33_962 270
979 3300041512 Ga0451853_2997487 Ga0451853_2997487_93_971 270
980 3300046452 Ga0495617_009193 Ga0495617_009193_2202_3143 270
981 3300046454 Ga0495592_0008439 Ga0495592_0008439_4558_5487 270
982 3300046454 Ga0495592_0040706 Ga0495592_0040706_842_1771 270
983 3300046455 Ga0495603_0022508 Ga0495603_0022508_1977_2906 270
984 3300046457 Ga0495590_0047805 Ga0495590_0047805_444_1385 270
985 3300046459 Ga0495629_0002009 Ga0495629_0002009_6599_7528 270
986 3300046462 Ga0495651_0020012 Ga0495651_0020012_3773_4702 270
987 3300046463 Ga0495653_0004970 Ga0495653_0004970_4255_5184 270
988 3300046463 Ga0495653_0162695 Ga0495653_0162695_100_1035 270
989 3300046463 Ga0495653_0172605 Ga0495653_0172605_516_1445 270
990 3300046477 Ga0495664_0028466 Ga0495664_0028466_460_1389 270
991 3300046499 Ga0495594_0005302 Ga0495594_0005302_5252_6181 270
992 3300046499 Ga0495594_0056316 Ga0495594_0056316_744_1685 270
993 3300046511 Ga0495608_0004206 Ga0495608_0004206_3855_4784 270
994 3300046516 Ga0495628_0015917 Ga0495628_0015917_4926_5855 270
995 3300046516 Ga0495628_0020992 Ga0495628_0020992_880_1809 270
996 3300046529 Ga0495652_0009266 Ga0495652_0009266_311_1240 270
997 3300046529 Ga0495652_0036766 Ga0495652_0036766_531_1460 270
998 3300046531 Ga0495665_0086664 Ga0495665_0086664_13_942 270
999 3300046533 Ga0495640_0016685 Ga0495640_0016685_2835_3764 270
1000 3300046535 Ga0495586_0005929 Ga0495586_0005929_3775_4704 270
1001 3300046536 Ga0495587_0003095 Ga0495587_0003095_6488_7417 270
1002 3300046543 Ga0495645_0003434 Ga0495645_0003434_2681_3610 270
1003 3300046543 Ga0495645_0027661 Ga0495645_0027661_2181_3110 270
1004 3300046559 Ga0495667_0001067 Ga0495667_0001067_6699_7628 270
1005 3300046559 Ga0495667_0038742 Ga0495667_0038742_1706_2635 270
1006 3300046615 Ga0495656_0040172 Ga0495656_0040172_444_1385 270
1007 3300046642 Ga0495634_0152570 Ga0495634_0152570_314_1243 270
1008 3300046663 Ga0495635_0011539 Ga0495635_0011539_3722_4651 270
1009 3300046664 Ga0495659_0060730 Ga0495659_0060730_396_1337 270
1010 3300046674 Ga0495588_0008434 Ga0495588_0008434_455_1396 270
1011 3300046675 Ga0495657_0007463 Ga0495657_0007463_4615_5544 270
1012 3300046678 Ga0495599_0002462 Ga0495599_0002462_7618_8547 270
1013 3300046678 Ga0495599_0075833 Ga0495599_0075833_164_1093 270
1014 3300046679 Ga0495623_0004291 Ga0495623_0004291_3286_4215 270
1015 3300046680 Ga0495646_0002070 Ga0495646_0002070_6471_7400 270
1016 3300046681 Ga0495647_0077526 Ga0495647_0077526_360_1301 270
1017 3300046684 Ga0495669_0091255 Ga0495669_0091255_421_1362 270
1018 3300046689 Ga0495613_0033991 Ga0495613_0033991_693_1622 270
1019 3300046690 Ga0495624_0167822 Ga0495624_0167822_308_1237 270
1020 3300046809 Ga0495600_0004625 Ga0495600_0004625_832_1761 270
1021 3300046809 Ga0495600_0037163 Ga0495600_0037163_573_1502 270
1022 3300047317 Ga0495604_0003694 Ga0495604_0003694_4767_5696 270
1023 3300047317 Ga0495604_0009091 Ga0495604_0009091_6889_7818 270
1024 3300047319 Ga0495674_0020453 Ga0495674_0020453_3982_4911 270
1025 3300047319 Ga0495674_0061451 Ga0495674_0061451_1395_2324 270
1026 3300047321 Ga0495676_0067865 Ga0495676_0067865_869_1798 270
1027 3300047321 Ga0495676_0325275 Ga0495676_0325275_86_1015 270
1028 3300047322 Ga0495680_0013445 Ga0495680_0013445_323_1252 270
1029 3300047322 Ga0495680_0227130 Ga0495680_0227130_332_1261 270
1030 3300047444 Ga0495675_0001338 Ga0495675_0001338_6491_7420 270
1031 3300047673 Ga0495593_0043803 Ga0495593_0043803_686_1615 270
1032 3300048088 Ga0495602_0002392 Ga0495602_0002392_11624_12553 270
1033 3300048088 Ga0495602_0082663 Ga0495602_0082663_121_1050 270
1034 3300048903 Ga0496100_0021053 Ga0496100_0021053_561_1490 270
1035 3300048904 Ga0496101_0001972 Ga0496101_0001972_3233_4162 270
1036 3300048906 Ga0496103_0074579 Ga0496103_0074579_35_970 270
1037 3300048907 Ga0496104_0000800 Ga0496104_0000800_14671_15600 270
1038 3300048907 Ga0496104_0005554 Ga0496104_0005554_6846_7775 270
1039 3300048908 Ga0496105_0002481 Ga0496105_0002481_3088_4017 270
1040 3300048908 Ga0496105_0041034 Ga0496105_0041034_790_1719 270
1041 3300048908 Ga0496105_0115950 Ga0496105_0115950_897_1832 270
1042 3300048909 Ga0496106_0001140 Ga0496106_0001140_15874_16809 270
1043 3300048909 Ga0496106_0086090 Ga0496106_0086090_685_1620 270
1044 3300048910 Ga0496107_0028349 Ga0496107_0028349_618_1547 270
1045 3300048912 Ga0496109_0047382 Ga0496109_0047382_2151_3086 270
1046 3300048912 Ga0496109_0056823 Ga0496109_0056823_660_1589 270
1047 3300048912 Ga0496109_0114108 Ga0496109_0114108_899_1828 270
1048 3300048912 Ga0496109_0159363 Ga0496109_0159363_959_1900 270
1049 3300048912 Ga0496109_0337880 Ga0496109_0337880_92_1021 270
1050 3300048913 Ga0496110_0017791 Ga0496110_0017791_4302_5237 270
1051 3300048913 Ga0496110_0059437 Ga0496110_0059437_1300_2229 270
1052 3300048913 Ga0496110_0066950 Ga0496110_0066950_1682_2611 270
1053 3300048914 Ga0496111_0016639 Ga0496111_0016639_421_1356 270
1054 3300048915 Ga0496112_0054974 Ga0496112_0054974_856_1791 270
1055 3300048916 Ga0496113_0033171 Ga0496113_0033171_344_1279 270
1056 3300048917 Ga0496114_0014349 Ga0496114_0014349_668_1597 270
1057 3300048917 Ga0496114_0037960 Ga0496114_0037960_1323_2258 270
1058 3300048918 Ga0496115_0010848 Ga0496115_0010848_3257_4186 270
1059 3300048918 Ga0496115_0011545 Ga0496115_0011545_5475_6404 270
1060 3300048918 Ga0496115_0036375 Ga0496115_0036375_2948_3883 270
1061 3300048918 Ga0496115_0096383 Ga0496115_0096383_694_1689 270
1062 3300048918 Ga0496115_0367682 Ga0496115_0367682_89_1024 270
1063 3300048920 Ga0496117_0032448 Ga0496117_0032448_263_1198 270
1064 3300048921 Ga0496118_0003337 Ga0496118_0003337_19116_20051 270
1065 3300048924 Ga0496121_0000458 Ga0496121_0000458_74644_75579 270
1066 3300048924 Ga0496121_0000668 Ga0496121_0000668_41954_42889 270
1067 3300048927 Ga0496124_0018892 Ga0496124_0018892_358_1293 270
1068 3300049592 Ga0501076_0240406 Ga0501076_0240406_240_1196 270
1069 3300049741 Ga0501079_0188704 Ga0501079_0188704_609_1565 270
1070 3300050489 nmdc:mga03683_103245_c1 nmdc:mga03683_103245_c1_13_951 270
1071 3300050490 nmdc:mga03n38_4227_c1 nmdc:mga03n38_4227_c1_2547_3482 270
1072 3300050494 nmdc:mga06z11_8844_c1 nmdc:mga06z11_8844_c1_3021_3956 270
1073 3300050496 nmdc:mga07m45_23167_c1 nmdc:mga07m45_23167_c1_392_1327 270
1074 3300050513 nmdc:mga0rr50_16958_c1 nmdc:mga0rr50_16958_c1_783_1712 270
1075 3300053077 Ga0495601_0000069 Ga0495601_0000069_1717_2646 270
1076 3300053077 Ga0495601_0015995 Ga0495601_0015995_2003_2932 270
1077 3300053077 Ga0495601_0264609 Ga0495601_0264609_45_980 270
1078 3300053078 Ga0495612_0001538 Ga0495612_0001538_6953_7882 270
1079 3300053078 Ga0495612_0002794 Ga0495612_0002794_2308_3237 270
1080 3300053084 Ga0495595_0002192 Ga0495595_0002192_6478_7407 270
1081 3300053084 Ga0495595_0021717 Ga0495595_0021717_991_1920 270
1082 3300053085 Ga0495619_0000546 Ga0495619_0000546_11419_12348 270
1083 3300053085 Ga0495619_0006319 Ga0495619_0006319_4218_5147 270
1084 3300053085 Ga0495619_0030373 Ga0495619_0030373_40_975 270
1085 3300053085 Ga0495619_0054428 Ga0495619_0054428_44_973 270
1086 3300053119 Ga0500595_002270 Ga0500595_002270_2901_3836 270
1087 3300053134 Ga0500658_0040668 Ga0500658_0040668_767_1708 270
1088 3300053139 Ga0500568_0008676 Ga0500568_0008676_1271_2206 270
1089 3300053730 Ga0500645_009286 Ga0500645_009286_47_988 270
1090 3300054114 Ga0501084_0033512 Ga0501084_0033512_3141_4097 270
1091 iso_pu_bacteria 2885409591 2885410475 270
1092 3300003203 JGI25406J46586_10000093 JGI25406J46586_100000937 271
1093 3300005337 Ga0070682_100045105 Ga0070682_1000451051 271
1094 3300005434 Ga0070709_10398850 Ga0070709_103988501 271
1095 3300005458 Ga0070681_10023087 Ga0070681_100230875 271
1096 3300005983 Ga0081540_1000178 Ga0081540_100017848 271
1097 3300005985 Ga0081539_10000140 Ga0081539_1000014025 271
1098 3300006038 Ga0075365_10165362 Ga0075365_101653622 271
1099 3300006175 Ga0070712_100097299 Ga0070712_1000972993 271
1100 3300006844 Ga0075428_100036724 Ga0075428_1000367242 271
1101 3300006846 Ga0075430_100004728 Ga0075430_1000047289 271
1102 3300006847 Ga0075431_100042672 Ga0075431_1000426724 271
1103 3300006852 Ga0075433_10025950 Ga0075433_100259506 271
1104 3300006871 Ga0075434_100016025 Ga0075434_1000160257 271
1105 3300006880 Ga0075429_100044200 Ga0075429_1000442002 271
1106 3300007076 Ga0075435_100102296 Ga0075435_1001022963 271
1107 3300007076 Ga0075435_100402241 Ga0075435_1004022411 271
1108 3300009094 Ga0111539_10010943 Ga0111539_100109438 271
1109 3300009147 Ga0114129_10014380 Ga0114129_100143806 271
1110 3300009147 Ga0114129_10023161 Ga0114129_100231615 271
1111 3300025928 Ga0207700_10089251 Ga0207700_100892512 271
1112 3300026041 Ga0207639_10145600 Ga0207639_101456002 271
1113 3300027671 Ga0209588_1013551 Ga0209588_10135512 271
1114 3300027907 Ga0207428_10005357 Ga0207428_100053577 271
1115 3300031235 Ga0265330_10058226 Ga0265330_100582262 271
1116 3300032002 Ga0307416_100430734 Ga0307416_1004307342 271
1117 3300032005 Ga0307411_10014692 Ga0307411_100146924 271
1118 3300032126 Ga0307415_100075619 Ga0307415_1000756193 271
1119 3300035114 Ga0373939_0002148 Ga0373939_0002148_246_1175 271
1120 3300035695 Ga0373927_0003772 Ga0373927_0003772_4239_5177 271
1121 3300038443 Ga0395901_0114391 Ga0395901_0114391_1733_2656 271
1122 3300048908 Ga0496105_0232230 Ga0496105_0232230_291_1214 271
1123 3300048915 Ga0496112_0000004 Ga0496112_0000004_315244_316179 271
1124 3300049579 Ga0501043_0196420 Ga0501043_0196420_84_1007 271
1125 3300049822 Ga0501035_0266080 Ga0501035_0266080_76_999 271
1126 3300049823 Ga0501044_0127991 Ga0501044_0127991_57_980 271
1127 3300050492 nmdc:mga0yw44_85308_c1 nmdc:mga0yw44_85308_c1_189_1112 271
1128 3300050507 nmdc:mga05p37_6528_c1 nmdc:mga05p37_6528_c1_8376_9305 271
1129 3300050507 nmdc:mga05p37_9682_c1 nmdc:mga05p37_9682_c1_4149_5078 271
1130 3300050508 nmdc:mga09592_2996_c1 nmdc:mga09592_2996_c1_8050_8979 271
1131 3300050509 nmdc:mga0qj67_3244_c1 nmdc:mga0qj67_3244_c1_6318_7247 271
1132 3300050510 nmdc:mga06r32_4964_c1 nmdc:mga06r32_4964_c1_4717_5646 271
1133 3300050511 nmdc:mga08y16_5147_c1 nmdc:mga08y16_5147_c1_4685_5614 271
1134 3300050512 nmdc:mga0n895_11200_c1 nmdc:mga0n895_11200_c1_324_1253 271
1135 3300050512 nmdc:mga0n895_214685_c1 nmdc:mga0n895_214685_c1_941_1870 271
1136 3300050513 nmdc:mga0rr50_115989_c1 nmdc:mga0rr50_115989_c1_1112_2041 271
1137 3300050513 nmdc:mga0rr50_120978_c1 nmdc:mga0rr50_120978_c1_134_1063 271
1138 3300050515 nmdc:mga0a205_5270_c1 nmdc:mga0a205_5270_c1_4445_5374 271
1139 3300050515 nmdc:mga0a205_85003_c1 nmdc:mga0a205_85003_c1_66_995 271
1140 3300053080 Ga0500635_0000553 Ga0500635_0000553_686_1621 271
1141 3300053102 Ga0500554_034066 Ga0500554_034066_345_1280 271
1142 3300053150 Ga0500603_000352 Ga0500603_000352_10901_11836 271
1143 iso_pu_bacteria 2513237090 2513611658 271
1144 iso_pu_bacteria 2582581306 2585268518 271
1145 iso_pu_bacteria 2582581866 2585394048 271
1146 iso_pu_bacteria 2643221595 2643987169 271
1147 iso_pu_bacteria 2643221627 2644155719 271
1148 iso_pu_bacteria 2643221651 2644291349 271
1149 iso_pu_bacteria 2841734538 2841740583 271
1150 iso_pu_bacteria 2856314179 2856315395 271
1151 iso_pu_bacteria 2869162929 2869166735 271
1152 iso_pu_bacteria 2871474448 2871478200 271
1153 iso_pu_bacteria 2874123672 2874128310 271
1154 iso_pu_bacteria 2876369609 2876369640 271
1155 iso_pu_bacteria 2878035449 2878036542 271
1156 iso_pu_bacteria 2878788777 2878789227 271
1157 iso_pu_bacteria 2881161766 2881162433 271
1158 iso_pu_bacteria 2885305155 2885311241 271
1159 iso_pu_bacteria 2885312484 2885316898 271
1160 iso_pu_bacteria 2885326080 2885326413 271
1161 iso_pu_bacteria 2885334103 2885334140 271
1162 iso_pu_bacteria 2906414383 2906415390 271
1163 iso_pu_bacteria 2937836603 2937839863 271
1164 iso_pu_bacteria 2958071322 2958075136 271
1165 iso_pu_bacteria 2977864932 2977872199 271
1166 iso_pu_bacteria 2996336353 2996339819 271
1167 iso_pu_bacteria 3003665799 3003668826 271
1168 iso_pu_bacteria 8004633249 8004634518 271
1169 3300001977 JGI24746J21847_1000078 JGI24746J21847_10000787 272
1170 3300001989 JGI24739J22299_10002225 JGI24739J22299_100022256 272
1171 3300001990 JGI24737J22298_10001972 JGI24737J22298_100019726 272
1172 3300002070 JGI24750J21931_1000188 JGI24750J21931_10001888 272
1173 3300002075 JGI24738J21930_10000068 JGI24738J21930_100000689 272
1174 3300002077 JGI24744J21845_10003094 JGI24744J21845_100030941 272
1175 3300002239 JGI24034J26672_10000731 JGI24034J26672_100007317 272
1176 3300002244 JGI24742J22300_10000912 JGI24742J22300_100009126 272
1177 3300005290 Ga0065712_10078559 Ga0065712_100785595 272
1178 3300005293 Ga0065715_10089172 Ga0065715_100891727 272
1179 3300005327 Ga0070658_10508686 Ga0070658_105086861 272
1180 3300005328 Ga0070676_10000363 Ga0070676_1000036310 272
1181 3300005328 Ga0070676_10150864 Ga0070676_101508641 272
1182 3300005329 Ga0070683_100004718 Ga0070683_1000047186 272
1183 3300005330 Ga0070690_100001828 Ga0070690_1000018288 272
1184 3300005330 Ga0070690_100059415 Ga0070690_1000594153 272
1185 3300005331 Ga0070670_100001134 Ga0070670_1000011348 272
1186 3300005333 Ga0070677_10000301 Ga0070677_1000030110 272
1187 3300005334 Ga0068869_100006712 Ga0068869_1000067126 272
1188 3300005336 Ga0070680_100014945 Ga0070680_1000149456 272
1189 3300005337 Ga0070682_100000719 Ga0070682_1000007197 272
1190 3300005338 Ga0068868_100020481 Ga0068868_1000204816 272
1191 3300005338 Ga0068868_100099040 Ga0068868_1000990402 272
1192 3300005339 Ga0070660_100000730 Ga0070660_10000073010 272
1193 3300005340 Ga0070689_100000601 Ga0070689_10000060110 272
1194 3300005341 Ga0070691_10001015 Ga0070691_100010157 272
1195 3300005343 Ga0070687_100000253 Ga0070687_1000002538 272
1196 3300005344 Ga0070661_100003564 Ga0070661_1000035647 272
1197 3300005345 Ga0070692_10000060 Ga0070692_100000609 272
1198 3300005347 Ga0070668_100028340 Ga0070668_1000283406 272
1199 3300005347 Ga0070668_100028662 Ga0070668_1000286622 272
1200 3300005353 Ga0070669_100000888 Ga0070669_10000088810 272
1201 3300005354 Ga0070675_100000441 Ga0070675_10000044116 272
1202 3300005355 Ga0070671_100001180 Ga0070671_1000011807 272
1203 3300005355 Ga0070671_100134323 Ga0070671_1001343232 272
1204 3300005356 Ga0070674_100000723 Ga0070674_1000007238 272
1205 3300005364 Ga0070673_100000456 Ga0070673_10000045610 272
1206 3300005365 Ga0070688_100000483 Ga0070688_10000048310 272
1207 3300005366 Ga0070659_100001763 Ga0070659_10000176310 272
1208 3300005367 Ga0070667_100004366 Ga0070667_1000043666 272
1209 3300005406 Ga0070703_10043715 Ga0070703_100437153 272
1210 3300005434 Ga0070709_10086130 Ga0070709_100861302 272
1211 3300005436 Ga0070713_100106979 Ga0070713_1001069792 272
1212 3300005438 Ga0070701_10000150 Ga0070701_1000015010 272
1213 3300005439 Ga0070711_100135095 Ga0070711_1001350951 272
1214 3300005440 Ga0070705_100004791 Ga0070705_1000047913 272
1215 3300005440 Ga0070705_100071873 Ga0070705_1000718732 272
1216 3300005441 Ga0070700_100001083 Ga0070700_1000010837 272
1217 3300005444 Ga0070694_100005807 Ga0070694_1000058079 272
1218 3300005455 Ga0070663_100001801 Ga0070663_1000018015 272
1219 3300005455 Ga0070663_100060550 Ga0070663_1000605503 272
1220 3300005455 Ga0070663_100108070 Ga0070663_1001080702 272
1221 3300005456 Ga0070678_100000199 Ga0070678_10000019915 272
1222 3300005456 Ga0070678_100040468 Ga0070678_1000404683 272
1223 3300005458 Ga0070681_10001398 Ga0070681_100013988 272
1224 3300005459 Ga0068867_100001623 Ga0068867_1000016236 272
1225 3300005466 Ga0070685_10000782 Ga0070685_1000078210 272
1226 3300005530 Ga0070679_100018692 Ga0070679_1000186925 272
1227 3300005535 Ga0070684_100008219 Ga0070684_10000821912 272
1228 3300005539 Ga0068853_100002281 Ga0068853_1000022818 272
1229 3300005543 Ga0070672_100001622 Ga0070672_1000016229 272
1230 3300005544 Ga0070686_100000746 Ga0070686_10000074610 272
1231 3300005544 Ga0070686_100364263 Ga0070686_1003642632 272
1232 3300005545 Ga0070695_100000553 Ga0070695_1000005537 272
1233 3300005547 Ga0070693_100000613 Ga0070693_1000006139 272
1234 3300005548 Ga0070665_100053248 Ga0070665_1000532482 272
1235 3300005548 Ga0070665_100223553 Ga0070665_1002235531 272
1236 3300005549 Ga0070704_100000423 Ga0070704_10000042310 272
1237 3300005563 Ga0068855_100004415 Ga0068855_1000044159 272
1238 3300005564 Ga0070664_100001312 Ga0070664_1000013126 272
1239 3300005577 Ga0068857_100010463 Ga0068857_1000104633 272
1240 3300005578 Ga0068854_100000827 Ga0068854_1000008274 272
1241 3300005614 Ga0068856_100001340 Ga0068856_10000134013 272
1242 3300005615 Ga0070702_100000293 Ga0070702_1000002934 272
1243 3300005616 Ga0068852_100082644 Ga0068852_1000826442 272
1244 3300005616 Ga0068852_100337945 Ga0068852_1003379452 272
1245 3300005617 Ga0068859_100001767 Ga0068859_1000017679 272
1246 3300005618 Ga0068864_100003544 Ga0068864_1000035447 272
1247 3300005718 Ga0068866_10000372 Ga0068866_100003727 272
1248 3300005834 Ga0068851_10095787 Ga0068851_100957871 272
1249 3300005834 Ga0068851_10187671 Ga0068851_101876711 272
1250 3300005840 Ga0068870_10000207 Ga0068870_100002077 272
1251 3300005842 Ga0068858_100004999 Ga0068858_10000499913 272
1252 3300005843 Ga0068860_100019087 Ga0068860_1000190872 272
1253 3300005844 Ga0068862_100002236 Ga0068862_1000022367 272
1254 3300006163 Ga0070715_10004793 Ga0070715_100047932 272
1255 3300006178 Ga0075367_10064271 Ga0075367_100642713 272
1256 3300006237 Ga0097621_100002408 Ga0097621_1000024089 272
1257 3300006237 Ga0097621_100020998 Ga0097621_1000209983 272
1258 3300006358 Ga0068871_100002267 Ga0068871_1000022679 272
1259 3300006358 Ga0068871_100067539 Ga0068871_1000675393 272
1260 3300006844 Ga0075428_100032160 Ga0075428_1000321605 272
1261 3300006852 Ga0075433_10236534 Ga0075433_102365342 272
1262 3300006871 Ga0075434_100007264 Ga0075434_1000072646 272
1263 3300006881 Ga0068865_100000537 Ga0068865_10000053710 272
1264 3300006931 Ga0097620_100001767 Ga0097620_1000017679 272
1265 3300009093 Ga0105240_10091802 Ga0105240_100918026 272
1266 3300009094 Ga0111539_10000665 Ga0111539_1000066520 272
1267 3300009094 Ga0111539_10008569 Ga0111539_100085693 272
1268 3300009098 Ga0105245_10000888 Ga0105245_1000088818 272
1269 3300009098 Ga0105245_10172820 Ga0105245_101728202 272
1270 3300009101 Ga0105247_10001292 Ga0105247_100012925 272
1271 3300009148 Ga0105243_10004807 Ga0105243_100048078 272
1272 3300009174 Ga0105241_10000662 Ga0105241_1000066217 272
1273 3300009176 Ga0105242_10001202 Ga0105242_1000120210 272
1274 3300009177 Ga0105248_10002336 Ga0105248_1000233610 272
1275 3300009177 Ga0105248_10302045 Ga0105248_103020452 272
1276 3300009553 Ga0105249_10001808 Ga0105249_1000180810 272
1277 3300010375 Ga0105239_10018370 Ga0105239_100183704 272
1278 3300011119 Ga0105246_10004623 Ga0105246_100046236 272
1279 3300013102 Ga0157371_10091223 Ga0157371_100912233 272
1280 3300013296 Ga0157374_10172666 Ga0157374_101726663 272
1281 3300013297 Ga0157378_10022520 Ga0157378_100225204 272
1282 3300013297 Ga0157378_10237215 Ga0157378_102372151 272
1283 3300013306 Ga0163162_10009182 Ga0163162_100091827 272
1284 3300013307 Ga0157372_10038501 Ga0157372_100385012 272
1285 3300013308 Ga0157375_10001031 Ga0157375_1000103110 272
1286 3300014325 Ga0163163_10034596 Ga0163163_100345962 272
1287 3300014325 Ga0163163_10473972 Ga0163163_104739722 272
1288 3300014326 Ga0157380_10000726 Ga0157380_100007267 272
1289 3300014745 Ga0157377_10000324 Ga0157377_100003248 272
1290 3300014968 Ga0157379_10001193 Ga0157379_100011937 272
1291 3300017792 Ga0163161_10001040 Ga0163161_1000104010 272
1292 3300017792 Ga0163161_10066765 Ga0163161_100667653 272
1293 3300025271 Ga0207666_1000034 Ga0207666_100003410 272
1294 3300025290 Ga0207673_1001005 Ga0207673_10010053 272
1295 3300025315 Ga0207697_10000280 Ga0207697_1000028010 272
1296 3300025885 Ga0207653_10001427 Ga0207653_100014276 272
1297 3300025893 Ga0207682_10000134 Ga0207682_1000013421 272
1298 3300025899 Ga0207642_10002338 Ga0207642_100023384 272
1299 3300025900 Ga0207710_10001541 Ga0207710_100015418 272
1300 3300025901 Ga0207688_10000526 Ga0207688_100005267 272
1301 3300025901 Ga0207688_10018403 Ga0207688_100184031 272
1302 3300025903 Ga0207680_10006135 Ga0207680_100061354 272
1303 3300025906 Ga0207699_10156368 Ga0207699_101563681 272
1304 3300025907 Ga0207645_10001617 Ga0207645_1000161710 272
1305 3300025907 Ga0207645_10025421 Ga0207645_100254214 272
1306 3300025908 Ga0207643_10000756 Ga0207643_1000075610 272
1307 3300025911 Ga0207654_10008890 Ga0207654_100088906 272
1308 3300025912 Ga0207707_10002112 Ga0207707_1000211210 272
1309 3300025913 Ga0207695_10042822 Ga0207695_100428226 272
1310 3300025917 Ga0207660_10001335 Ga0207660_100013357 272
1311 3300025918 Ga0207662_10000341 Ga0207662_100003417 272
1312 3300025919 Ga0207657_10002888 Ga0207657_100028885 272
1313 3300025920 Ga0207649_10000271 Ga0207649_1000027110 272
1314 3300025921 Ga0207652_10001830 Ga0207652_1000183010 272
1315 3300025923 Ga0207681_10000658 Ga0207681_1000065810 272
1316 3300025924 Ga0207694_10268150 Ga0207694_102681502 272
1317 3300025925 Ga0207650_10028994 Ga0207650_100289944 272
1318 3300025926 Ga0207659_10000177 Ga0207659_1000017714 272
1319 3300025926 Ga0207659_10126994 Ga0207659_101269942 272
1320 3300025927 Ga0207687_10000495 Ga0207687_1000049510 272
1321 3300025927 Ga0207687_10099514 Ga0207687_100995141 272
1322 3300025928 Ga0207700_10098190 Ga0207700_100981902 272
1323 3300025931 Ga0207644_10000279 Ga0207644_100002799 272
1324 3300025933 Ga0207706_10005939 Ga0207706_100059397 272
1325 3300025934 Ga0207686_10001383 Ga0207686_100013836 272
1326 3300025934 Ga0207686_10144815 Ga0207686_101448152 272
1327 3300025935 Ga0207709_10000952 Ga0207709_1000095210 272
1328 3300025935 Ga0207709_10102163 Ga0207709_101021632 272
1329 3300025935 Ga0207709_10105019 Ga0207709_101050192 272
1330 3300025936 Ga0207670_10000491 Ga0207670_1000049110 272
1331 3300025937 Ga0207669_10000649 Ga0207669_100006499 272
1332 3300025940 Ga0207691_10002815 Ga0207691_100028159 272
1333 3300025941 Ga0207711_10001570 Ga0207711_1000157010 272
1334 3300025941 Ga0207711_10038301 Ga0207711_100383013 272
1335 3300025942 Ga0207689_10002449 Ga0207689_1000244910 272
1336 3300025942 Ga0207689_10200764 Ga0207689_102007642 272
1337 3300025944 Ga0207661_10000642 Ga0207661_100006427 272
1338 3300025945 Ga0207679_10000046 Ga0207679_1000004612 272
1339 3300025949 Ga0207667_10007962 Ga0207667_100079627 272
1340 3300025960 Ga0207651_10000214 Ga0207651_1000021410 272
1341 3300025961 Ga0207712_10003297 Ga0207712_100032976 272
1342 3300025972 Ga0207668_10000537 Ga0207668_1000053710 272
1343 3300025972 Ga0207668_10039496 Ga0207668_100394962 272
1344 3300025981 Ga0207640_10000765 Ga0207640_1000076510 272
1345 3300025986 Ga0207658_10001147 Ga0207658_100011478 272
1346 3300025986 Ga0207658_10214465 Ga0207658_102144652 272
1347 3300026023 Ga0207677_10003377 Ga0207677_100033775 272
1348 3300026023 Ga0207677_10397030 Ga0207677_103970302 272
1349 3300026035 Ga0207703_10000940 Ga0207703_1000094016 272
1350 3300026041 Ga0207639_10000852 Ga0207639_1000085210 272
1351 3300026067 Ga0207678_10011036 Ga0207678_100110366 272
1352 3300026067 Ga0207678_10063804 Ga0207678_100638043 272
1353 3300026075 Ga0207708_10001006 Ga0207708_100010067 272
1354 3300026075 Ga0207708_10263666 Ga0207708_102636662 272
1355 3300026078 Ga0207702_10002642 Ga0207702_1000264214 272
1356 3300026088 Ga0207641_10001370 Ga0207641_1000137010 272
1357 3300026089 Ga0207648_10002036 Ga0207648_1000203610 272
1358 3300026095 Ga0207676_10004314 Ga0207676_100043147 272
1359 3300026116 Ga0207674_10002956 Ga0207674_1000295610 272
1360 3300026118 Ga0207675_100006209 Ga0207675_1000062097 272
1361 3300026121 Ga0207683_10001099 Ga0207683_1000109922 272
1362 3300026121 Ga0207683_10001904 Ga0207683_100019045 272
1363 3300026142 Ga0207698_10001980 Ga0207698_100019808 272
1364 3300027617 Ga0210002_1000843 Ga0210002_10008434 272
1365 3300027876 Ga0209974_10000502 Ga0209974_100005029 272
1366 3300027907 Ga0207428_10001117 Ga0207428_100011175 272
1367 3300027907 Ga0207428_10002977 Ga0207428_100029773 272
1368 3300028379 Ga0268266_10049262 Ga0268266_100492623 272
1369 3300028380 Ga0268265_10000817 Ga0268265_1000081716 272
1370 3300028380 Ga0268265_10106303 Ga0268265_101063032 272
1371 3300028381 Ga0268264_10001227 Ga0268264_1000122710 272
1372 3300028381 Ga0268264_10331187 Ga0268264_103311872 272
1373 3300031242 Ga0265329_10051696 Ga0265329_100516962 272
1374 3300034819 Ga0373958_0005293 Ga0373958_0005293_586_1515 272
1375 3300034957 Ga0373938_0000998 Ga0373938_0000998_2886_3815 272
1376 3300035086 Ga0373934_0005990 Ga0373934_0005990_1375_2304 272
1377 3300035090 Ga0373949_0002975 Ga0373949_0002975_1263_2192 272
1378 3300035091 Ga0373951_0001619 Ga0373951_0001619_3995_4924 272
1379 3300035092 Ga0373952_0001046 Ga0373952_0001046_2377_3306 272
1380 3300035092 Ga0373952_0005686 Ga0373952_0005686_145_1074 272
1381 3300035112 Ga0373932_0000703 Ga0373932_0000703_4079_5008 272
1382 3300035118 Ga0373954_0010627 Ga0373954_0010627_2927_3856 272
1383 3300035120 Ga0373957_0004743 Ga0373957_0004743_701_1630 272
1384 3300035241 Ga0373961_0021710 Ga0373961_0021710_438_1367 272
1385 3300035242 Ga0373962_0000253 Ga0373962_0000253_9179_10108 272
1386 3300035724 Ga0373933_0005081 Ga0373933_0005081_1568_2497 272
1387 3300036401 Ga0373937_0004998 Ga0373937_0004998_1164_2093 272
1388 3300036401 Ga0373937_0100457 Ga0373937_0100457_796_1725 272
1389 3300046511 Ga0495608_0097145 Ga0495608_0097145_31_960 272
1390 3300046533 Ga0495640_0021160 Ga0495640_0021160_2665_3594 272
1391 3300046559 Ga0495667_0096965 Ga0495667_0096965_444_1373 272
1392 3300046675 Ga0495657_0016060 Ga0495657_0016060_3928_4857 272
1393 3300046809 Ga0495600_0174564 Ga0495600_0174564_444_1373 272
1394 3300047322 Ga0495680_0034583 Ga0495680_0034583_297_1226 272
1395 3300047322 Ga0495680_0059751 Ga0495680_0059751_1417_2346 272
1396 3300047471 Ga0495684_0216359 Ga0495684_0216359_91_1020 272
1397 3300048088 Ga0495602_0193937 Ga0495602_0193937_584_1513 272
1398 3300048903 Ga0496100_0003962 Ga0496100_0003962_2839_3768 272
1399 3300048904 Ga0496101_0001738 Ga0496101_0001738_298_1227 272
1400 3300048905 Ga0496102_0001427 Ga0496102_0001427_4451_5380 272
1401 3300048906 Ga0496103_0001145 Ga0496103_0001145_799_1728 272
1402 3300048909 Ga0496106_0000644 Ga0496106_0000644_15848_16777 272
1403 3300048910 Ga0496107_0000844 Ga0496107_0000844_13218_14147 272
1404 3300048911 Ga0496108_0002624 Ga0496108_0002624_1582_2511 272
1405 3300048912 Ga0496109_0010936 Ga0496109_0010936_4361_5290 272
1406 3300048912 Ga0496109_0196619 Ga0496109_0196619_202_1131 272
1407 3300048913 Ga0496110_0002024 Ga0496110_0002024_11698_12627 272
1408 3300048916 Ga0496113_0048221 Ga0496113_0048221_1963_2892 272
1409 3300049571 Ga0501034_0045623 Ga0501034_0045623_2972_3874 272
1410 3300049574 Ga0501038_0151532 Ga0501038_0151532_181_1083 272
1411 3300049581 Ga0501047_0006890 Ga0501047_0006890_7940_8842 272
1412 3300049589 Ga0501073_0019444 Ga0501073_0019444_1358_2260 272
1413 3300049743 Ga0501081_0322235 Ga0501081_0322235_200_1108 272
1414 3300049744 Ga0501083_0004063 Ga0501083_0004063_2139_3041 272
1415 3300049744 Ga0501083_0009036 Ga0501083_0009036_1115_2038 272
1416 3300049823 Ga0501044_0271852 Ga0501044_0271852_142_1044 272
1417 3300050511 nmdc:mga08y16_149666_c1 nmdc:mga08y16_149666_c1_298_1227 272
1418 3300050511 nmdc:mga08y16_6181_c1 nmdc:mga08y16_6181_c1_6940_7824 272
1419 3300050512 nmdc:mga0n895_1698_c1 nmdc:mga0n895_1698_c1_4182_5111 272
1420 3300050513 nmdc:mga0rr50_78012_c1 nmdc:mga0rr50_78012_c1_52_981 272
1421 3300050515 nmdc:mga0a205_253208_c1 nmdc:mga0a205_253208_c1_152_1120 272
1422 3300053077 Ga0495601_0049540 Ga0495601_0049540_1120_2049 272
1423 3300053077 Ga0495601_0141663 Ga0495601_0141663_321_1250 272
1424 3300053084 Ga0495595_0010780 Ga0495595_0010780_462_1391 272
1425 3300053085 Ga0495619_0000510 Ga0495619_0000510_19868_20797 272
1426 3300053150 Ga0500603_011115 Ga0500603_011115_572_1480 272
1427 3300003322 rootL2_10030665 rootL2_1003066510 273
1428 3300003323 rootH1_10102299 rootH1_101022997 273
1429 3300003323 rootH1_10165105 rootH1_101651052 273
1430 3300005336 Ga0070680_100265194 Ga0070680_1002651942 273
1431 3300005434 Ga0070709_10007969 Ga0070709_100079692 273
1432 3300005435 Ga0070714_100018498 Ga0070714_1000184986 273
1433 3300005436 Ga0070713_100000924 Ga0070713_1000009246 273
1434 3300005436 Ga0070713_100110352 Ga0070713_1001103522 273
1435 3300005437 Ga0070710_10002939 Ga0070710_100029394 273
1436 3300005439 Ga0070711_100006726 Ga0070711_1000067264 273
1437 3300005439 Ga0070711_100033562 Ga0070711_1000335623 273
1438 3300005458 Ga0070681_10333822 Ga0070681_103338222 273
1439 3300005468 Ga0070707_100075543 Ga0070707_1000755432 273
1440 3300005530 Ga0070679_100163344 Ga0070679_1001633442 273
1441 3300005535 Ga0070684_100074644 Ga0070684_1000746443 273
1442 3300005548 Ga0070665_100142512 Ga0070665_1001425122 273
1443 3300005981 Ga0081538_10004000 Ga0081538_100040008 273
1444 3300006028 Ga0070717_10000939 Ga0070717_100009396 273
1445 3300006163 Ga0070715_10018865 Ga0070715_100188652 273
1446 3300006173 Ga0070716_100156597 Ga0070716_1001565971 273
1447 3300006175 Ga0070712_100032737 Ga0070712_1000327373 273
1448 3300006871 Ga0075434_100530469 Ga0075434_1005304692 273
1449 3300007076 Ga0075435_100030553 Ga0075435_1000305534 273
1450 3300009174 Ga0105241_10153154 Ga0105241_101531542 273
1451 3300009551 Ga0105238_10485589 Ga0105238_104855892 273
1452 3300010375 Ga0105239_10508835 Ga0105239_105088352 273
1453 3300013306 Ga0163162_10268120 Ga0163162_102681202 273
1454 3300025898 Ga0207692_10000094 Ga0207692_100000944 273
1455 3300025900 Ga0207710_10204023 Ga0207710_102040231 273
1456 3300025905 Ga0207685_10000908 Ga0207685_100009084 273
1457 3300025906 Ga0207699_10003453 Ga0207699_100034535 273
1458 3300025912 Ga0207707_10226759 Ga0207707_102267591 273
1459 3300025913 Ga0207695_10380657 Ga0207695_103806572 273
1460 3300025915 Ga0207693_10003163 Ga0207693_100031634 273
1461 3300025915 Ga0207693_10305309 Ga0207693_103053092 273
1462 3300025916 Ga0207663_10009234 Ga0207663_100092343 273
1463 3300025916 Ga0207663_10040304 Ga0207663_100403042 273
1464 3300025928 Ga0207700_10003759 Ga0207700_100037591 273
1465 3300025929 Ga0207664_10001383 Ga0207664_100013837 273
1466 3300025939 Ga0207665_10039306 Ga0207665_100393062 273
1467 3300025941 Ga0207711_10022846 Ga0207711_100228463 273
1468 3300027312 Ga0209371_1004784 Ga0209371_10047845 273
1469 3300030500 Ga0268256_1004561 Ga0268256_10045613 273
1470 3300031711 Ga0265314_10010227 Ga0265314_100102273 273
1471 3300031727 Ga0316576_10065065 Ga0316576_100650652 273
1472 3300031995 Ga0307409_100125096 Ga0307409_1001250962 273
1473 3300032002 Ga0307416_100027300 Ga0307416_1000273003 273
1474 3300032005 Ga0307411_10121284 Ga0307411_101212842 273
1475 3300035086 Ga0373934_0078183 Ga0373934_0078183_38_946 273
1476 3300037418 Ga0395900_0353237 Ga0395900_0353237_266_1189 273
1477 3300037466 Ga0395898_0129930 Ga0395898_0129930_385_1308 273
1478 3300038443 Ga0395901_0020828 Ga0395901_0020828_1575_2498 273
1479 3300045976 Ga0466967_0144164 Ga0466967_0144164_1286_2185 273
1480 3300047322 Ga0495680_0173749 Ga0495680_0173749_435_1331 273
1481 3300048905 Ga0496102_0241721 Ga0496102_0241721_312_1235 273
1482 3300048911 Ga0496108_0039305 Ga0496108_0039305_2995_3924 273
1483 3300049571 Ga0501034_0001160 Ga0501034_0001160_27775_28704 273
1484 3300049571 Ga0501034_0052759 Ga0501034_0052759_479_1408 273
1485 3300049586 Ga0501070_0053406 Ga0501070_0053406_1805_2734 273
1486 3300049823 Ga0501044_0259159 Ga0501044_0259159_735_1664 273
1487 3300050512 nmdc:mga0n895_226641_c1 nmdc:mga0n895_226641_c1_172_1095 273
1488 3300053088 Ga0500644_0128570 Ga0500644_0128570_26_937 273
1489 3300053130 Ga0500642_0133023 Ga0500642_0133023_113_1000 273
1490 3300053139 Ga0500568_0000436 Ga0500568_0000436_7189_8076 273
1491 3300053140 Ga0500573_0162455 Ga0500573_0162455_192_1091 273
1492 3300053153 Ga0500616_0000034 Ga0500616_0000034_158211_159122 273
1493 3300061734 Ga0530510_0138247 Ga0530510_0138247_128_1111 273
1494 iso_pu_bacteria 2508501122 2509110549 273
1495 iso_pu_bacteria 2509276019 2509377203 273
1496 iso_pu_bacteria 2510065057 2510307815 273
1497 iso_pu_bacteria 2510917028 2511185822 273
1498 iso_pu_bacteria 2511231027 2511392103 273
1499 iso_pu_bacteria 2511231052 2511497572 273
1500 iso_pu_bacteria 2512047086 2512530014 273
1501 iso_pu_bacteria 2512875026 2512969743 273
1502 iso_pu_bacteria 2513237086 2513581825 273
1503 iso_pu_bacteria 2513237089 2513603101 273
1504 iso_pu_bacteria 2513237091 2513619291 273
1505 iso_pu_bacteria 2513237140 2513887195 273
1506 iso_pu_bacteria 2513237143 2513901447 273
1507 iso_pu_bacteria 2513237160 2514004528 273
1508 iso_pu_bacteria 2515154107 2515609861 273
1509 iso_pu_bacteria 2516143018 2516207739 273
1510 iso_pu_bacteria 2516653046 2516896769 273
1511 iso_pu_bacteria 2517487022 2517565378 273
1512 iso_pu_bacteria 2524023207 2524451444 273
1513 iso_pu_bacteria 2551306084 2551677224 273
1514 iso_pu_bacteria 2551306085 2551688376 273
1515 iso_pu_bacteria 2551306086 2551697044 273
1516 iso_pu_bacteria 2551306087 2551700605 273
1517 iso_pu_bacteria 2551306089 2551715080 273
1518 iso_pu_bacteria 2551306090 2551721343 273
1519 iso_pu_bacteria 2551306090 2551722703 273
1520 iso_pu_bacteria 2551306091 2551729429 273
1521 iso_pu_bacteria 2551306092 2551738398 273
1522 iso_pu_bacteria 2551306093 2551743854 273
1523 iso_pu_bacteria 2558860100 2558862271 273
1524 iso_pu_bacteria 2599185352 2600196386 273
1525 iso_pu_bacteria 2643221723 2644673522 273
1526 iso_pu_bacteria 2657244999 2657683508 273
1527 iso_pu_bacteria 2690316117 2692319272 273
1528 iso_pu_bacteria 2751185821 2753458945 273
1529 iso_pu_bacteria 2765235802 2765465965 273
1530 iso_pu_bacteria 2767802442 2770196601 273
1531 iso_pu_bacteria 2775506902 2776269289 273
1532 iso_pu_bacteria 2775506904 2776283572 273
1533 iso_pu_bacteria 2791355091 2792621518 273
1534 iso_pu_bacteria 2791355092 2792627794 273
1535 iso_pu_bacteria 2791355094 2792640236 273
1536 iso_pu_bacteria 2802428858 2802716169 273
1537 iso_pu_bacteria 2802428859 2802722793 273
1538 iso_pu_bacteria 2802428860 2802729062 273
1539 iso_pu_bacteria 2802428861 2802735456 273
1540 iso_pu_bacteria 2802428862 2802741968 273
1541 iso_pu_bacteria 2802428863 2802748418 273
1542 iso_pu_bacteria 2802429268 2804754547 273
1543 iso_pu_bacteria 2818991448 2819612347 273
1544 iso_pu_bacteria 2838074704 2838075651 273
1545 iso_pu_bacteria 2842871566 2842874922 273
1546 iso_pu_bacteria 2847417321 2847422219 273
1547 iso_pu_bacteria 2848992105 2848998282 273
1548 iso_pu_bacteria 2850079185 2850085341 273
1549 iso_pu_bacteria 2855825444 2855828404 273
1550 iso_pu_bacteria 2855839649 2855843516 273
1551 iso_pu_bacteria 2855872281 2855875662 273
1552 iso_pu_bacteria 2858800743 2858807222 273
1553 iso_pu_bacteria 2894652903 2894653443 273
1554 iso_pu_bacteria 2896384573 2896388159 273
1555 iso_pu_bacteria 2904578770 2904579704 273
1556 iso_pu_bacteria 2909042592 2909047804 273
1557 iso_pu_bacteria 2915980308 2915983867 273
1558 iso_pu_bacteria 2915986958 2915988999 273
1559 iso_pu_bacteria 2915993759 2916000144 273
1560 iso_pu_bacteria 2916000859 2916004806 273
1561 iso_pu_bacteria 2916007675 2916013136 273
1562 iso_pu_bacteria 2916014648 2916020227 273
1563 iso_pu_bacteria 2916021584 2916027047 273
1564 iso_pu_bacteria 2916028427 2916029955 273
1565 iso_pu_bacteria 2916035215 2916041098 273
1566 iso_pu_bacteria 2916041962 2916048576 273
1567 iso_pu_bacteria 2916048683 2916052114 273
1568 iso_pu_bacteria 2916055098 2916058736 273
1569 iso_pu_bacteria 2916061851 2916068472 273
1570 iso_pu_bacteria 2916068649 2916075186 273
1571 iso_pu_bacteria 2916076590 2916083037 273
1572 iso_pu_bacteria 2919119836 2919120629 273
1573 iso_pu_bacteria 2920760137 2920764267 273
1574 iso_pu_bacteria 2921201388 2921203077 273
1575 iso_pu_bacteria 2921208531 2921210189 273
1576 iso_pu_bacteria 2921237296 2921238612 273
1577 iso_pu_bacteria 2921244191 2921247669 273
1578 iso_pu_bacteria 2921250672 2921256177 273
1579 iso_pu_bacteria 2921257292 2921263498 273
1580 iso_pu_bacteria 2921263974 2921265386 273
1581 iso_pu_bacteria 2921282425 2921283177 273
1582 iso_pu_bacteria 2921289301 2921296031 273
1583 iso_pu_bacteria 2921296804 2921302016 273
1584 iso_pu_bacteria 2924144063 2924148976 273
1585 iso_pu_bacteria 2924150972 2924155392 273
1586 iso_pu_bacteria 2924158325 2924158644 273
1587 iso_pu_bacteria 2924165586 2924167297 273
1588 iso_pu_bacteria 2924172951 2924175843 273
1589 iso_pu_bacteria 2924179722 2924183894 273
1590 iso_pu_bacteria 2924186466 2924193438 273
1591 iso_pu_bacteria 2924193448 2924198811 273
1592 iso_pu_bacteria 2924200457 2924204685 273
1593 iso_pu_bacteria 2924207177 2924212271 273
1594 iso_pu_bacteria 2924214083 2924215434 273
1595 iso_pu_bacteria 2924221636 2924222436 273
1596 iso_pu_bacteria 2924228884 2924232557 273
1597 iso_pu_bacteria 2928521798 2928522503 273
1598 iso_pu_bacteria 2936996657 2936996672 273
1599 iso_pu_bacteria 2937002841 2937008421 273
1600 iso_pu_bacteria 2937009748 2937015606 273
1601 iso_pu_bacteria 2937016420 2937020115 273
1602 iso_pu_bacteria 2937023124 2937026373 273
1603 iso_pu_bacteria 2937029754 2937032374 273
1604 iso_pu_bacteria 2937036028 2937038360 273
1605 iso_pu_bacteria 2937042894 2937043473 273
1606 iso_pu_bacteria 2937049772 2937050471 273
1607 iso_pu_bacteria 2937056579 2937057124 273
1608 iso_pu_bacteria 2937063883 2937069052 273
1609 iso_pu_bacteria 2937071275 2937076753 273
1610 iso_pu_bacteria 2937078374 2937081837 273
1611 iso_pu_bacteria 2937084907 2937090311 273
1612 iso_pu_bacteria 2937091812 2937093340 273
1613 iso_pu_bacteria 2937098957 2937099164 273
1614 iso_pu_bacteria 2937106411 2937106758 273
1615 iso_pu_bacteria 2937113482 2937116908 273
1616 iso_pu_bacteria 2937119839 2937125301 273
1617 iso_pu_bacteria 2937126314 2937131839 273
1618 iso_pu_bacteria 2954011201 2954014101 273
1619 iso_pu_bacteria 2957375807 2957381040 273
1620 iso_pu_bacteria 2957382221 2957387239 273
1621 iso_pu_bacteria 2957388812 2957394313 273
1622 iso_pu_bacteria 2957395598 2957402168 273
1623 iso_pu_bacteria 2957402308 2957408159 273
1624 iso_pu_bacteria 2957408893 2957412363 273
1625 iso_pu_bacteria 2957415311 2957417887 273
1626 iso_pu_bacteria 2957422303 2957426856 273
1627 iso_pu_bacteria 2957430029 2957437063 273
1628 iso_pu_bacteria 2957437181 2957442760 273
1629 iso_pu_bacteria 2957443900 2957444072 273
1630 iso_pu_bacteria 2957450854 2957455006 273
1631 iso_pu_bacteria 2957457609 2957460769 273
1632 iso_pu_bacteria 2957464669 2957470747 273
1633 iso_pu_bacteria 2957471148 2957472807 273
1634 iso_pu_bacteria 2957478035 2957479285 273
1635 iso_pu_bacteria 2957484790 2957487215 273
1636 iso_pu_bacteria 2957491536 2957497399 273
1637 iso_pu_bacteria 2957498199 2957505430 273
1638 iso_pu_bacteria 2957505466 2957506375 273
1639 iso_pu_bacteria 2960584000 2960589894 273
1640 iso_pu_bacteria 2960591022 2960596658 273
1641 iso_pu_bacteria 2960597568 2960603228 273
1642 iso_pu_bacteria 2960603979 2960607532 273
1643 iso_pu_bacteria 2960610863 2960616404 273
1644 iso_pu_bacteria 2960617483 2960619238 273
1645 iso_pu_bacteria 2960624210 2960624697 273
1646 iso_pu_bacteria 2960631154 2960634554 273
1647 iso_pu_bacteria 2960637947 2960642943 273
1648 iso_pu_bacteria 2960645483 2960645954 273
1649 iso_pu_bacteria 2960652885 2960653484 273
1650 iso_pu_bacteria 2960660292 2960662607 273
1651 iso_pu_bacteria 2960667422 2960673007 273
1652 iso_pu_bacteria 2960674078 2960678373 273
1653 iso_pu_bacteria 2960680706 2960685749 273
1654 iso_pu_bacteria 2960687367 2960692355 273
1655 iso_pu_bacteria 2960693952 2960694976 273
1656 iso_pu_bacteria 2964607997 2964608274 273
1657 iso_pu_bacteria 2964615318 2964621288 273
1658 iso_pu_bacteria 2964621998 2964622286 273
1659 iso_pu_bacteria 2964628898 2964632214 273
1660 iso_pu_bacteria 2964636051 2964639388 273
1661 iso_pu_bacteria 2964643177 2964647663 273
1662 iso_pu_bacteria 2964649959 2964653470 273
1663 iso_pu_bacteria 2964656573 2964658573 273
1664 iso_pu_bacteria 2964663802 2964670474 273
1665 iso_pu_bacteria 2964670856 2964675981 273
1666 iso_pu_bacteria 2964678106 2964681499 273
1667 iso_pu_bacteria 2964685014 2964685561 273
1668 iso_pu_bacteria 2964691889 2964692306 273
1669 iso_pu_bacteria 2964698721 2964699241 273
1670 iso_pu_bacteria 2964705432 2964708824 273
1671 iso_pu_bacteria 2964712639 2964713112 273
1672 iso_pu_bacteria 2964719344 2964720171 273
1673 iso_pu_bacteria 2967664464 2967666375 273
1674 iso_pu_bacteria 2967671571 2967672555 273
1675 iso_pu_bacteria 2967678726 2967679620 273
1676 iso_pu_bacteria 2967686174 2967692656 273
1677 iso_pu_bacteria 2967693043 2967696546 273
1678 iso_pu_bacteria 2967699805 2967701072 273
1679 iso_pu_bacteria 2967706974 2967707743 273
1680 iso_pu_bacteria 2967714385 2967717114 273
1681 iso_pu_bacteria 2967721400 2967728514 273
1682 iso_pu_bacteria 2967728569 2967731781 273
1683 iso_pu_bacteria 2967735183 2967741648 273
1684 iso_pu_bacteria 2967742019 2967743060 273
1685 iso_pu_bacteria 2967748971 2967753948 273
1686 iso_pu_bacteria 2967755722 2967761879 273
1687 iso_pu_bacteria 2967762386 2967766172 273
1688 iso_pu_bacteria 2967769361 2967771857 273
1689 iso_pu_bacteria 2967775926 2967777298 273
1690 iso_pu_bacteria 2970019648 2970023845 273
1691 iso_pu_bacteria 2970026789 2970028496 273
1692 iso_pu_bacteria 2970033650 2970040778 273
1693 iso_pu_bacteria 2970040964 2970047531 273
1694 iso_pu_bacteria 2970047711 2970054121 273
1695 iso_pu_bacteria 2970054988 2970055273 273
1696 iso_pu_bacteria 2970061556 2970063375 273
1697 iso_pu_bacteria 2970068827 2970075947 273
1698 iso_pu_bacteria 2970076120 2970081917 273
1699 iso_pu_bacteria 2970082768 2970085821 273
1700 iso_pu_bacteria 2970088815 2970092339 273
1701 iso_pu_bacteria 2970095765 2970096232 273
1702 iso_pu_bacteria 2970102677 2970107896 273
1703 iso_pu_bacteria 2970109326 2970109644 273
1704 iso_pu_bacteria 2970116247 2970122221 273
1705 iso_pu_bacteria 2970122695 2970124999 273
1706 iso_pu_bacteria 2970129317 2970132520 273
1707 iso_pu_bacteria 2970136068 2970136904 273
1708 iso_pu_bacteria 2970143518 2970147096 273
1709 iso_pu_bacteria 2970149975 2970156077 273
1710 iso_pu_bacteria 2970156795 2970157606 273
1711 iso_pu_bacteria 2970164137 2970169440 273
1712 iso_pu_bacteria 2970170962 2970176498 273
1713 iso_pu_bacteria 2970177841 2970182850 273
1714 iso_pu_bacteria 2970184632 2970188971 273
1715 iso_pu_bacteria 2970191845 2970198621 273
1716 iso_pu_bacteria 2977516862 2977520424 273
1717 iso_pu_bacteria 2977523885 2977526836 273
1718 iso_pu_bacteria 2977530762 2977533170 273
1719 iso_pu_bacteria 2977537788 2977538341 273
1720 iso_pu_bacteria 2977544691 2977546242 273
1721 iso_pu_bacteria 2977551784 2977555669 273
1722 iso_pu_bacteria 2977558990 2977562919 273
1723 iso_pu_bacteria 2977565890 2977569643 273
1724 iso_pu_bacteria 2977572785 2977572955 273
1725 iso_pu_bacteria 2977579622 2977583106 273
1726 iso_pu_bacteria 3002141150 3002141961 273
1727 iso_pu_bacteria 643692032 643823875 273
1728 iso_pu_bacteria 648276728 648740342 273
1729 iso_pu_bacteria 8003992118 8003996095 273
1730 iso_pu_bacteria 8003999396 8004003860 273
1731 iso_pu_bacteria 8005645114 8005645610 273
1732 iso_pu_bacteria 8005682033 8005686802 273
1733 iso_pu_bacteria 8054558443 8054559312 273
1734 3300002739 JGI25158J39367_1013253 JGI25158J39367_10132532 274
1735 3300002987 JGI25159J45721_1000071 JGI25159J45721_100007135 274
1736 3300002987 JGI25159J45721_1000191 JGI25159J45721_100019117 274
1737 3300003354 JGI25160J50197_1000162 JGI25160J50197_100016228 274
1738 3300003374 JGI25161J50226_1008671 JGI25161J50226_10086711 274
1739 3300003578 Ga0006562J51391_1100436 Ga0006562J51391_11004362 274
1740 3300003771 Ga0055526_1001457 Ga0055526_10014573 274
1741 3300003781 Ga0055536_1000667 Ga0055536_100066710 274
1742 3300003791 Ga0055530_10016961 Ga0055530_100169613 274
1743 3300003794 Ga0055531_10029098 Ga0055531_100290982 274
1744 3300004625 Ga0055543_1001124 Ga0055543_10011247 274
1745 3300005262 Ga0065165_1000535 Ga0065165_100053528 274
1746 3300005327 Ga0070658_10010898 Ga0070658_100108988 274
1747 3300005334 Ga0068869_100027674 Ga0068869_1000276744 274
1748 3300005339 Ga0070660_100039203 Ga0070660_1000392033 274
1749 3300005435 Ga0070714_100005537 Ga0070714_1000055374 274
1750 3300005436 Ga0070713_100358843 Ga0070713_1003588432 274
1751 3300005444 Ga0070694_100096736 Ga0070694_1000967362 274
1752 3300005455 Ga0070663_100156568 Ga0070663_1001565682 274
1753 3300005530 Ga0070679_100281259 Ga0070679_1002812592 274
1754 3300005616 Ga0068852_100048195 Ga0068852_1000481952 274
1755 3300005843 Ga0068860_100053985 Ga0068860_1000539853 274
1756 3300006038 Ga0075365_10207076 Ga0075365_102070762 274
1757 3300006038 Ga0075365_10242433 Ga0075365_102424332 274
1758 3300006178 Ga0075367_10047833 Ga0075367_100478331 274
1759 3300006353 Ga0075370_10064973 Ga0075370_100649732 274
1760 3300006946 Ga0079104_1006482 Ga0079104_10064823 274
1761 3300006946 Ga0079104_1006593 Ga0079104_10065933 274
1762 3300013105 Ga0157369_10434397 Ga0157369_104343972 274
1763 3300013306 Ga0163162_10376905 Ga0163162_103769052 274
1764 3300021320 Ga0214544_1001716 Ga0214544_100171632 274
1765 3300021321 Ga0214542_1000082 Ga0214542_100008213 274
1766 3300021321 Ga0214542_1029074 Ga0214542_10290742 274
1767 3300021327 Ga0214543_1000005 Ga0214543_1000005278 274
1768 3300021327 Ga0214543_1000075 Ga0214543_100007513 274
1769 3300022739 Ga0228711_1000045 Ga0228711_100004511 274
1770 3300022740 Ga0228710_1000036 Ga0228710_100003691 274
1771 3300025208 Ga0209436_101866 Ga0209436_1018667 274
1772 3300025284 Ga0209130_1000147 Ga0209130_100014739 274
1773 3300025292 Ga0209676_1001620 Ga0209676_10016207 274
1774 3300025294 Ga0209025_1000240 Ga0209025_100024048 274
1775 3300025295 Ga0209564_1001127 Ga0209564_100112718 274
1776 3300025297 Ga0209758_1042178 Ga0209758_10421782 274
1777 3300025298 Ga0209050_1003004 Ga0209050_10030049 274
1778 3300025299 Ga0209256_1001569 Ga0209256_10015699 274
1779 3300025302 Ga0207426_1000267 Ga0207426_100026780 274
1780 3300025303 Ga0209051_1004860 Ga0209051_10048607 274
1781 3300025304 Ga0209257_1002116 Ga0209257_100211618 274
1782 3300025912 Ga0207707_10064296 Ga0207707_100642963 274
1783 3300025919 Ga0207657_10010043 Ga0207657_100100439 274
1784 3300025921 Ga0207652_10005078 Ga0207652_100050781 274
1785 3300025928 Ga0207700_10293125 Ga0207700_102931252 274
1786 3300025929 Ga0207664_10004401 Ga0207664_100044014 274
1787 3300025949 Ga0207667_10375713 Ga0207667_103757131 274
1788 3300025972 Ga0207668_10044036 Ga0207668_100440362 274
1789 3300026067 Ga0207678_10041626 Ga0207678_100416262 274
1790 3300026118 Ga0207675_100036100 Ga0207675_1000361004 274
1791 3300026142 Ga0207698_10045535 Ga0207698_100455354 274
1792 3300027111 Ga0209281_1000178 Ga0209281_100017828 274
1793 3300027111 Ga0209281_1000417 Ga0209281_100041762 274
1794 3300027666 Ga0209282_1000023 Ga0209282_100002354 274
1795 3300028380 Ga0268265_10090068 Ga0268265_100900683 274
1796 3300028381 Ga0268264_10146311 Ga0268264_101463112 274
1797 3300028794 Ga0307515_10000145 Ga0307515_10000145125 274
1798 3300028794 Ga0307515_10024560 Ga0307515_100245603 274
1799 3300031456 Ga0307513_10014467 Ga0307513_100144674 274
1800 3300031456 Ga0307513_10337812 Ga0307513_103378122 274
1801 3300031456 Ga0307513_10389947 Ga0307513_103899471 274
1802 3300031595 Ga0265313_10027292 Ga0265313_100272923 274
1803 3300031712 Ga0265342_10001015 Ga0265342_1000101510 274
1804 3300031730 Ga0307516_10097870 Ga0307516_100978703 274
1805 3300031730 Ga0307516_10138472 Ga0307516_101384723 274
1806 3300031967 Ga0315914_1000016 Ga0315914_100001611 274
1807 3300033430 Ga0315913_1000027 Ga0315913_100002783 274
1808 3300033464 Ga0315915_1000007 Ga0315915_100000789 274
1809 3300042007 Ga0439449_0029019 Ga0439449_0029019_177_1076 274
1810 3300045051 Ga0451576_0249067 Ga0451576_0249067_283_1176 274
1811 3300046691 Ga0495670_0123536 Ga0495670_0123536_88_1023 274
1812 3300048911 Ga0496108_0416720 Ga0496108_0416720_127_1056 274
1813 3300048912 Ga0496109_0351675 Ga0496109_0351675_432_1361 274
1814 3300049569 Ga0501032_0065700 Ga0501032_0065700_78_968 274
1815 3300049569 Ga0501032_0326011 Ga0501032_0326011_40_945 274
1816 3300049571 Ga0501034_0019951 Ga0501034_0019951_4753_5643 274
1817 3300049572 Ga0501036_0018536 Ga0501036_0018536_3261_4151 274
1818 3300049573 Ga0501037_0063903 Ga0501037_0063903_1687_2589 274
1819 3300049574 Ga0501038_0013935 Ga0501038_0013935_926_1816 274
1820 3300049574 Ga0501038_0046125 Ga0501038_0046125_2075_2965 274
1821 3300049574 Ga0501038_0274435 Ga0501038_0274435_10_912 274
1822 3300049575 Ga0501039_0009687 Ga0501039_0009687_1257_2147 274
1823 3300049579 Ga0501043_0042607 Ga0501043_0042607_1181_2083 274
1824 3300049581 Ga0501047_0007706 Ga0501047_0007706_3071_3961 274
1825 3300049581 Ga0501047_0073014 Ga0501047_0073014_314_1219 274
1826 3300049584 Ga0501068_0007123 Ga0501068_0007123_4131_5021 274
1827 3300049587 Ga0501071_0036317 Ga0501071_0036317_79_969 274
1828 3300049590 Ga0501074_0013976 Ga0501074_0013976_4702_5592 274
1829 3300049742 Ga0501080_0018278 Ga0501080_0018278_3690_4580 274
1830 3300049742 Ga0501080_0048231 Ga0501080_0048231_1954_2844 274
1831 3300049744 Ga0501083_0103991 Ga0501083_0103991_296_1186 274
1832 3300049823 Ga0501044_0052219 Ga0501044_0052219_1135_2058 274
1833 3300049823 Ga0501044_0058326 Ga0501044_0058326_342_1244 274
1834 3300049823 Ga0501044_0329185 Ga0501044_0329185_97_1002 274
1835 3300049824 Ga0501045_0011049 Ga0501045_0011049_912_1802 274
1836 3300050492 nmdc:mga0yw44_210923_c1 nmdc:mga0yw44_210923_c1_138_1037 274
1837 3300050496 nmdc:mga07m45_128147_c1 nmdc:mga07m45_128147_c1_217_1152 274
1838 3300053111 Ga0500572_000205 Ga0500572_000205_17661_18596 274
1839 iso_pu_bacteria 2508501128 2509151620 274
1840 iso_pu_bacteria 2513237098 2513674405 274
1841 iso_pu_bacteria 2513237138 2513871128 274
1842 iso_pu_bacteria 2524023210 2524465789 274
1843 iso_pu_bacteria 2582581867 2585404965 274
1844 iso_pu_bacteria 2585427590 2585820341 274
1845 iso_pu_bacteria 2667528175 2671121863 274
1846 iso_pu_bacteria 2791355082 2792584703 274
1847 iso_pu_bacteria 2885383462 2885391308 274
1848 iso_pu_bacteria 2903748898 2903753481 274
1849 iso_pu_bacteria 2903768456 2903773795 274
1850 iso_pu_bacteria 2906610324 2906617230 274
1851 iso_pu_bacteria 2913295892 2913296626 274
1852 iso_pu_bacteria 2923556063 2923560129 274
1853 iso_pu_bacteria 8049293176 8049296777 274
1854 iso_pu_bacteria 8056681323 8056688316 274
1855 3300005295 Ga0065707_10009110 Ga0065707_100091104 275
1856 3300005536 Ga0070697_100020681 Ga0070697_1000206812 275
1857 3300005545 Ga0070695_100015098 Ga0070695_1000150982 275
1858 3300005937 Ga0081455_10114199 Ga0081455_101141992 275
1859 3300006186 Ga0075369_10007546 Ga0075369_100075462 275
1860 3300006844 Ga0075428_100161452 Ga0075428_1001614522 275
1861 3300006914 Ga0075436_100020856 Ga0075436_1000208562 275
1862 3300009147 Ga0114129_10201223 Ga0114129_102012233 275
1863 3300010375 Ga0105239_10101033 Ga0105239_101010334 275
1864 3300031238 Ga0265332_10000310 Ga0265332_100003109 275
1865 3300031241 Ga0265325_10087215 Ga0265325_100872152 275
1866 3300031242 Ga0265329_10029574 Ga0265329_100295742 275
1867 3300031247 Ga0265340_10000573 Ga0265340_100005739 275
1868 3300031249 Ga0265339_10006075 Ga0265339_100060754 275
1869 3300031250 Ga0265331_10023268 Ga0265331_100232683 275
1870 3300031711 Ga0265314_10015978 Ga0265314_100159784 275
1871 3300031712 Ga0265342_10000175 Ga0265342_1000017532 275
1872 3300044712 Ga0453684_0168135 Ga0453684_0168135_433_1335 275
1873 3300047320 Ga0495672_0122665 Ga0495672_0122665_115_1008 275
1874 3300049569 Ga0501032_0002871 Ga0501032_0002871_8974_9867 275
1875 3300049570 Ga0501033_0002505 Ga0501033_0002505_13223_14116 275
1876 3300049571 Ga0501034_0082306 Ga0501034_0082306_2298_3191 275
1877 3300049572 Ga0501036_0010290 Ga0501036_0010290_53_946 275
1878 3300049573 Ga0501037_0016410 Ga0501037_0016410_4514_5407 275
1879 3300049575 Ga0501039_0009695 Ga0501039_0009695_6114_7007 275
1880 3300049580 Ga0501046_0002308 Ga0501046_0002308_9492_10385 275
1881 3300049582 Ga0501048_0022170 Ga0501048_0022170_33_926 275
1882 3300049586 Ga0501070_0002192 Ga0501070_0002192_9511_10404 275
1883 3300049589 Ga0501073_0001103 Ga0501073_0001103_6868_7761 275
1884 3300049590 Ga0501074_0001626 Ga0501074_0001626_8974_9867 275
1885 3300049742 Ga0501080_0001592 Ga0501080_0001592_13867_14760 275
1886 3300049744 Ga0501083_0005997 Ga0501083_0005997_7580_8473 275
1887 3300049822 Ga0501035_0006474 Ga0501035_0006474_2004_2897 275
1888 3300049823 Ga0501044_0018664 Ga0501044_0018664_3563_4456 275
1889 3300050507 nmdc:mga05p37_177737_c1 nmdc:mga05p37_177737_c1_1584_2513 275
1890 3300050514 nmdc:mga08x19_6_c1 nmdc:mga08x19_6_c1_316699_317628 275
1891 3300050516 nmdc:mga0sz30_110459_c1 nmdc:mga0sz30_110459_c1_14_913 275
1892 3300053109 Ga0500569_086131 Ga0500569_086131_30_929 275
1893 3300053137 Ga0500561_0054580 Ga0500561_0054580_104_1003 275
1894 3300053156 Ga0500622_0005196 Ga0500622_0005196_4650_5549 275
1895 3300053161 Ga0500634_0096280 Ga0500634_0096280_237_1136 275
1896 3300060353 Ga0501082_0275401 Ga0501082_0275401_293_1222 275
1897 3300005435 Ga0070714_100090121 Ga0070714_1000901211 276
1898 3300005436 Ga0070713_100064294 Ga0070713_1000642943 276
1899 3300005437 Ga0070710_10000567 Ga0070710_1000056714 276
1900 3300005983 Ga0081540_1004176 Ga0081540_10041768 276
1901 3300006028 Ga0070717_10026518 Ga0070717_100265182 276
1902 3300006051 Ga0075364_10014381 Ga0075364_100143813 276
1903 3300006163 Ga0070715_10006442 Ga0070715_100064421 276
1904 3300006173 Ga0070716_100004945 Ga0070716_1000049453 276
1905 3300006178 Ga0075367_10010333 Ga0075367_100103334 276
1906 3300006353 Ga0075370_10002663 Ga0075370_100026637 276
1907 3300009098 Ga0105245_10449832 Ga0105245_104498322 276
1908 3300013306 Ga0163162_10523767 Ga0163162_105237672 276
1909 3300025898 Ga0207692_10029647 Ga0207692_100296472 276
1910 3300025905 Ga0207685_10003323 Ga0207685_100033234 276
1911 3300025906 Ga0207699_10012564 Ga0207699_100125644 276
1912 3300025915 Ga0207693_10000581 Ga0207693_100005818 276
1913 3300025916 Ga0207663_10000084 Ga0207663_1000008421 276
1914 3300025928 Ga0207700_10032203 Ga0207700_100322033 276
1915 3300025929 Ga0207664_10054830 Ga0207664_100548303 276
1916 3300025939 Ga0207665_10003511 Ga0207665_100035114 276
1917 3300031711 Ga0265314_10011261 Ga0265314_100112612 276
1918 3300031712 Ga0265342_10015115 Ga0265342_100151154 276
1919 3300037466 Ga0395898_0245165 Ga0395898_0245165_583_1488 276
1920 3300037471 Ga0395905_0148370 Ga0395905_0148370_517_1422 276
1921 3300038443 Ga0395901_0093707 Ga0395901_0093707_1565_2476 276
1922 3300039450 Ga0436363_1249879 Ga0436363_1249879_387_1289 276
1923 3300048912 Ga0496109_0383480 Ga0496109_0383480_221_1126 276
1924 3300048921 Ga0496118_0186348 Ga0496118_0186348_86_991 276
1925 3300048924 Ga0496121_0000239 Ga0496121_0000239_113696_114604 276
1926 3300048925 Ga0496122_0069612 Ga0496122_0069612_92_997 276
1927 3300048929 Ga0496126_0004802 Ga0496126_0004802_8012_8917 276
1928 3300048929 Ga0496126_0015313 Ga0496126_0015313_5451_6356 276
1929 3300049587 Ga0501071_0056607 Ga0501071_0056607_483_1412 276
1930 3300049591 Ga0501075_0005436 Ga0501075_0005436_5417_6346 276
1931 3300049592 Ga0501076_0009771 Ga0501076_0009771_2205_3134 276
1932 3300049741 Ga0501079_0021362 Ga0501079_0021362_254_1183 276
1933 3300049743 Ga0501081_0016540 Ga0501081_0016540_1040_1969 276
1934 3300049743 Ga0501081_0264680 Ga0501081_0264680_12_926 276
1935 3300050494 nmdc:mga06z11_254071_c1 nmdc:mga06z11_254071_c1_63_980 276
1936 3300050516 nmdc:mga0sz30_82870_c1 nmdc:mga0sz30_82870_c1_351_1265 276
1937 3300060353 Ga0501082_0054346 Ga0501082_0054346_599_1528 276
1938 iso_pu_bacteria 2513237096 2513657854 276
1939 iso_pu_bacteria 2513237137 2513855554 276
1940 iso_pu_bacteria 2513237145 2513920053 276
1941 iso_pu_bacteria 2517572143 2517892099 276
1942 iso_pu_bacteria 2524023228 2524534184 276
1943 iso_pu_bacteria 2595698237 2596373334 276
1944 iso_pu_bacteria 2728368998 2728751097 276
1945 iso_pu_bacteria 2791355197 2793068816 276
1946 iso_pu_bacteria 2841911363 2841911456 276
1947 iso_pu_bacteria 2841917233 2841917919 276
1948 iso_pu_bacteria 2885374607 2885381708 276
1949 iso_pu_bacteria 2889306138 2889307770 276
1950 iso_pu_bacteria 2902330777 2902333453 276
1951 iso_pu_bacteria 2902405164 2902406964 276
1952 iso_pu_bacteria 2904690495 2904694835 276
1953 iso_pu_bacteria 2904699407 2904702221 276
1954 iso_pu_bacteria 2906635258 2906643381 276
1955 iso_pu_bacteria 2906660503 2906662488 276
1956 iso_pu_bacteria 2908739725 2908742379 276
1957 iso_pu_bacteria 2908756301 2908760055 276
1958 iso_pu_bacteria 2922425934 2922430599 276
1959 iso_pu_bacteria 2928125067 2928127142 276
1960 iso_pu_bacteria 2935630451 2935631236 276
1961 iso_pu_bacteria 2941507105 2941509977 276
1962 iso_pu_bacteria 2941515067 2941518936 276
1963 iso_pu_bacteria 2941523033 2941525376 276
1964 iso_pu_bacteria 3005474847 3005480509 276
1965 iso_pu_bacteria 8006926726 8006931532 276
1966 iso_pu_bacteria 8006933436 8006940268 276
1967 iso_pu_bacteria 8006973647 8006980046 276
1968 iso_pu_bacteria 8019555841 8019556250 276
1969 iso_pu_bacteria 8019565922 8019569060 276
1970 iso_pu_bacteria 8056689827 8056694255 276
1971 3300005336 Ga0070680_100187852 Ga0070680_1001878522 277
1972 3300005530 Ga0070679_100399522 Ga0070679_1003995222 277
1973 3300005548 Ga0070665_100473756 Ga0070665_1004737561 277
1974 3300005983 Ga0081540_1073559 Ga0081540_10735592 277
1975 3300006038 Ga0075365_10140945 Ga0075365_101409452 277
1976 3300006186 Ga0075369_10095669 Ga0075369_100956692 277
1977 3300006846 Ga0075430_100336624 Ga0075430_1003366242 277
1978 3300006847 Ga0075431_100307894 Ga0075431_1003078942 277
1979 3300007788 Ga0099795_10122381 Ga0099795_101223812 277
1980 3300013100 Ga0157373_10169213 Ga0157373_101692131 277
1981 3300025919 Ga0207657_10075630 Ga0207657_100756302 277
1982 3300025949 Ga0207667_10234942 Ga0207667_102349422 277
1983 3300027512 Ga0209179_1011737 Ga0209179_10117372 277
1984 3300028556 Ga0265337_1002249 Ga0265337_10022499 277
1985 3300028563 Ga0265319_1004129 Ga0265319_10041295 277
1986 3300028573 Ga0265334_10001756 Ga0265334_100017566 277
1987 3300028577 Ga0265318_10004183 Ga0265318_100041833 277
1988 3300028653 Ga0265323_10001892 Ga0265323_100018924 277
1989 3300028654 Ga0265322_10031463 Ga0265322_100314632 277
1990 3300028666 Ga0265336_10001788 Ga0265336_100017882 277
1991 3300028800 Ga0265338_10000321 Ga0265338_100003219 277
1992 3300029957 Ga0265324_10002078 Ga0265324_100020789 277
1993 3300031239 Ga0265328_10063721 Ga0265328_100637212 277
1994 3300031241 Ga0265325_10033851 Ga0265325_100338512 277
1995 3300031247 Ga0265340_10005245 Ga0265340_100052451 277
1996 3300031711 Ga0265314_10009137 Ga0265314_100091375 277
1997 3300035115 Ga0373941_0060981 Ga0373941_0060981_72_1001 277
1998 3300036401 Ga0373937_0027190 Ga0373937_0027190_560_1468 277
1999 3300037418 Ga0395900_0138201 Ga0395900_0138201_105_1013 277
2000 3300046511 Ga0495608_0024535 Ga0495608_0024535_614_1522 277
2001 3300046516 Ga0495628_0060134 Ga0495628_0060134_1014_1922 277
2002 3300046524 Ga0495648_0004264 Ga0495648_0004264_2709_3617 277
2003 3300046536 Ga0495587_0011112 Ga0495587_0011112_588_1496 277
2004 3300046543 Ga0495645_0057762 Ga0495645_0057762_672_1580 277
2005 3300046559 Ga0495667_0074683 Ga0495667_0074683_879_1787 277
2006 3300046642 Ga0495634_0061549 Ga0495634_0061549_544_1452 277
2007 3300046675 Ga0495657_0015882 Ga0495657_0015882_2953_3861 277
2008 3300047317 Ga0495604_0074255 Ga0495604_0074255_636_1544 277
2009 3300047322 Ga0495680_0022767 Ga0495680_0022767_4092_5000 277
2010 3300048088 Ga0495602_0160448 Ga0495602_0160448_702_1610 277
2011 3300048910 Ga0496107_0005355 Ga0496107_0005355_608_1516 277
2012 3300048911 Ga0496108_0000515 Ga0496108_0000515_16012_16920 277
2013 3300048912 Ga0496109_0002891 Ga0496109_0002891_2321_3229 277
2014 3300048913 Ga0496110_0075442 Ga0496110_0075442_800_1708 277
2015 3300048915 Ga0496112_0015385 Ga0496112_0015385_1487_2395 277
2016 3300048915 Ga0496112_0057233 Ga0496112_0057233_476_1384 277
2017 3300048916 Ga0496113_0221634 Ga0496113_0221634_77_985 277
2018 3300048927 Ga0496124_0079218 Ga0496124_0079218_59_982 277
2019 3300048929 Ga0496126_0003422 Ga0496126_0003422_3253_4161 277
2020 3300049568 Ga0501031_0001597 Ga0501031_0001597_1042_1962 277
2021 3300049569 Ga0501032_0000619 Ga0501032_0000619_17282_18202 277
2022 3300049570 Ga0501033_0000108 Ga0501033_0000108_29582_30502 277
2023 3300049570 Ga0501033_0008940 Ga0501033_0008940_6723_7646 277
2024 3300049571 Ga0501034_0000100 Ga0501034_0000100_126649_127569 277
2025 3300049572 Ga0501036_0004308 Ga0501036_0004308_7341_8261 277
2026 3300049572 Ga0501036_0005602 Ga0501036_0005602_8156_9079 277
2027 3300049573 Ga0501037_0000153 Ga0501037_0000153_10812_11732 277
2028 3300049573 Ga0501037_0007559 Ga0501037_0007559_2397_3320 277
2029 3300049574 Ga0501038_0000138 Ga0501038_0000138_52742_53662 277
2030 3300049574 Ga0501038_0000575 Ga0501038_0000575_28254_29177 277
2031 3300049575 Ga0501039_0001334 Ga0501039_0001334_14342_15262 277
2032 3300049578 Ga0501042_0126384 Ga0501042_0126384_218_1138 277
2033 3300049579 Ga0501043_0000085 Ga0501043_0000085_48767_49687 277
2034 3300049579 Ga0501043_0013532 Ga0501043_0013532_3243_4199 277
2035 3300049580 Ga0501046_0000267 Ga0501046_0000267_49786_50706 277
2036 3300049580 Ga0501046_0001536 Ga0501046_0001536_16705_17628 277
2037 3300049581 Ga0501047_0000221 Ga0501047_0000221_36907_37827 277
2038 3300049581 Ga0501047_0017518 Ga0501047_0017518_2457_3380 277
2039 3300049582 Ga0501048_0023873 Ga0501048_0023873_74_994 277
2040 3300049583 Ga0501067_0022104 Ga0501067_0022104_2066_2986 277
2041 3300049584 Ga0501068_0000689 Ga0501068_0000689_11067_11987 277
2042 3300049584 Ga0501068_0046133 Ga0501068_0046133_1475_2398 277
2043 3300049585 Ga0501069_0003185 Ga0501069_0003185_1764_2684 277
2044 3300049586 Ga0501070_0000601 Ga0501070_0000601_3381_4301 277
2045 3300049588 Ga0501072_0001591 Ga0501072_0001591_7847_8767 277
2046 3300049589 Ga0501073_0000290 Ga0501073_0000290_19791_20711 277
2047 3300049590 Ga0501074_0000094 Ga0501074_0000094_33436_34356 277
2048 3300049741 Ga0501079_0011578 Ga0501079_0011578_1125_2045 277
2049 3300049742 Ga0501080_0000104 Ga0501080_0000104_48_971 277
2050 3300049742 Ga0501080_0004806 Ga0501080_0004806_3931_4851 277
2051 3300049744 Ga0501083_0000087 Ga0501083_0000087_42148_43068 277
2052 3300049822 Ga0501035_0000016 Ga0501035_0000016_241380_242303 277
2053 3300049822 Ga0501035_0000223 Ga0501035_0000223_42697_43617 277
2054 3300049823 Ga0501044_0000369 Ga0501044_0000369_54211_55131 277
2055 3300049823 Ga0501044_0008397 Ga0501044_0008397_7939_8862 277
2056 3300049823 Ga0501044_0074528 Ga0501044_0074528_50_973 277
2057 3300049824 Ga0501045_0021131 Ga0501045_0021131_1326_2246 277
2058 3300050489 nmdc:mga03683_49264_c1 nmdc:mga03683_49264_c1_756_1679 277
2059 3300050509 nmdc:mga0qj67_62845_c1 nmdc:mga0qj67_62845_c1_1816_2718 277
2060 3300050510 nmdc:mga06r32_181747_c1 nmdc:mga06r32_181747_c1_777_1700 277
2061 3300053078 Ga0495612_0094592 Ga0495612_0094592_22_930 277
2062 3300053091 Ga0500647_0042911 Ga0500647_0042911_689_1597 277
2063 3300053094 Ga0500566_0000006 Ga0500566_0000006_78734_79642 277
2064 3300053115 Ga0500591_023887 Ga0500591_023887_951_1859 277
2065 3300053136 Ga0500559_0001029 Ga0500559_0001029_1387_2295 277
2066 3300053159 Ga0500630_000954 Ga0500630_000954_225_1133 277
2067 3300053163 Ga0500639_000016 Ga0500639_000016_62324_63232 277
2068 3300053178 Ga0500637_0108590 Ga0500637_0108590_277_1185 277
2069 3300053725 Ga0500576_094607 Ga0500576_094607_132_1040 277
2070 iso_pu_bacteria 2513237095 2513645544 277
2071 iso_pu_bacteria 2513237101 2513692861 277
2072 iso_pu_bacteria 2513237102 2513702393 277
2073 iso_pu_bacteria 2513237104 2513718476 277
2074 iso_pu_bacteria 2517093001 2517102764 277
2075 iso_pu_bacteria 2524023205 2524437629 277
2076 iso_pu_bacteria 2602042107 2603856746 277
2077 iso_pu_bacteria 2643221547 2643758380 277
2078 iso_pu_bacteria 2721755755 2723844772 277
2079 iso_pu_bacteria 2744054633 2745079562 277
2080 iso_pu_bacteria 2791355196 2793062688 277
2081 iso_pu_bacteria 2791355199 2793079884 277
2082 iso_pu_bacteria 2816332527 2818238591 277
2083 iso_pu_bacteria 2824617872 2824618009 277
2084 iso_pu_bacteria 2824626560 2824626677 277
2085 iso_pu_bacteria 2824635225 2824636688 277
2086 iso_pu_bacteria 2824644064 2824648991 277
2087 iso_pu_bacteria 2824679649 2824685823 277
2088 iso_pu_bacteria 2824704595 2824711555 277
2089 iso_pu_bacteria 2824714736 2824719279 277
2090 iso_pu_bacteria 2824723954 2824729678 277
2091 iso_pu_bacteria 2824753945 2824754259 277
2092 iso_pu_bacteria 2824763712 2824768996 277
2093 iso_pu_bacteria 2841957949 2841964141 277
2094 iso_pu_bacteria 2842038055 2842040092 277
2095 iso_pu_bacteria 2842045827 2842046963 277
2096 iso_pu_bacteria 2847930680 2847936504 277
2097 iso_pu_bacteria 2849076700 2849079047 277
2098 iso_pu_bacteria 2857509624 2857516703 277
2099 iso_pu_bacteria 2857524615 2857528224 277
2100 iso_pu_bacteria 2874612657 2874619468 277
2101 iso_pu_bacteria 2874620515 2874627522 277
2102 iso_pu_bacteria 2879083081 2879089460 277
2103 iso_pu_bacteria 2881364244 2881368572 277
2104 iso_pu_bacteria 2881665667 2881672619 277
2105 iso_pu_bacteria 2885366525 2885369175 277
2106 iso_pu_bacteria 2888378607 2888384379 277
2107 iso_pu_bacteria 2893066018 2893068665 277
2108 iso_pu_bacteria 2904666416 2904673158 277
2109 iso_pu_bacteria 2904711408 2904714982 277
2110 iso_pu_bacteria 2906626472 2906633613 277
2111 iso_pu_bacteria 2906643746 2906651297 277
2112 iso_pu_bacteria 2919073203 2919075647 277
2113 iso_pu_bacteria 2922386360 2922391257 277
2114 iso_pu_bacteria 2922393267 2922400518 277
2115 iso_pu_bacteria 3005506211 3005510596 277
2116 3300005434 Ga0070709_10044157 Ga0070709_100441571 278
2117 3300006028 Ga0070717_10117229 Ga0070717_101172292 278
2118 3300025253 Ga0209677_106740 Ga0209677_1067403 278
2119 3300025906 Ga0207699_10336980 Ga0207699_103369801 278
2120 3300025928 Ga0207700_10057884 Ga0207700_100578842 278
2121 3300025939 Ga0207665_10155098 Ga0207665_101550982 278
2122 3300028794 Ga0307515_10365862 Ga0307515_103658621 278
2123 3300031548 Ga0307408_100024163 Ga0307408_1000241632 278
2124 3300031852 Ga0307410_10144101 Ga0307410_101441012 278
2125 3300035111 Ga0373923_0002909 Ga0373923_0002909_4372_5298 278
2126 3300035113 Ga0373936_0000167 Ga0373936_0000167_14111_15037 278
2127 3300035117 Ga0373953_0000383 Ga0373953_0000383_9691_10617 278
2128 3300035118 Ga0373954_0017874 Ga0373954_0017874_1788_2714 278
2129 3300035172 Ga0373955_0000048 Ga0373955_0000048_34702_35628 278
2130 3300035410 Ga0373924_0008840 Ga0373924_0008840_1533_2459 278
2131 3300035692 Ga0373935_0000886 Ga0373935_0000886_14004_14930 278
2132 3300035695 Ga0373927_0003898 Ga0373927_0003898_8356_9282 278
2133 3300035724 Ga0373933_0000648 Ga0373933_0000648_4870_5796 278
2134 3300035725 Ga0373947_0002875 Ga0373947_0002875_6513_7439 278
2135 3300036401 Ga0373937_0000019 Ga0373937_0000019_47878_48804 278
2136 3300037068 Ga0373925_0000026 Ga0373925_0000026_96163_97089 278
2137 3300044694 Ga0466963_0051192 Ga0466963_0051192_32_964 278
2138 3300046454 Ga0495592_0000017 Ga0495592_0000017_98435_99361 278
2139 3300046459 Ga0495629_0179824 Ga0495629_0179824_78_1004 278
2140 3300046462 Ga0495651_0001618 Ga0495651_0001618_8738_9664 278
2141 3300046463 Ga0495653_0000033 Ga0495653_0000033_32882_33808 278
2142 3300046476 Ga0495662_0002681 Ga0495662_0002681_7378_8304 278
2143 3300046477 Ga0495664_0000008 Ga0495664_0000008_96163_97089 278
2144 3300046511 Ga0495608_0000014 Ga0495608_0000014_32890_33816 278
2145 3300046514 Ga0495618_0000027 Ga0495618_0000027_78707_79633 278
2146 3300046516 Ga0495628_0000008 Ga0495628_0000008_96148_97074 278
2147 3300046517 Ga0495630_0000293 Ga0495630_0000293_16464_17390 278
2148 3300046529 Ga0495652_0000005 Ga0495652_0000005_96163_97089 278
2149 3300046533 Ga0495640_0000017 Ga0495640_0000017_89878_90804 278
2150 3300046536 Ga0495587_0000005 Ga0495587_0000005_261310_262236 278
2151 3300046543 Ga0495645_0000007 Ga0495645_0000007_239456_240382 278
2152 3300046559 Ga0495667_0000012 Ga0495667_0000012_187146_188072 278
2153 3300046642 Ga0495634_0001489 Ga0495634_0001489_1478_2404 278
2154 3300046663 Ga0495635_0000010 Ga0495635_0000010_32916_33842 278
2155 3300046675 Ga0495657_0000108 Ga0495657_0000108_32959_33885 278
2156 3300046678 Ga0495599_0000015 Ga0495599_0000015_96378_97304 278
2157 3300046679 Ga0495623_0000102 Ga0495623_0000102_27026_27952 278
2158 3300046680 Ga0495646_0000066 Ga0495646_0000066_47800_48726 278
2159 3300046690 Ga0495624_0047635 Ga0495624_0047635_512_1438 278
2160 3300046809 Ga0495600_0000128 Ga0495600_0000128_12280_13206 278
2161 3300047317 Ga0495604_0000001 Ga0495604_0000001_187147_188073 278
2162 3300047319 Ga0495674_0000012 Ga0495674_0000012_221878_222804 278
2163 3300047322 Ga0495680_0000409 Ga0495680_0000409_32887_33813 278
2164 3300047444 Ga0495675_0000152 Ga0495675_0000152_18264_19190 278
2165 3300047471 Ga0495684_0000022 Ga0495684_0000022_42403_43329 278
2166 3300048088 Ga0495602_0000106 Ga0495602_0000106_32919_33845 278
2167 3300048924 Ga0496121_0056335 Ga0496121_0056335_1050_1982 278
2168 3300053077 Ga0495601_0000011 Ga0495601_0000011_216161_217087 278
2169 3300053078 Ga0495612_0000006 Ga0495612_0000006_69805_70731 278
2170 3300053084 Ga0495595_0000021 Ga0495595_0000021_82113_83039 278
2171 3300053085 Ga0495619_0000013 Ga0495619_0000013_216082_217008 278
2172 3300005330 Ga0070690_100156029 Ga0070690_1001560291 279
2173 3300005331 Ga0070670_100092630 Ga0070670_1000926302 279
2174 3300005333 Ga0070677_10000815 Ga0070677_100008153 279
2175 3300005354 Ga0070675_100157865 Ga0070675_1001578652 279
2176 3300005456 Ga0070678_100113809 Ga0070678_1001138093 279
2177 3300005543 Ga0070672_100113094 Ga0070672_1001130943 279
2178 3300005544 Ga0070686_100126051 Ga0070686_1001260512 279
2179 3300005615 Ga0070702_100153280 Ga0070702_1001532801 279
2180 3300005617 Ga0068859_100112696 Ga0068859_1001126962 279
2181 3300005842 Ga0068858_100086404 Ga0068858_1000864044 279
2182 3300005937 Ga0081455_10012847 Ga0081455_100128473 279
2183 3300005937 Ga0081455_10040490 Ga0081455_100404902 279
2184 3300005937 Ga0081455_10069190 Ga0081455_100691905 279
2185 3300005983 Ga0081540_1008963 Ga0081540_10089634 279
2186 3300005983 Ga0081540_1028377 Ga0081540_10283772 279
2187 3300006844 Ga0075428_100012659 Ga0075428_1000126598 279
2188 3300006846 Ga0075430_100007217 Ga0075430_1000072178 279
2189 3300006847 Ga0075431_100007073 Ga0075431_1000070738 279
2190 3300006871 Ga0075434_100080778 Ga0075434_1000807783 279
2191 3300006880 Ga0075429_100007705 Ga0075429_1000077058 279
2192 3300006931 Ga0097620_100112695 Ga0097620_1001126952 279
2193 3300009094 Ga0111539_10011182 Ga0111539_100111825 279
2194 3300009098 Ga0105245_10134656 Ga0105245_101346562 279
2195 3300009147 Ga0114129_10011980 Ga0114129_100119806 279
2196 3300025893 Ga0207682_10002016 Ga0207682_1000201610 279
2197 3300025900 Ga0207710_10014042 Ga0207710_100140423 279
2198 3300025901 Ga0207688_10024645 Ga0207688_100246453 279
2199 3300025903 Ga0207680_10276788 Ga0207680_102767882 279
2200 3300025918 Ga0207662_10043821 Ga0207662_100438211 279
2201 3300025936 Ga0207670_10294260 Ga0207670_102942601 279
2202 3300025937 Ga0207669_10304028 Ga0207669_103040281 279
2203 3300025938 Ga0207704_10149637 Ga0207704_101496372 279
2204 3300025942 Ga0207689_10022970 Ga0207689_100229704 279
2205 3300025960 Ga0207651_10128464 Ga0207651_101284641 279
2206 3300025972 Ga0207668_10090905 Ga0207668_100909051 279
2207 3300025986 Ga0207658_10195155 Ga0207658_101951552 279
2208 3300026035 Ga0207703_10300748 Ga0207703_103007481 279
2209 3300026121 Ga0207683_10004971 Ga0207683_1000497112 279
2210 3300027907 Ga0207428_10002830 Ga0207428_1000283012 279
2211 3300037418 Ga0395900_0523299 Ga0395900_0523299_80_1018 279
2212 3300038443 Ga0395901_0099947 Ga0395901_0099947_1500_2438 279
2213 3300046539 Ga0495621_0022017 Ga0495621_0022017_337_1269 279
2214 3300049571 Ga0501034_0256361 Ga0501034_0256361_187_1125 279
2215 3300049822 Ga0501035_0235751 Ga0501035_0235751_184_1122 279
2216 3300050507 nmdc:mga05p37_4809_c1 nmdc:mga05p37_4809_c1_9796_10725 279
2217 3300050508 nmdc:mga09592_3717_c1 nmdc:mga09592_3717_c1_6648_7577 279
2218 3300050509 nmdc:mga0qj67_4177_c1 nmdc:mga0qj67_4177_c1_7019_7948 279
2219 3300050510 nmdc:mga06r32_5210_c1 nmdc:mga06r32_5210_c1_6034_6963 279
2220 3300050511 nmdc:mga08y16_4659_c1 nmdc:mga08y16_4659_c1_7739_8668 279
2221 3300050512 nmdc:mga0n895_13164_c1 nmdc:mga0n895_13164_c1_1230_2159 279
2222 3300050515 nmdc:mga0a205_7853_c1 nmdc:mga0a205_7853_c1_3260_4189 279
2223 3300053136 Ga0500559_0001576 Ga0500559_0001576_6344_7279 279
2224 3300053158 Ga0500627_0041339 Ga0500627_0041339_870_1799 279
2225 iso_pu_bacteria 2513237092 2513622437 279
2226 iso_pu_bacteria 2513237139 2513873049 279
2227 iso_pu_bacteria 2513237161 2514015653 279
2228 iso_pu_bacteria 2617270735 2617347088 279
2229 iso_pu_bacteria 2617270741 2617375483 279
2230 iso_pu_bacteria 2802429603 2805915052 279
2231 iso_pu_bacteria 2824671348 2824674908 279
2232 iso_pu_bacteria 2824687955 2824691333 279
2233 iso_pu_bacteria 2824696289 2824699487 279
2234 iso_pu_bacteria 2824732956 2824733355 279
2235 iso_pu_bacteria 2824746037 2824746518 279
2236 iso_pu_bacteria 2824773399 2824775346 279
2237 iso_pu_bacteria 2838122688 2838123444 279
2238 iso_pu_bacteria 2841941048 2841947783 279
2239 iso_pu_bacteria 2841949485 2841949546 279
2240 iso_pu_bacteria 2841966195 2841971947 279
2241 iso_pu_bacteria 2841974524 2841974710 279
2242 iso_pu_bacteria 2841983080 2841983732 279
2243 iso_pu_bacteria 2847939898 2847946850 279
2244 iso_pu_bacteria 2874604998 2874605507 279
2245 iso_pu_bacteria 2876808645 2876813059 279
2246 iso_pu_bacteria 2879110137 2879115827 279
2247 iso_pu_bacteria 2889033259 2889039471 279
2248 iso_pu_bacteria 2908775508 2908780457 279
2249 iso_pu_bacteria 2922361189 2922365643 279
2250 iso_pu_bacteria 3005483717 3005484598 279
2251 iso_pu_bacteria 3005587118 3005587764 279
2252 iso_pu_bacteria 8006964411 8006967024 279
2253 iso_pu_bacteria 8006984368 8006987978 279
2254 iso_pu_bacteria 8006994254 8006995708 279
2255 iso_pu_bacteria 8016583857 8016593168 279
2256 iso_pu_bacteria 8019648815 8019658825 279
2257 iso_pu_bacteria 8056673599 8056677658 279
2258 3300003215 JGI25153J46596_10034859 JGI25153J46596_100348592 280
2259 3300005262 Ga0065165_1039207 Ga0065165_10392071 280
2260 3300005545 Ga0070695_100026376 Ga0070695_1000263762 280
2261 3300006051 Ga0075364_10080285 Ga0075364_100802852 280
2262 3300006178 Ga0075367_10169287 Ga0075367_101692872 280
2263 3300006186 Ga0075369_10002591 Ga0075369_100025914 280
2264 3300006353 Ga0075370_10067560 Ga0075370_100675602 280
2265 3300010375 Ga0105239_10143258 Ga0105239_101432582 280
2266 3300025297 Ga0209758_1002072 Ga0209758_100207211 280
2267 3300026078 Ga0207702_10266355 Ga0207702_102663551 280
2268 3300028794 Ga0307515_10170183 Ga0307515_101701832 280
2269 3300035695 Ga0373927_0028419 Ga0373927_0028419_972_1886 280
2270 3300035695 Ga0373927_0134087 Ga0373927_0134087_593_1507 280
2271 3300037068 Ga0373925_0044559 Ga0373925_0044559_257_1171 280
2272 3300046501 Ga0495607_0148620 Ga0495607_0148620_114_1031 280
2273 3300046524 Ga0495648_0049210 Ga0495648_0049210_1180_2097 280
2274 3300046660 Ga0495625_0226549 Ga0495625_0226549_260_1177 280
2275 3300046665 Ga0495661_0042055 Ga0495661_0042055_983_1900 280
2276 3300046691 Ga0495670_0043395 Ga0495670_0043395_1227_2144 280
2277 3300047472 Ga0495686_0014825 Ga0495686_0014825_4107_5024 280
2278 3300047472 Ga0495686_0194325 Ga0495686_0194325_50_967 280
2279 3300048919 Ga0496116_0001829 Ga0496116_0001829_3101_4018 280
2280 3300048920 Ga0496117_0012904 Ga0496117_0012904_2180_3097 280
2281 3300048920 Ga0496117_0140800 Ga0496117_0140800_10_927 280
2282 3300048921 Ga0496118_0020646 Ga0496118_0020646_867_1784 280
2283 3300048921 Ga0496118_0234163 Ga0496118_0234163_80_997 280
2284 3300048924 Ga0496121_0016457 Ga0496121_0016457_134_1051 280
2285 3300048925 Ga0496122_0022144 Ga0496122_0022144_1180_2097 280
2286 3300048925 Ga0496122_0032207 Ga0496122_0032207_213_1130 280
2287 3300048926 Ga0496123_0084542 Ga0496123_0084542_516_1433 280
2288 3300048927 Ga0496124_0284248 Ga0496124_0284248_151_1068 280
2289 3300048928 Ga0496125_0000060 Ga0496125_0000060_41501_42418 280
2290 3300048928 Ga0496125_0001496 Ga0496125_0001496_17791_18708 280
2291 3300048928 Ga0496125_0008272 Ga0496125_0008272_2717_3634 280
2292 3300048928 Ga0496125_0034560 Ga0496125_0034560_3202_4143 280
2293 3300048928 Ga0496125_0107876 Ga0496125_0107876_663_1580 280
2294 3300048928 Ga0496125_0117830 Ga0496125_0117830_311_1252 280
2295 3300048929 Ga0496126_0014201 Ga0496126_0014201_772_1689 280
2296 3300048929 Ga0496126_0022450 Ga0496126_0022450_892_1809 280
2297 3300048929 Ga0496126_0157137 Ga0496126_0157137_308_1225 280
2298 3300048929 Ga0496126_0185688 Ga0496126_0185688_721_1638 280
2299 3300049574 Ga0501038_0409868 Ga0501038_0409868_23_940 280
2300 3300050490 nmdc:mga03n38_31356_c1 nmdc:mga03n38_31356_c1_617_1534 280
2301 3300050492 nmdc:mga0yw44_24791_c1 nmdc:mga0yw44_24791_c1_2208_3125 280
2302 3300050496 nmdc:mga07m45_81890_c1 nmdc:mga07m45_81890_c1_355_1272 280
2303 3300053094 Ga0500566_0006605 Ga0500566_0006605_2534_3451 280
2304 3300053096 Ga0500641_0011077 Ga0500641_0011077_1905_2822 280
2305 3300053098 Ga0500650_0000139 Ga0500650_0000139_8582_9499 280
2306 3300053104 Ga0500556_0000002 Ga0500556_0000002_417323_418240 280
2307 3300053109 Ga0500569_072340 Ga0500569_072340_62_979 280
2308 3300053116 Ga0500592_003487 Ga0500592_003487_731_1648 280
2309 3300053119 Ga0500595_002016 Ga0500595_002016_3001_3918 280
2310 3300053119 Ga0500595_022201 Ga0500595_022201_1297_2214 280
2311 3300053122 Ga0500608_000349 Ga0500608_000349_7476_8393 280
2312 3300053130 Ga0500642_0000016 Ga0500642_0000016_130134_131051 280
2313 3300053130 Ga0500642_0001946 Ga0500642_0001946_2407_3324 280
2314 3300053134 Ga0500658_0006747 Ga0500658_0006747_1211_2128 280
2315 3300053136 Ga0500559_0001124 Ga0500559_0001124_11753_12670 280
2316 3300053136 Ga0500559_0026426 Ga0500559_0026426_237_1154 280
2317 3300053139 Ga0500568_0001161 Ga0500568_0001161_14956_15873 280
2318 3300053142 Ga0500577_0004713 Ga0500577_0004713_233_1165 280
2319 3300053151 Ga0500604_0000600 Ga0500604_0000600_3871_4788 280
2320 3300053153 Ga0500616_0000061 Ga0500616_0000061_225773_226690 280
2321 3300053156 Ga0500622_0000916 Ga0500622_0000916_15108_16025 280
2322 3300053158 Ga0500627_0027158 Ga0500627_0027158_998_1915 280
2323 3300053177 Ga0500636_0000963 Ga0500636_0000963_3457_4374 280
2324 3300053730 Ga0500645_028057 Ga0500645_028057_118_1035 280
2325 3300054114 Ga0501084_0205344 Ga0501084_0205344_345_1262 280
2326 3300005459 Ga0068867_100415048 Ga0068867_1004150481 281
2327 3300014325 Ga0163163_10066264 Ga0163163_100662644 281
2328 3300017792 Ga0163161_10308004 Ga0163161_103080041 281
2329 3300025921 Ga0207652_10210434 Ga0207652_102104342 281
2330 3300048907 Ga0496104_0004653 Ga0496104_0004653_8492_9421 281
2331 3300048908 Ga0496105_0034743 Ga0496105_0034743_1674_2603 281
2332 3300048911 Ga0496108_0042195 Ga0496108_0042195_1662_2591 281
2333 3300048914 Ga0496111_0001863 Ga0496111_0001863_8795_9724 281
2334 3300048915 Ga0496112_0029057 Ga0496112_0029057_1947_2876 281
2335 3300048916 Ga0496113_0006037 Ga0496113_0006037_4358_5287 281
2336 3300048918 Ga0496115_0203322 Ga0496115_0203322_540_1469 281
2337 3300005330 Ga0070690_100218651 Ga0070690_1002186512 282
2338 3300005338 Ga0068868_100196694 Ga0068868_1001966942 282
2339 3300005544 Ga0070686_100038298 Ga0070686_1000382982 282
2340 3300005937 Ga0081455_10046838 Ga0081455_100468383 282
2341 3300006042 Ga0075368_10062768 Ga0075368_100627682 282
2342 3300006048 Ga0075363_100217517 Ga0075363_1002175171 282
2343 3300006051 Ga0075364_10017396 Ga0075364_100173963 282
2344 3300006178 Ga0075367_10152383 Ga0075367_101523832 282
2345 3300009098 Ga0105245_10339423 Ga0105245_103394232 282
2346 3300009177 Ga0105248_10073744 Ga0105248_100737442 282
2347 3300025927 Ga0207687_10213466 Ga0207687_102134662 282
2348 3300026023 Ga0207677_10187035 Ga0207677_101870351 282
2349 3300027866 Ga0209813_10041690 Ga0209813_100416902 282
2350 3300031238 Ga0265332_10047913 Ga0265332_100479132 282
2351 3300031241 Ga0265325_10060067 Ga0265325_100600672 282
2352 3300031712 Ga0265342_10096945 Ga0265342_100969452 282
2353 3300050490 nmdc:mga03n38_31544_c1 nmdc:mga03n38_31544_c1_155_1081 282
2354 3300050494 nmdc:mga06z11_26216_c1 nmdc:mga06z11_26216_c1_1604_2530 282
2355 3300050495 nmdc:mga04h51_24534_c1 nmdc:mga04h51_24534_c1_97_1155 282
2356 3300050513 nmdc:mga0rr50_332802_c1 nmdc:mga0rr50_332802_c1_203_1117 282
2357 3300003203 JGI25406J46586_10019490 JGI25406J46586_100194902 283
2358 3300003215 JGI25153J46596_10000462 JGI25153J46596_1000046214 283
2359 3300005985 Ga0081539_10003950 Ga0081539_1000395010 283
2360 3300006871 Ga0075434_100060094 Ga0075434_1000600942 283
2361 3300009551 Ga0105238_10166238 Ga0105238_101662382 283
2362 3300021384 Ga0213876_10031058 Ga0213876_100310583 283
2363 3300025297 Ga0209758_1003468 Ga0209758_10034688 283
2364 3300025924 Ga0207694_10124725 Ga0207694_101247252 283
2365 3300026041 Ga0207639_10044998 Ga0207639_100449983 283
2366 3300028800 Ga0265338_10067886 Ga0265338_100678864 283
2367 3300031344 Ga0265316_10053501 Ga0265316_100535012 283
2368 3300036401 Ga0373937_0073809 Ga0373937_0073809_1035_1961 283
2369 3300037418 Ga0395900_0018516 Ga0395900_0018516_4068_5003 283
2370 3300037471 Ga0395905_0004739 Ga0395905_0004739_5207_6142 283
2371 3300039437 Ga0436365_1935471 Ga0436365_1935471_802_1731 283
2372 3300039438 Ga0436360_0089382 Ga0436360_0089382_1069_1998 283
2373 3300039447 Ga0436361_0655620 Ga0436361_0655620_842_1771 283
2374 3300039450 Ga0436363_0180757 Ga0436363_0180757_545_1474 283
2375 3300050514 nmdc:mga08x19_307936_c1 nmdc:mga08x19_307936_c1_137_1066 283
2376 3300050514 nmdc:mga08x19_36649_c1 nmdc:mga08x19_36649_c1_1753_2679 283
2377 2209111006 2214753561 2213766402 284
2378 3300000041 ARcpr5oldR_c000103 ARcpr5oldR_00010321 284
2379 3300000042 ARSoilYngRDRAFT_c00128 ARSoilYngRDRAFT_0012815 284
2380 3300000043 ARcpr5yngRDRAFT_c000134 ARcpr5yngRDRAFT_0001344 284
2381 3300000044 ARSoilOldRDRAFT_c000140 ARSoilOldRDRAFT_00014023 284
2382 3300000045 ARCol0oldRDRAFT_c00073 ARCol0oldRDRAFT_000732 284
2383 3300000652 ARCol0yngRDRAFT_1000069 ARCol0yngRDRAFT_100006925 284
2384 3300001990 JGI24737J22298_10016881 JGI24737J22298_100168811 284
2385 3300003203 JGI25406J46586_10004407 JGI25406J46586_100044076 284
2386 3300003215 JGI25153J46596_10006690 JGI25153J46596_100066904 284
2387 3300005289 Ga0065704_10084877 Ga0065704_100848776 284
2388 3300005328 Ga0070676_10087544 Ga0070676_100875441 284
2389 3300005331 Ga0070670_100022469 Ga0070670_1000224692 284
2390 3300005336 Ga0070680_100049830 Ga0070680_1000498303 284
2391 3300005336 Ga0070680_100084720 Ga0070680_1000847203 284
2392 3300005337 Ga0070682_100001130 Ga0070682_10000113011 284
2393 3300005341 Ga0070691_10030268 Ga0070691_100302682 284
2394 3300005343 Ga0070687_100035296 Ga0070687_1000352961 284
2395 3300005345 Ga0070692_10005786 Ga0070692_100057861 284
2396 3300005347 Ga0070668_100047115 Ga0070668_1000471153 284
2397 3300005354 Ga0070675_100021486 Ga0070675_1000214863 284
2398 3300005356 Ga0070674_100015910 Ga0070674_1000159104 284
2399 3300005366 Ga0070659_100020321 Ga0070659_1000203214 284
2400 3300005366 Ga0070659_100062767 Ga0070659_1000627673 284
2401 3300005438 Ga0070701_10033103 Ga0070701_100331033 284
2402 3300005440 Ga0070705_100066936 Ga0070705_1000669362 284
2403 3300005441 Ga0070700_100059945 Ga0070700_1000599451 284
2404 3300005457 Ga0070662_100155756 Ga0070662_1001557562 284
2405 3300005458 Ga0070681_10055231 Ga0070681_100552312 284
2406 3300005459 Ga0068867_100012724 Ga0068867_1000127243 284
2407 3300005530 Ga0070679_100012363 Ga0070679_1000123632 284
2408 3300005539 Ga0068853_100001448 Ga0068853_1000014487 284
2409 3300005544 Ga0070686_100004148 Ga0070686_1000041482 284
2410 3300005545 Ga0070695_100380509 Ga0070695_1003805091 284
2411 3300005546 Ga0070696_100037740 Ga0070696_1000377402 284
2412 3300005564 Ga0070664_100161518 Ga0070664_1001615183 284
2413 3300005564 Ga0070664_100181501 Ga0070664_1001815012 284
2414 3300005578 Ga0068854_100299927 Ga0068854_1002999272 284
2415 3300005614 Ga0068856_100380383 Ga0068856_1003803831 284
2416 3300005618 Ga0068864_100261510 Ga0068864_1002615101 284
2417 3300005842 Ga0068858_100218511 Ga0068858_1002185112 284
2418 3300005843 Ga0068860_100130329 Ga0068860_1001303292 284
2419 3300005843 Ga0068860_100379728 Ga0068860_1003797282 284
2420 3300005844 Ga0068862_100042905 Ga0068862_1000429051 284
2421 3300005937 Ga0081455_10006534 Ga0081455_1000653411 284
2422 3300005985 Ga0081539_10002801 Ga0081539_100028018 284
2423 3300006051 Ga0075364_10143068 Ga0075364_101430682 284
2424 3300006173 Ga0070716_100075169 Ga0070716_1000751692 284
2425 3300006175 Ga0070712_100356218 Ga0070712_1003562181 284
2426 3300006178 Ga0075367_10069862 Ga0075367_100698622 284
2427 3300006195 Ga0075366_10009787 Ga0075366_100097872 284
2428 3300006852 Ga0075433_10107189 Ga0075433_101071894 284
2429 3300006871 Ga0075434_100470898 Ga0075434_1004708982 284
2430 3300007076 Ga0075435_100024058 Ga0075435_1000240586 284
2431 3300009094 Ga0111539_10004508 Ga0111539_100045089 284
2432 3300009094 Ga0111539_10017014 Ga0111539_100170142 284
2433 3300009101 Ga0105247_10007990 Ga0105247_100079905 284
2434 3300009148 Ga0105243_10021765 Ga0105243_100217653 284
2435 3300009174 Ga0105241_10041866 Ga0105241_100418664 284
2436 3300009553 Ga0105249_10095560 Ga0105249_100955602 284
2437 3300010375 Ga0105239_10060785 Ga0105239_100607853 284
2438 3300010375 Ga0105239_10288540 Ga0105239_102885402 284
2439 3300012510 Ga0157316_1003925 Ga0157316_10039252 284
2440 3300012515 Ga0157338_1004862 Ga0157338_10048622 284
2441 3300013100 Ga0157373_10016616 Ga0157373_100166162 284
2442 3300013104 Ga0157370_10004885 Ga0157370_1000488512 284
2443 3300013306 Ga0163162_10015064 Ga0163162_100150645 284
2444 3300013307 Ga0157372_10005926 Ga0157372_100059269 284
2445 3300013308 Ga0157375_10043776 Ga0157375_100437763 284
2446 3300014325 Ga0163163_10003323 Ga0163163_100033237 284
2447 3300021384 Ga0213876_10031688 Ga0213876_100316882 284
2448 3300025297 Ga0209758_1000267 Ga0209758_100026711 284
2449 3300025315 Ga0207697_10004919 Ga0207697_100049194 284
2450 3300025911 Ga0207654_10079072 Ga0207654_100790722 284
2451 3300025912 Ga0207707_10001961 Ga0207707_1000196114 284
2452 3300025912 Ga0207707_10319158 Ga0207707_103191581 284
2453 3300025918 Ga0207662_10007966 Ga0207662_100079665 284
2454 3300025919 Ga0207657_10092475 Ga0207657_100924753 284
2455 3300025921 Ga0207652_10026846 Ga0207652_100268466 284
2456 3300025925 Ga0207650_10065615 Ga0207650_100656154 284
2457 3300025926 Ga0207659_10359798 Ga0207659_103597981 284
2458 3300025932 Ga0207690_10006785 Ga0207690_100067855 284
2459 3300025932 Ga0207690_10008986 Ga0207690_100089865 284
2460 3300025933 Ga0207706_10012772 Ga0207706_100127724 284
2461 3300025935 Ga0207709_10025179 Ga0207709_100251792 284
2462 3300025936 Ga0207670_10113715 Ga0207670_101137151 284
2463 3300025937 Ga0207669_10062571 Ga0207669_100625713 284
2464 3300025938 Ga0207704_10222906 Ga0207704_102229061 284
2465 3300025939 Ga0207665_10150489 Ga0207665_101504892 284
2466 3300025949 Ga0207667_10040700 Ga0207667_100407001 284
2467 3300026041 Ga0207639_10005764 Ga0207639_100057644 284
2468 3300026067 Ga0207678_10021117 Ga0207678_100211173 284
2469 3300026075 Ga0207708_10005549 Ga0207708_100055496 284
2470 3300026089 Ga0207648_10013101 Ga0207648_100131015 284
2471 3300027682 Ga0209971_1002102 Ga0209971_10021023 284
2472 3300027695 Ga0209966_1003376 Ga0209966_10033763 284
2473 3300027717 Ga0209998_10003074 Ga0209998_100030742 284
2474 3300027876 Ga0209974_10030788 Ga0209974_100307882 284
2475 3300027907 Ga0207428_10002104 Ga0207428_1000210410 284
2476 3300028381 Ga0268264_10085103 Ga0268264_100851032 284
2477 3300028556 Ga0265337_1001372 Ga0265337_100137211 284
2478 3300034816 Ga0373930_0002558 Ga0373930_0002558_1832_2752 284
2479 3300034817 Ga0373948_0000454 Ga0373948_0000454_1314_2234 284
2480 3300034820 Ga0373959_0000553 Ga0373959_0000553_4270_5190 284
2481 3300034957 Ga0373938_0000334 Ga0373938_0000334_4889_5809 284
2482 3300035084 Ga0373928_0001960 Ga0373928_0001960_3054_3974 284
2483 3300035085 Ga0373929_0000456 Ga0373929_0000456_4247_5167 284
2484 3300035089 Ga0373944_0008447 Ga0373944_0008447_1045_1965 284
2485 3300035090 Ga0373949_0003442 Ga0373949_0003442_196_1116 284
2486 3300035091 Ga0373951_0006155 Ga0373951_0006155_216_1136 284
2487 3300035092 Ga0373952_0000133 Ga0373952_0000133_8364_9284 284
2488 3300035111 Ga0373923_0025196 Ga0373923_0025196_217_1137 284
2489 3300035112 Ga0373932_0000255 Ga0373932_0000255_13012_13932 284
2490 3300035113 Ga0373936_0059083 Ga0373936_0059083_178_1098 284
2491 3300035115 Ga0373941_0000664 Ga0373941_0000664_1314_2234 284
2492 3300035116 Ga0373945_0009492 Ga0373945_0009492_1792_2712 284
2493 3300035121 Ga0373960_0001740 Ga0373960_0001740_1659_2579 284
2494 3300035170 Ga0373943_0026560 Ga0373943_0026560_842_1762 284
2495 3300035171 Ga0373946_0015917 Ga0373946_0015917_1854_2774 284
2496 3300035172 Ga0373955_0065116 Ga0373955_0065116_255_1175 284
2497 3300035207 Ga0373942_0024739 Ga0373942_0024739_132_1052 284
2498 3300035241 Ga0373961_0003634 Ga0373961_0003634_2720_3640 284
2499 3300035242 Ga0373962_0000351 Ga0373962_0000351_6613_7533 284
2500 3300035410 Ga0373924_0017315 Ga0373924_0017315_1052_1972 284
2501 3300035691 Ga0373931_0044012 Ga0373931_0044012_14_934 284
2502 3300035692 Ga0373935_0110180 Ga0373935_0110180_98_1018 284
2503 3300035695 Ga0373927_0099336 Ga0373927_0099336_457_1377 284
2504 3300035725 Ga0373947_0030704 Ga0373947_0030704_246_1175 284
2505 3300035725 Ga0373947_0158669 Ga0373947_0158669_300_1220 284
2506 3300036401 Ga0373937_0041072 Ga0373937_0041072_157_1077 284
2507 3300036401 Ga0373937_0222527 Ga0373937_0222527_506_1435 284
2508 3300037853 Ga0436364_0210909 Ga0436364_0210909_997_1926 284
2509 3300039437 Ga0436365_1923442 Ga0436365_1923442_3915_4853 284
2510 3300039447 Ga0436361_0619802 Ga0436361_0619802_722_1651 284
2511 3300042439 Ga0439464_0015850 Ga0439464_0015850_40_960 284
2512 3300044673 Ga0453683_0153663 Ga0453683_0153663_497_1417 284
2513 3300044712 Ga0453684_0099668 Ga0453684_0099668_2255_3175 284
2514 3300046454 Ga0495592_0124845 Ga0495592_0124845_787_1707 284
2515 3300046455 Ga0495603_0019978 Ga0495603_0019978_1361_2281 284
2516 3300046459 Ga0495629_0065212 Ga0495629_0065212_796_1716 284
2517 3300046460 Ga0495638_0147300 Ga0495638_0147300_420_1352 284
2518 3300046461 Ga0495641_0016503 Ga0495641_0016503_2040_2960 284
2519 3300046462 Ga0495651_0025519 Ga0495651_0025519_3293_4213 284
2520 3300046463 Ga0495653_0010292 Ga0495653_0010292_4954_5874 284
2521 3300046472 Ga0495580_0009608 Ga0495580_0009608_676_1596 284
2522 3300046472 Ga0495580_0293085 Ga0495580_0293085_134_1063 284
2523 3300046473 Ga0495582_0027980 Ga0495582_0027980_1767_2687 284
2524 3300046475 Ga0495639_0006383 Ga0495639_0006383_3514_4434 284
2525 3300046476 Ga0495662_0014574 Ga0495662_0014574_2160_3080 284
2526 3300046477 Ga0495664_0167418 Ga0495664_0167418_234_1154 284
2527 3300046499 Ga0495594_0049124 Ga0495594_0049124_585_1505 284
2528 3300046511 Ga0495608_0016085 Ga0495608_0016085_3480_4400 284
2529 3300046516 Ga0495628_0055119 Ga0495628_0055119_765_1685 284
2530 3300046517 Ga0495630_0110694 Ga0495630_0110694_431_1360 284
2531 3300046517 Ga0495630_0120932 Ga0495630_0120932_939_1859 284
2532 3300046526 Ga0495666_0033183 Ga0495666_0033183_369_1289 284
2533 3300046531 Ga0495665_0013496 Ga0495665_0013496_2817_3737 284
2534 3300046533 Ga0495640_0044489 Ga0495640_0044489_933_1853 284
2535 3300046536 Ga0495587_0118854 Ga0495587_0118854_249_1169 284
2536 3300046557 Ga0495622_0059628 Ga0495622_0059628_101_1021 284
2537 3300046559 Ga0495667_0038530 Ga0495667_0038530_2168_3088 284
2538 3300046642 Ga0495634_0094410 Ga0495634_0094410_369_1289 284
2539 3300046663 Ga0495635_0006383 Ga0495635_0006383_284_1204 284
2540 3300046665 Ga0495661_0064610 Ga0495661_0064610_962_1882 284
2541 3300046674 Ga0495588_0004700 Ga0495588_0004700_3336_4256 284
2542 3300046680 Ga0495646_0006456 Ga0495646_0006456_178_1098 284
2543 3300046681 Ga0495647_0010062 Ga0495647_0010062_657_1577 284
2544 3300046683 Ga0495658_0005461 Ga0495658_0005461_3176_4096 284
2545 3300046689 Ga0495613_0037445 Ga0495613_0037445_2514_3434 284
2546 3300046690 Ga0495624_0117310 Ga0495624_0117310_556_1476 284
2547 3300046691 Ga0495670_0185838 Ga0495670_0185838_94_1014 284
2548 3300046809 Ga0495600_0012562 Ga0495600_0012562_1026_1946 284
2549 3300046809 Ga0495600_0206286 Ga0495600_0206286_151_1080 284
2550 3300047315 Ga0495581_0038390 Ga0495581_0038390_638_1558 284
2551 3300047317 Ga0495604_0043017 Ga0495604_0043017_1668_2588 284
2552 3300047319 Ga0495674_0064670 Ga0495674_0064670_1803_2723 284
2553 3300047321 Ga0495676_0044830 Ga0495676_0044830_801_1721 284
2554 3300047446 Ga0495679_042121 Ga0495679_042121_257_1177 284
2555 3300047471 Ga0495684_0000994 Ga0495684_0000994_1307_2227 284
2556 3300047673 Ga0495593_0028799 Ga0495593_0028799_1260_2180 284
2557 3300048088 Ga0495602_0153840 Ga0495602_0153840_438_1367 284
2558 3300048907 Ga0496104_0025260 Ga0496104_0025260_1881_2828 284
2559 3300048908 Ga0496105_0180521 Ga0496105_0180521_579_1508 284
2560 3300048909 Ga0496106_0057267 Ga0496106_0057267_1761_2681 284
2561 3300048910 Ga0496107_0014646 Ga0496107_0014646_2503_3423 284
2562 3300048911 Ga0496108_0002310 Ga0496108_0002310_3862_4782 284
2563 3300048915 Ga0496112_0013933 Ga0496112_0013933_4267_5187 284
2564 3300048916 Ga0496113_0010146 Ga0496113_0010146_4154_5074 284
2565 3300048917 Ga0496114_0042196 Ga0496114_0042196_366_1313 284
2566 3300049568 Ga0501031_0033847 Ga0501031_0033847_670_1599 284
2567 3300049571 Ga0501034_0005371 Ga0501034_0005371_12931_13929 284
2568 3300049572 Ga0501036_0008108 Ga0501036_0008108_6179_7177 284
2569 3300049573 Ga0501037_0002178 Ga0501037_0002178_5829_6827 284
2570 3300049573 Ga0501037_0139621 Ga0501037_0139621_42_1016 284
2571 3300049575 Ga0501039_0025267 Ga0501039_0025267_668_1666 284
2572 3300049575 Ga0501039_0066627 Ga0501039_0066627_1614_2543 284
2573 3300049576 Ga0501040_0180904 Ga0501040_0180904_505_1467 284
2574 3300049578 Ga0501042_0239800 Ga0501042_0239800_18_980 284
2575 3300049579 Ga0501043_0018418 Ga0501043_0018418_2952_3950 284
2576 3300049579 Ga0501043_0225196 Ga0501043_0225196_208_1137 284
2577 3300049580 Ga0501046_0009020 Ga0501046_0009020_3135_4133 284
2578 3300049581 Ga0501047_0014013 Ga0501047_0014013_5140_6138 284
2579 3300049582 Ga0501048_0061726 Ga0501048_0061726_1624_2598 284
2580 3300049585 Ga0501069_0088781 Ga0501069_0088781_619_1548 284
2581 3300049586 Ga0501070_0024927 Ga0501070_0024927_1433_2431 284
2582 3300049588 Ga0501072_0054662 Ga0501072_0054662_1849_2823 284
2583 3300049592 Ga0501076_0030224 Ga0501076_0030224_409_1338 284
2584 3300049593 Ga0501077_0159883 Ga0501077_0159883_230_1150 284
2585 3300049741 Ga0501079_0031572 Ga0501079_0031572_1854_2783 284
2586 3300049742 Ga0501080_0057864 Ga0501080_0057864_1049_2047 284
2587 3300049743 Ga0501081_0080512 Ga0501081_0080512_123_1052 284
2588 3300049744 Ga0501083_0134073 Ga0501083_0134073_473_1402 284
2589 3300049822 Ga0501035_0016134 Ga0501035_0016134_2641_3639 284
2590 3300050490 nmdc:mga03n38_114742_c1 nmdc:mga03n38_114742_c1_227_1165 284
2591 3300050491 nmdc:mga00v17_250510_c1 nmdc:mga00v17_250510_c1_185_1114 284
2592 3300050491 nmdc:mga00v17_45010_c1 nmdc:mga00v17_45010_c1_631_1569 284
2593 3300050511 nmdc:mga08y16_75341_c1 nmdc:mga08y16_75341_c1_2495_3415 284
2594 3300050513 nmdc:mga0rr50_478826_c1 nmdc:mga0rr50_478826_c1_110_1039 284
2595 3300050515 nmdc:mga0a205_43920_c1 nmdc:mga0a205_43920_c1_2065_2985 284
2596 3300053077 Ga0495601_0006824 Ga0495601_0006824_60_989 284
2597 3300053077 Ga0495601_0025496 Ga0495601_0025496_1957_2877 284
2598 3300053077 Ga0495601_0027153 Ga0495601_0027153_561_1490 284
2599 3300053078 Ga0495612_0022203 Ga0495612_0022203_346_1266 284
2600 3300053084 Ga0495595_0013074 Ga0495595_0013074_1792_2712 284
2601 3300053084 Ga0495595_0014466 Ga0495595_0014466_66_995 284
2602 3300053085 Ga0495619_0003732 Ga0495619_0003732_7081_8010 284
2603 3300053085 Ga0495619_0029780 Ga0495619_0029780_484_1404 284
2604 3300053087 Ga0500643_001421 Ga0500643_001421_4554_5486 284
2605 3300053088 Ga0500644_0000877 Ga0500644_0000877_7856_8788 284
2606 3300053093 Ga0500651_0001657 Ga0500651_0001657_2156_3088 284
2607 3300053094 Ga0500566_0059491 Ga0500566_0059491_680_1600 284
2608 3300053119 Ga0500595_000003 Ga0500595_000003_394554_395486 284
2609 3300053139 Ga0500568_0031295 Ga0500568_0031295_140_1075 284
2610 3300053153 Ga0500616_0000002 Ga0500616_0000002_1581170_1582102 284
2611 3300053730 Ga0500645_000226 Ga0500645_000226_30384_31358 284
2612 3300054114 Ga0501084_0043679 Ga0501084_0043679_2685_3659 284
2613 3300054114 Ga0501084_0379774 Ga0501084_0379774_73_1071 284

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

140

328

0.85

Feature Viewer

pLDDT pTM Quality
62.39 0.46 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map