F496963

General Info

Members Datasets Scaffolds Average Seq Length
2626 898 5252 229

Family's Representative Sequence

Representative Sequence 3300005344|Ga0070661_100134546|Ga0070661_1001345461
Length 253
Sequence MFGNFDWDVIRRSLPYLFRDGMTFTVTLTVLAMSGGLMLGTILAMMRLSSVAILSRLAGAYVNLMRSVPLLLVIFWFYFLVPYIGGYLFHQLYLLNPNGIGKVLVDAFGYQVEAGRPIQVGAFASSLITFTIFEAAYYCEIMRAGIQSISRGQMYAGYALGLNYWQTMGRIVLPQAFRNMIPVLLTQTIILFQDTSLVYVLSITDFLGAASKIAQRDGRLVEMYLFAAFVYFVISFSGSLLVKRLQVKLAVIR

Samples

Sample ID Description Type Environment
1 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
2 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
3 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
4 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
5 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
6 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
7 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
11 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
12 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
13 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
14 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
15 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
16 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
17 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
18 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
19 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
20 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
21 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
22 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
23 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
24 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
25 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
26 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
27 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
28 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
29 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
30 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
31 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
32 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
33 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
34 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
35 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
36 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
37 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
38 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
39 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
40 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
41 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
42 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
43 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
44 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
45 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
46 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
47 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
48 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
49 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
50 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
51 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
52 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
53 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
54 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
55 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
56 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
57 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
58 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
59 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
60 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
61 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
62 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
63 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
64 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
65 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
66 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
67 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
68 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
69 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
70 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
71 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
72 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
73 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
74 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
75 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
76 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
77 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
78 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
79 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
80 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
81 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
82 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
83 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
84 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
85 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
86 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
87 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
88 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
89 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
90 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
91 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
92 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
93 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
94 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
95 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
96 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
97 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
98 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
99 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
100 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
101 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
102 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
103 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
104 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
105 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
106 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
107 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
108 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
109 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
110 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
111 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
112 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
113 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
114 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
115 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
116 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
117 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
118 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
119 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
120 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
121 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
122 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
123 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
124 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
125 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
126 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
127 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
128 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
129 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
130 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
131 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
132 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
133 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
134 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
135 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
136 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
137 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
138 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
139 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
140 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
141 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
142 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
143 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
144 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
145 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
146 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
147 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
148 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
149 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
150 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
151 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
152 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
153 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
154 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
155 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
156 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
157 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
158 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
159 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
160 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
161 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
162 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
163 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
164 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
165 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
166 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
167 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
168 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
169 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
170 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
171 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
172 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
173 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
174 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
175 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
176 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
177 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
178 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
179 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
180 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
181 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
182 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
183 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
184 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
185 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
186 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
187 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
188 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
189 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
190 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
191 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
192 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
193 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
194 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
195 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
196 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
197 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
198 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
199 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
200 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
201 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
202 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
203 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
204 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
205 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
207 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
208 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
209 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
210 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
211 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
212 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
213 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
214 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
215 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
216 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
217 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
218 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
219 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
274 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
275 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
276 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
279 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
280 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
281 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
282 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
283 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
284 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
286 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
287 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
288 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
289 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
290 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
291 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
292 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
293 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
294 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
295 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
296 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
297 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
298 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
299 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
300 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
301 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
302 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
303 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
304 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
305 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
307 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
308 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
309 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
310 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
311 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
312 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
313 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
314 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
315 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
316 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
317 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
318 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
319 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
320 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
321 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
322 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
323 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
324 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
325 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
326 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
327 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
328 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
329 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
330 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
331 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
332 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
333 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
334 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
335 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
336 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
337 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
338 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
339 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
340 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
341 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
342 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
343 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
344 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
345 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
346 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
347 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
348 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
349 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
350 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
351 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
352 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
353 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
354 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
355 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
356 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
357 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
358 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
359 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
360 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
361 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
362 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
363 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
364 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
365 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
366 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
367 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
368 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
369 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
370 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
371 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
372 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
373 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
374 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
375 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
376 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
377 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
378 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
379 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
380 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
381 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
382 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
383 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
384 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
385 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
386 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
387 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
388 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
389 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
390 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
391 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
392 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
393 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
394 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
395 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
396 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
397 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
398 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
399 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
400 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
401 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
402 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
403 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
404 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
405 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
406 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
407 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
408 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
409 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
410 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
411 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
412 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
413 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
414 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
415 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
416 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
417 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
418 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
419 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
420 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
421 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
422 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
423 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
424 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
425 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
426 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
427 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
428 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
429 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
430 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
431 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
432 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
433 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
434 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
435 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
436 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
437 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
438 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
439 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
440 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
441 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
442 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
443 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
444 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
445 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
446 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
447 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
448 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
449 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
450 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
451 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
452 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
453 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
454 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
455 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
456 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
457 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
458 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
459 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
460 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
461 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
462 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
463 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
464 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
465 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
466 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
467 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
468 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
469 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
470 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
471 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
472 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
473 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
474 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
475 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
476 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
477 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
478 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
479 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
480 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
481 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
482 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
483 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
484 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
485 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
486 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
487 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
488 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
489 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
490 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
491 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
492 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
493 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
494 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
495 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
496 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
497 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
498 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
499 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
500 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
501 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
502 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
503 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
504 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
505 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
506 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
507 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
508 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
509 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
510 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
511 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
512 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
513 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
514 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
515 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
516 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
517 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
518 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
519 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
520 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
521 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
522 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
523 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
524 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
525 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
526 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
527 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
528 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
529 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
530 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
531 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
532 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
533 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
534 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
535 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
536 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
537 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
538 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
539 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
540 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
541 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
542 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
543 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
544 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
545 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
546 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
547 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
548 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
549 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
550 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
551 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
552 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
553 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
554 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
555 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
556 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
557 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
558 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
559 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
560 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
561 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
562 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
563 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
564 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
565 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
566 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
567 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
568 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
569 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
570 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
571 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
572 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
573 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
574 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
575 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
576 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
577 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
578 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
579 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
580 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
581 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
582 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
583 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
584 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
585 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
586 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
587 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
588 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
589 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
590 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
591 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
592 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
593 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
594 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
595 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
596 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
597 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
598 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
599 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
600 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
601 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
602 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
603 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
604 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
605 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
606 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
607 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
608 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
609 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
610 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
611 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
612 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
613 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
614 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
615 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
616 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
617 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
618 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
619 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
620 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
621 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
622 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
623 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
624 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
625 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
626 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
627 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
628 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
629 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
630 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
631 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
632 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
633 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
634 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
635 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
636 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
637 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
638 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
639 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
640 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
641 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
642 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
643 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
644 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
645 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
646 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
647 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
648 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
649 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
650 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
651 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
652 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
653 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
654 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
655 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
656 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
657 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
658 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
659 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
660 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
661 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
662 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
663 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
664 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
665 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
666 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
667 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
668 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
669 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
670 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
671 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
672 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
673 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
674 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
675 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
676 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
677 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
678 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
679 2643221569 Achromobacter sp. Root565 Isolate Unclassified
680 2643221594 Achromobacter sp. Root170 Isolate Unclassified
681 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
682 2643221621 Achromobacter sp. Root83 Isolate Unclassified
683 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
684 2643221638 Duganella sp. Root336D2 Isolate Unclassified
685 2643221645 Massilia sp. Root351 Isolate Unclassified
686 2643221664 Massilia sp. Root418 Isolate Unclassified
687 2643221672 Variovorax sp. Root434 Isolate Unclassified
688 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
689 2738541280 Massilia sp. GV090 Isolate Unclassified
690 2738541300 Massilia sp. GV016 Isolate Unclassified
691 2738543018 Massilia sp. GV045 Isolate Unclassified
692 2738543030 Massilia sp. GV097 Isolate Unclassified
693 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
694 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
695 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
696 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
697 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
698 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
699 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
700 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
701 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
702 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
703 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
704 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
705 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
706 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
707 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
708 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
709 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
710 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
711 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
712 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
713 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
714 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
715 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
716 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
717 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
718 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
719 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
720 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
721 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
722 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
723 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
724 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
725 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
726 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
727 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
728 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
729 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
730 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
731 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
732 2842711865 Duganella sp. R-73148 Isolate Unclassified
733 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
734 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
735 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
736 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
737 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
738 2855730933 Achromobacter sp. HZ28 Isolate Nodule
739 2855767633 Achromobacter sp. HZ34 Isolate Nodule
740 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
741 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
742 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
743 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
744 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
745 2857558681 Duganella sp. R-74565 Isolate Unclassified
746 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
747 2858950400 Achromobacter sp. K91 Isolate Unclassified
748 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
749 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
750 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
751 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
752 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
753 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
754 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
755 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
756 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
757 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
758 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
759 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
760 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
761 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
762 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
763 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
764 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
765 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
766 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
767 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
768 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
769 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
770 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
771 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
772 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
773 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
774 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
775 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
776 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
777 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
778 2902330777 Methylobacterium sp. 2A Isolate Unclassified
779 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
780 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
781 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
782 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
783 2904424332 Duganella sp. 1411 Isolate Rhizosphere
784 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
785 2904699407
786 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
787 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
788 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
789 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
790 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
791 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
792 2919476304 Duganella sp. 3397 Isolate Unclassified
793 2922368715
794 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
795 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
796 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
797 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
798 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
799 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
800 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
801 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
802 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
803 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
804 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
805 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
806 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
807 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
808 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
809 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
810 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
811 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
812 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
813 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
814 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
815 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
816 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
817 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
818 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
819 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
820 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
821 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
822 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
823 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
824 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
825 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
826 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
827 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
828 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
829 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
830 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
831 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
832 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
833 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
834 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
835 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
836 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
837 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
838 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
839 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
840 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
841 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
842 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
843 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
844 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
845 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
846 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
847 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
848 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
849 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
850 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
851 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
852 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
853 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
854 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
855 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
856 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
857 2941479691
858 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
859 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
860 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
861 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
862 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
863 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
864 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
865 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
866 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
867 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
868 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
869 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
870 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
871 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
872 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
873 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
874 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
875 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
876 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
877 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
878 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
879 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
880 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
881 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
882 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
883 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
884 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
885 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
886 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
887 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
888 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
889 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
890 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
891 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
892 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
893 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
894 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
895 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
896 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
897 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
898 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 90.28
Metatranscriptomes 0.27
Isolates 9.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.06
Nodule 6.25
Rhizoplane 3.43
Rhizosphere 73.99
Stem 0
Stem Tuber 0
Unclassified 0.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070661_100134546 3300005344 Bacteria 1859
2 ARcpr5oldR_c000111 3300000041 Bacteria 14696
3 ARSoilYngRDRAFT_c00101 3300000042 Bacteria 14644
4 ARcpr5yngRDRAFT_c000611 3300000043 Bacteria 4495
5 ARSoilOldRDRAFT_c000075 3300000044 Bacteria 18961
6 ARCol0oldRDRAFT_c00114 3300000045 Bacteria 7012
7 ARCol0yngRDRAFT_1000068 3300000652 Bacteria 18966
8 JGI24737J22298_10000767 3300001990 Bacteria 11346
9 JGI24737J22298_10032280 3300001990 Bacteria 1631
10 JGI24737J22298_10056117 3300001990 Bacteria 1190
11 JGI24735J21928_10037256 3300002067 Bacteria 1426
12 JGI24748J21848_1019612 3300002074 Bacteria 813
13 JGI24738J21930_10013662 3300002075 Bacteria 1752
14 JGI24749J21850_1004621 3300002076 Bacteria 1927
15 JGI24744J21845_10001437 3300002077 Bacteria 4734
16 JGI24742J22300_10029641 3300002244 Bacteria 953
17 JGI25150J39212_1000836 3300002774 Bacteria 10318
18 JGI25150J39212_1001760 3300002774 Bacteria 5769
19 JGI25150J39212_1011011 3300002774 Bacteria 1657
20 JGI25159J45721_1001676 3300002987 Bacteria 8981
21 JGI25159J45721_1001744 3300002987 Bacteria 8758
22 JGI25159J45721_1002624 3300002987 Bacteria 6721
23 JGI25151J46595_10000852 3300003187 Bacteria 24283
24 JGI25151J46595_10002292 3300003187 Bacteria 11705
25 JGI25406J46586_10004826 3300003203 Bacteria 6268
26 JGI25153J46596_10002780 3300003215 Bacteria 9952
27 JGI25153J46596_10009794 3300003215 Bacteria 4404
28 JGI25153J46596_10013885 3300003215 Bacteria 3380
29 JGI25153J46596_10016150 3300003215 Bacteria 3007
30 JGI25153J46596_10029762 3300003215 Bacteria 1869
31 rootL2_10039033 3300003322 Bacteria 1073
32 JGI26129J50193_1005612 3300003349 Bacteria 895
33 JGI25160J50197_1002292 3300003354 Bacteria 8968
34 JGI25160J50197_1002807 3300003354 Bacteria 7976
35 JGI25161J50226_1000359 3300003374 Bacteria 23600
36 JGI25161J50226_1000568 3300003374 Bacteria 15639
37 Ga0007417J51691_1009481 3300003544 Bacteria 4631
38 Ga0007409J51694_1004381 3300003575 Bacteria 6398
39 Ga0007416J51690_1005346 3300003577 Bacteria 5788
40 Ga0032354_1019660 3300003693 Bacteria 4640
41 Ga0055539_1001386 3300003752 Bacteria 4594
42 Ga0055539_1002621 3300003752 Bacteria 2688
43 Ga0055526_1000226 3300003771 Bacteria 47921
44 Ga0055526_1001304 3300003771 Bacteria 17872
45 Ga0055526_1001652 3300003771 Bacteria 15646
46 Ga0055526_1036025 3300003771 Bacteria 1321
47 Ga0055537_1000047 3300003773 Bacteria 88000
48 Ga0055537_1000853 3300003773 Bacteria 14833
49 Ga0055537_1008250 3300003773 Bacteria 2422
50 Ga0055524_1000039 3300003775 Bacteria 159897
51 Ga0055524_1000723 3300003775 Bacteria 22629
52 Ga0055524_1003008 3300003775 Bacteria 8354
53 Ga0055524_1003701 3300003775 Bacteria 7317
54 Ga0055536_1000782 3300003781 Bacteria 21233
55 Ga0055534_1000803 3300003784 Bacteria 14593
56 Ga0055534_1002558 3300003784 Bacteria 6236
57 Ga0055534_1008291 3300003784 Bacteria 2369
58 Ga0055534_1014938 3300003784 Bacteria 1438
59 Ga0055528_1001770 3300003790 Bacteria 12400
60 Ga0055528_1003520 3300003790 Bacteria 7813
61 Ga0055530_10000199 3300003791 Bacteria 53828
62 Ga0055540_1000047 3300003792 Bacteria 146914
63 Ga0055531_10000848 3300003794 Bacteria 25238
64 Ga0055531_10005239 3300003794 Bacteria 7617
65 Ga0055531_10009445 3300003794 Bacteria 4981
66 Ga0055531_10011844 3300003794 Bacteria 4161
67 Ga0055543_1000364 3300004625 Bacteria 30047
68 Ga0055543_1009069 3300004625 Bacteria 2164
69 Ga0065165_1001009 3300005262 Bacteria 34332
70 Ga0065165_1001013 3300005262 Bacteria 34221
71 Ga0065165_1001177 3300005262 Bacteria 30398
72 Ga0065165_1001442 3300005262 Bacteria 25772
73 Ga0065165_1047833 3300005262 Bacteria 1232
74 Ga0065165_1067758 3300005262 Bacteria 956
75 Ga0065717_1002570 3300005276 Bacteria 1801
76 Ga0065714_10006041 3300005288 Bacteria 4088
77 Ga0065704_10071086 3300005289 Bacteria 13277
78 Ga0065712_10005097 3300005290 Bacteria 3193
79 Ga0065712_10012206 3300005290 Bacteria 3165
80 Ga0065712_10071626 3300005290 Bacteria 5151
81 Ga0065712_10091789 3300005290 Bacteria 2357
82 Ga0065715_10001199 3300005293 Bacteria 15243
83 Ga0065715_10029869 3300005293 Bacteria 1176
84 Ga0065715_10093842 3300005293 Bacteria 4518
85 Ga0070658_10001915 3300005327 Bacteria 17560
86 Ga0070658_10043959 3300005327 Bacteria 3609
87 Ga0070658_10071085 3300005327 Bacteria 2850
88 Ga0070658_10118129 3300005327 Bacteria 2202
89 Ga0070658_10141682 3300005327 Bacteria 2009
90 Ga0070658_10205288 3300005327 Bacteria 1664
91 Ga0070658_10341159 3300005327 Bacteria 1281
92 Ga0070676_10094014 3300005328 Bacteria 1841
93 Ga0070683_100003301 3300005329 Bacteria 13044
94 Ga0070683_100003885 3300005329 Bacteria 12224
95 Ga0070683_100042654 3300005329 Bacteria 4177
96 Ga0070683_100075042 3300005329 Bacteria 3159
97 Ga0070683_100260703 3300005329 Bacteria 1649
98 Ga0070690_100000086 3300005330 Bacteria 45886
99 Ga0070690_100001998 3300005330 Bacteria 10861
100 Ga0070690_100043339 3300005330 Bacteria 2854
101 Ga0070690_100158368 3300005330 Bacteria 1550
102 Ga0070677_10016992 3300005333 Bacteria 2598
103 Ga0070677_10062034 3300005333 Bacteria 1545
104 Ga0068869_100000300 3300005334 Bacteria 26332
105 Ga0068869_100224009 3300005334 Bacteria 1492
106 Ga0070680_100010416 3300005336 Bacteria 7168
107 Ga0070680_100012640 3300005336 Bacteria 6563
108 Ga0070680_100044693 3300005336 Bacteria 3599
109 Ga0070680_100061005 3300005336 Bacteria 3087
110 Ga0070680_100106302 3300005336 Bacteria 2333
111 Ga0070680_100117542 3300005336 Bacteria 2217
112 Ga0070680_100173425 3300005336 Bacteria 1815
113 Ga0070680_100200052 3300005336 Bacteria 1685
114 Ga0070680_100379467 3300005336 Bacteria 1203
115 Ga0070680_100508724 3300005336 Bacteria 1031
116 Ga0070682_100007298 3300005337 Bacteria 6232
117 Ga0070682_100063938 3300005337 Bacteria 2334
118 Ga0070682_100265716 3300005337 Bacteria 1244
119 Ga0070682_100273559 3300005337 Bacteria 1228
120 Ga0070682_100441020 3300005337 Bacteria 995
121 Ga0068868_100000831 3300005338 Bacteria 20934
122 Ga0068868_100245679 3300005338 Bacteria 1505
123 Ga0068868_100292927 3300005338 Bacteria 1380
124 Ga0068868_100299079 3300005338 Bacteria 1366
125 Ga0070660_100000725 3300005339 Bacteria 21879
126 Ga0070660_100008433 3300005339 Bacteria 7205
127 Ga0070660_100030625 3300005339 Bacteria 4037
128 Ga0070660_100056354 3300005339 Bacteria 3040
129 Ga0070660_100290950 3300005339 Bacteria 1338
130 Ga0070660_100690451 3300005339 Bacteria 855
131 Ga0070689_100000317 3300005340 Bacteria 28150
132 Ga0070689_100008267 3300005340 Bacteria 7323
133 Ga0070689_100012680 3300005340 Bacteria 6079
134 Ga0070689_100026934 3300005340 Bacteria 4331
135 Ga0070689_100065941 3300005340 Bacteria 2820
136 Ga0070689_100108163 3300005340 Bacteria 2209
137 Ga0070689_100150827 3300005340 Bacteria 1875
138 Ga0070689_100178314 3300005340 Bacteria 1724
139 Ga0070689_100279900 3300005340 Bacteria 1383
140 Ga0070689_100284772 3300005340 Bacteria 1372
141 Ga0070689_100415860 3300005340 Bacteria 1139
142 Ga0070691_10003301 3300005341 Bacteria 7234
143 Ga0070691_10003760 3300005341 Bacteria 6859
144 Ga0070691_10006901 3300005341 Bacteria 5194
145 Ga0070691_10171800 3300005341 Bacteria 1124
146 Ga0070687_100000162 3300005343 Bacteria 23106
147 Ga0070687_100019697 3300005343 Bacteria 3143
148 Ga0070687_100285554 3300005343 Bacteria 1041
149 Ga0070661_100000513 3300005344 Bacteria 29734
150 Ga0070661_100044154 3300005344 Bacteria 3256
151 Ga0070661_100064854 3300005344 Bacteria 2684
152 Ga0070661_100082398 3300005344 Bacteria 2376
153 Ga0070661_100168800 3300005344 Bacteria 1661
154 Ga0070661_100213592 3300005344 Bacteria 1477
155 Ga0070661_100661378 3300005344 Bacteria 849
156 Ga0070692_10000148 3300005345 Bacteria 17249
157 Ga0070692_10021925 3300005345 Bacteria 3113
158 Ga0070692_10025736 3300005345 Bacteria 2903
159 Ga0070692_10060570 3300005345 Bacteria 1993
160 Ga0070692_10291701 3300005345 Bacteria 993
161 Ga0070668_100046393 3300005347 Bacteria 3336
162 Ga0070668_100088534 3300005347 Bacteria 2437
163 Ga0070668_100090375 3300005347 Bacteria 2412
164 Ga0070668_100118852 3300005347 Bacteria 2110
165 Ga0070668_100160384 3300005347 Bacteria 1824
166 Ga0070669_100004782 3300005353 Bacteria 9771
167 Ga0070669_100032699 3300005353 Bacteria 3758
168 Ga0070669_100084667 3300005353 Bacteria 2366
169 Ga0070669_100112834 3300005353 Bacteria 2065
170 Ga0070669_100611310 3300005353 Bacteria 914
171 Ga0070675_100004556 3300005354 Bacteria 10579
172 Ga0070675_100131909 3300005354 Bacteria 2130
173 Ga0070671_100075465 3300005355 Bacteria 2816
174 Ga0070674_100409822 3300005356 Bacteria 1109
175 Ga0070673_100014834 3300005364 Bacteria 5449
176 Ga0070673_100133428 3300005364 Bacteria 2087
177 Ga0070673_100186597 3300005364 Bacteria 1778
178 Ga0070673_100340526 3300005364 Bacteria 1329
179 Ga0070688_100048358 3300005365 Bacteria 2642
180 Ga0070688_100079294 3300005365 Bacteria 2121
181 Ga0070688_100272744 3300005365 Bacteria 1212
182 Ga0070659_100000556 3300005366 Bacteria 27336
183 Ga0070659_100013556 3300005366 Bacteria 6071
184 Ga0070659_100234260 3300005366 Bacteria 1518
185 Ga0070667_100107757 3300005367 Bacteria 2413
186 Ga0070667_100219888 3300005367 Bacteria 1690
187 Ga0070667_100505908 3300005367 Bacteria 1108
188 Ga0070709_10001276 3300005434 Bacteria 13760
189 Ga0070709_10029928 3300005434 Bacteria 3262
190 Ga0070709_10082232 3300005434 Bacteria 2104
191 Ga0070709_10126482 3300005434 Bacteria 1739
192 Ga0070709_10212896 3300005434 Bacteria 1374
193 Ga0070714_100009911 3300005435 Bacteria 7514
194 Ga0070714_100020365 3300005435 Bacteria 5416
195 Ga0070714_100026401 3300005435 Bacteria 4800
196 Ga0070714_100141772 3300005435 Bacteria 2158
197 Ga0070714_100197285 3300005435 Bacteria 1840
198 Ga0070714_100226343 3300005435 Bacteria 1721
199 Ga0070714_100269770 3300005435 Bacteria 1578
200 Ga0070714_100640629 3300005435 Bacteria 1022
201 Ga0070713_100054342 3300005436 Bacteria 3322
202 Ga0070713_100081605 3300005436 Bacteria 2759
203 Ga0070713_100179954 3300005436 Bacteria 1899
204 Ga0070713_100723861 3300005436 Bacteria 951
205 Ga0070710_10003504 3300005437 Bacteria 7436
206 Ga0070710_10043430 3300005437 Bacteria 2489
207 Ga0070710_10073005 3300005437 Bacteria 1983
208 Ga0070701_10000329 3300005438 Bacteria 15629
209 Ga0070701_10084534 3300005438 Bacteria 1726
210 Ga0070711_100007004 3300005439 Bacteria 6841
211 Ga0070711_100040488 3300005439 Bacteria 3143
212 Ga0070711_100065032 3300005439 Bacteria 2549
213 Ga0070711_100225132 3300005439 Bacteria 1460
214 Ga0070711_100502511 3300005439 Bacteria 1000
215 Ga0070705_100000115 3300005440 Bacteria 45886
216 Ga0070705_100011569 3300005440 Bacteria 4458
217 Ga0070705_100258237 3300005440 Bacteria 1227
218 Ga0070705_100300114 3300005440 Bacteria 1151
219 Ga0070700_100003157 3300005441 Bacteria 8466
220 Ga0070700_100536203 3300005441 Bacteria 907
221 Ga0070694_100000066 3300005444 Bacteria 49292
222 Ga0070694_100004270 3300005444 Bacteria 8601
223 Ga0070694_100006882 3300005444 Bacteria 6911
224 Ga0070694_100013605 3300005444 Bacteria 5084
225 Ga0070694_100023963 3300005444 Bacteria 3934
226 Ga0070694_100075829 3300005444 Bacteria 2326
227 Ga0070694_100093928 3300005444 Bacteria 2109
228 Ga0070694_100119856 3300005444 Bacteria 1886
229 Ga0070694_100163235 3300005444 Bacteria 1636
230 Ga0070708_100023747 3300005445 Bacteria 5217
231 Ga0070708_100061584 3300005445 Bacteria 3353
232 Ga0070663_100008086 3300005455 Bacteria 6450
233 Ga0070663_100010452 3300005455 Bacteria 5785
234 Ga0070663_100031014 3300005455 Bacteria 3669
235 Ga0070663_100178978 3300005455 Bacteria 1643
236 Ga0070663_100289186 3300005455 Bacteria 1308
237 Ga0070663_100352736 3300005455 Bacteria 1191
238 Ga0070678_100014091 3300005456 Bacteria 5032
239 Ga0070678_100031016 3300005456 Bacteria 3681
240 Ga0070678_100081975 3300005456 Bacteria 2447
241 Ga0070678_100319901 3300005456 Bacteria 1325
242 Ga0070662_100133356 3300005457 Bacteria 1918
243 Ga0070662_100363367 3300005457 Bacteria 1188
244 Ga0070681_10000695 3300005458 Bacteria 27954
245 Ga0070681_10021502 3300005458 Bacteria 6466
246 Ga0070681_10027436 3300005458 Bacteria 5725
247 Ga0070681_10027607 3300005458 Bacteria 5707
248 Ga0070681_10042120 3300005458 Bacteria 4576
249 Ga0070681_10052696 3300005458 Bacteria 4059
250 Ga0070681_10058438 3300005458 Bacteria 3836
251 Ga0070681_10061799 3300005458 Bacteria 3720
252 Ga0070681_10073846 3300005458 Bacteria 3372
253 Ga0070681_10129893 3300005458 Bacteria 2451
254 Ga0070681_10193229 3300005458 Bacteria 1955
255 Ga0070681_10447608 3300005458 Bacteria 1203
256 Ga0070681_10565649 3300005458 Bacteria 1051
257 Ga0070681_10765923 3300005458 Bacteria 882
258 Ga0068867_100000422 3300005459 Bacteria 28308
259 Ga0068867_100002316 3300005459 Bacteria 13404
260 Ga0068867_100061339 3300005459 Bacteria 2792
261 Ga0068867_100294408 3300005459 Bacteria 1336
262 Ga0070685_10003631 3300005466 Bacteria 7831
263 Ga0070685_10069531 3300005466 Bacteria 2083
264 Ga0070706_100021177 3300005467 Bacteria 5987
265 Ga0070706_100105723 3300005467 Bacteria 2619
266 Ga0070706_100122183 3300005467 Bacteria 2427
267 Ga0070706_100206239 3300005467 Bacteria 1836
268 Ga0070706_100290469 3300005467 Bacteria 1526
269 Ga0070707_100035350 3300005468 Bacteria 4766
270 Ga0070707_100170353 3300005468 Bacteria 2122
271 Ga0070707_100348268 3300005468 Bacteria 1439
272 Ga0070698_100000691 3300005471 Bacteria 36018
273 Ga0070698_100030131 3300005471 Bacteria 5628
274 Ga0070699_100004971 3300005518 Bacteria 11723
275 Ga0070699_100034058 3300005518 Bacteria 4401
276 Ga0070699_100222577 3300005518 Bacteria 1682
277 Ga0070679_100024275 3300005530 Bacteria 5940
278 Ga0070679_100034919 3300005530 Bacteria 4986
279 Ga0070679_100051430 3300005530 Bacteria 4103
280 Ga0070679_100097970 3300005530 Bacteria 2920
281 Ga0070679_100098605 3300005530 Bacteria 2909
282 Ga0070679_100133245 3300005530 Bacteria 2466
283 Ga0070679_100168402 3300005530 Bacteria 2164
284 Ga0070679_100173036 3300005530 Bacteria 2132
285 Ga0070684_100011858 3300005535 Bacteria 6959
286 Ga0070684_100041455 3300005535 Bacteria 3969
287 Ga0070684_100046721 3300005535 Bacteria 3751
288 Ga0070684_100067953 3300005535 Bacteria 3131
289 Ga0070684_100111150 3300005535 Bacteria 2457
290 Ga0070684_100176999 3300005535 Bacteria 1939
291 Ga0070684_100368818 3300005535 Bacteria 1322
292 Ga0070684_100481536 3300005535 Bacteria 1149
293 Ga0070697_100005365 3300005536 Bacteria 9863
294 Ga0070697_100009161 3300005536 Bacteria 7733
295 Ga0070697_100065353 3300005536 Bacteria 2972
296 Ga0070697_100251393 3300005536 Bacteria 1512
297 Ga0068853_100003342 3300005539 Bacteria 12280
298 Ga0068853_100050623 3300005539 Bacteria 3574
299 Ga0068853_100078084 3300005539 Bacteria 2893
300 Ga0068853_100081524 3300005539 Bacteria 2833
301 Ga0068853_100093245 3300005539 Bacteria 2651
302 Ga0068853_100396148 3300005539 Bacteria 1292
303 Ga0070672_100084825 3300005543 Bacteria 2544
304 Ga0070672_100164154 3300005543 Bacteria 1844
305 Ga0070672_100386529 3300005543 Bacteria 1198
306 Ga0070686_100000167 3300005544 Bacteria 45886
307 Ga0070686_100008844 3300005544 Bacteria 5643
308 Ga0070686_100023571 3300005544 Bacteria 3680
309 Ga0070686_100058628 3300005544 Bacteria 2477
310 Ga0070686_100097420 3300005544 Bacteria 1980
311 Ga0070686_100172047 3300005544 Bacteria 1532
312 Ga0070686_100241673 3300005544 Bacteria 1315
313 Ga0070695_100000164 3300005545 Bacteria 31583
314 Ga0070695_100000823 3300005545 Bacteria 16733
315 Ga0070695_100004471 3300005545 Bacteria 8215
316 Ga0070695_100010346 3300005545 Bacteria 5567
317 Ga0070695_100113078 3300005545 Bacteria 1846
318 Ga0070695_100675337 3300005545 Bacteria 818
319 Ga0070696_100000643 3300005546 Bacteria 22328
320 Ga0070696_100003306 3300005546 Bacteria 10765
321 Ga0070696_100009228 3300005546 Bacteria 6602
322 Ga0070696_100010931 3300005546 Bacteria 6081
323 Ga0070696_100037721 3300005546 Bacteria 3333
324 Ga0070696_100038320 3300005546 Bacteria 3308
325 Ga0070696_100165957 3300005546 Bacteria 1629
326 Ga0070696_100407704 3300005546 Bacteria 1065
327 Ga0070696_100407822 3300005546 Bacteria 1064
328 Ga0070696_100559198 3300005546 Bacteria 917
329 Ga0070696_100638867 3300005546 Bacteria 862
330 Ga0070693_100000043 3300005547 Bacteria 48919
331 Ga0070693_100001161 3300005547 Bacteria 11827
332 Ga0070693_100022858 3300005547 Bacteria 3333
333 Ga0070693_100150646 3300005547 Bacteria 1473
334 Ga0070693_100224847 3300005547 Bacteria 1232
335 Ga0070693_100259182 3300005547 Bacteria 1156
336 Ga0070665_100005999 3300005548 Bacteria 12427
337 Ga0070665_100478872 3300005548 Bacteria 1255
338 Ga0070704_100000027 3300005549 Bacteria 47731
339 Ga0070704_100002925 3300005549 Bacteria 9702
340 Ga0070704_100049552 3300005549 Bacteria 2947
341 Ga0070704_100353231 3300005549 Bacteria 1242
342 Ga0068855_100003366 3300005563 Bacteria 19577
343 Ga0068855_100008136 3300005563 Bacteria 12675
344 Ga0068855_100026664 3300005563 Bacteria 6914
345 Ga0068855_100028603 3300005563 Bacteria 6668
346 Ga0068855_100035870 3300005563 Bacteria 5905
347 Ga0068855_100036468 3300005563 Bacteria 5852
348 Ga0068855_100066234 3300005563 Bacteria 4212
349 Ga0068855_100071740 3300005563 Bacteria 4026
350 Ga0068855_100112677 3300005563 Bacteria 3122
351 Ga0068855_100141618 3300005563 Bacteria 2740
352 Ga0068855_100145565 3300005563 Bacteria 2698
353 Ga0068855_100323380 3300005563 Bacteria 1704
354 Ga0068855_100368303 3300005563 Bacteria 1580
355 Ga0068855_100546196 3300005563 Bacteria 1255
356 Ga0070664_100006869 3300005564 Bacteria 9177
357 Ga0070664_100028499 3300005564 Bacteria 4646
358 Ga0070664_100043278 3300005564 Bacteria 3799
359 Ga0070664_100142334 3300005564 Bacteria 2112
360 Ga0070664_100300713 3300005564 Bacteria 1450
361 Ga0070664_100552850 3300005564 Bacteria 1064
362 Ga0068857_100000897 3300005577 Bacteria 22487
363 Ga0068857_100031603 3300005577 Bacteria 4678
364 Ga0068857_100033556 3300005577 Bacteria 4540
365 Ga0068857_100214394 3300005577 Bacteria 1757
366 Ga0068857_100413262 3300005577 Bacteria 1257
367 Ga0068854_100002468 3300005578 Bacteria 11440
368 Ga0068854_100107549 3300005578 Bacteria 2099
369 Ga0068854_100118440 3300005578 Bacteria 2006
370 Ga0068854_100244266 3300005578 Bacteria 1431
371 Ga0068854_100329945 3300005578 Bacteria 1243
372 Ga0068854_100773814 3300005578 Bacteria 834
373 Ga0068856_100000712 3300005614 Bacteria 36113
374 Ga0068856_100013738 3300005614 Bacteria 7829
375 Ga0068856_100018043 3300005614 Bacteria 6843
376 Ga0068856_100019954 3300005614 Bacteria 6506
377 Ga0068856_100025710 3300005614 Bacteria 5740
378 Ga0068856_100190280 3300005614 Bacteria 2066
379 Ga0068856_100298408 3300005614 Bacteria 1629
380 Ga0070702_100000078 3300005615 Bacteria 28197
381 Ga0070702_100016165 3300005615 Bacteria 3824
382 Ga0070702_100070786 3300005615 Bacteria 2060
383 Ga0070702_100189996 3300005615 Bacteria 1351
384 Ga0070702_100696847 3300005615 Bacteria 774
385 Ga0068852_100066412 3300005616 Bacteria 3150
386 Ga0068852_100071661 3300005616 Bacteria 3044
387 Ga0068852_100103481 3300005616 Bacteria 2575
388 Ga0068852_100164973 3300005616 Bacteria 2072
389 Ga0068852_100233678 3300005616 Bacteria 1754
390 Ga0068852_100334282 3300005616 Bacteria 1475
391 Ga0068852_100482094 3300005616 Bacteria 1232
392 Ga0068852_100684372 3300005616 Bacteria 1035
393 Ga0068859_100008744 3300005617 Bacteria 10232
394 Ga0068859_100016531 3300005617 Bacteria 7407
395 Ga0068859_100112955 3300005617 Bacteria 2780
396 Ga0068859_100196077 3300005617 Bacteria 2104
397 Ga0068859_100231027 3300005617 Bacteria 1938
398 Ga0068859_100278707 3300005617 Bacteria 1764
399 Ga0068859_100776260 3300005617 Bacteria 1047
400 Ga0068864_100055636 3300005618 Bacteria 3417
401 Ga0068864_100089520 3300005618 Bacteria 2712
402 Ga0068864_100383284 3300005618 Bacteria 1333
403 Ga0068864_100856771 3300005618 Bacteria 896
404 Ga0068866_10001174 3300005718 Bacteria 11451
405 Ga0068866_10029750 3300005718 Bacteria 2615
406 Ga0068861_100000521 3300005719 Bacteria 22497
407 Ga0068861_100003518 3300005719 Bacteria 10409
408 Ga0068861_100102410 3300005719 Bacteria 2279
409 Ga0068861_100631911 3300005719 Bacteria 987
410 Ga0068861_100723001 3300005719 Bacteria 927
411 Ga0068851_10002061 3300005834 Bacteria 8858
412 Ga0068870_10024163 3300005840 Bacteria 3005
413 Ga0068870_10030163 3300005840 Bacteria 2739
414 Ga0068863_100194525 3300005841 Bacteria 1949
415 Ga0068863_100519024 3300005841 Bacteria 1174
416 Ga0068863_100583488 3300005841 Bacteria 1105
417 Ga0068858_100000286 3300005842 Bacteria 54596
418 Ga0068858_100039563 3300005842 Bacteria 4372
419 Ga0068858_100146799 3300005842 Bacteria 2215
420 Ga0068858_100361246 3300005842 Bacteria 1392
421 Ga0068858_100369936 3300005842 Bacteria 1374
422 Ga0068858_100428973 3300005842 Bacteria 1272
423 Ga0068858_100511712 3300005842 Bacteria 1160
424 Ga0068860_100000222 3300005843 Bacteria 88724
425 Ga0068860_100000770 3300005843 Bacteria 36109
426 Ga0068860_100068484 3300005843 Bacteria 3372
427 Ga0068860_100110743 3300005843 Bacteria 2624
428 Ga0068860_100143578 3300005843 Bacteria 2295
429 Ga0068860_100200484 3300005843 Bacteria 1934
430 Ga0068860_100215585 3300005843 Bacteria 1863
431 Ga0068860_100258849 3300005843 Bacteria 1696
432 Ga0068860_100440780 3300005843 Bacteria 1294
433 Ga0068860_100444838 3300005843 Bacteria 1288
434 Ga0068860_100478806 3300005843 Bacteria 1241
435 Ga0068860_100531466 3300005843 Bacteria 1177
436 Ga0068862_100003231 3300005844 Bacteria 14109
437 Ga0068862_100013691 3300005844 Bacteria 6718
438 Ga0068862_100038951 3300005844 Bacteria 4035
439 Ga0068862_100056737 3300005844 Bacteria 3356
440 Ga0068862_100119426 3300005844 Bacteria 2322
441 Ga0068862_100266306 3300005844 Bacteria 1566
442 Ga0068862_100377507 3300005844 Bacteria 1321
443 Ga0068862_100454912 3300005844 Bacteria 1207
444 Ga0081455_10000276 3300005937 Bacteria 68055
445 Ga0081455_10040989 3300005937 Bacteria 4079
446 Ga0081455_10064985 3300005937 Bacteria 3054
447 Ga0081455_10096044 3300005937 Bacteria 2391
448 Ga0081538_10037147 3300005981 Bacteria 3166
449 Ga0081538_10062853 3300005981 Bacteria 2113
450 Ga0081540_1016874 3300005983 Bacteria 4547
451 Ga0081540_1018379 3300005983 Bacteria 4290
452 Ga0081540_1031482 3300005983 Bacteria 2915
453 Ga0081540_1057327 3300005983 Bacteria 1885
454 Ga0081540_1085068 3300005983 Bacteria 1410
455 Ga0081539_10000365 3300005985 Bacteria 99063
456 Ga0081539_10000540 3300005985 Bacteria 78243
457 Ga0081539_10061282 3300005985 Bacteria 2062
458 Ga0070717_10005721 3300006028 Bacteria 9092
459 Ga0070717_10092601 3300006028 Bacteria 2554
460 Ga0075365_10014849 3300006038 Bacteria 4693
461 Ga0075365_10084521 3300006038 Bacteria 2154
462 Ga0075365_10240934 3300006038 Bacteria 1270
463 Ga0075365_10241974 3300006038 Bacteria 1267
464 Ga0075365_10350024 3300006038 Bacteria 1041
465 Ga0075365_10400373 3300006038 Bacteria 969
466 Ga0075368_10020133 3300006042 Bacteria 2523
467 Ga0075363_100011478 3300006048 Bacteria 4243
468 Ga0075363_100024332 3300006048 Bacteria 3077
469 Ga0075363_100159166 3300006048 Bacteria 1278
470 Ga0075363_100279018 3300006048 Bacteria 966
471 Ga0075364_10063358 3300006051 Bacteria 2427
472 Ga0075364_10083480 3300006051 Bacteria 2114
473 Ga0075364_10248691 3300006051 Bacteria 1208
474 Ga0075364_10286146 3300006051 Bacteria 1121
475 Ga0075364_10353579 3300006051 Bacteria 1001
476 Ga0075432_10015278 3300006058 Bacteria 2617
477 Ga0070715_10017370 3300006163 Bacteria 2723
478 Ga0070716_100002810 3300006173 Bacteria 8106
479 Ga0070716_100003846 3300006173 Bacteria 7126
480 Ga0070716_100004252 3300006173 Bacteria 6816
481 Ga0070716_100041903 3300006173 Bacteria 2553
482 Ga0070716_100088929 3300006173 Bacteria 1864
483 Ga0070716_100242653 3300006173 Bacteria 1223
484 Ga0070712_100084094 3300006175 Bacteria 2312
485 Ga0070712_100088469 3300006175 Bacteria 2263
486 Ga0075362_10015370 3300006177 Bacteria 3112
487 Ga0075362_10019441 3300006177 Bacteria 2824
488 Ga0075362_10055704 3300006177 Bacteria 1778
489 Ga0075362_10131837 3300006177 Bacteria 1189
490 Ga0075362_10198735 3300006177 Bacteria 975
491 Ga0075367_10025670 3300006178 Bacteria 3334
492 Ga0075367_10027145 3300006178 Bacteria 3254
493 Ga0075367_10041067 3300006178 Bacteria 2703
494 Ga0075367_10200086 3300006178 Bacteria 1248
495 Ga0075367_10370367 3300006178 Bacteria 905
496 Ga0075369_10029522 3300006186 Bacteria 2304
497 Ga0075369_10031432 3300006186 Bacteria 2241
498 Ga0075369_10042556 3300006186 Bacteria 1947
499 Ga0075369_10084710 3300006186 Bacteria 1409
500 Ga0075366_10012943 3300006195 Bacteria 4742
501 Ga0075366_10022411 3300006195 Bacteria 3674
502 Ga0097621_100003897 3300006237 Bacteria 10342
503 Ga0097621_100027109 3300006237 Bacteria 4502
504 Ga0097621_100075751 3300006237 Bacteria 2789
505 Ga0097621_100077737 3300006237 Bacteria 2755
506 Ga0097621_100160974 3300006237 Bacteria 1929
507 Ga0097621_100423254 3300006237 Bacteria 1196
508 Ga0097621_100463206 3300006237 Bacteria 1144
509 Ga0097621_100543470 3300006237 Bacteria 1057
510 Ga0075370_10003312 3300006353 Bacteria 7648
511 Ga0075370_10082078 3300006353 Bacteria 1853
512 Ga0075370_10115765 3300006353 Bacteria 1558
513 Ga0075370_10188265 3300006353 Bacteria 1215
514 Ga0068871_100000460 3300006358 Bacteria 27930
515 Ga0068871_100001642 3300006358 Bacteria 15074
516 Ga0068871_100006132 3300006358 Bacteria 8470
517 Ga0068871_100008734 3300006358 Bacteria 7292
518 Ga0068871_100115524 3300006358 Bacteria 2262
519 Ga0068871_100556210 3300006358 Bacteria 1040
520 Ga0068871_100777234 3300006358 Bacteria 881
521 Ga0075428_100000165 3300006844 Bacteria 60894
522 Ga0075428_100000502 3300006844 Bacteria 39707
523 Ga0075428_100059007 3300006844 Bacteria 4202
524 Ga0075428_100109109 3300006844 Bacteria 3016
525 Ga0075428_100119714 3300006844 Bacteria 2866
526 Ga0075428_100119754 3300006844 Bacteria 2866
527 Ga0075428_100314088 3300006844 Bacteria 1684
528 Ga0075430_100001376 3300006846 Bacteria 19735
529 Ga0075430_100010738 3300006846 Bacteria 7763
530 Ga0075430_100013684 3300006846 Bacteria 6916
531 Ga0075431_100015657 3300006847 Bacteria 7687
532 Ga0075431_100021294 3300006847 Bacteria 6626
533 Ga0075431_100032774 3300006847 Bacteria 5355
534 Ga0075431_100198291 3300006847 Bacteria 2055
535 Ga0075431_100282828 3300006847 Bacteria 1679
536 Ga0075433_10000830 3300006852 Bacteria 21606
537 Ga0075433_10062410 3300006852 Bacteria 3263
538 Ga0075433_10108468 3300006852 Bacteria 2462
539 Ga0075433_10135307 3300006852 Bacteria 2190
540 Ga0075433_10144738 3300006852 Bacteria 2113
541 Ga0075433_10259247 3300006852 Bacteria 1542
542 Ga0075433_10313732 3300006852 Bacteria 1388
543 Ga0075433_10407994 3300006852 Bacteria 1199
544 Ga0075434_100000563 3300006871 Bacteria 28523
545 Ga0075434_100005940 3300006871 Bacteria 11173
546 Ga0075434_100051394 3300006871 Bacteria 4096
547 Ga0075434_100080461 3300006871 Bacteria 3255
548 Ga0075434_100159101 3300006871 Bacteria 2278
549 Ga0075434_100660454 3300006871 Bacteria 1064
550 Ga0075434_100881928 3300006871 Bacteria 910
551 Ga0075434_100967403 3300006871 Bacteria 865
552 Ga0075429_100000430 3300006880 Bacteria 31312
553 Ga0075429_100005823 3300006880 Bacteria 10634
554 Ga0075429_100061945 3300006880 Bacteria 3259
555 Ga0075429_100197400 3300006880 Bacteria 1762
556 Ga0075429_100529599 3300006880 Bacteria 1033
557 Ga0068865_100000043 3300006881 Bacteria 70962
558 Ga0075436_100000235 3300006914 Bacteria 34727
559 Ga0075436_100002224 3300006914 Bacteria 13400
560 Ga0075436_100012516 3300006914 Bacteria 5814
561 Ga0075436_100042321 3300006914 Bacteria 3142
562 Ga0075436_100104183 3300006914 Bacteria 1977
563 Ga0075436_100267084 3300006914 Bacteria 1221
564 Ga0075436_100279804 3300006914 Bacteria 1193
565 Ga0097620_100006932 3300006931 Bacteria 11505
566 Ga0097620_100008744 3300006931 Bacteria 10232
567 Ga0097620_100016531 3300006931 Bacteria 7407
568 Ga0097620_100112941 3300006931 Bacteria 2780
569 Ga0097620_100196080 3300006931 Bacteria 2104
570 Ga0097620_100231039 3300006931 Bacteria 1938
571 Ga0097620_100278729 3300006931 Bacteria 1764
572 Ga0097620_100776237 3300006931 Bacteria 1047
573 Ga0099825_1033281 3300006941 Bacteria 2013
574 Ga0099824_1015072 3300006942 Bacteria 7459
575 Ga0099822_1056894 3300006943 Bacteria 1409
576 Ga0099823_1009032 3300006944 Bacteria 10121
577 Ga0099826_10096933 3300006948 Bacteria 1788
578 Ga0075435_100004339 3300007076 Bacteria 9748
579 Ga0075435_100007138 3300007076 Bacteria 7939
580 Ga0075435_100043131 3300007076 Bacteria 3610
581 Ga0075435_100307024 3300007076 Bacteria 1357
582 Ga0075435_100349650 3300007076 Bacteria 1267
583 Ga0075435_100621164 3300007076 Bacteria 937
584 Ga0099794_10006079 3300007265 Bacteria 4876
585 Ga0099794_10016216 3300007265 Bacteria 3300
586 Ga0099794_10020684 3300007265 Bacteria 2981
587 Ga0099794_10251700 3300007265 Bacteria 911
588 Ga0099795_10061711 3300007788 Bacteria 1393
589 Ga0099795_10177507 3300007788 Bacteria 888
590 Ga0105244_10001583 3300009036 Bacteria 18086
591 Ga0105244_10017280 3300009036 Bacteria 4081
592 Ga0105244_10024948 3300009036 Bacteria 3256
593 Ga0105244_10086775 3300009036 Bacteria 1542
594 Ga0105240_10001147 3300009093 Bacteria 46354
595 Ga0105240_10004081 3300009093 Bacteria 22462
596 Ga0105240_10004369 3300009093 Bacteria 21580
597 Ga0105240_10028379 3300009093 Bacteria 7311
598 Ga0105240_10029822 3300009093 Bacteria 7100
599 Ga0105240_10032533 3300009093 Bacteria 6752
600 Ga0105240_10040108 3300009093 Bacteria 5992
601 Ga0105240_10100172 3300009093 Bacteria 3526
602 Ga0105240_10192851 3300009093 Bacteria 2394
603 Ga0105240_10198099 3300009093 Bacteria 2356
604 Ga0105240_10212225 3300009093 Bacteria 2261
605 Ga0105240_10247515 3300009093 Bacteria 2063
606 Ga0105240_10306002 3300009093 Bacteria 1817
607 Ga0105240_10413806 3300009093 Bacteria 1516
608 Ga0105240_10503726 3300009093 Bacteria 1346
609 Ga0111539_10001265 3300009094 Bacteria 33733
610 Ga0111539_10001811 3300009094 Bacteria 28459
611 Ga0111539_10002049 3300009094 Bacteria 26955
612 Ga0111539_10006467 3300009094 Bacteria 15092
613 Ga0111539_10027439 3300009094 Bacteria 6955
614 Ga0111539_10071980 3300009094 Bacteria 4078
615 Ga0111539_10096765 3300009094 Bacteria 3467
616 Ga0111539_10306624 3300009094 Bacteria 1847
617 Ga0111539_10317527 3300009094 Bacteria 1813
618 Ga0111539_10454437 3300009094 Bacteria 1492
619 Ga0111539_10969529 3300009094 Bacteria 989
620 Ga0105245_10000271 3300009098 Bacteria 49162
621 Ga0105245_10036282 3300009098 Bacteria 4379
622 Ga0105245_10047123 3300009098 Bacteria 3852
623 Ga0105245_10172957 3300009098 Bacteria 2058
624 Ga0105245_10457469 3300009098 Bacteria 1286
625 Ga0105245_10463281 3300009098 Bacteria 1278
626 Ga0105247_10050663 3300009101 Bacteria 2555
627 Ga0114129_10012670 3300009147 Bacteria 12006
628 Ga0114129_10026010 3300009147 Bacteria 8288
629 Ga0114129_10069818 3300009147 Bacteria 4898
630 Ga0114129_10162368 3300009147 Bacteria 3051
631 Ga0114129_10182254 3300009147 Bacteria 2857
632 Ga0114129_10348082 3300009147 Bacteria 1964
633 Ga0114129_10494526 3300009147 Bacteria 1598
634 Ga0114129_10626841 3300009147 Bacteria 1390
635 Ga0114129_10628535 3300009147 Bacteria 1388
636 Ga0114129_10794231 3300009147 Bacteria 1208
637 Ga0105243_10001687 3300009148 Bacteria 19030
638 Ga0105243_10002095 3300009148 Bacteria 16889
639 Ga0105243_10013075 3300009148 Bacteria 6272
640 Ga0105243_10052561 3300009148 Bacteria 3227
641 Ga0105243_10097617 3300009148 Bacteria 2432
642 Ga0105243_10116340 3300009148 Bacteria 2246
643 Ga0105243_10403003 3300009148 Bacteria 1271
644 Ga0105241_10002027 3300009174 Bacteria 15316
645 Ga0105241_10028793 3300009174 Bacteria 4139
646 Ga0105241_10040441 3300009174 Bacteria 3520
647 Ga0105241_10260789 3300009174 Bacteria 1473
648 Ga0105241_10413855 3300009174 Bacteria 1185
649 Ga0105242_10000296 3300009176 Bacteria 39554
650 Ga0105242_10023572 3300009176 Bacteria 4850
651 Ga0105242_10031643 3300009176 Bacteria 4228
652 Ga0105242_10175030 3300009176 Bacteria 1889
653 Ga0105242_10235366 3300009176 Bacteria 1643
654 Ga0105242_10293614 3300009176 Bacteria 1481
655 Ga0105242_10361968 3300009176 Bacteria 1343
656 Ga0105248_10045676 3300009177 Bacteria 4911
657 Ga0105248_10068375 3300009177 Bacteria 3988
658 Ga0105248_10312213 3300009177 Bacteria 1771
659 Ga0105248_10323655 3300009177 Bacteria 1736
660 Ga0105248_10356547 3300009177 Bacteria 1647
661 Ga0105248_10661745 3300009177 Bacteria 1178
662 Ga0105237_10009810 3300009545 Bacteria 10238
663 Ga0105237_10015336 3300009545 Bacteria 7980
664 Ga0105237_10022629 3300009545 Bacteria 6446
665 Ga0105237_10047338 3300009545 Bacteria 4323
666 Ga0105237_10168154 3300009545 Bacteria 2192
667 Ga0105237_10296450 3300009545 Bacteria 1620
668 Ga0105237_10301200 3300009545 Bacteria 1606
669 Ga0105237_10344650 3300009545 Bacteria 1494
670 Ga0105237_10667488 3300009545 Bacteria 1046
671 Ga0105238_10003092 3300009551 Bacteria 16591
672 Ga0105238_10003744 3300009551 Bacteria 15118
673 Ga0105238_10032944 3300009551 Bacteria 5274
674 Ga0105238_10050989 3300009551 Bacteria 4164
675 Ga0105238_10070942 3300009551 Bacteria 3482
676 Ga0105238_10104983 3300009551 Bacteria 2807
677 Ga0105238_10120834 3300009551 Bacteria 2599
678 Ga0105238_10219311 3300009551 Bacteria 1878
679 Ga0105238_10467016 3300009551 Bacteria 1260
680 Ga0105238_10572222 3300009551 Bacteria 1135
681 Ga0105238_11150584 3300009551 Bacteria 799
682 Ga0105249_10027588 3300009553 Bacteria 5124
683 Ga0105249_10037767 3300009553 Bacteria 4382
684 Ga0105249_10039571 3300009553 Bacteria 4282
685 Ga0105249_10110829 3300009553 Bacteria 2594
686 Ga0105249_10459841 3300009553 Bacteria 1312
687 Ga0105249_10605775 3300009553 Bacteria 1150
688 Ga0105249_11137719 3300009553 Bacteria 851
689 Ga0099796_10008928 3300010159 Bacteria 2691
690 Ga0099796_10205259 3300010159 Bacteria 801
691 Ga0099796_10223348 3300010159 Bacteria 773
692 Ga0105239_10006148 3300010375 Bacteria 13969
693 Ga0105239_10012109 3300010375 Bacteria 9617
694 Ga0105239_10014050 3300010375 Bacteria 8889
695 Ga0105239_10024321 3300010375 Bacteria 6672
696 Ga0105239_10175057 3300010375 Bacteria 2400
697 Ga0105239_10336797 3300010375 Bacteria 1702
698 Ga0105239_10776090 3300010375 Bacteria 1098
699 Ga0105239_10848369 3300010375 Bacteria 1048
700 Ga0105239_11367734 3300010375 Bacteria 817
701 Ga0105246_10012990 3300011119 Bacteria 5211
702 Ga0105246_10035445 3300011119 Bacteria 3335
703 Ga0105246_10037532 3300011119 Bacteria 3252
704 Ga0105246_10279663 3300011119 Bacteria 1338
705 Ga0105246_10467709 3300011119 Bacteria 1064
706 Ga0157322_1002507 3300012490 Bacteria 1041
707 Ga0157345_1001502 3300012498 Bacteria 1639
708 Ga0157313_1001727 3300012503 Bacteria 1221
709 Ga0157326_1003283 3300012513 Bacteria 1707
710 Ga0157373_10034917 3300013100 Bacteria 3611
711 Ga0157373_10040289 3300013100 Bacteria 3343
712 Ga0157373_10043171 3300013100 Bacteria 3221
713 Ga0157373_10087865 3300013100 Bacteria 2190
714 Ga0157371_10016723 3300013102 Bacteria 5465
715 Ga0157371_10140325 3300013102 Bacteria 1721
716 Ga0157370_10001416 3300013104 Bacteria 29771
717 Ga0157370_10002820 3300013104 Bacteria 20763
718 Ga0157370_10006585 3300013104 Bacteria 12785
719 Ga0157370_10014250 3300013104 Bacteria 8140
720 Ga0157370_10029928 3300013104 Bacteria 5337
721 Ga0157370_10045381 3300013104 Bacteria 4216
722 Ga0157370_10066831 3300013104 Bacteria 3399
723 Ga0157370_10089974 3300013104 Bacteria 2882
724 Ga0157370_10177889 3300013104 Bacteria 1977
725 Ga0157370_10388372 3300013104 Bacteria 1285
726 Ga0157370_10411814 3300013104 Bacteria 1244
727 Ga0157369_10001367 3300013105 Bacteria 30073
728 Ga0157369_10004167 3300013105 Bacteria 17131
729 Ga0157369_10004364 3300013105 Bacteria 16692
730 Ga0157369_10008890 3300013105 Bacteria 11508
731 Ga0157369_10009086 3300013105 Bacteria 11375
732 Ga0157369_10186914 3300013105 Bacteria 2178
733 Ga0157369_10335036 3300013105 Bacteria 1572
734 Ga0157369_10340858 3300013105 Bacteria 1557
735 Ga0157374_10006868 3300013296 Bacteria 9681
736 Ga0157374_10039570 3300013296 Bacteria 4339
737 Ga0157374_10065079 3300013296 Bacteria 3423
738 Ga0157374_10074922 3300013296 Bacteria 3197
739 Ga0157378_10000140 3300013297 Bacteria 67335
740 Ga0157378_10001069 3300013297 Bacteria 25077
741 Ga0157378_10308986 3300013297 Bacteria 1533
742 Ga0157378_10330057 3300013297 Bacteria 1484
743 Ga0157378_10363706 3300013297 Bacteria 1416
744 Ga0157378_10416918 3300013297 Bacteria 1326
745 Ga0157378_11369419 3300013297 Bacteria 750
746 Ga0163162_10009909 3300013306 Bacteria 9266
747 Ga0163162_10010390 3300013306 Bacteria 9048
748 Ga0163162_10071039 3300013306 Bacteria 3533
749 Ga0163162_10256925 3300013306 Bacteria 1879
750 Ga0163162_10324679 3300013306 Bacteria 1671
751 Ga0163162_10402192 3300013306 Bacteria 1502
752 Ga0163162_10830134 3300013306 Bacteria 1040
753 Ga0163162_10879491 3300013306 Bacteria 1010
754 Ga0157372_10000655 3300013307 Bacteria 38006
755 Ga0157372_10002479 3300013307 Bacteria 20002
756 Ga0157372_10010585 3300013307 Bacteria 9813
757 Ga0157372_10049135 3300013307 Bacteria 4690
758 Ga0157372_10123333 3300013307 Bacteria 2978
759 Ga0157372_10175882 3300013307 Bacteria 2477
760 Ga0157372_10205089 3300013307 Bacteria 2284
761 Ga0157372_10257640 3300013307 Bacteria 2025
762 Ga0157372_10502404 3300013307 Bacteria 1414
763 Ga0157372_10506191 3300013307 Bacteria 1408
764 Ga0157375_10076221 3300013308 Bacteria 3380
765 Ga0157375_10105819 3300013308 Bacteria 2905
766 Ga0157375_10437782 3300013308 Bacteria 1473
767 Ga0157375_10550728 3300013308 Bacteria 1315
768 Ga0163163_10043695 3300014325 Bacteria 4394
769 Ga0163163_10093822 3300014325 Bacteria 3018
770 Ga0163163_10784119 3300014325 Bacteria 1016
771 Ga0157380_10042442 3300014326 Bacteria 3556
772 Ga0157380_10134523 3300014326 Bacteria 2114
773 Ga0157380_10279652 3300014326 Bacteria 1526
774 Ga0157380_10319497 3300014326 Bacteria 1439
775 Ga0157380_10403665 3300014326 Bacteria 1297
776 Ga0157380_11246063 3300014326 Bacteria 789
777 Ga0182008_10002205 3300014497 Bacteria 12352
778 Ga0182008_10041092 3300014497 Bacteria 2307
779 Ga0157377_10015707 3300014745 Bacteria 3880
780 Ga0157379_10025051 3300014968 Bacteria 5297
781 Ga0157379_10043705 3300014968 Bacteria 4000
782 Ga0157379_10084137 3300014968 Bacteria 2851
783 Ga0157379_10115785 3300014968 Bacteria 2410
784 Ga0157379_10119384 3300014968 Bacteria 2372
785 Ga0157379_10185802 3300014968 Bacteria 1878
786 Ga0157379_10258045 3300014968 Bacteria 1583
787 Ga0157379_10321241 3300014968 Bacteria 1413
788 Ga0157376_10001035 3300014969 Bacteria 18219
789 Ga0157376_10049928 3300014969 Bacteria 3468
790 Ga0182006_1000010 3300015261 Bacteria 413414
791 Ga0182007_10000021 3300015262 Bacteria 193408
792 Ga0182005_1000003 3300015265 Bacteria 683269
793 Ga0182005_1000009 3300015265 Bacteria 455334
794 Ga0163161_10046570 3300017792 Bacteria 3129
795 Ga0163161_10048622 3300017792 Bacteria 3064
796 Ga0163161_10086000 3300017792 Bacteria 2320
797 Ga0163161_10228346 3300017792 Bacteria 1444
798 Ga0163161_10281691 3300017792 Bacteria 1304
799 Ga0163161_10347523 3300017792 Bacteria 1178
800 Ga0163161_10424969 3300017792 Bacteria 1070
801 Ga0214544_1000003 3300021320 Bacteria 643752
802 Ga0214542_1000022 3300021321 Bacteria 193578
803 Ga0214545_1000010 3300021324 Bacteria 193578
804 Ga0214543_1000035 3300021327 Bacteria 183100
805 Ga0213872_10018271 3300021361 Bacteria 3234
806 Ga0213876_10008884 3300021384 Bacteria 5419
807 Ga0213876_10027632 3300021384 Bacteria 2993
808 Ga0213876_10151918 3300021384 Bacteria 1231
809 Ga0209436_100171 3300025208 Bacteria 31081
810 Ga0209436_100322 3300025208 Bacteria 21971
811 Ga0209563_102990 3300025230 Bacteria 3632
812 Ga0207425_1000006 3300025245 Bacteria 808854
813 Ga0207425_1000354 3300025245 Bacteria 31834
814 Ga0207425_1001911 3300025245 Bacteria 7893
815 Ga0209677_101351 3300025253 Bacteria 10771
816 Ga0209677_101442 3300025253 Bacteria 10282
817 Ga0209129_1000009 3300025258 Bacteria 633100
818 Ga0209129_1002425 3300025258 Bacteria 9165
819 Ga0209233_1002708 3300025261 Bacteria 6398
820 Ga0209565_1000080 3300025263 Bacteria 156999
821 Ga0209565_1000459 3300025263 Bacteria 31365
822 Ga0209565_1000488 3300025263 Bacteria 29101
823 Ga0209565_1003784 3300025263 Bacteria 4786
824 Ga0209565_1006292 3300025263 Bacteria 3347
825 Ga0209565_1042499 3300025263 Bacteria 842
826 Ga0207666_1000360 3300025271 Bacteria 6167
827 Ga0207666_1020133 3300025271 Bacteria 977
828 Ga0209455_1002361 3300025272 Bacteria 7353
829 Ga0209673_1000088 3300025273 Bacteria 204629
830 Ga0209673_1036425 3300025273 Bacteria 1459
831 Ga0209130_1000238 3300025284 Bacteria 70723
832 Ga0209130_1000493 3300025284 Bacteria 40544
833 Ga0209130_1000726 3300025284 Bacteria 29071
834 Ga0209675_1002650 3300025291 Bacteria 9037
835 Ga0209675_1004521 3300025291 Bacteria 6156
836 Ga0209675_1005140 3300025291 Bacteria 5565
837 Ga0209676_1000073 3300025292 Bacteria 305947
838 Ga0209676_1000286 3300025292 Bacteria 103478
839 Ga0209676_1004990 3300025292 Bacteria 7114
840 Ga0209025_1000198 3300025294 Bacteria 146276
841 Ga0209025_1001379 3300025294 Bacteria 32535
842 Ga0209564_1000098 3300025295 Bacteria 228906
843 Ga0209564_1000313 3300025295 Bacteria 95224
844 Ga0209564_1006204 3300025295 Bacteria 6532
845 Ga0209564_1007889 3300025295 Bacteria 5384
846 Ga0209564_1007991 3300025295 Bacteria 5316
847 Ga0209564_1007997 3300025295 Bacteria 5313
848 Ga0209758_1000071 3300025297 Bacteria 283749
849 Ga0209758_1000106 3300025297 Bacteria 218450
850 Ga0209758_1000344 3300025297 Bacteria 85133
851 Ga0209758_1002307 3300025297 Bacteria 19725
852 Ga0209758_1013940 3300025297 Bacteria 4326
853 Ga0209758_1052171 3300025297 Bacteria 1417
854 Ga0209050_1000008 3300025298 Bacteria 1144179
855 Ga0209050_1000183 3300025298 Bacteria 142357
856 Ga0209050_1001801 3300025298 Bacteria 20967
857 Ga0209050_1010730 3300025298 Bacteria 4467
858 Ga0209050_1031595 3300025298 Bacteria 1647
859 Ga0209256_1000096 3300025299 Bacteria 204629
860 Ga0209256_1000498 3300025299 Bacteria 57607
861 Ga0209256_1001704 3300025299 Bacteria 21157
862 Ga0209256_1005569 3300025299 Bacteria 7173
863 Ga0207426_1000374 3300025302 Bacteria 78498
864 Ga0207426_1000440 3300025302 Bacteria 66997
865 Ga0207426_1001049 3300025302 Bacteria 26249
866 Ga0207426_1001712 3300025302 Bacteria 16832
867 Ga0207426_1007090 3300025302 Bacteria 4740
868 Ga0207426_1016605 3300025302 Bacteria 2637
869 Ga0209051_1000005 3300025303 Bacteria 1142353
870 Ga0209051_1017007 3300025303 Bacteria 3265
871 Ga0209051_1073700 3300025303 Bacteria 1016
872 Ga0209257_1000010 3300025304 Bacteria 1158682
873 Ga0209257_1000031 3300025304 Bacteria 688770
874 Ga0209257_1000819 3300025304 Bacteria 45046
875 Ga0209257_1001077 3300025304 Bacteria 35853
876 Ga0209257_1029703 3300025304 Bacteria 1777
877 Ga0207697_10006675 3300025315 Bacteria 5197
878 Ga0207697_10044116 3300025315 Bacteria 1834
879 Ga0207697_10057829 3300025315 Bacteria 1610
880 Ga0207697_10166431 3300025315 Bacteria 963
881 Ga0207656_10003875 3300025321 Bacteria 5187
882 Ga0207656_10005001 3300025321 Bacteria 4658
883 Ga0207656_10265645 3300025321 Bacteria 843
884 Ga0207655_1002560 3300025728 Bacteria 14549
885 Ga0207653_10131245 3300025885 Bacteria 909
886 Ga0207682_10005872 3300025893 Bacteria 4976
887 Ga0207682_10037972 3300025893 Bacteria 1952
888 Ga0207692_10002984 3300025898 Bacteria 6554
889 Ga0207692_10012527 3300025898 Bacteria 3645
890 Ga0207692_10015463 3300025898 Bacteria 3359
891 Ga0207692_10030585 3300025898 Bacteria 2569
892 Ga0207692_10174220 3300025898 Bacteria 1249
893 Ga0207692_10348646 3300025898 Bacteria 912
894 Ga0207642_10000413 3300025899 Bacteria 12887
895 Ga0207710_10030473 3300025900 Bacteria 2354
896 Ga0207688_10002227 3300025901 Bacteria 10447
897 Ga0207688_10004822 3300025901 Bacteria 7348
898 Ga0207688_10056072 3300025901 Bacteria 2213
899 Ga0207688_10085657 3300025901 Bacteria 1805
900 Ga0207688_10096304 3300025901 Bacteria 1704
901 Ga0207688_10123895 3300025901 Bacteria 1510
902 Ga0207647_10002707 3300025904 Bacteria 13386
903 Ga0207647_10045887 3300025904 Bacteria 2725
904 Ga0207647_10066896 3300025904 Bacteria 2178
905 Ga0207685_10087388 3300025905 Bacteria 1305
906 Ga0207699_10050063 3300025906 Bacteria 2462
907 Ga0207699_10104315 3300025906 Bacteria 1805
908 Ga0207699_10136371 3300025906 Bacteria 1608
909 Ga0207699_10169344 3300025906 Bacteria 1460
910 Ga0207699_10187650 3300025906 Bacteria 1393
911 Ga0207645_10028700 3300025907 Bacteria 3590
912 Ga0207645_10054561 3300025907 Bacteria 2552
913 Ga0207643_10010711 3300025908 Bacteria 4941
914 Ga0207643_10011789 3300025908 Bacteria 4718
915 Ga0207643_10035916 3300025908 Bacteria 2780
916 Ga0207643_10068348 3300025908 Bacteria 2041
917 Ga0207643_10094100 3300025908 Bacteria 1750
918 Ga0207643_10193290 3300025908 Bacteria 1236
919 Ga0207643_10230910 3300025908 Bacteria 1135
920 Ga0207705_10083001 3300025909 Bacteria 2337
921 Ga0207705_10429748 3300025909 Bacteria 1023
922 Ga0207684_10004217 3300025910 Bacteria 13644
923 Ga0207684_10022022 3300025910 Bacteria 5443
924 Ga0207684_10054995 3300025910 Bacteria 3377
925 Ga0207684_10448709 3300025910 Bacteria 1107
926 Ga0207654_10015778 3300025911 Bacteria 3926
927 Ga0207654_10025689 3300025911 Bacteria 3180
928 Ga0207654_10076115 3300025911 Bacteria 2007
929 Ga0207654_10081153 3300025911 Bacteria 1952
930 Ga0207654_10133636 3300025911 Bacteria 1573
931 Ga0207654_10283272 3300025911 Bacteria 1122
932 Ga0207707_10000832 3300025912 Bacteria 30304
933 Ga0207707_10015279 3300025912 Bacteria 6685
934 Ga0207707_10023819 3300025912 Bacteria 5354
935 Ga0207707_10024393 3300025912 Bacteria 5292
936 Ga0207707_10029358 3300025912 Bacteria 4806
937 Ga0207707_10035892 3300025912 Bacteria 4335
938 Ga0207707_10035901 3300025912 Bacteria 4334
939 Ga0207707_10047665 3300025912 Bacteria 3731
940 Ga0207707_10052063 3300025912 Bacteria 3565
941 Ga0207707_10510506 3300025912 Bacteria 1024
942 Ga0207695_10000123 3300025913 Bacteria 232059
943 Ga0207695_10014962 3300025913 Bacteria 9157
944 Ga0207695_10019499 3300025913 Bacteria 7809
945 Ga0207695_10021930 3300025913 Bacteria 7268
946 Ga0207695_10033727 3300025913 Bacteria 5577
947 Ga0207695_10070328 3300025913 Bacteria 3578
948 Ga0207695_10084250 3300025913 Bacteria 3210
949 Ga0207695_10142642 3300025913 Bacteria 2342
950 Ga0207695_10242832 3300025913 Bacteria 1702
951 Ga0207695_10315678 3300025913 Bacteria 1453
952 Ga0207695_10455045 3300025913 Bacteria 1163
953 Ga0207671_10039283 3300025914 Bacteria 3505
954 Ga0207671_10062980 3300025914 Bacteria 2755
955 Ga0207671_10118382 3300025914 Bacteria 2023
956 Ga0207671_10162366 3300025914 Bacteria 1731
957 Ga0207671_10173271 3300025914 Bacteria 1676
958 Ga0207671_10431319 3300025914 Bacteria 1049
959 Ga0207693_10004235 3300025915 Bacteria 12167
960 Ga0207693_10018459 3300025915 Bacteria 5556
961 Ga0207693_10029805 3300025915 Bacteria 4307
962 Ga0207693_10220263 3300025915 Bacteria 1491
963 Ga0207663_10058300 3300025916 Bacteria 2436
964 Ga0207663_10103378 3300025916 Bacteria 1918
965 Ga0207663_10121696 3300025916 Bacteria 1788
966 Ga0207663_10210314 3300025916 Bacteria 1409
967 Ga0207663_10435044 3300025916 Bacteria 1009
968 Ga0207663_10602358 3300025916 Bacteria 863
969 Ga0207660_10000496 3300025917 Bacteria 26222
970 Ga0207660_10032603 3300025917 Bacteria 3597
971 Ga0207660_10039257 3300025917 Bacteria 3309
972 Ga0207660_10047373 3300025917 Bacteria 3039
973 Ga0207660_10075535 3300025917 Bacteria 2462
974 Ga0207660_10089384 3300025917 Bacteria 2280
975 Ga0207660_10089610 3300025917 Bacteria 2277
976 Ga0207660_10160520 3300025917 Bacteria 1734
977 Ga0207660_10453508 3300025917 Bacteria 1037
978 Ga0207660_10520501 3300025917 Bacteria 966
979 Ga0207662_10000024 3300025918 Bacteria 70677
980 Ga0207662_10017512 3300025918 Bacteria 4055
981 Ga0207657_10000213 3300025919 Bacteria 60310
982 Ga0207657_10002516 3300025919 Bacteria 19818
983 Ga0207657_10002601 3300025919 Bacteria 19533
984 Ga0207657_10008209 3300025919 Bacteria 10632
985 Ga0207657_10039462 3300025919 Bacteria 4195
986 Ga0207657_10041830 3300025919 Bacteria 4048
987 Ga0207657_10085135 3300025919 Bacteria 2649
988 Ga0207657_10279261 3300025919 Bacteria 1326
989 Ga0207649_10007000 3300025920 Bacteria 6125
990 Ga0207649_10034845 3300025920 Bacteria 3019
991 Ga0207649_10064534 3300025920 Bacteria 2315
992 Ga0207649_10074057 3300025920 Bacteria 2184
993 Ga0207649_10100561 3300025920 Bacteria 1913
994 Ga0207649_10114971 3300025920 Bacteria 1804
995 Ga0207649_10128469 3300025920 Bacteria 1718
996 Ga0207649_10136715 3300025920 Bacteria 1672
997 Ga0207649_10161768 3300025920 Bacteria 1552
998 Ga0207649_10251362 3300025920 Bacteria 1273
999 Ga0207652_10007795 3300025921 Bacteria 8600
1000 Ga0207652_10096614 3300025921 Bacteria 2603
1001 Ga0207652_10105544 3300025921 Bacteria 2493
1002 Ga0207652_10106458 3300025921 Bacteria 2482
1003 Ga0207652_10125065 3300025921 Bacteria 2290
1004 Ga0207652_10179941 3300025921 Bacteria 1900
1005 Ga0207652_10286100 3300025921 Bacteria 1487
1006 Ga0207652_10402414 3300025921 Bacteria 1235
1007 Ga0207652_10899963 3300025921 Bacteria 782
1008 Ga0207646_10000250 3300025922 Bacteria 73162
1009 Ga0207646_10017586 3300025922 Bacteria 6683
1010 Ga0207646_10123418 3300025922 Bacteria 2328
1011 Ga0207646_10332362 3300025922 Bacteria 1373
1012 Ga0207646_10821450 3300025922 Bacteria 827
1013 Ga0207681_10000501 3300025923 Bacteria 27289
1014 Ga0207681_10026353 3300025923 Bacteria 3749
1015 Ga0207681_10156138 3300025923 Bacteria 1715
1016 Ga0207694_10004773 3300025924 Bacteria 10535
1017 Ga0207694_10008491 3300025924 Bacteria 7756
1018 Ga0207694_10028337 3300025924 Bacteria 4269
1019 Ga0207694_10080146 3300025924 Bacteria 2562
1020 Ga0207694_10121530 3300025924 Bacteria 2085
1021 Ga0207694_10123973 3300025924 Bacteria 2065
1022 Ga0207694_10155717 3300025924 Bacteria 1843
1023 Ga0207694_10220734 3300025924 Bacteria 1546
1024 Ga0207694_10714848 3300025924 Bacteria 845
1025 Ga0207659_10003439 3300025926 Bacteria 9490
1026 Ga0207659_10065981 3300025926 Bacteria 2625
1027 Ga0207659_10158512 3300025926 Bacteria 1774
1028 Ga0207687_10000191 3300025927 Bacteria 41173
1029 Ga0207687_10025694 3300025927 Bacteria 3941
1030 Ga0207687_10046573 3300025927 Bacteria 3002
1031 Ga0207687_10385163 3300025927 Bacteria 1150
1032 Ga0207687_10432613 3300025927 Bacteria 1088
1033 Ga0207700_10002748 3300025928 Bacteria 10145
1034 Ga0207700_10041184 3300025928 Bacteria 3378
1035 Ga0207700_10051441 3300025928 Bacteria 3075
1036 Ga0207700_10087384 3300025928 Bacteria 2452
1037 Ga0207700_10649656 3300025928 Bacteria 940
1038 Ga0207664_10009532 3300025929 Bacteria 6816
1039 Ga0207664_10036482 3300025929 Bacteria 3800
1040 Ga0207664_10039956 3300025929 Bacteria 3644
1041 Ga0207664_10107075 3300025929 Bacteria 2319
1042 Ga0207664_10113403 3300025929 Bacteria 2257
1043 Ga0207664_10373424 3300025929 Bacteria 1265
1044 Ga0207644_10013321 3300025931 Bacteria 5480
1045 Ga0207690_10009141 3300025932 Bacteria 5882
1046 Ga0207690_10037314 3300025932 Bacteria 3154
1047 Ga0207690_10085135 3300025932 Bacteria 2218
1048 Ga0207690_10391662 3300025932 Bacteria 1106
1049 Ga0207706_10008286 3300025933 Bacteria 9588
1050 Ga0207706_10022812 3300025933 Bacteria 5615
1051 Ga0207706_10158949 3300025933 Bacteria 1987
1052 Ga0207706_10188267 3300025933 Bacteria 1812
1053 Ga0207706_10257937 3300025933 Bacteria 1522
1054 Ga0207686_10004451 3300025934 Bacteria 7510
1055 Ga0207686_10023376 3300025934 Bacteria 3569
1056 Ga0207686_10082758 3300025934 Bacteria 2099
1057 Ga0207686_10215777 3300025934 Bacteria 1382
1058 Ga0207686_10346538 3300025934 Bacteria 1117
1059 Ga0207686_10649759 3300025934 Bacteria 834
1060 Ga0207709_10001103 3300025935 Bacteria 19800
1061 Ga0207709_10012170 3300025935 Bacteria 4741
1062 Ga0207709_10198780 3300025935 Bacteria 1430
1063 Ga0207670_10001307 3300025936 Bacteria 13150
1064 Ga0207670_10005004 3300025936 Bacteria 7223
1065 Ga0207670_10083983 3300025936 Bacteria 2235
1066 Ga0207670_10089649 3300025936 Bacteria 2171
1067 Ga0207670_10153812 3300025936 Bacteria 1709
1068 Ga0207670_10197667 3300025936 Bacteria 1526
1069 Ga0207670_10212020 3300025936 Bacteria 1478
1070 Ga0207670_10471440 3300025936 Bacteria 1015
1071 Ga0207669_10118546 3300025937 Bacteria 1791
1072 Ga0207669_10595437 3300025937 Bacteria 898
1073 Ga0207704_10003022 3300025938 Bacteria 7602
1074 Ga0207704_10034436 3300025938 Bacteria 2890
1075 Ga0207704_10232050 3300025938 Bacteria 1373
1076 Ga0207704_10269547 3300025938 Bacteria 1288
1077 Ga0207704_10410488 3300025938 Bacteria 1071
1078 Ga0207665_10025588 3300025939 Bacteria 3895
1079 Ga0207665_10082253 3300025939 Bacteria 2218
1080 Ga0207665_10263562 3300025939 Bacteria 1277
1081 Ga0207665_10719364 3300025939 Bacteria 786
1082 Ga0207691_10064525 3300025940 Bacteria 3318
1083 Ga0207691_10111337 3300025940 Bacteria 2434
1084 Ga0207691_10112267 3300025940 Bacteria 2422
1085 Ga0207691_10221997 3300025940 Bacteria 1638
1086 Ga0207691_10408993 3300025940 Bacteria 1157
1087 Ga0207711_10079916 3300025941 Bacteria 2855
1088 Ga0207711_10115974 3300025941 Bacteria 2387
1089 Ga0207711_10170056 3300025941 Bacteria 1977
1090 Ga0207711_10282360 3300025941 Bacteria 1529
1091 Ga0207711_10303626 3300025941 Bacteria 1472
1092 Ga0207711_10339808 3300025941 Bacteria 1389
1093 Ga0207711_10368394 3300025941 Bacteria 1332
1094 Ga0207689_10000162 3300025942 Bacteria 57621
1095 Ga0207689_10015031 3300025942 Bacteria 6563
1096 Ga0207689_10033361 3300025942 Bacteria 4278
1097 Ga0207689_10072508 3300025942 Bacteria 2829
1098 Ga0207689_10112283 3300025942 Bacteria 2240
1099 Ga0207689_10181606 3300025942 Bacteria 1735
1100 Ga0207689_10242572 3300025942 Bacteria 1490
1101 Ga0207661_10000159 3300025944 Bacteria 43412
1102 Ga0207661_10080520 3300025944 Bacteria 2688
1103 Ga0207661_10180818 3300025944 Bacteria 1842
1104 Ga0207661_10390606 3300025944 Bacteria 1260
1105 Ga0207679_10011745 3300025945 Bacteria 5688
1106 Ga0207679_10017031 3300025945 Bacteria 4836
1107 Ga0207679_10113399 3300025945 Bacteria 2144
1108 Ga0207679_10141765 3300025945 Bacteria 1944
1109 Ga0207679_10415991 3300025945 Bacteria 1185
1110 Ga0207667_10003531 3300025949 Bacteria 19329
1111 Ga0207667_10013860 3300025949 Bacteria 9209
1112 Ga0207667_10015478 3300025949 Bacteria 8663
1113 Ga0207667_10043798 3300025949 Bacteria 4748
1114 Ga0207667_10055833 3300025949 Bacteria 4150
1115 Ga0207667_10057334 3300025949 Bacteria 4088
1116 Ga0207667_10058745 3300025949 Bacteria 4032
1117 Ga0207667_10065863 3300025949 Bacteria 3777
1118 Ga0207667_10076547 3300025949 Bacteria 3472
1119 Ga0207667_10080619 3300025949 Bacteria 3372
1120 Ga0207667_10083788 3300025949 Bacteria 3301
1121 Ga0207667_10116278 3300025949 Bacteria 2756
1122 Ga0207667_10119661 3300025949 Bacteria 2714
1123 Ga0207667_10275500 3300025949 Bacteria 1720
1124 Ga0207667_10411728 3300025949 Bacteria 1376
1125 Ga0207667_10559931 3300025949 Bacteria 1156
1126 Ga0207651_10027062 3300025960 Bacteria 3596
1127 Ga0207651_10036708 3300025960 Bacteria 3203
1128 Ga0207651_10105440 3300025960 Bacteria 2103
1129 Ga0207651_10317921 3300025960 Bacteria 1300
1130 Ga0207712_10010705 3300025961 Bacteria 5825
1131 Ga0207712_10020536 3300025961 Bacteria 4326
1132 Ga0207712_10021692 3300025961 Bacteria 4219
1133 Ga0207712_10069958 3300025961 Bacteria 2520
1134 Ga0207712_10402805 3300025961 Bacteria 1150
1135 Ga0207668_10042192 3300025972 Bacteria 3088
1136 Ga0207668_10080992 3300025972 Bacteria 2354
1137 Ga0207668_10117361 3300025972 Bacteria 2008
1138 Ga0207668_10174913 3300025972 Bacteria 1687
1139 Ga0207668_10209680 3300025972 Bacteria 1557
1140 Ga0207668_10308050 3300025972 Bacteria 1309
1141 Ga0207668_10354639 3300025972 Bacteria 1227
1142 Ga0207668_10469755 3300025972 Bacteria 1077
1143 Ga0207668_10494170 3300025972 Bacteria 1051
1144 Ga0207640_10001819 3300025981 Bacteria 11441
1145 Ga0207640_10006883 3300025981 Bacteria 6252
1146 Ga0207640_10061581 3300025981 Bacteria 2486
1147 Ga0207640_10239344 3300025981 Bacteria 1401
1148 Ga0207640_10442502 3300025981 Bacteria 1069
1149 Ga0207658_10115517 3300025986 Bacteria 2130
1150 Ga0207658_10319496 3300025986 Bacteria 1343
1151 Ga0207677_10001045 3300026023 Bacteria 15188
1152 Ga0207677_10013644 3300026023 Bacteria 4715
1153 Ga0207677_10016949 3300026023 Bacteria 4329
1154 Ga0207677_10076774 3300026023 Bacteria 2380
1155 Ga0207677_10138374 3300026023 Bacteria 1860
1156 Ga0207677_10161747 3300026023 Bacteria 1740
1157 Ga0207677_10319417 3300026023 Bacteria 1290
1158 Ga0207703_10006243 3300026035 Bacteria 9532
1159 Ga0207703_10066956 3300026035 Bacteria 2955
1160 Ga0207703_10085690 3300026035 Bacteria 2637
1161 Ga0207703_10094309 3300026035 Bacteria 2523
1162 Ga0207703_10386393 3300026035 Bacteria 1296
1163 Ga0207703_10412436 3300026035 Bacteria 1255
1164 Ga0207639_10035205 3300026041 Bacteria 3705
1165 Ga0207639_10054563 3300026041 Bacteria 3055
1166 Ga0207639_10060162 3300026041 Bacteria 2930
1167 Ga0207639_10092480 3300026041 Bacteria 2424
1168 Ga0207639_10163382 3300026041 Bacteria 1879
1169 Ga0207639_10259443 3300026041 Bacteria 1519
1170 Ga0207678_10011369 3300026067 Bacteria 7812
1171 Ga0207678_10016015 3300026067 Bacteria 6586
1172 Ga0207678_10018537 3300026067 Bacteria 6112
1173 Ga0207678_10066745 3300026067 Bacteria 3088
1174 Ga0207678_10209095 3300026067 Bacteria 1669
1175 Ga0207678_10383506 3300026067 Bacteria 1215
1176 Ga0207708_10003836 3300026075 Bacteria 11082
1177 Ga0207708_10009517 3300026075 Bacteria 7202
1178 Ga0207708_10012979 3300026075 Bacteria 6212
1179 Ga0207708_10021210 3300026075 Bacteria 4898
1180 Ga0207708_10031300 3300026075 Bacteria 4038
1181 Ga0207702_10007391 3300026078 Bacteria 9379
1182 Ga0207702_10014575 3300026078 Bacteria 6524
1183 Ga0207702_10018575 3300026078 Bacteria 5753
1184 Ga0207702_10024254 3300026078 Bacteria 5032
1185 Ga0207702_10047626 3300026078 Bacteria 3613
1186 Ga0207702_10120984 3300026078 Bacteria 2343
1187 Ga0207702_10603791 3300026078 Bacteria 1077
1188 Ga0207641_10024950 3300026088 Bacteria 4929
1189 Ga0207641_10099073 3300026088 Bacteria 2564
1190 Ga0207641_10119847 3300026088 Bacteria 2346
1191 Ga0207641_10406026 3300026088 Bacteria 1309
1192 Ga0207641_10571168 3300026088 Bacteria 1105
1193 Ga0207648_10000147 3300026089 Bacteria 70420
1194 Ga0207648_10035967 3300026089 Bacteria 4363
1195 Ga0207648_10062180 3300026089 Bacteria 3256
1196 Ga0207648_10081011 3300026089 Bacteria 2832
1197 Ga0207648_10129755 3300026089 Bacteria 2219
1198 Ga0207676_10039899 3300026095 Bacteria 3595
1199 Ga0207676_10133592 3300026095 Bacteria 2114
1200 Ga0207676_10141473 3300026095 Bacteria 2060
1201 Ga0207676_10211754 3300026095 Bacteria 1720
1202 Ga0207676_10428785 3300026095 Bacteria 1242
1203 Ga0207674_10000045 3300026116 Bacteria 122251
1204 Ga0207674_10000398 3300026116 Bacteria 56288
1205 Ga0207674_10118754 3300026116 Bacteria 2614
1206 Ga0207674_10415628 3300026116 Bacteria 1299
1207 Ga0207674_10437246 3300026116 Bacteria 1264
1208 Ga0207675_100000104 3300026118 Bacteria 67261
1209 Ga0207675_100014678 3300026118 Bacteria 7304
1210 Ga0207675_100043575 3300026118 Bacteria 4191
1211 Ga0207675_100048747 3300026118 Bacteria 3953
1212 Ga0207675_100206117 3300026118 Bacteria 1890
1213 Ga0207675_100286897 3300026118 Bacteria 1600
1214 Ga0207675_100415780 3300026118 Bacteria 1327
1215 Ga0207675_100472299 3300026118 Bacteria 1245
1216 Ga0207675_100968325 3300026118 Bacteria 869
1217 Ga0207683_10014746 3300026121 Bacteria 6653
1218 Ga0207683_10015816 3300026121 Bacteria 6423
1219 Ga0207683_10026022 3300026121 Bacteria 5052
1220 Ga0207683_10247949 3300026121 Bacteria 1625
1221 Ga0207683_10385062 3300026121 Bacteria 1289
1222 Ga0207698_10001067 3300026142 Bacteria 15959
1223 Ga0207698_10002878 3300026142 Bacteria 10293
1224 Ga0207698_10008305 3300026142 Bacteria 6557
1225 Ga0207698_10065674 3300026142 Bacteria 2852
1226 Ga0207698_10118374 3300026142 Bacteria 2237
1227 Ga0207698_10164819 3300026142 Bacteria 1943
1228 Ga0207698_10428335 3300026142 Bacteria 1271
1229 Ga0207698_10661045 3300026142 Bacteria 1036
1230 Ga0207698_10825276 3300026142 Bacteria 931
1231 Ga0209281_1007516 3300027111 Bacteria 2729
1232 Ga0209281_1017209 3300027111 Bacteria 1471
1233 Ga0209389_1000016 3300027296 Bacteria 184844
1234 Ga0209389_1000027 3300027296 Bacteria 146917
1235 Ga0209589_1000031 3300027357 Bacteria 147054
1236 Ga0209969_1007842 3300027360 Bacteria 1510
1237 Ga0209489_100057 3300027361 Bacteria 147398
1238 Ga0209489_100063 3300027361 Bacteria 144408
1239 Ga0209700_100012 3300027363 Bacteria 357892
1240 Ga0209967_1000518 3300027364 Bacteria 5062
1241 Ga0209967_1001872 3300027364 Bacteria 2705
1242 Ga0209967_1004238 3300027364 Bacteria 1899
1243 Ga0209981_1001333 3300027378 Bacteria 3128
1244 Ga0209996_1001330 3300027395 Bacteria 2954
1245 Ga0209996_1009654 3300027395 Bacteria 1274
1246 Ga0210000_1004651 3300027462 Bacteria 1980
1247 Ga0210000_1011340 3300027462 Bacteria 1321
1248 Ga0209995_1001365 3300027471 Bacteria 3761
1249 Ga0209179_1008247 3300027512 Bacteria 1750
1250 Ga0209179_1031365 3300027512 Bacteria 1090
1251 Ga0209999_1002550 3300027543 Bacteria 3222
1252 Ga0209588_1001152 3300027671 Bacteria 6826
1253 Ga0209588_1003670 3300027671 Bacteria 4268
1254 Ga0209588_1021988 3300027671 Bacteria 2006
1255 Ga0209588_1090861 3300027671 Bacteria 984
1256 Ga0209971_1004901 3300027682 Bacteria 3180
1257 Ga0209998_10000276 3300027717 Bacteria 16120
1258 Ga0209998_10026954 3300027717 Bacteria 1257
1259 Ga0209998_10047323 3300027717 Bacteria 988
1260 Ga0209813_10005677 3300027866 Bacteria 3042
1261 Ga0209974_10004290 3300027876 Bacteria 5084
1262 Ga0209974_10051012 3300027876 Bacteria 1390
1263 Ga0209974_10061019 3300027876 Bacteria 1276
1264 Ga0207428_10000176 3300027907 Bacteria 89634
1265 Ga0207428_10000619 3300027907 Bacteria 41940
1266 Ga0207428_10001497 3300027907 Bacteria 24423
1267 Ga0207428_10020049 3300027907 Bacteria 5689
1268 Ga0207428_10054922 3300027907 Bacteria 3169
1269 Ga0268266_10090737 3300028379 Bacteria 2678
1270 Ga0268266_11082872 3300028379 Bacteria 775
1271 Ga0268265_10000585 3300028380 Bacteria 36765
1272 Ga0268265_10000875 3300028380 Bacteria 28237
1273 Ga0268265_10163404 3300028380 Bacteria 1894
1274 Ga0268265_10173444 3300028380 Bacteria 1845
1275 Ga0268265_10180549 3300028380 Bacteria 1813
1276 Ga0268265_10188807 3300028380 Bacteria 1777
1277 Ga0268265_10316534 3300028380 Bacteria 1411
1278 Ga0268265_10339910 3300028380 Bacteria 1366
1279 Ga0268264_10000042 3300028381 Bacteria 372069
1280 Ga0268264_10000841 3300028381 Bacteria 32855
1281 Ga0268264_10086873 3300028381 Bacteria 2688
1282 Ga0268264_10114602 3300028381 Bacteria 2367
1283 Ga0268264_10123348 3300028381 Bacteria 2286
1284 Ga0268264_10151675 3300028381 Bacteria 2078
1285 Ga0268264_10199553 3300028381 Bacteria 1829
1286 Ga0268264_10528660 3300028381 Bacteria 1154
1287 Ga0265318_10021729 3300028577 Bacteria 2573
1288 Ga0307515_10518134 3300028794 Bacteria 802
1289 Ga0316177_1120927 3300030731 Bacteria 5109
1290 Ga0316180_1146035 3300030736 Bacteria 2993
1291 Ga0316183_1005661 3300030742 Bacteria 2296
1292 Ga0316181_1069339 3300030744 Bacteria 1711
1293 Ga0316182_1284474 3300030745 Bacteria 2340
1294 Ga0316182_1296919 3300030745 Bacteria 1123
1295 Ga0316182_1315656 3300030745 Bacteria 4112
1296 Ga0265330_10006187 3300031235 Bacteria 5925
1297 Ga0265332_10008912 3300031238 Bacteria 4488
1298 Ga0265328_10028349 3300031239 Bacteria 2094
1299 Ga0265320_10054730 3300031240 Bacteria 1924
1300 Ga0265340_10043423 3300031247 Bacteria 2204
1301 Ga0265339_10005071 3300031249 Bacteria 8846
1302 Ga0265339_10039372 3300031249 Bacteria 2631
1303 Ga0265331_10004784 3300031250 Bacteria 8338
1304 Ga0265331_10054949 3300031250 Bacteria 1895
1305 Ga0265316_10148147 3300031344 Bacteria 1759
1306 Ga0307513_10392083 3300031456 Bacteria 1125
1307 Ga0307509_10141452 3300031507 Bacteria 2340
1308 Ga0307509_10360630 3300031507 Bacteria 1173
1309 Ga0307509_10364655 3300031507 Bacteria 1163
1310 Ga0307408_100000312 3300031548 Bacteria 46592
1311 Ga0307408_100000569 3300031548 Bacteria 31764
1312 Ga0307408_100001191 3300031548 Bacteria 19661
1313 Ga0307408_100122752 3300031548 Bacteria 2015
1314 Ga0307408_100363271 3300031548 Bacteria 1232
1315 Ga0307408_100477612 3300031548 Bacteria 1087
1316 Ga0307408_100560859 3300031548 Bacteria 1009
1317 Ga0307408_100621071 3300031548 Bacteria 963
1318 Ga0307508_10000019 3300031616 Bacteria 197575
1319 Ga0307508_10252920 3300031616 Bacteria 1357
1320 Ga0265314_10004441 3300031711 Bacteria 13019
1321 Ga0265314_10023881 3300031711 Bacteria 4648
1322 Ga0265342_10004046 3300031712 Bacteria 11701
1323 Ga0307516_10067084 3300031730 Bacteria 3458
1324 Ga0307516_10105847 3300031730 Bacteria 2624
1325 Ga0307516_10119426 3300031730 Bacteria 2429
1326 Ga0307516_10137400 3300031730 Bacteria 2217
1327 Ga0307405_10319532 3300031731 Bacteria 1185
1328 Ga0307413_10026366 3300031824 Bacteria 3201
1329 Ga0307413_10512559 3300031824 Bacteria 965
1330 Ga0307410_10004635 3300031852 Bacteria 7140
1331 Ga0307410_10038312 3300031852 Bacteria 3139
1332 Ga0307406_10011520 3300031901 Bacteria 5024
1333 Ga0307406_10198142 3300031901 Bacteria 1476
1334 Ga0307406_10514538 3300031901 Bacteria 973
1335 Ga0307407_10041597 3300031903 Bacteria 2571
1336 Ga0307407_10159760 3300031903 Bacteria 1474
1337 Ga0307412_10000120 3300031911 Bacteria 59537
1338 Ga0307412_10213883 3300031911 Bacteria 1473
1339 Ga0307409_100051813 3300031995 Bacteria 3143
1340 Ga0307409_100200883 3300031995 Bacteria 1783
1341 Ga0307416_100101547 3300032002 Bacteria 2505
1342 Ga0307416_100232394 3300032002 Bacteria 1779
1343 Ga0307416_100336166 3300032002 Bacteria 1520
1344 Ga0307416_100453011 3300032002 Bacteria 1336
1345 Ga0307416_100466082 3300032002 Bacteria 1320
1346 Ga0307416_100673535 3300032002 Bacteria 1121
1347 Ga0307416_100854118 3300032002 Bacteria 1008
1348 Ga0307414_10117685 3300032004 Bacteria 2036
1349 Ga0307414_10527757 3300032004 Bacteria 1049
1350 Ga0307411_10043483 3300032005 Bacteria 2874
1351 Ga0307411_10297230 3300032005 Bacteria 1293
1352 Ga0307411_10499380 3300032005 Bacteria 1028
1353 Ga0307415_100127668 3300032126 Bacteria 1919
1354 Ga0307415_100425467 3300032126 Bacteria 1141
1355 Ga0307507_10066258 3300033179 Bacteria 3313
1356 Ga0307507_10296378 3300033179 Bacteria 996
1357 Ga0307510_10009428 3300033180 Bacteria 11628
1358 Ga0307510_10028111 3300033180 Bacteria 6427
1359 Ga0307510_10196764 3300033180 Bacteria 1556
1360 Ga0373930_0002929 3300034816 Bacteria 2683
1361 Ga0373948_0000161 3300034817 Bacteria 7403
1362 Ga0373950_0000909 3300034818 Bacteria 3733
1363 Ga0373950_0014933 3300034818 Bacteria 1312
1364 Ga0373958_0000134 3300034819 Bacteria 8234
1365 Ga0373959_0001053 3300034820 Bacteria 4525
1366 Ga0373938_0000080 3300034957 Bacteria 12924
1367 Ga0373938_0066185 3300034957 Bacteria 855
1368 Ga0373938_0089552 3300034957 Bacteria 760
1369 Ga0373926_0000738 3300035083 Bacteria 9082
1370 Ga0373926_0041629 3300035083 Bacteria 1642
1371 Ga0373926_0042124 3300035083 Bacteria 1632
1372 Ga0373928_0000094 3300035084 Bacteria 15773
1373 Ga0373928_0028739 3300035084 Bacteria 1219
1374 Ga0373929_0003690 3300035085 Bacteria 2747
1375 Ga0373934_0034885 3300035086 Bacteria 1978
1376 Ga0373940_0000238 3300035088 Bacteria 7844
1377 Ga0373940_0018810 3300035088 Bacteria 1737
1378 Ga0373944_0015004 3300035089 Bacteria 2170
1379 Ga0373944_0029677 3300035089 Bacteria 1636
1380 Ga0373949_0001061 3300035090 Bacteria 8408
1381 Ga0373949_0007783 3300035090 Bacteria 2347
1382 Ga0373951_0000639 3300035091 Bacteria 9663
1383 Ga0373951_0005084 3300035091 Bacteria 3075
1384 Ga0373952_0018072 3300035092 Bacteria 1455
1385 Ga0373923_0043733 3300035111 Bacteria 1854
1386 Ga0373932_0004896 3300035112 Bacteria 3155
1387 Ga0373932_0015713 3300035112 Bacteria 1922
1388 Ga0373932_0036299 3300035112 Bacteria 1399
1389 Ga0373932_0088397 3300035112 Bacteria 990
1390 Ga0373936_0001313 3300035113 Bacteria 9002
1391 Ga0373936_0018632 3300035113 Bacteria 2683
1392 Ga0373936_0021347 3300035113 Bacteria 2518
1393 Ga0373936_0159829 3300035113 Bacteria 981
1394 Ga0373939_0001226 3300035114 Bacteria 6270
1395 Ga0373939_0010972 3300035114 Bacteria 2279
1396 Ga0373939_0013675 3300035114 Bacteria 2093
1397 Ga0373941_0000298 3300035115 Bacteria 9578
1398 Ga0373945_0055674 3300035116 Bacteria 1465
1399 Ga0373945_0197762 3300035116 Bacteria 833
1400 Ga0373954_0021802 3300035118 Bacteria 2902
1401 Ga0373960_0000044 3300035121 Bacteria 16345
1402 Ga0373960_0087472 3300035121 Bacteria 991
1403 Ga0373943_0048150 3300035170 Bacteria 2087
1404 Ga0373943_0138921 3300035170 Bacteria 1307
1405 Ga0373943_0201660 3300035170 Bacteria 1101
1406 Ga0373946_0018863 3300035171 Bacteria 2652
1407 Ga0373946_0103306 3300035171 Bacteria 1280
1408 Ga0373946_0160900 3300035171 Bacteria 1054
1409 Ga0373955_0240461 3300035172 Bacteria 1084
1410 Ga0373942_0000449 3300035207 Bacteria 11579
1411 Ga0373961_0002586 3300035241 Bacteria 4657
1412 Ga0373961_0096252 3300035241 Bacteria 953
1413 Ga0373962_0003079 3300035242 Bacteria 3995
1414 Ga0373962_0023177 3300035242 Bacteria 1652
1415 Ga0373924_0002604 3300035410 Bacteria 6086
1416 Ga0373924_0002729 3300035410 Bacteria 5962
1417 Ga0373924_0017277 3300035410 Bacteria 2765
1418 Ga0373924_0050977 3300035410 Bacteria 1715
1419 Ga0373931_0000648 3300035691 Bacteria 14369
1420 Ga0373931_0017630 3300035691 Bacteria 3535
1421 Ga0373931_0026288 3300035691 Bacteria 2961
1422 Ga0373931_0026426 3300035691 Bacteria 2954
1423 Ga0373931_0030064 3300035691 Bacteria 2794
1424 Ga0373931_0196352 3300035691 Bacteria 1203
1425 Ga0373935_0012874 3300035692 Bacteria 5038
1426 Ga0373935_0022134 3300035692 Bacteria 3894
1427 Ga0373935_0072720 3300035692 Bacteria 2220
1428 Ga0373935_0114596 3300035692 Bacteria 1793
1429 Ga0373927_0003632 3300035695 Bacteria 11005
1430 Ga0373927_0023086 3300035695 Bacteria 4074
1431 Ga0373927_0546573 3300035695 Bacteria 765
1432 Ga0373933_0035762 3300035724 Bacteria 2903
1433 Ga0373933_0430398 3300035724 Bacteria 862
1434 Ga0373947_0099341 3300035725 Bacteria 1827
1435 Ga0373937_0021155 3300036401 Bacteria 5838
1436 Ga0373937_0039088 3300036401 Bacteria 4324
1437 Ga0373937_0076356 3300036401 Bacteria 3094
1438 Ga0373937_0159572 3300036401 Bacteria 2114
1439 Ga0372808_009087 3300036459 Bacteria 1385
1440 Ga0373925_0008382 3300037068 Bacteria 7525
1441 Ga0373925_0045274 3300037068 Bacteria 3268
1442 Ga0373925_0065105 3300037068 Bacteria 2745
1443 Ga0373925_0318965 3300037068 Bacteria 1257
1444 Ga0395899_0003193 3300037312 Bacteria 12986
1445 Ga0395899_0058237 3300037312 Bacteria 2850
1446 Ga0395900_0008352 3300037418 Bacteria 10657
1447 Ga0395900_0109588 3300037418 Bacteria 2837
1448 Ga0395900_0113344 3300037418 Bacteria 2783
1449 Ga0395900_0402796 3300037418 Bacteria 1332
1450 Ga0395900_0442625 3300037418 Bacteria 1257
1451 Ga0395898_0008065 3300037466 Bacteria 11163
1452 Ga0395898_0036730 3300037466 Bacteria 4863
1453 Ga0395898_0086534 3300037466 Bacteria 3020
1454 Ga0395898_0245640 3300037466 Bacteria 1707
1455 Ga0395898_0281724 3300037466 Bacteria 1586
1456 Ga0395898_0345790 3300037466 Bacteria 1418
1457 Ga0395905_0002724 3300037471 Bacteria 19358
1458 Ga0395905_0012352 3300037471 Bacteria 8221
1459 Ga0395905_0023299 3300037471 Bacteria 5854
1460 Ga0395905_0029515 3300037471 Bacteria 5167
1461 Ga0395905_0053940 3300037471 Bacteria 3762
1462 Ga0395905_0316500 3300037471 Bacteria 1450
1463 Ga0395905_0369659 3300037471 Bacteria 1327
1464 Ga0395905_0629341 3300037471 Bacteria 975
1465 Ga0395905_0687645 3300037471 Bacteria 925
1466 Ga0436364_1230166 3300037853 Bacteria 1679
1467 Ga0395901_0014698 3300038443 Bacteria 7955
1468 Ga0395901_0036429 3300038443 Bacteria 5085
1469 Ga0395901_0073927 3300038443 Bacteria 3556
1470 Ga0395901_0103394 3300038443 Bacteria 2989
1471 Ga0395901_0182224 3300038443 Bacteria 2203
1472 Ga0395901_0236141 3300038443 Bacteria 1908
1473 Ga0395901_0260784 3300038443 Bacteria 1804
1474 Ga0395901_0674465 3300038443 Bacteria 1034
1475 Ga0242420_018932 3300038996 Bacteria 1216
1476 Ga0242420_026115 3300038996 Bacteria 1064
1477 Ga0242420_038916 3300038996 Bacteria 904
1478 Ga0436365_0038561 3300039437 Bacteria 4244
1479 Ga0436365_0318115 3300039437 Bacteria 1213
1480 Ga0436365_0633843 3300039437 Bacteria 1994
1481 Ga0436365_0846950 3300039437 Bacteria 908
1482 Ga0436365_1019690 3300039437 Bacteria 1227
1483 Ga0436365_1452548 3300039437 Bacteria 3109
1484 Ga0436365_1533291 3300039437 Bacteria 1617
1485 Ga0436360_0329047 3300039438 Bacteria 1931
1486 Ga0436360_0887353 3300039438 Bacteria 2362
1487 Ga0436361_0586765 3300039447 Bacteria 11422
1488 Ga0436363_1496104 3300039450 Bacteria 1160
1489 Ga0436362_0546340 3300039453 Bacteria 1314
1490 Ga0436362_0883250 3300039453 Bacteria 1313
1491 Ga0439436_0090670 3300041404 Bacteria 851
1492 Ga0451789_0251368 3300041443 Bacteria 1309
1493 Ga0451807_1408311 3300041486 Bacteria 1090
1494 Ga0451837_1330906 3300041494 Bacteria 1209
1495 Ga0451853_0489163 3300041512 Bacteria 770
1496 Ga0439441_005277 3300042001 Bacteria 1999
1497 Ga0439441_025771 3300042001 Bacteria 1112
1498 Ga0439441_067732 3300042001 Bacteria 761
1499 Ga0439451_013662 3300042009 Bacteria 1641
1500 Ga0450891_018125 3300042129 Bacteria 680
1501 Ga0439446_0002327 3300042156 Bacteria 4548
1502 Ga0439434_0000438 3300042435 Bacteria 11880
1503 Ga0439435_0000537 3300042436 Bacteria 6075
1504 Ga0439435_0001751 3300042436 Bacteria 4121
1505 Ga0439444_0006262 3300042437 Bacteria 1794
1506 Ga0439460_0001193 3300042461 Bacteria 6115
1507 Ga0451577_0138443 3300042876 Bacteria 2186
1508 Ga0451577_0306811 3300042876 Bacteria 1438
1509 Ga0451577_0761094 3300042876 Bacteria 876
1510 Ga0466972_0000179 3300044658 Bacteria 49010
1511 Ga0466972_0000224 3300044658 Bacteria 39867
1512 Ga0466972_0006460 3300044658 Bacteria 5889
1513 Ga0466972_0242456 3300044658 Bacteria 843
1514 Ga0453683_0022477 3300044673 Bacteria 4023
1515 Ga0453683_0166871 3300044673 Bacteria 1394
1516 Ga0466965_0001368 3300044683 Bacteria 9785
1517 Ga0466965_0254164 3300044683 Bacteria 943
1518 Ga0466966_0000830 3300044684 Bacteria 19703
1519 Ga0466961_0000023 3300044693 Bacteria 97134
1520 Ga0466961_0155865 3300044693 Bacteria 1425
1521 Ga0466961_0225968 3300044693 Bacteria 1153
1522 Ga0466963_0142486 3300044694 Bacteria 1661
1523 Ga0466964_0052467 3300044706 Bacteria 1676
1524 Ga0466964_0069652 3300044706 Bacteria 1484
1525 Ga0466964_0142915 3300044706 Bacteria 1102
1526 Ga0466964_0143567 3300044706 Bacteria 1100
1527 Ga0453684_0020509 3300044712 Bacteria 9962
1528 Ga0453684_0127987 3300044712 Bacteria 3053
1529 Ga0453684_0244215 3300044712 Bacteria 2065
1530 Ga0453684_0595873 3300044712 Bacteria 1212
1531 Ga0466970_0029846 3300044765 Bacteria 2874
1532 Ga0466970_0085049 3300044765 Bacteria 1713
1533 Ga0466970_0125960 3300044765 Bacteria 1405
1534 Ga0466957_0055189 3300044842 Bacteria 2428
1535 Ga0466957_0240285 3300044842 Bacteria 1201
1536 Ga0466957_0310705 3300044842 Bacteria 1061
1537 Ga0466960_0016870 3300044901 Bacteria 3175
1538 Ga0466960_0151436 3300044901 Bacteria 1239
1539 Ga0466959_0032575 3300045049 Bacteria 3858
1540 Ga0466959_0035127 3300045049 Bacteria 3709
1541 Ga0451576_0026409 3300045051 Bacteria 6246
1542 Ga0451576_0076491 3300045051 Bacteria 3483
1543 Ga0451576_0126884 3300045051 Bacteria 2658
1544 Ga0451576_0224612 3300045051 Bacteria 1961
1545 Ga0451576_0274158 3300045051 Bacteria 1764
1546 Ga0451576_0356016 3300045051 Bacteria 1532
1547 Ga0451576_0358519 3300045051 Bacteria 1527
1548 Ga0451576_0692128 3300045051 Bacteria 1071
1549 Ga0451576_0732007 3300045051 Bacteria 1039
1550 Ga0466958_0013122 3300045836 Bacteria 4711
1551 Ga0466967_0071411 3300045976 Bacteria 3109
1552 Ga0466967_0104727 3300045976 Bacteria 2590
1553 Ga0466967_0299929 3300045976 Bacteria 1546
1554 Ga0466967_0788334 3300045976 Bacteria 943
1555 Ga0495617_000959 3300046452 Bacteria 13413
1556 Ga0495617_039279 3300046452 Bacteria 1582
1557 Ga0495627_000046 3300046453 Bacteria 176186
1558 Ga0495627_000054 3300046453 Bacteria 151899
1559 Ga0495627_001968 3300046453 Bacteria 10626
1560 Ga0495592_0136776 3300046454 Bacteria 1708
1561 Ga0495603_0045648 3300046455 Bacteria 2612
1562 Ga0495603_0054409 3300046455 Bacteria 2372
1563 Ga0495603_0079661 3300046455 Bacteria 1920
1564 Ga0495603_0164509 3300046455 Bacteria 1286
1565 Ga0495590_0000030 3300046457 Bacteria 146237
1566 Ga0495629_0001925 3300046459 Bacteria 16181
1567 Ga0495629_0237190 3300046459 Bacteria 1256
1568 Ga0495638_0009377 3300046460 Bacteria 6880
1569 Ga0495638_0024282 3300046460 Bacteria 3955
1570 Ga0495638_0118341 3300046460 Bacteria 1567
1571 Ga0495638_0175647 3300046460 Bacteria 1226
1572 Ga0495641_0139973 3300046461 Bacteria 1081
1573 Ga0495651_0034303 3300046462 Bacteria 3956
1574 Ga0495651_0050526 3300046462 Bacteria 3207
1575 Ga0495651_0100483 3300046462 Bacteria 2155
1576 Ga0495653_0020946 3300046463 Bacteria 5298
1577 Ga0495653_0317959 3300046463 Bacteria 1010
1578 Ga0495650_0000777 3300046471 Bacteria 39323
1579 Ga0495650_0078745 3300046471 Bacteria 1275
1580 Ga0495580_0002026 3300046472 Bacteria 17832
1581 Ga0495580_0005633 3300046472 Bacteria 10302
1582 Ga0495580_0014551 3300046472 Bacteria 5964
1583 Ga0495580_0018723 3300046472 Bacteria 5153
1584 Ga0495582_0018041 3300046473 Bacteria 3859
1585 Ga0495582_0038107 3300046473 Bacteria 2644
1586 Ga0495605_0026314 3300046474 Bacteria 3025
1587 Ga0495605_0043566 3300046474 Bacteria 2224
1588 Ga0495605_0108345 3300046474 Bacteria 1270
1589 Ga0495639_0007882 3300046475 Bacteria 4578
1590 Ga0495639_0008211 3300046475 Bacteria 4483
1591 Ga0495662_0006209 3300046476 Bacteria 5975
1592 Ga0495662_0020809 3300046476 Bacteria 3173
1593 Ga0495662_0100446 3300046476 Bacteria 1415
1594 Ga0495664_0007694 3300046477 Bacteria 5993
1595 Ga0495664_0110171 3300046477 Bacteria 1661
1596 Ga0495664_0184198 3300046477 Bacteria 1266
1597 Ga0495584_0001261 3300046491 Bacteria 15421
1598 Ga0495584_0002680 3300046491 Bacteria 10013
1599 Ga0495584_0077592 3300046491 Bacteria 1671
1600 Ga0495584_0207014 3300046491 Bacteria 997
1601 Ga0495585_0040181 3300046492 Bacteria 2627
1602 Ga0495585_0117475 3300046492 Bacteria 1409
1603 Ga0495585_0128148 3300046492 Bacteria 1338
1604 Ga0495585_0170185 3300046492 Bacteria 1126
1605 Ga0495585_0196801 3300046492 Bacteria 1028
1606 Ga0495594_0033287 3300046499 Bacteria 2801
1607 Ga0495596_0009715 3300046500 Bacteria 4223
1608 Ga0495596_0056293 3300046500 Bacteria 1536
1609 Ga0495607_0000016 3300046501 Bacteria 177613
1610 Ga0495607_0104584 3300046501 Bacteria 1510
1611 Ga0495607_0109537 3300046501 Bacteria 1466
1612 Ga0495607_0112887 3300046501 Bacteria 1438
1613 Ga0495583_0000134 3300046506 Bacteria 124077
1614 Ga0495583_0000989 3300046506 Bacteria 32582
1615 Ga0495583_0003100 3300046506 Bacteria 13146
1616 Ga0495583_0010587 3300046506 Bacteria 5364
1617 Ga0495583_0030698 3300046506 Bacteria 2613
1618 Ga0495583_0119927 3300046506 Bacteria 1108
1619 Ga0495606_0000807 3300046507 Bacteria 47620
1620 Ga0495606_0009374 3300046507 Bacteria 8288
1621 Ga0495606_0014677 3300046507 Bacteria 6092
1622 Ga0495606_0047144 3300046507 Bacteria 2843
1623 Ga0495606_0053830 3300046507 Bacteria 2609
1624 Ga0495606_0069493 3300046507 Bacteria 2224
1625 Ga0495606_0083387 3300046507 Bacteria 1982
1626 Ga0495606_0128980 3300046507 Bacteria 1505
1627 Ga0495606_0210273 3300046507 Bacteria 1102
1628 Ga0495606_0279324 3300046507 Bacteria 914
1629 Ga0495606_0384391 3300046507 Bacteria 735
1630 Ga0495608_0001832 3300046511 Bacteria 15154
1631 Ga0495608_0008777 3300046511 Bacteria 7072
1632 Ga0495608_0027684 3300046511 Bacteria 3856
1633 Ga0495608_0361789 3300046511 Bacteria 892
1634 Ga0495610_0005246 3300046512 Bacteria 9273
1635 Ga0495610_0141028 3300046512 Bacteria 1037
1636 Ga0495616_0007134 3300046513 Bacteria 6705
1637 Ga0495616_0012903 3300046513 Bacteria 4726
1638 Ga0495616_0018431 3300046513 Bacteria 3831
1639 Ga0495618_0057258 3300046514 Bacteria 2468
1640 Ga0495618_0128448 3300046514 Bacteria 1622
1641 Ga0495628_0002925 3300046516 Bacteria 15306
1642 Ga0495628_0048418 3300046516 Bacteria 3369
1643 Ga0495628_0055740 3300046516 Bacteria 3113
1644 Ga0495628_0066501 3300046516 Bacteria 2818
1645 Ga0495630_0001970 3300046517 Bacteria 14287
1646 Ga0495630_0059924 3300046517 Bacteria 2856
1647 Ga0495630_0101844 3300046517 Bacteria 2172
1648 Ga0495630_0275581 3300046517 Bacteria 1285
1649 Ga0495632_0116473 3300046519 Bacteria 1251
1650 Ga0495643_0000639 3300046522 Bacteria 41499
1651 Ga0495643_0001431 3300046522 Bacteria 22049
1652 Ga0495643_0028845 3300046522 Bacteria 3108
1653 Ga0495643_0029940 3300046522 Bacteria 3043
1654 Ga0495643_0105788 3300046522 Bacteria 1436
1655 Ga0495644_0014657 3300046523 Bacteria 3002
1656 Ga0495644_0025791 3300046523 Bacteria 2230
1657 Ga0495644_0030050 3300046523 Bacteria 2051
1658 Ga0495644_0050171 3300046523 Bacteria 1566
1659 Ga0495648_0005565 3300046524 Bacteria 10451
1660 Ga0495648_0006734 3300046524 Bacteria 9297
1661 Ga0495648_0024566 3300046524 Bacteria 4101
1662 Ga0495648_0024760 3300046524 Bacteria 4077
1663 Ga0495648_0040368 3300046524 Bacteria 2959
1664 Ga0495663_0027579 3300046525 Bacteria 1667
1665 Ga0495666_0004607 3300046526 Bacteria 6971
1666 Ga0495666_0007942 3300046526 Bacteria 5314
1667 Ga0495642_0008146 3300046528 Bacteria 4010
1668 Ga0495642_0023811 3300046528 Bacteria 2419
1669 Ga0495642_0027671 3300046528 Bacteria 2257
1670 Ga0495642_0028152 3300046528 Bacteria 2238
1671 Ga0495642_0147515 3300046528 Bacteria 1017
1672 Ga0495652_0003201 3300046529 Bacteria 16320
1673 Ga0495652_0114176 3300046529 Bacteria 2167
1674 Ga0495652_0168772 3300046529 Bacteria 1691
1675 Ga0495652_0199796 3300046529 Bacteria 1518
1676 Ga0495652_0203603 3300046529 Bacteria 1500
1677 Ga0495654_0027387 3300046530 Bacteria 2923
1678 Ga0495654_0177316 3300046530 Bacteria 925
1679 Ga0495665_0011144 3300046531 Bacteria 4866
1680 Ga0495665_0036939 3300046531 Bacteria 2607
1681 Ga0495665_0107753 3300046531 Bacteria 1462
1682 Ga0495640_0015232 3300046533 Bacteria 5789
1683 Ga0495640_0027942 3300046533 Bacteria 4064
1684 Ga0495640_0029794 3300046533 Bacteria 3912
1685 Ga0495640_0052256 3300046533 Bacteria 2807
1686 Ga0495586_0001220 3300046535 Bacteria 14439
1687 Ga0495586_0010359 3300046535 Bacteria 4957
1688 Ga0495587_0017938 3300046536 Bacteria 4389
1689 Ga0495587_0051950 3300046536 Bacteria 2421
1690 Ga0495587_0054175 3300046536 Bacteria 2364
1691 Ga0495598_0009081 3300046537 Bacteria 2337
1692 Ga0495598_0010798 3300046537 Bacteria 2197
1693 Ga0495598_0099104 3300046537 Bacteria 962
1694 Ga0495609_0002146 3300046538 Bacteria 12411
1695 Ga0495609_0004314 3300046538 Bacteria 7818
1696 Ga0495609_0012684 3300046538 Bacteria 3995
1697 Ga0495609_0018086 3300046538 Bacteria 3269
1698 Ga0495609_0022023 3300046538 Bacteria 2937
1699 Ga0495609_0057157 3300046538 Bacteria 1727
1700 Ga0495609_0188331 3300046538 Bacteria 866
1701 Ga0495621_0014454 3300046539 Bacteria 2498
1702 Ga0495621_0068326 3300046539 Bacteria 1304
1703 Ga0495621_0123789 3300046539 Bacteria 1001
1704 Ga0495597_0000630 3300046542 Bacteria 28791
1705 Ga0495597_0001389 3300046542 Bacteria 17475
1706 Ga0495597_0035388 3300046542 Bacteria 2252
1707 Ga0495645_0002965 3300046543 Bacteria 11488
1708 Ga0495645_0029507 3300046543 Bacteria 3989
1709 Ga0495645_0048632 3300046543 Bacteria 3088
1710 Ga0495622_0011694 3300046557 Bacteria 4057
1711 Ga0495622_0022983 3300046557 Bacteria 2906
1712 Ga0495622_0043843 3300046557 Bacteria 2079
1713 Ga0495622_0086509 3300046557 Bacteria 1441
1714 Ga0495633_0000738 3300046558 Bacteria 29636
1715 Ga0495633_0002417 3300046558 Bacteria 13199
1716 Ga0495633_0013946 3300046558 Bacteria 4214
1717 Ga0495633_0015230 3300046558 Bacteria 3995
1718 Ga0495633_0083370 3300046558 Bacteria 1487
1719 Ga0495667_0004813 3300046559 Bacteria 9127
1720 Ga0495667_0027311 3300046559 Bacteria 3847
1721 Ga0495667_0157469 3300046559 Bacteria 1461
1722 Ga0495656_0041044 3300046615 Bacteria 1931
1723 Ga0495656_0129291 3300046615 Bacteria 1200
1724 Ga0495668_0000875 3300046616 Bacteria 33965
1725 Ga0495668_0011677 3300046616 Bacteria 5248
1726 Ga0495668_0029895 3300046616 Bacteria 3078
1727 Ga0495668_0032070 3300046616 Bacteria 2958
1728 Ga0495668_0037250 3300046616 Bacteria 2721
1729 Ga0495668_0149732 3300046616 Bacteria 1278
1730 Ga0495668_0402661 3300046616 Bacteria 752
1731 Ga0495634_0003016 3300046642 Bacteria 13704
1732 Ga0495634_0091748 3300046642 Bacteria 1971
1733 Ga0495634_0112839 3300046642 Bacteria 1746
1734 Ga0495611_0012931 3300046648 Bacteria 3548
1735 Ga0495611_0024624 3300046648 Bacteria 2619
1736 Ga0495611_0109080 3300046648 Bacteria 1288
1737 Ga0495625_0002719 3300046660 Bacteria 18757
1738 Ga0495625_0006919 3300046660 Bacteria 10007
1739 Ga0495625_0007076 3300046660 Bacteria 9859
1740 Ga0495625_0010836 3300046660 Bacteria 7497
1741 Ga0495625_0017497 3300046660 Bacteria 5611
1742 Ga0495625_0018949 3300046660 Bacteria 5355
1743 Ga0495625_0103309 3300046660 Bacteria 1954
1744 Ga0495625_0233511 3300046660 Bacteria 1200
1745 Ga0495635_0009317 3300046663 Bacteria 6859
1746 Ga0495635_0023830 3300046663 Bacteria 4265
1747 Ga0495635_0163520 3300046663 Bacteria 1514
1748 Ga0495659_0000007 3300046664 Bacteria 105393
1749 Ga0495659_0000741 3300046664 Bacteria 11717
1750 Ga0495659_0002385 3300046664 Bacteria 6069
1751 Ga0495661_0000008 3300046665 Bacteria 317971
1752 Ga0495661_0005792 3300046665 Bacteria 8736
1753 Ga0495661_0084090 3300046665 Bacteria 1828
1754 Ga0495661_0153239 3300046665 Bacteria 1243
1755 Ga0495661_0312445 3300046665 Bacteria 783
1756 Ga0495588_0001390 3300046674 Bacteria 10343
1757 Ga0495588_0009976 3300046674 Bacteria 4403
1758 Ga0495588_0324279 3300046674 Bacteria 810
1759 Ga0495657_0003474 3300046675 Bacteria 12853
1760 Ga0495599_0012568 3300046678 Bacteria 5222
1761 Ga0495599_0030716 3300046678 Bacteria 3372
1762 Ga0495599_0178057 3300046678 Bacteria 1311
1763 Ga0495623_0031617 3300046679 Bacteria 3403
1764 Ga0495623_0090100 3300046679 Bacteria 1884
1765 Ga0495623_0281608 3300046679 Bacteria 925
1766 Ga0495646_0291946 3300046680 Bacteria 864
1767 Ga0495647_0004595 3300046681 Bacteria 4497
1768 Ga0495647_0014637 3300046681 Bacteria 2736
1769 Ga0495647_0024147 3300046681 Bacteria 2211
1770 Ga0495658_0008157 3300046683 Bacteria 5188
1771 Ga0495658_0008470 3300046683 Bacteria 5096
1772 Ga0495658_0053588 3300046683 Bacteria 2292
1773 Ga0495658_0083029 3300046683 Bacteria 1883
1774 Ga0495658_0138195 3300046683 Bacteria 1488
1775 Ga0495669_0002019 3300046684 Bacteria 8319
1776 Ga0495669_0012169 3300046684 Bacteria 3659
1777 Ga0495669_0022577 3300046684 Bacteria 2733
1778 Ga0495669_0057763 3300046684 Bacteria 1751
1779 Ga0495669_0072507 3300046684 Bacteria 1571
1780 Ga0495613_0012954 3300046689 Bacteria 6195
1781 Ga0495613_0028419 3300046689 Bacteria 4159
1782 Ga0495613_0081477 3300046689 Bacteria 2351
1783 Ga0495613_0312084 3300046689 Bacteria 1087
1784 Ga0495624_0005122 3300046690 Bacteria 9470
1785 Ga0495624_0006495 3300046690 Bacteria 8291
1786 Ga0495624_0034068 3300046690 Bacteria 3297
1787 Ga0495624_0071884 3300046690 Bacteria 2152
1788 Ga0495670_0001574 3300046691 Bacteria 11143
1789 Ga0495670_0009279 3300046691 Bacteria 4839
1790 Ga0495670_0021697 3300046691 Bacteria 3168
1791 Ga0495670_0042676 3300046691 Bacteria 2263
1792 Ga0495671_0000521 3300046692 Bacteria 29322
1793 Ga0495671_0179511 3300046692 Bacteria 1028
1794 Ga0495649_0003458 3300046694 Bacteria 10644
1795 Ga0495649_0007278 3300046694 Bacteria 6772
1796 Ga0495649_0129623 3300046694 Bacteria 1331
1797 Ga0495649_0158700 3300046694 Bacteria 1186
1798 Ga0495589_0156595 3300046794 Bacteria 1086
1799 Ga0495589_0258258 3300046794 Bacteria 813
1800 Ga0495600_0002113 3300046809 Bacteria 11241
1801 Ga0495600_0008815 3300046809 Bacteria 6210
1802 Ga0495660_0000088 3300046810 Bacteria 98970
1803 Ga0495660_0000476 3300046810 Bacteria 33346
1804 Ga0495660_0001105 3300046810 Bacteria 19276
1805 Ga0495660_0002203 3300046810 Bacteria 12542
1806 Ga0495660_0022170 3300046810 Bacteria 3629
1807 Ga0495581_0010897 3300047315 Bacteria 5257
1808 Ga0495581_0012078 3300047315 Bacteria 4997
1809 Ga0495604_0005104 3300047317 Bacteria 10396
1810 Ga0495604_0005897 3300047317 Bacteria 9717
1811 Ga0495604_0044714 3300047317 Bacteria 3458
1812 Ga0495636_0001121 3300047318 Bacteria 10101
1813 Ga0495636_0011491 3300047318 Bacteria 3504
1814 Ga0495636_0073667 3300047318 Bacteria 1461
1815 Ga0495674_0001841 3300047319 Bacteria 20895
1816 Ga0495674_0028067 3300047319 Bacteria 5137
1817 Ga0495672_0000014 3300047320 Bacteria 505636
1818 Ga0495672_0000285 3300047320 Bacteria 70145
1819 Ga0495672_0001228 3300047320 Bacteria 25780
1820 Ga0495672_0032327 3300047320 Bacteria 3257
1821 Ga0495672_0067513 3300047320 Bacteria 2036
1822 Ga0495676_0067445 3300047321 Bacteria 2768
1823 Ga0495676_0085843 3300047321 Bacteria 2370
1824 Ga0495676_0223523 3300047321 Bacteria 1296
1825 Ga0495680_0001322 3300047322 Bacteria 27035
1826 Ga0495683_0000809 3300047323 Bacteria 22269
1827 Ga0495683_0047413 3300047323 Bacteria 2156
1828 Ga0495683_0083039 3300047323 Bacteria 1560
1829 Ga0495683_0188793 3300047323 Bacteria 936
1830 Ga0495687_001324 3300047443 Bacteria 23105
1831 Ga0495687_001794 3300047443 Bacteria 18949
1832 Ga0495687_003369 3300047443 Bacteria 11662
1833 Ga0495687_009276 3300047443 Bacteria 5520
1834 Ga0495687_021501 3300047443 Bacteria 3118
1835 Ga0495675_0004442 3300047444 Bacteria 8487
1836 Ga0495677_0010538 3300047445 Bacteria 3392
1837 Ga0495677_0118055 3300047445 Bacteria 1010
1838 Ga0495679_022024 3300047446 Bacteria 2188
1839 Ga0495679_034079 3300047446 Bacteria 1623
1840 Ga0495685_000624 3300047447 Bacteria 10826
1841 Ga0495685_018083 3300047447 Bacteria 2416
1842 Ga0495673_0000525 3300047469 Bacteria 40095
1843 Ga0495673_0029487 3300047469 Bacteria 2589
1844 Ga0495673_0107676 3300047469 Bacteria 1118
1845 Ga0495684_0065461 3300047471 Bacteria 2763
1846 Ga0495684_0124558 3300047471 Bacteria 1939
1847 Ga0495686_0004524 3300047472 Bacteria 11394
1848 Ga0495686_0249618 3300047472 Bacteria 997
1849 Ga0495593_0003267 3300047673 Bacteria 9722
1850 Ga0495593_0011754 3300047673 Bacteria 5021
1851 Ga0495593_0159933 3300047673 Bacteria 1137
1852 Ga0495602_0001522 3300048088 Bacteria 23067
1853 Ga0495614_0102366 3300048089 Bacteria 1253
1854 Ga0496100_0158786 3300048903 Bacteria 1619
1855 Ga0496101_0013436 3300048904 Bacteria 5486
1856 Ga0496101_0102541 3300048904 Bacteria 2143
1857 Ga0496101_0412582 3300048904 Bacteria 1064
1858 Ga0496102_0001172 3300048905 Bacteria 23912
1859 Ga0496102_0004735 3300048905 Bacteria 11526
1860 Ga0496102_0010080 3300048905 Bacteria 8130
1861 Ga0496102_0039427 3300048905 Bacteria 4269
1862 Ga0496102_0044182 3300048905 Bacteria 4043
1863 Ga0496102_0095294 3300048905 Bacteria 2758
1864 Ga0496103_0022306 3300048906 Bacteria 3812
1865 Ga0496103_0029262 3300048906 Bacteria 3347
1866 Ga0496103_0052043 3300048906 Bacteria 2536
1867 Ga0496103_0112760 3300048906 Bacteria 1728
1868 Ga0496103_0141553 3300048906 Bacteria 1538
1869 Ga0496103_0418200 3300048906 Bacteria 860
1870 Ga0496104_0013714 3300048907 Bacteria 7310
1871 Ga0496104_0013828 3300048907 Bacteria 7281
1872 Ga0496104_0052425 3300048907 Bacteria 3853
1873 Ga0496104_0072227 3300048907 Bacteria 3281
1874 Ga0496104_0144591 3300048907 Bacteria 2284
1875 Ga0496104_0317260 3300048907 Bacteria 1472
1876 Ga0496105_0019607 3300048908 Bacteria 5455
1877 Ga0496105_0040611 3300048908 Bacteria 3836
1878 Ga0496105_0042979 3300048908 Bacteria 3727
1879 Ga0496105_0177806 3300048908 Bacteria 1743
1880 Ga0496106_0106122 3300048909 Bacteria 2183
1881 Ga0496106_0146589 3300048909 Bacteria 1860
1882 Ga0496106_0154299 3300048909 Bacteria 1812
1883 Ga0496106_0236249 3300048909 Bacteria 1460
1884 Ga0496106_0690443 3300048909 Bacteria 814
1885 Ga0496107_0046877 3300048910 Bacteria 3111
1886 Ga0496107_0066793 3300048910 Bacteria 2607
1887 Ga0496107_0076307 3300048910 Bacteria 2441
1888 Ga0496107_0112675 3300048910 Bacteria 2000
1889 Ga0496107_0249449 3300048910 Bacteria 1321
1890 Ga0496107_0485477 3300048910 Bacteria 917
1891 Ga0496108_0007768 3300048911 Bacteria 8689
1892 Ga0496108_0030580 3300048911 Bacteria 4463
1893 Ga0496108_0606575 3300048911 Bacteria 954
1894 Ga0496109_0013203 3300048912 Bacteria 7150
1895 Ga0496109_0016571 3300048912 Bacteria 6444
1896 Ga0496109_0164136 3300048912 Bacteria 2082
1897 Ga0496109_0226271 3300048912 Bacteria 1759
1898 Ga0496109_0615170 3300048912 Bacteria 1023
1899 Ga0496110_0013454 3300048913 Bacteria 6766
1900 Ga0496110_0022480 3300048913 Bacteria 5355
1901 Ga0496110_0123893 3300048913 Bacteria 2331
1902 Ga0496110_0140607 3300048913 Bacteria 2182
1903 Ga0496110_0206945 3300048913 Bacteria 1783
1904 Ga0496110_0207997 3300048913 Bacteria 1778
1905 Ga0496110_0299417 3300048913 Bacteria 1465
1906 Ga0496110_0463767 3300048913 Bacteria 1154
1907 Ga0496110_0544306 3300048913 Bacteria 1055
1908 Ga0496111_0021330 3300048914 Bacteria 4522
1909 Ga0496111_0034953 3300048914 Bacteria 3590
1910 Ga0496111_0039106 3300048914 Bacteria 3400
1911 Ga0496111_0115267 3300048914 Bacteria 1981
1912 Ga0496111_0118117 3300048914 Bacteria 1957
1913 Ga0496111_0144725 3300048914 Bacteria 1762
1914 Ga0496111_0151644 3300048914 Bacteria 1719
1915 Ga0496112_0067770 3300048915 Bacteria 3523
1916 Ga0496112_0139760 3300048915 Bacteria 2391
1917 Ga0496112_0170604 3300048915 Bacteria 2141
1918 Ga0496112_0296922 3300048915 Bacteria 1561
1919 Ga0496112_0331874 3300048915 Bacteria 1465
1920 Ga0496112_0546107 3300048915 Bacteria 1093
1921 Ga0496112_0786749 3300048915 Bacteria 876
1922 Ga0496113_0005324 3300048916 Bacteria 8011
1923 Ga0496113_0096372 3300048916 Bacteria 2287
1924 Ga0496113_0098211 3300048916 Bacteria 2266
1925 Ga0496113_0283331 3300048916 Bacteria 1325
1926 Ga0496113_0378976 3300048916 Bacteria 1135
1927 Ga0496114_0055275 3300048917 Bacteria 3311
1928 Ga0496114_0062448 3300048917 Bacteria 3117
1929 Ga0496114_0094418 3300048917 Bacteria 2544
1930 Ga0496114_0158043 3300048917 Bacteria 1969
1931 Ga0496114_0170208 3300048917 Bacteria 1898
1932 Ga0496114_0352680 3300048917 Bacteria 1301
1933 Ga0496114_0572495 3300048917 Bacteria 997
1934 Ga0496114_0685038 3300048917 Bacteria 900
1935 Ga0496115_0008912 3300048918 Bacteria 7438
1936 Ga0496115_0039349 3300048918 Bacteria 3755
1937 Ga0496115_0087048 3300048918 Bacteria 2549
1938 Ga0496115_0311506 3300048918 Bacteria 1289
1939 Ga0496116_0015318 3300048919 Bacteria 6065
1940 Ga0496116_0017629 3300048919 Bacteria 5534
1941 Ga0496116_0021466 3300048919 Bacteria 4870
1942 Ga0496116_0086191 3300048919 Bacteria 1928
1943 Ga0496117_0000010 3300048920 Bacteria 611954
1944 Ga0496117_0054805 3300048920 Bacteria 2791
1945 Ga0496117_0076542 3300048920 Bacteria 2218
1946 Ga0496117_0141061 3300048920 Bacteria 1443
1947 Ga0496118_0000009 3300048921 Bacteria 611954
1948 Ga0496118_0019784 3300048921 Bacteria 6004
1949 Ga0496118_0021278 3300048921 Bacteria 5716
1950 Ga0496118_0025820 3300048921 Bacteria 5025
1951 Ga0496118_0042073 3300048921 Bacteria 3609
1952 Ga0496118_0045289 3300048921 Bacteria 3436
1953 Ga0496118_0094892 3300048921 Bacteria 2038
1954 Ga0496118_0195979 3300048921 Bacteria 1202
1955 Ga0496119_0020769 3300048922 Bacteria 4771
1956 Ga0496119_0057610 3300048922 Bacteria 2347
1957 Ga0496119_0105480 3300048922 Bacteria 1574
1958 Ga0496119_0143213 3300048922 Bacteria 1288
1959 Ga0496119_0275698 3300048922 Bacteria 838
1960 Ga0496120_0023889 3300048923 Bacteria 3820
1961 Ga0496120_0031549 3300048923 Bacteria 3207
1962 Ga0496121_0000479 3300048924 Bacteria 77608
1963 Ga0496121_0003573 3300048924 Bacteria 21976
1964 Ga0496121_0005384 3300048924 Bacteria 16445
1965 Ga0496121_0008714 3300048924 Bacteria 11840
1966 Ga0496121_0019117 3300048924 Bacteria 6870
1967 Ga0496121_0026869 3300048924 Bacteria 5405
1968 Ga0496121_0041119 3300048924 Bacteria 4046
1969 Ga0496121_0054152 3300048924 Bacteria 3355
1970 Ga0496121_0058920 3300048924 Bacteria 3170
1971 Ga0496121_0063515 3300048924 Bacteria 3016
1972 Ga0496121_0067062 3300048924 Bacteria 2909
1973 Ga0496121_0164215 3300048924 Bacteria 1620
1974 Ga0496121_0168464 3300048924 Bacteria 1594
1975 Ga0496122_0000320 3300048925 Bacteria 105489
1976 Ga0496122_0000878 3300048925 Bacteria 56301
1977 Ga0496122_0003066 3300048925 Bacteria 22532
1978 Ga0496122_0046042 3300048925 Bacteria 3383
1979 Ga0496122_0153054 3300048925 Bacteria 1420
1980 Ga0496123_0000258 3300048926 Bacteria 107501
1981 Ga0496123_0000603 3300048926 Bacteria 61111
1982 Ga0496123_0004181 3300048926 Bacteria 15427
1983 Ga0496123_0137995 3300048926 Bacteria 1338
1984 Ga0496123_0138924 3300048926 Bacteria 1332
1985 Ga0496124_0002457 3300048927 Bacteria 24235
1986 Ga0496124_0007078 3300048927 Bacteria 12019
1987 Ga0496124_0028933 3300048927 Bacteria 4946
1988 Ga0496124_0035805 3300048927 Bacteria 4337
1989 Ga0496124_0040925 3300048927 Bacteria 4003
1990 Ga0496124_0158046 3300048927 Bacteria 1770
1991 Ga0496124_0160111 3300048927 Bacteria 1755
1992 Ga0496124_0229539 3300048927 Bacteria 1389
1993 Ga0496124_0419853 3300048927 Bacteria 922
1994 Ga0496125_0000168 3300048928 Bacteria 146364
1995 Ga0496125_0012765 3300048928 Bacteria 8305
1996 Ga0496125_0047258 3300048928 Bacteria 3601
1997 Ga0496125_0061710 3300048928 Bacteria 3004
1998 Ga0496125_0075479 3300048928 Bacteria 2608
1999 Ga0496125_0083732 3300048928 Bacteria 2425
2000 Ga0496125_0101613 3300048928 Bacteria 2115
2001 Ga0496125_0272888 3300048928 Bacteria 1052
2002 Ga0496126_0007773 3300048929 Bacteria 11685
2003 Ga0496126_0016969 3300048929 Bacteria 7264
2004 Ga0496126_0021091 3300048929 Bacteria 6372
2005 Ga0496126_0029480 3300048929 Bacteria 5213
2006 Ga0496126_0036823 3300048929 Bacteria 4572
2007 Ga0496126_0053954 3300048929 Bacteria 3644
2008 Ga0496126_0081237 3300048929 Bacteria 2866
2009 Ga0496126_0133797 3300048929 Bacteria 2140
2010 Ga0496126_0135289 3300048929 Bacteria 2126
2011 Ga0496126_0173860 3300048929 Bacteria 1833
2012 Ga0496126_0257893 3300048929 Bacteria 1451
2013 Ga0496126_0412030 3300048929 Bacteria 1094
2014 Ga0495678_000241 3300049459 Bacteria 61623
2015 Ga0495678_003780 3300049459 Bacteria 9136
2016 Ga0495682_0000675 3300049460 Bacteria 22495
2017 Ga0495682_0007891 3300049460 Bacteria 4209
2018 Ga0495682_0018652 3300049460 Bacteria 2613
2019 Ga0495682_0021435 3300049460 Bacteria 2421
2020 Ga0495682_0076044 3300049460 Bacteria 1208
2021 Ga0501291_012982 3300049514 Bacteria 1226
2022 Ga0501298_018222 3300049521 Bacteria 1289
2023 Ga0501298_026608 3300049521 Bacteria 1114
2024 Ga0501298_058088 3300049521 Bacteria 814
2025 Ga0501031_0008748 3300049568 Bacteria 6584
2026 Ga0501031_0133063 3300049568 Bacteria 1624
2027 Ga0501031_0240445 3300049568 Bacteria 1177
2028 Ga0501032_0000017 3300049569 Bacteria 158303
2029 Ga0501032_0027373 3300049569 Bacteria 3917
2030 Ga0501032_0073017 3300049569 Bacteria 2286
2031 Ga0501033_0000029 3300049570 Bacteria 158294
2032 Ga0501033_0002889 3300049570 Bacteria 14376
2033 Ga0501033_0018642 3300049570 Bacteria 5245
2034 Ga0501033_0038550 3300049570 Bacteria 3572
2035 Ga0501033_0093760 3300049570 Bacteria 2196
2036 Ga0501034_0000102 3300049571 Bacteria 158302
2037 Ga0501034_0000364 3300049571 Bacteria 77230
2038 Ga0501034_0004358 3300049571 Bacteria 15776
2039 Ga0501034_0021404 3300049571 Bacteria 6591
2040 Ga0501034_0341971 3300049571 Bacteria 1426
2041 Ga0501034_0362495 3300049571 Bacteria 1376
2042 Ga0501034_0407256 3300049571 Bacteria 1282
2043 Ga0501034_0435830 3300049571 Bacteria 1230
2044 Ga0501036_0000011 3300049572 Bacteria 158302
2045 Ga0501036_0001177 3300049572 Bacteria 19900
2046 Ga0501036_0070613 3300049572 Bacteria 2953
2047 Ga0501036_0189033 3300049572 Bacteria 1733
2048 Ga0501036_0294005 3300049572 Bacteria 1359
2049 Ga0501036_0321115 3300049572 Bacteria 1294
2050 Ga0501036_0363197 3300049572 Bacteria 1209
2051 Ga0501036_0393523 3300049572 Bacteria 1156
2052 Ga0501037_0000015 3300049573 Bacteria 161311
2053 Ga0501037_0068814 3300049573 Bacteria 2578
2054 Ga0501037_0080883 3300049573 Bacteria 2356
2055 Ga0501037_0235433 3300049573 Bacteria 1285
2056 Ga0501038_0000016 3300049574 Bacteria 159150
2057 Ga0501038_0032182 3300049574 Bacteria 4629
2058 Ga0501038_0345160 3300049574 Bacteria 1160
2059 Ga0501038_0579442 3300049574 Bacteria 851
2060 Ga0501039_0000023 3300049575 Bacteria 158026
2061 Ga0501039_0016154 3300049575 Bacteria 5719
2062 Ga0501039_0023535 3300049575 Bacteria 4727
2063 Ga0501039_0130627 3300049575 Bacteria 1971
2064 Ga0501039_0563473 3300049575 Bacteria 894
2065 Ga0501039_0667607 3300049575 Bacteria 813
2066 Ga0501040_0002138 3300049576 Bacteria 12752
2067 Ga0501040_0026194 3300049576 Bacteria 3922
2068 Ga0501040_0027827 3300049576 Bacteria 3808
2069 Ga0501040_0327789 3300049576 Bacteria 1095
2070 Ga0501040_0693838 3300049576 Bacteria 736
2071 Ga0501041_0000193 3300049577 Bacteria 27897
2072 Ga0501041_0024077 3300049577 Bacteria 3653
2073 Ga0501041_0072591 3300049577 Bacteria 2114
2074 Ga0501041_0077125 3300049577 Bacteria 2050
2075 Ga0501041_0098276 3300049577 Bacteria 1810
2076 Ga0501042_0004565 3300049578 Bacteria 8835
2077 Ga0501042_0090866 3300049578 Bacteria 2191
2078 Ga0501042_0136282 3300049578 Bacteria 1770
2079 Ga0501043_0001694 3300049579 Bacteria 19128
2080 Ga0501043_0017400 3300049579 Bacteria 5635
2081 Ga0501043_0088181 3300049579 Bacteria 2438
2082 Ga0501046_0036927 3300049580 Bacteria 3928
2083 Ga0501046_0062516 3300049580 Bacteria 2909
2084 Ga0501046_0236852 3300049580 Bacteria 1347
2085 Ga0501046_0431171 3300049580 Bacteria 949
2086 Ga0501047_0002883 3300049581 Bacteria 16309
2087 Ga0501047_0004523 3300049581 Bacteria 13074
2088 Ga0501047_0010121 3300049581 Bacteria 8915
2089 Ga0501047_0047731 3300049581 Bacteria 4136
2090 Ga0501047_0084472 3300049581 Bacteria 3051
2091 Ga0501047_0220757 3300049581 Bacteria 1752
2092 Ga0501047_0254770 3300049581 Bacteria 1603
2093 Ga0501048_0098248 3300049582 Bacteria 2066
2094 Ga0501048_0199254 3300049582 Bacteria 1419
2095 Ga0501067_0003557 3300049583 Bacteria 8576
2096 Ga0501068_0029366 3300049584 Bacteria 3255
2097 Ga0501068_0040430 3300049584 Bacteria 2800
2098 Ga0501068_0043517 3300049584 Bacteria 2702
2099 Ga0501068_0157162 3300049584 Bacteria 1432
2100 Ga0501068_0191929 3300049584 Bacteria 1294
2101 Ga0501069_0067446 3300049585 Bacteria 2001
2102 Ga0501069_0321767 3300049585 Bacteria 909
2103 Ga0501070_0000831 3300049586 Bacteria 28088
2104 Ga0501070_0214440 3300049586 Bacteria 1579
2105 Ga0501070_0245868 3300049586 Bacteria 1464
2106 Ga0501071_0013067 3300049587 Bacteria 5651
2107 Ga0501071_0112715 3300049587 Bacteria 2011
2108 Ga0501071_0457811 3300049587 Bacteria 977
2109 Ga0501072_0019551 3300049588 Bacteria 5237
2110 Ga0501072_0029256 3300049588 Bacteria 4302
2111 Ga0501072_0042997 3300049588 Bacteria 3551
2112 Ga0501072_0054043 3300049588 Bacteria 3164
2113 Ga0501072_0532452 3300049588 Bacteria 928
2114 Ga0501073_0003485 3300049589 Bacteria 11818
2115 Ga0501073_0212076 3300049589 Bacteria 1338
2116 Ga0501073_0344306 3300049589 Bacteria 1029
2117 Ga0501073_0433509 3300049589 Bacteria 908
2118 Ga0501074_0036921 3300049590 Bacteria 3540
2119 Ga0501074_0053439 3300049590 Bacteria 2914
2120 Ga0501074_0207685 3300049590 Bacteria 1395
2121 Ga0501074_0281342 3300049590 Bacteria 1183
2122 Ga0501075_0000888 3300049591 Bacteria 18899
2123 Ga0501075_0003954 3300049591 Bacteria 9988
2124 Ga0501075_0007178 3300049591 Bacteria 7718
2125 Ga0501075_0011908 3300049591 Bacteria 6170
2126 Ga0501075_0372108 3300049591 Bacteria 1089
2127 Ga0501076_0003340 3300049592 Bacteria 11258
2128 Ga0501076_0004337 3300049592 Bacteria 10066
2129 Ga0501076_0010586 3300049592 Bacteria 6848
2130 Ga0501076_0013603 3300049592 Bacteria 6104
2131 Ga0501076_0033611 3300049592 Bacteria 4004
2132 Ga0501076_0066200 3300049592 Bacteria 2883
2133 Ga0501076_0139395 3300049592 Bacteria 1970
2134 Ga0501076_0188527 3300049592 Bacteria 1683
2135 Ga0501076_0965950 3300049592 Bacteria 702
2136 Ga0501077_0002416 3300049593 Bacteria 11212
2137 Ga0501077_0019630 3300049593 Bacteria 4275
2138 Ga0501077_0021769 3300049593 Bacteria 4059
2139 Ga0501077_0042340 3300049593 Bacteria 2896
2140 Ga0501077_0177679 3300049593 Bacteria 1353
2141 Ga0501222_004481 3300049662 Bacteria 1898
2142 Ga0501227_001267 3300049665 Bacteria 5659
2143 Ga0501227_009588 3300049665 Bacteria 2089
2144 Ga0501249_015779 3300049679 Bacteria 1618
2145 Ga0501249_038294 3300049679 Unclassified 1083
2146 Ga0501221_016924 3300049704 Bacteria 1386
2147 Ga0501079_0000582 3300049741 Bacteria 24208
2148 Ga0501079_0004666 3300049741 Bacteria 10151
2149 Ga0501079_0008816 3300049741 Bacteria 7640
2150 Ga0501079_0181739 3300049741 Bacteria 1641
2151 Ga0501079_0226343 3300049741 Bacteria 1461
2152 Ga0501079_0237396 3300049741 Bacteria 1424
2153 Ga0501079_0283333 3300049741 Bacteria 1296
2154 Ga0501080_0003730 3300049742 Bacteria 13445
2155 Ga0501080_0011958 3300049742 Bacteria 7949
2156 Ga0501080_0013237 3300049742 Bacteria 7580
2157 Ga0501080_0021885 3300049742 Bacteria 5921
2158 Ga0501080_0032138 3300049742 Bacteria 4893
2159 Ga0501080_0093877 3300049742 Bacteria 2786
2160 Ga0501080_0317392 3300049742 Bacteria 1411
2161 Ga0501080_0586869 3300049742 Bacteria 990
2162 Ga0501081_0000369 3300049743 Bacteria 24571
2163 Ga0501081_0002042 3300049743 Bacteria 12582
2164 Ga0501081_0007011 3300049743 Bacteria 7329
2165 Ga0501083_0001666 3300049744 Bacteria 15165
2166 Ga0501083_0029357 3300049744 Bacteria 3783
2167 Ga0501083_0068530 3300049744 Bacteria 2361
2168 Ga0501241_015477 3300049758 Bacteria 1388
2169 Ga0501269_000671 3300049766 Bacteria 5794
2170 Ga0501283_011716 3300049779 Bacteria 1308
2171 Ga0501283_015171 3300049779 Bacteria 1184
2172 Ga0501035_0000038 3300049822 Bacteria 158818
2173 Ga0501035_0018125 3300049822 Bacteria 6487
2174 Ga0501035_0023460 3300049822 Bacteria 5659
2175 Ga0501035_0153478 3300049822 Bacteria 1997
2176 Ga0501035_0160127 3300049822 Bacteria 1949
2177 Ga0501035_0179758 3300049822 Bacteria 1823
2178 Ga0501035_0194833 3300049822 Bacteria 1741
2179 Ga0501035_0605562 3300049822 Bacteria 892
2180 Ga0501044_0000850 3300049823 Bacteria 36685
2181 Ga0501044_0003435 3300049823 Bacteria 17851
2182 Ga0501044_0004489 3300049823 Bacteria 15605
2183 Ga0501044_0008000 3300049823 Bacteria 11617
2184 Ga0501044_0223494 3300049823 Bacteria 1833
2185 Ga0501045_0000091 3300049824 Bacteria 43375
2186 Ga0501045_0016917 3300049824 Bacteria 5179
2187 Ga0501045_0019665 3300049824 Bacteria 4818
2188 Ga0501045_0023900 3300049824 Bacteria 4387
2189 Ga0501045_0591800 3300049824 Bacteria 822
2190 nmdc:mga03683_27233_c1 3300050489 Bacteria 2261
2191 nmdc:mga03683_85154_c1 3300050489 Bacteria 1370
2192 nmdc:mga03n38_117581_c1 3300050490 Bacteria 1302
2193 nmdc:mga03n38_123061_c1 3300050490 Bacteria 1277
2194 nmdc:mga03n38_168774_c1 3300050490 Bacteria 1113
2195 nmdc:mga00v17_128410_c1 3300050491 Bacteria 1619
2196 nmdc:mga00v17_244838_c1 3300050491 Bacteria 1163
2197 nmdc:mga00v17_298933_c1 3300050491 Bacteria 1045
2198 nmdc:mga00v17_70112_c1 3300050491 Bacteria 2170
2199 nmdc:mga00v17_704929_c1 3300050491 Bacteria 647
2200 nmdc:mga0yw44_14514_c1 3300050492 Bacteria 4187
2201 nmdc:mga0yw44_298167_c1 3300050492 Bacteria 1080
2202 nmdc:mga0yw44_45730_c1 3300050492 Bacteria 2626
2203 nmdc:mga0yw44_68185_c1 3300050492 Bacteria 2200
2204 nmdc:mga0yw44_76443_c1 3300050492 Bacteria 2090
2205 nmdc:mga0k408_26665_c1 3300050493 Bacteria 3278
2206 nmdc:mga0k408_90556_c1 3300050493 Bacteria 1796
2207 nmdc:mga0k408_94375_c1 3300050493 Bacteria 1760
2208 nmdc:mga06z11_10443_c1 3300050494 Bacteria 3960
2209 nmdc:mga04h51_94543_c1 3300050495 Bacteria 1081
2210 nmdc:mga07m45_223816_c1 3300050496 Bacteria 1095
2211 nmdc:mga05p37_108903_c1 3300050507 Bacteria 3408
2212 nmdc:mga05p37_1105_c1 3300050507 Bacteria 30994
2213 nmdc:mga05p37_1115788_c1 3300050507 Bacteria 824
2214 nmdc:mga05p37_154762_c1 3300050507 Bacteria 2802
2215 nmdc:mga05p37_16768_c1 3300050507 Bacteria 8830
2216 nmdc:mga05p37_375381_c1 3300050507 Bacteria 1668
2217 nmdc:mga05p37_382900_c1 3300050507 Bacteria 1648
2218 nmdc:mga05p37_82199_c1 3300050507 Bacteria 3969
2219 nmdc:mga05p37_946_c1 3300050507 Bacteria 32751
2220 nmdc:mga09592_138609_c1 3300050508 Bacteria 2096
2221 nmdc:mga09592_14281_c1 3300050508 Bacteria 6482
2222 nmdc:mga09592_148_c1 3300050508 Bacteria 47706
2223 nmdc:mga09592_223_c1 3300050508 Bacteria 40841
2224 nmdc:mga09592_37143_c1 3300050508 Bacteria 4084
2225 nmdc:mga09592_47913_c1 3300050508 Bacteria 3602
2226 nmdc:mga09592_95302_c1 3300050508 Bacteria 2546
2227 nmdc:mga0qj67_13203_c1 3300050509 Bacteria 6234
2228 nmdc:mga0qj67_287556_c1 3300050509 Bacteria 1332
2229 nmdc:mga0qj67_368224_c1 3300050509 Bacteria 1161
2230 nmdc:mga0qj67_6761_c1 3300050509 Bacteria 8431
2231 nmdc:mga0qj67_81159_c1 3300050509 Bacteria 2600
2232 nmdc:mga06r32_2367_c1 3300050510 Bacteria 16888
2233 nmdc:mga06r32_24322_c1 3300050510 Bacteria 5620
2234 nmdc:mga06r32_371314_c1 3300050510 Bacteria 1414
2235 nmdc:mga06r32_385365_c1 3300050510 Bacteria 1384
2236 nmdc:mga06r32_595429_c1 3300050510 Bacteria 1077
2237 nmdc:mga08y16_11195_c1 3300050511 Bacteria 9423
2238 nmdc:mga08y16_141849_c1 3300050511 Bacteria 2498
2239 nmdc:mga08y16_15627_c1 3300050511 Bacteria 7984
2240 nmdc:mga08y16_160778_c1 3300050511 Bacteria 2334
2241 nmdc:mga08y16_181845_c1 3300050511 Bacteria 2183
2242 nmdc:mga08y16_2868_c1 3300050511 Bacteria 17735
2243 nmdc:mga08y16_310150_c1 3300050511 Bacteria 1625
2244 nmdc:mga08y16_36399_c1 3300050511 Bacteria 4124
2245 nmdc:mga08y16_384315_c1 3300050511 Bacteria 1439
2246 nmdc:mga08y16_5540_c1 3300050511 Bacteria 13217
2247 nmdc:mga08y16_72310_c1 3300050511 Bacteria 3594
2248 nmdc:mga0n895_141779_c1 3300050512 Bacteria 2432
2249 nmdc:mga0n895_222600_c1 3300050512 Bacteria 1916
2250 nmdc:mga0n895_2429_c1 3300050512 Bacteria 14534
2251 nmdc:mga0n895_344403_c1 3300050512 Bacteria 1510
2252 nmdc:mga0n895_363643_c1 3300050512 Bacteria 1465
2253 nmdc:mga0n895_393347_c1 3300050512 Bacteria 1402
2254 nmdc:mga0n895_461356_c1 3300050512 Bacteria 1282
2255 nmdc:mga0n895_4960_c1 3300050512 Bacteria 11040
2256 nmdc:mga0n895_799508_c1 3300050512 Bacteria 934
2257 nmdc:mga0n895_8012_c1 3300050512 Bacteria 9115
2258 nmdc:mga0n895_87597_c1 3300050512 Bacteria 3112
2259 nmdc:mga0rr50_17877_c1 3300050513 Bacteria 4748
2260 nmdc:mga0rr50_179011_c1 3300050513 Bacteria 1732
2261 nmdc:mga0rr50_2208_c1 3300050513 Bacteria 10922
2262 nmdc:mga0rr50_291077_c1 3300050513 Bacteria 1365
2263 nmdc:mga0rr50_330413_c1 3300050513 Bacteria 1280
2264 nmdc:mga0rr50_616202_c1 3300050513 Bacteria 926
2265 nmdc:mga0rr50_636136_c1 3300050513 Bacteria 910
2266 nmdc:mga0rr50_914_c1 3300050513 Bacteria 15979
2267 nmdc:mga08x19_171797_c1 3300050514 Bacteria 1476
2268 nmdc:mga08x19_19887_c1 3300050514 Bacteria 4127
2269 nmdc:mga08x19_219137_c1 3300050514 Bacteria 1307
2270 nmdc:mga08x19_258238_c1 3300050514 Bacteria 1204
2271 nmdc:mga08x19_29107_c1 3300050514 Bacteria 3463
2272 nmdc:mga08x19_388064_c1 3300050514 Bacteria 978
2273 nmdc:mga08x19_41196_c1 3300050514 Bacteria 2941
2274 nmdc:mga08x19_724_c1 3300050514 Bacteria 21036
2275 nmdc:mga08x19_8960_c1 3300050514 Bacteria 5971
2276 nmdc:mga0a205_119665_c1 3300050515 Bacteria 2533
2277 nmdc:mga0a205_148545_c1 3300050515 Bacteria 2244
2278 nmdc:mga0a205_187_c1 3300050515 Bacteria 42758
2279 nmdc:mga0a205_244041_c1 3300050515 Bacteria 1677
2280 nmdc:mga0a205_314855_c1 3300050515 Bacteria 1437
2281 nmdc:mga0a205_371_c1 3300050515 Bacteria 33954
2282 nmdc:mga0a205_399017_c1 3300050515 Bacteria 1239
2283 nmdc:mga0a205_510668_c1 3300050515 Bacteria 1058
2284 nmdc:mga0a205_623288_c1 3300050515 Bacteria 931
2285 nmdc:mga0a205_62609_c1 3300050515 Bacteria 3594
2286 nmdc:mga0sz30_37313_c1 3300050516 Bacteria 2034
2287 nmdc:mga0sz30_78981_c1 3300050516 Bacteria 1422
2288 Ga0495601_0060495 3300053077 Bacteria 2403
2289 Ga0495601_0198513 3300053077 Bacteria 1311
2290 Ga0500610_0068549 3300053079 Bacteria 1850
2291 Ga0500635_0000979 3300053080 Bacteria 6867
2292 Ga0500635_0007194 3300053080 Bacteria 3011
2293 Ga0500635_0121307 3300053080 Bacteria 979
2294 Ga0495655_0002112 3300053083 Bacteria 3121
2295 Ga0495655_0008570 3300053083 Bacteria 1948
2296 Ga0495595_0045651 3300053084 Bacteria 2016
2297 Ga0495619_0018931 3300053085 Bacteria 4373
2298 Ga0500643_000052 3300053087 Bacteria 144656
2299 Ga0500647_0123876 3300053091 Bacteria 1222
2300 Ga0500583_0178299 3300053092 Bacteria 1058
2301 Ga0500566_0000181 3300053094 Bacteria 32381
2302 Ga0500566_0057395 3300053094 Bacteria 2211
2303 Ga0500566_0067942 3300053094 Bacteria 2005
2304 Ga0500640_006447 3300053095 Bacteria 4482
2305 Ga0500641_0030645 3300053096 Bacteria 2115
2306 Ga0500641_0033383 3300053096 Bacteria 2042
2307 Ga0500555_044960 3300053103 Bacteria 1221
2308 Ga0500557_000046 3300053105 Bacteria 59508
2309 Ga0500572_000837 3300053111 Bacteria 9643
2310 Ga0500572_001605 3300053111 Bacteria 5970
2311 Ga0500591_014440 3300053115 Bacteria 3796
2312 Ga0500595_014551 3300053119 Bacteria 2982
2313 Ga0500595_017928 3300053119 Bacteria 2600
2314 Ga0500595_022350 3300053119 Bacteria 2242
2315 Ga0500608_015000 3300053122 Bacteria 3471
2316 Ga0500614_005405 3300053123 Bacteria 2680
2317 Ga0500618_001833 3300053125 Bacteria 8885
2318 Ga0500642_0000038 3300053130 Bacteria 98299
2319 Ga0500642_0010337 3300053130 Bacteria 3286
2320 Ga0500642_0073992 3300053130 Bacteria 1554
2321 Ga0500559_0000695 3300053136 Bacteria 22137
2322 Ga0500559_0000713 3300053136 Bacteria 21844
2323 Ga0500559_0030345 3300053136 Bacteria 2317
2324 Ga0500564_068772 3300053138 Bacteria 1599
2325 Ga0500568_0037435 3300053139 Bacteria 1968
2326 Ga0500573_0002705 3300053140 Bacteria 8953
2327 Ga0500573_0018205 3300053140 Bacteria 4004
2328 Ga0500573_0024618 3300053140 Bacteria 3460
2329 Ga0500589_078260 3300053147 Bacteria 1481
2330 Ga0500590_031550 3300053148 Bacteria 2748
2331 Ga0500590_033219 3300053148 Bacteria 2674
2332 Ga0500603_002928 3300053150 Bacteria 3695
2333 Ga0500603_011859 3300053150 Bacteria 1992
2334 Ga0500603_042704 3300053150 Bacteria 1215
2335 Ga0500620_135237 3300053155 Bacteria 862
2336 Ga0500622_0008750 3300053156 Bacteria 5639
2337 Ga0500624_042000 3300053157 Bacteria 825
2338 Ga0500630_005801 3300053159 Bacteria 6036
2339 Ga0500634_0007991 3300053161 Bacteria 5259
2340 Ga0500639_000035 3300053163 Bacteria 66883
2341 Ga0500639_003323 3300053163 Bacteria 8118
2342 Ga0500639_106247 3300053163 Bacteria 1373
2343 Ga0500636_0004059 3300053177 Bacteria 8265
2344 Ga0500636_0218200 3300053177 Bacteria 996
2345 Ga0500637_0114339 3300053178 Bacteria 1565
2346 Ga0500637_0211359 3300053178 Bacteria 1100
2347 Ga0500576_070163 3300053725 Bacteria 1508
2348 Ga0500576_109747 3300053725 Bacteria 1108
2349 Ga0500609_003220 3300053731 Bacteria 2308
2350 Ga0500552_001241 3300053733 Bacteria 2420
2351 Ga0500596_000368 3300053735 Bacteria 8162
2352 Ga0500596_001567 3300053735 Bacteria 4640
2353 Ga0500599_001055 3300053736 Bacteria 3112
2354 Ga0500601_002196 3300053737 Bacteria 2096
2355 Ga0501084_0002360 3300054114 Bacteria 15185
2356 Ga0501084_0093182 3300054114 Bacteria 2529
2357 Ga0501084_0123528 3300054114 Bacteria 2177
2358 Ga0587077_000034 3300059493 Bacteria 6115
2359 Ga0587077_000440 3300059493 Bacteria 3528
2360 Ga0501082_0002452 3300060353 Bacteria 16281
2361 Ga0501082_0010757 3300060353 Bacteria 7877
2362 Ga0501082_0015587 3300060353 Bacteria 6542
2363 Ga0501082_0019165 3300060353 Bacteria 5895
2364 Ga0501082_0043148 3300060353 Bacteria 3888
2365 Ga0501082_0043247 3300060353 Bacteria 3884
2366 Ga0501082_0047946 3300060353 Bacteria 3682
2367 Ga0501082_0144607 3300060353 Bacteria 2064
2368 Ga0466962_0020654 3300061719 Bacteria 3164
2369 Ga0466962_0182994 3300061719 Bacteria 1022
2370 Ga0466962_0220412 3300061719 Bacteria 929
2371 Ga0466962_0291041 3300061719 Bacteria 807
2372 Ga0530510_0000042 3300061734 Bacteria 58436
2373 Ga0530510_0000505 3300061734 Bacteria 24760
2374 Ga0530510_0000628 3300061734 Bacteria 22761
2375 Ga0530510_0257708 3300061734 Bacteria 1300
2376 Ga0530510_0269324 3300061734 Bacteria 1271
2377 2507512056 2507262055 Bacteria 8048963
2378 2508545717 2508501009 Bacteria 7784016
2379 2508694540 2508501042 Bacteria 8719808
2380 2509151269 2508501128 Bacteria 8613869
2381 2511249780 2511231003 Bacteria 5606035
2382 2511401145 2511231028 Bacteria 8046582
2383 2513624547 2513237092 Bacteria 8341956
2384 2513638592 2513237094 Bacteria 8789602
2385 2513650025 2513237095 Bacteria 8976980
2386 2513678480 2513237098 Bacteria 9902361
2387 2513704172 2513237102 Bacteria 7703324
2388 2513720176 2513237104 Bacteria 10034502
2389 2513874310 2513237139 Bacteria 8737671
2390 2513892334 2513237141 Bacteria 8496279
2391 2514014793 2513237161 Bacteria 8871253
2392 2514016802 2513237161 Bacteria 8871253
2393 2515624530 2515154112 Bacteria 8294334
2394 2517104541 2517093001 Bacteria 9002274
2395 2524438500 2524023205 Bacteria 8918781
2396 2524466286 2524023210 Bacteria 9029266
2397 2524534970 2524023228 Bacteria 10118060
2398 2528850203 2528768022 Bacteria 10457665
2399 2596374091 2595698237 Bacteria 6712432
2400 2599902959 2599185292 Bacteria 6290804
2401 2601666792 2600255292 Bacteria 6300551
2402 2617353159 2617270735 Bacteria 9163226
2403 2617374516 2617270741 Bacteria 8201522
2404 2643790205 2643221554 Bacteria 6603920
2405 2643861782 2643221569 Bacteria 6064337
2406 2643983183 2643221594 Bacteria 5811388
2407 2644028046 2643221603 Bacteria 6147767
2408 2644123444 2643221621 Bacteria 6212786
2409 2644131911 2643221623 Bacteria 5239945
2410 2644215199 2643221638 Bacteria 6579467
2411 2644249142 2643221645 Bacteria 7207331
2412 2644355927 2643221664 Bacteria 7272945
2413 2644401261 2643221672 Bacteria 6322190
2414 2692315000 2690316117 Bacteria 6800650
2415 2738740577 2738541280 Bacteria 6630198
2416 2738844897 2738541300 Bacteria 6675882
2417 2739277312 2738543018 Bacteria 6718814
2418 2739346355 2738543030 Bacteria 6719714
2419 2745077279 2744054633 Bacteria 8678936
2420 2793059448 2791355196 Bacteria 7323613
2421 2805916076 2802429603 Bacteria 8777136
2422 2809033292 2808606395 Bacteria 6020352
2423 2818242988 2816332527 Bacteria 8933356
2424 2823425252 2823421272 Bacteria 5372474
2425 2824604468 2824600985 Bacteria 8488197
2426 2824614991 2824609381 Bacteria 8672835
2427 2824624297 2824617872 Bacteria 8814715
2428 2824633070 2824626560 Bacteria 8813858
2429 2824640660 2824635225 Bacteria 8785348
2430 2824650121 2824644064 Bacteria 8743947
2431 2824657486 2824653114 Bacteria 8493680
2432 2824665169 2824661429 Bacteria 9877870
2433 2824674021 2824671348 Bacteria 8369588
2434 2824680215 2824679649 Bacteria 8248951
2435 2824691236 2824687955 Bacteria 8360029
2436 2824700925 2824696289 Bacteria 8335049
2437 2824709732 2824704595 Bacteria 9667483
2438 2824720019 2824714736 Bacteria 8717648
2439 2824728147 2824723954 Bacteria 8758240
2440 2824736146 2824732956 Bacteria 7810675
2441 2824748022 2824746037 Bacteria 7911610
2442 2824759309 2824753945 Bacteria 9787441
2443 2824768573 2824763712 Bacteria 9792355
2444 2824778296 2824773399 Bacteria 8360218
2445 2829747098 2829745981 Bacteria 5406054
2446 2838128577 2838122688 Bacteria 8803140
2447 2838740239 2838736955 Bacteria 5760694
2448 2841843636 2841840854 Bacteria 5761912
2449 2841942433 2841941048 Bacteria 8688029
2450 2841952057 2841949485 Bacteria 8680857
2451 2841953221 2841949485 Bacteria 8680857
2452 2841960751 2841957949 Bacteria 8652217
2453 2841973890 2841966195 Bacteria 8673214
2454 2841982955 2841974524 Bacteria 8931498
2455 2841984450 2841983080 Bacteria 8395090
2456 2842041827 2842038055 Bacteria 8002051
2457 2842049869 2842045827 Bacteria 8006841
2458 2842143356 2842140634 Bacteria 5759631
2459 2842714074 2842711865 Bacteria 7155354
2460 2844321284 2844315083 Bacteria 8138177
2461 2847419942 2847417321 Bacteria 6913799
2462 2847932125 2847930680 Bacteria 9342022
2463 2847943356 2847939898 Bacteria 8606328
2464 2849077080 2849076700 Bacteria 7039503
2465 2855732706 2855730933 Bacteria 7047938
2466 2855771458 2855767633 Bacteria 7049357
2467 2855877012 2855872281 Bacteria 6964271
2468 2857514627 2857509624 Bacteria 7472071
2469 2857536723 2857531043 Bacteria 6754041
2470 2857538218 2857537821 Bacteria 5248181
2471 2857548558 2857547612 Bacteria 6179999
2472 2857562535 2857558681 Bacteria 6617694
2473 2857580831 2857576091 Bacteria 5465855
2474 2858952041 2858950400 Bacteria 6783797
2475 2861694355 2861691609 Bacteria 5628931
2476 2874595763 2874590934 Bacteria 8299676
2477 2874614963 2874612657 Bacteria 8252029
2478 2874624184 2874620515 Bacteria 8290088
2479 2874630362 2874628541 Bacteria 8630250
2480 2874651605 2874645413 Bacteria 8214782
2481 2876767610 2876761206 Bacteria 10111113
2482 2876775960 2876771140 Bacteria 8287509
2483 2876808693 2876808645 Bacteria 8824342
2484 2876821168 2876818435 Bacteria 8274608
2485 2879080049 2879074833 Bacteria 8279565
2486 2879083520 2879083081 Bacteria 8587928
2487 2879106475 2879099564 Bacteria 10442239
2488 2879111961 2879110137 Bacteria 8907982
2489 2879132723 2879127579 Bacteria 8294491
2490 2879146508 2879142872 Bacteria 8267021
2491 2881367558 2881364244 Bacteria 7710352
2492 2881416662 2881412998 Bacteria 6492157
2493 2881669271 2881665667 Bacteria 8175609
2494 2881929202 2881927736 Bacteria 3993927
2495 2885083244 2885080285 Bacteria 6355622
2496 2885374558 2885366525 Bacteria 8326213
2497 2885392401 2885383462 Bacteria 9473874
2498 2885417342 2885409591 Bacteria 9235467
2499 2887377444 2887375801 Bacteria 5334027
2500 2887378605 2887375801 Bacteria 5334027
2501 2888387582 2888378607 Bacteria 9652610
2502 2888391622 2888388044 Bacteria 7304136
2503 2888426802 2888419890 Bacteria 7857137
2504 2889311532 2889306138 Bacteria 6358934
2505 2895513628 2895511927 Bacteria 6802080
2506 2902334061 2902330777 Bacteria 6395352
2507 2902411843 2902405164 Bacteria 6784948
2508 2903731525 2903727486 Bacteria 8281579
2509 2903751785 2903748898 Bacteria 9972761
2510 2903775640 2903768456 Bacteria 9749579
2511 2904430684 2904424332 Bacteria 7633521
2512 2904670895 2904666416 Bacteria 8226587
2513 2904711030
2514 2904713490 2904711408 Bacteria 9771557
2515 2906607898 2906602504 Bacteria 8295279
2516 2906633119 2906626472 Bacteria 8826946
2517 2906645695 2906643746 Bacteria 8722424
2518 2908740208 2908739725 Bacteria 8628932
2519 2908776995 2908775508 Bacteria 8092255
2520 2919481328 2919476304 Bacteria 5888696
2521 2922376559
2522 2922393389 2922393267 Bacteria 8285685
2523 2928130095 2928125067 Bacteria 5937560
2524 2929619940 2929615660 Bacteria 9193770
2525 2929629252 2929624759 Bacteria 9339455
2526 2932413153 2932410948 Bacteria 6312192
2527 2932420668 2932416698 Bacteria 6315112
2528 2932789622 2932784394 Bacteria 9704911
2529 2932796703 2932794094 Bacteria 7915132
2530 2932802515 2932801729 Bacteria 7987968
2531 2932814872 2932809354 Bacteria 9135765
2532 2932824271 2932818245 Bacteria 9955613
2533 2932834001 2932828146 Bacteria 9745859
2534 2933581858 2933577622 Bacteria 9116884
2535 2935613301 2935608549 Bacteria 8203142
2536 2935623609 2935616580 Bacteria 9032984
2537 2935644996 2935638405 Bacteria 10015038
2538 2935653825 2935648319 Bacteria 8801166
2539 2935662574 2935656913 Bacteria 8965014
2540 2935672045 2935665750 Bacteria 9571747
2541 2935683029 2935675223 Bacteria 9928132
2542 2935689199 2935684952 Bacteria 9590419
2543 2935697543 2935694250 Bacteria 9291695
2544 2935711120 2935703347 Bacteria 10242284
2545 2935720145 2935713505 Bacteria 9608509
2546 2935728238 2935722832 Bacteria 9608746
2547 2935737165 2935732158 Bacteria 9706831
2548 2935746774 2935741537 Bacteria 9707219
2549 2935757741 2935750917 Bacteria 9590372
2550 2935764121 2935760218 Bacteria 9817913
2551 2935776404 2935769743 Bacteria 7878163
2552 2935784335 2935777560 Bacteria 8077691
2553 2935792371 2935785616 Bacteria 7962367
2554 2935800534 2935793552 Bacteria 8012592
2555 2935808709 2935801545 Bacteria 9301974
2556 2935817505 2935810662 Bacteria 9401221
2557 2935824845 2935819856 Bacteria 8261050
2558 2935834158 2935827899 Bacteria 10038562
2559 2935844760 2935837841 Bacteria 9454360
2560 2935852065 2935847175 Bacteria 8228321
2561 2935861784 2935855204 Bacteria 9035059
2562 2935868580 2935864058 Bacteria 9784707
2563 2935879354 2935873716 Bacteria 9632195
2564 2935887044 2935883170 Bacteria 7964738
2565 2935911412 2935908558 Bacteria 8568796
2566 2935920946 2935916978 Bacteria 9113783
2567 2935928441 2935926038 Bacteria 8601059
2568 2935938086 2935934488 Bacteria 8602579
2569 2935945368 2935942939 Bacteria 8599779
2570 2935954126 2935951376 Bacteria 8602333
2571 2935965937 2935959822 Bacteria 7869783
2572 2935971606 2935967501 Bacteria 8603075
2573 2935980009 2935975950 Bacteria 8347125
2574 2935989435 2935984226 Bacteria 8302647
2575 2935998478 2935992306 Bacteria 9802711
2576 2936009061 2936002035 Bacteria 9362176
2577 2936016778 2936011229 Bacteria 8801034
2578 2936025411 2936019824 Bacteria 8804134
2579 2936034351 2936028420 Bacteria 8965941
2580 2936044302 2936037263 Bacteria 9446081
2581 2936052408 2936046547 Bacteria 8903709
2582 2936060690 2936055302 Bacteria 8785755
2583 2939633758 2939631187 Bacteria 6118131
2584 2940563437 2940556831 Bacteria 9590747
2585 2941482456
2586 2941531864 2941531003 Bacteria 7653939
2587 2941545345 2941538514 Bacteria 9402094
2588 2954769234 2954767861 Bacteria 5535784
2589 3003667219 3003665799 Bacteria 7279786
2590 3005485852 3005483717 Bacteria 7877331
2591 3005506717 3005506211 Bacteria 6943378
2592 3005588843 3005587118 Bacteria 7794411
2593 3005601621 3005594810 Bacteria 8716512
2594 3005717356 3005710791 Bacteria 7622528
2595 3005724315 3005718088 Bacteria 8283608
2596 8006937526 8006933436 Bacteria 10410654
2597 8006977554 8006973647 Bacteria 10679141
2598 8016525060 8016522445 Bacteria 8156687
2599 8016538637 8016530956 Bacteria 8155261
2600 8016542926 8016539877 Bacteria 8155419
2601 8016550365 8016548790 Bacteria 8155074
2602 8016558775 8016557553 Bacteria 8154380
2603 8016580979 8016575299 Bacteria 8154085
2604 8016587766 8016583857 Bacteria 10421953
2605 8016596750 8016595262 Bacteria 8149947
2606 8016619429 8016613128 Bacteria 8794220
2607 8016630176 8016622563 Bacteria 7999408
2608 8016636988 8016630954 Bacteria 9217207
2609 8017066234 8017057580 Bacteria 10023680
2610 8019538307 8019530166 Bacteria 8155624
2611 8019541669 8019538911 Bacteria 7872763
2612 8019549115 8019547302 Bacteria 7996444
2613 8019596428 8019586578 Bacteria 10212056
2614 8019613275 8019608314 Bacteria 10042931
2615 8019623946 8019619141 Bacteria 9218857
2616 8019638090 8019629233 Bacteria 8687553
2617 8019641547 8019638758 Bacteria 9062356
2618 8019653460 8019648815 Bacteria 10014479
2619 8019666008 8019659431 Bacteria 8577854
2620 8019675526 8019668869 Bacteria 8791617
2621 8019680572 8019678201 Bacteria 8863603
2622 8019695185 8019687851 Bacteria 8712826
2623 8034963248 8034962539 Bacteria 4884839
2624 8055750308 8055742211 Bacteria 9226248
2625 8056694793 8056689827 Bacteria 6712655
2626 8056976083 8056967851 Bacteria 9038162
2627 Ga0070661_100134546
2628 ARcpr5oldR_c000111
2629 ARSoilYngRDRAFT_c00101
2630 ARcpr5yngRDRAFT_c000611
2631 ARSoilOldRDRAFT_c000075
2632 ARCol0oldRDRAFT_c00114
2633 ARCol0yngRDRAFT_1000068
2634 JGI24737J22298_10000767
2635 JGI24737J22298_10032280
2636 JGI24737J22298_10056117
2637 JGI24735J21928_10037256
2638 JGI24748J21848_1019612
2639 JGI24738J21930_10013662
2640 JGI24749J21850_1004621
2641 JGI24744J21845_10001437
2642 JGI24742J22300_10029641
2643 JGI25150J39212_1000836
2644 JGI25150J39212_1001760
2645 JGI25150J39212_1011011
2646 JGI25159J45721_1001676
2647 JGI25159J45721_1001744
2648 JGI25159J45721_1002624
2649 JGI25151J46595_10000852
2650 JGI25151J46595_10002292
2651 JGI25406J46586_10004826
2652 JGI25153J46596_10002780
2653 JGI25153J46596_10009794
2654 JGI25153J46596_10013885
2655 JGI25153J46596_10016150
2656 JGI25153J46596_10029762
2657 rootL2_10039033
2658 JGI26129J50193_1005612
2659 JGI25160J50197_1002292
2660 JGI25160J50197_1002807
2661 JGI25161J50226_1000359
2662 JGI25161J50226_1000568
2663 Ga0007417J51691_1009481
2664 Ga0007409J51694_1004381
2665 Ga0007416J51690_1005346
2666 Ga0032354_1019660
2667 Ga0055539_1001386
2668 Ga0055539_1002621
2669 Ga0055526_1000226
2670 Ga0055526_1001304
2671 Ga0055526_1001652
2672 Ga0055526_1036025
2673 Ga0055537_1000047
2674 Ga0055537_1000853
2675 Ga0055537_1008250
2676 Ga0055524_1000039
2677 Ga0055524_1000723
2678 Ga0055524_1003008
2679 Ga0055524_1003701
2680 Ga0055536_1000782
2681 Ga0055534_1000803
2682 Ga0055534_1002558
2683 Ga0055534_1008291
2684 Ga0055534_1014938
2685 Ga0055528_1001770
2686 Ga0055528_1003520
2687 Ga0055530_10000199
2688 Ga0055540_1000047
2689 Ga0055531_10000848
2690 Ga0055531_10005239
2691 Ga0055531_10009445
2692 Ga0055531_10011844
2693 Ga0055543_1000364
2694 Ga0055543_1009069
2695 Ga0065165_1001009
2696 Ga0065165_1001013
2697 Ga0065165_1001177
2698 Ga0065165_1001442
2699 Ga0065165_1047833
2700 Ga0065165_1067758
2701 Ga0065717_1002570
2702 Ga0065714_10006041
2703 Ga0065704_10071086
2704 Ga0065712_10005097
2705 Ga0065712_10012206
2706 Ga0065712_10071626
2707 Ga0065712_10091789
2708 Ga0065715_10001199
2709 Ga0065715_10029869
2710 Ga0065715_10093842
2711 Ga0070658_10001915
2712 Ga0070658_10043959
2713 Ga0070658_10071085
2714 Ga0070658_10118129
2715 Ga0070658_10141682
2716 Ga0070658_10205288
2717 Ga0070658_10341159
2718 Ga0070676_10094014
2719 Ga0070683_100003301
2720 Ga0070683_100003885
2721 Ga0070683_100042654
2722 Ga0070683_100075042
2723 Ga0070683_100260703
2724 Ga0070690_100000086
2725 Ga0070690_100001998
2726 Ga0070690_100043339
2727 Ga0070690_100158368
2728 Ga0070677_10016992
2729 Ga0070677_10062034
2730 Ga0068869_100000300
2731 Ga0068869_100224009
2732 Ga0070680_100010416
2733 Ga0070680_100012640
2734 Ga0070680_100044693
2735 Ga0070680_100061005
2736 Ga0070680_100106302
2737 Ga0070680_100117542
2738 Ga0070680_100173425
2739 Ga0070680_100200052
2740 Ga0070680_100379467
2741 Ga0070680_100508724
2742 Ga0070682_100007298
2743 Ga0070682_100063938
2744 Ga0070682_100265716
2745 Ga0070682_100273559
2746 Ga0070682_100441020
2747 Ga0068868_100000831
2748 Ga0068868_100245679
2749 Ga0068868_100292927
2750 Ga0068868_100299079
2751 Ga0070660_100000725
2752 Ga0070660_100008433
2753 Ga0070660_100030625
2754 Ga0070660_100056354
2755 Ga0070660_100290950
2756 Ga0070660_100690451
2757 Ga0070689_100000317
2758 Ga0070689_100008267
2759 Ga0070689_100012680
2760 Ga0070689_100026934
2761 Ga0070689_100065941
2762 Ga0070689_100108163
2763 Ga0070689_100150827
2764 Ga0070689_100178314
2765 Ga0070689_100279900
2766 Ga0070689_100284772
2767 Ga0070689_100415860
2768 Ga0070691_10003301
2769 Ga0070691_10003760
2770 Ga0070691_10006901
2771 Ga0070691_10171800
2772 Ga0070687_100000162
2773 Ga0070687_100019697
2774 Ga0070687_100285554
2775 Ga0070661_100000513
2776 Ga0070661_100044154
2777 Ga0070661_100064854
2778 Ga0070661_100082398
2779 Ga0070661_100168800
2780 Ga0070661_100213592
2781 Ga0070661_100661378
2782 Ga0070692_10000148
2783 Ga0070692_10021925
2784 Ga0070692_10025736
2785 Ga0070692_10060570
2786 Ga0070692_10291701
2787 Ga0070668_100046393
2788 Ga0070668_100088534
2789 Ga0070668_100090375
2790 Ga0070668_100118852
2791 Ga0070668_100160384
2792 Ga0070669_100004782
2793 Ga0070669_100032699
2794 Ga0070669_100084667
2795 Ga0070669_100112834
2796 Ga0070669_100611310
2797 Ga0070675_100004556
2798 Ga0070675_100131909
2799 Ga0070671_100075465
2800 Ga0070674_100409822
2801 Ga0070673_100014834
2802 Ga0070673_100133428
2803 Ga0070673_100186597
2804 Ga0070673_100340526
2805 Ga0070688_100048358
2806 Ga0070688_100079294
2807 Ga0070688_100272744
2808 Ga0070659_100000556
2809 Ga0070659_100013556
2810 Ga0070659_100234260
2811 Ga0070667_100107757
2812 Ga0070667_100219888
2813 Ga0070667_100505908
2814 Ga0070709_10001276
2815 Ga0070709_10029928
2816 Ga0070709_10082232
2817 Ga0070709_10126482
2818 Ga0070709_10212896
2819 Ga0070714_100009911
2820 Ga0070714_100020365
2821 Ga0070714_100026401
2822 Ga0070714_100141772
2823 Ga0070714_100197285
2824 Ga0070714_100226343
2825 Ga0070714_100269770
2826 Ga0070714_100640629
2827 Ga0070713_100054342
2828 Ga0070713_100081605
2829 Ga0070713_100179954
2830 Ga0070713_100723861
2831 Ga0070710_10003504
2832 Ga0070710_10043430
2833 Ga0070710_10073005
2834 Ga0070701_10000329
2835 Ga0070701_10084534
2836 Ga0070711_100007004
2837 Ga0070711_100040488
2838 Ga0070711_100065032
2839 Ga0070711_100225132
2840 Ga0070711_100502511
2841 Ga0070705_100000115
2842 Ga0070705_100011569
2843 Ga0070705_100258237
2844 Ga0070705_100300114
2845 Ga0070700_100003157
2846 Ga0070700_100536203
2847 Ga0070694_100000066
2848 Ga0070694_100004270
2849 Ga0070694_100006882
2850 Ga0070694_100013605
2851 Ga0070694_100023963
2852 Ga0070694_100075829
2853 Ga0070694_100093928
2854 Ga0070694_100119856
2855 Ga0070694_100163235
2856 Ga0070708_100023747
2857 Ga0070708_100061584
2858 Ga0070663_100008086
2859 Ga0070663_100010452
2860 Ga0070663_100031014
2861 Ga0070663_100178978
2862 Ga0070663_100289186
2863 Ga0070663_100352736
2864 Ga0070678_100014091
2865 Ga0070678_100031016
2866 Ga0070678_100081975
2867 Ga0070678_100319901
2868 Ga0070662_100133356
2869 Ga0070662_100363367
2870 Ga0070681_10000695
2871 Ga0070681_10021502
2872 Ga0070681_10027436
2873 Ga0070681_10027607
2874 Ga0070681_10042120
2875 Ga0070681_10052696
2876 Ga0070681_10058438
2877 Ga0070681_10061799
2878 Ga0070681_10073846
2879 Ga0070681_10129893
2880 Ga0070681_10193229
2881 Ga0070681_10447608
2882 Ga0070681_10565649
2883 Ga0070681_10765923
2884 Ga0068867_100000422
2885 Ga0068867_100002316
2886 Ga0068867_100061339
2887 Ga0068867_100294408
2888 Ga0070685_10003631
2889 Ga0070685_10069531
2890 Ga0070706_100021177
2891 Ga0070706_100105723
2892 Ga0070706_100122183
2893 Ga0070706_100206239
2894 Ga0070706_100290469
2895 Ga0070707_100035350
2896 Ga0070707_100170353
2897 Ga0070707_100348268
2898 Ga0070698_100000691
2899 Ga0070698_100030131
2900 Ga0070699_100004971
2901 Ga0070699_100034058
2902 Ga0070699_100222577
2903 Ga0070679_100024275
2904 Ga0070679_100034919
2905 Ga0070679_100051430
2906 Ga0070679_100097970
2907 Ga0070679_100098605
2908 Ga0070679_100133245
2909 Ga0070679_100168402
2910 Ga0070679_100173036
2911 Ga0070684_100011858
2912 Ga0070684_100041455
2913 Ga0070684_100046721
2914 Ga0070684_100067953
2915 Ga0070684_100111150
2916 Ga0070684_100176999
2917 Ga0070684_100368818
2918 Ga0070684_100481536
2919 Ga0070697_100005365
2920 Ga0070697_100009161
2921 Ga0070697_100065353
2922 Ga0070697_100251393
2923 Ga0068853_100003342
2924 Ga0068853_100050623
2925 Ga0068853_100078084
2926 Ga0068853_100081524
2927 Ga0068853_100093245
2928 Ga0068853_100396148
2929 Ga0070672_100084825
2930 Ga0070672_100164154
2931 Ga0070672_100386529
2932 Ga0070686_100000167
2933 Ga0070686_100008844
2934 Ga0070686_100023571
2935 Ga0070686_100058628
2936 Ga0070686_100097420
2937 Ga0070686_100172047
2938 Ga0070686_100241673
2939 Ga0070695_100000164
2940 Ga0070695_100000823
2941 Ga0070695_100004471
2942 Ga0070695_100010346
2943 Ga0070695_100113078
2944 Ga0070695_100675337
2945 Ga0070696_100000643
2946 Ga0070696_100003306
2947 Ga0070696_100009228
2948 Ga0070696_100010931
2949 Ga0070696_100037721
2950 Ga0070696_100038320
2951 Ga0070696_100165957
2952 Ga0070696_100407704
2953 Ga0070696_100407822
2954 Ga0070696_100559198
2955 Ga0070696_100638867
2956 Ga0070693_100000043
2957 Ga0070693_100001161
2958 Ga0070693_100022858
2959 Ga0070693_100150646
2960 Ga0070693_100224847
2961 Ga0070693_100259182
2962 Ga0070665_100005999
2963 Ga0070665_100478872
2964 Ga0070704_100000027
2965 Ga0070704_100002925
2966 Ga0070704_100049552
2967 Ga0070704_100353231
2968 Ga0068855_100003366
2969 Ga0068855_100008136
2970 Ga0068855_100026664
2971 Ga0068855_100028603
2972 Ga0068855_100035870
2973 Ga0068855_100036468
2974 Ga0068855_100066234
2975 Ga0068855_100071740
2976 Ga0068855_100112677
2977 Ga0068855_100141618
2978 Ga0068855_100145565
2979 Ga0068855_100323380
2980 Ga0068855_100368303
2981 Ga0068855_100546196
2982 Ga0070664_100006869
2983 Ga0070664_100028499
2984 Ga0070664_100043278
2985 Ga0070664_100142334
2986 Ga0070664_100300713
2987 Ga0070664_100552850
2988 Ga0068857_100000897
2989 Ga0068857_100031603
2990 Ga0068857_100033556
2991 Ga0068857_100214394
2992 Ga0068857_100413262
2993 Ga0068854_100002468
2994 Ga0068854_100107549
2995 Ga0068854_100118440
2996 Ga0068854_100244266
2997 Ga0068854_100329945
2998 Ga0068854_100773814
2999 Ga0068856_100000712
3000 Ga0068856_100013738
3001 Ga0068856_100018043
3002 Ga0068856_100019954
3003 Ga0068856_100025710
3004 Ga0068856_100190280
3005 Ga0068856_100298408
3006 Ga0070702_100000078
3007 Ga0070702_100016165
3008 Ga0070702_100070786
3009 Ga0070702_100189996
3010 Ga0070702_100696847
3011 Ga0068852_100066412
3012 Ga0068852_100071661
3013 Ga0068852_100103481
3014 Ga0068852_100164973
3015 Ga0068852_100233678
3016 Ga0068852_100334282
3017 Ga0068852_100482094
3018 Ga0068852_100684372
3019 Ga0068859_100008744
3020 Ga0068859_100016531
3021 Ga0068859_100112955
3022 Ga0068859_100196077
3023 Ga0068859_100231027
3024 Ga0068859_100278707
3025 Ga0068859_100776260
3026 Ga0068864_100055636
3027 Ga0068864_100089520
3028 Ga0068864_100383284
3029 Ga0068864_100856771
3030 Ga0068866_10001174
3031 Ga0068866_10029750
3032 Ga0068861_100000521
3033 Ga0068861_100003518
3034 Ga0068861_100102410
3035 Ga0068861_100631911
3036 Ga0068861_100723001
3037 Ga0068851_10002061
3038 Ga0068870_10024163
3039 Ga0068870_10030163
3040 Ga0068863_100194525
3041 Ga0068863_100519024
3042 Ga0068863_100583488
3043 Ga0068858_100000286
3044 Ga0068858_100039563
3045 Ga0068858_100146799
3046 Ga0068858_100361246
3047 Ga0068858_100369936
3048 Ga0068858_100428973
3049 Ga0068858_100511712
3050 Ga0068860_100000222
3051 Ga0068860_100000770
3052 Ga0068860_100068484
3053 Ga0068860_100110743
3054 Ga0068860_100143578
3055 Ga0068860_100200484
3056 Ga0068860_100215585
3057 Ga0068860_100258849
3058 Ga0068860_100440780
3059 Ga0068860_100444838
3060 Ga0068860_100478806
3061 Ga0068860_100531466
3062 Ga0068862_100003231
3063 Ga0068862_100013691
3064 Ga0068862_100038951
3065 Ga0068862_100056737
3066 Ga0068862_100119426
3067 Ga0068862_100266306
3068 Ga0068862_100377507
3069 Ga0068862_100454912
3070 Ga0081455_10000276
3071 Ga0081455_10040989
3072 Ga0081455_10064985
3073 Ga0081455_10096044
3074 Ga0081538_10037147
3075 Ga0081538_10062853
3076 Ga0081540_1016874
3077 Ga0081540_1018379
3078 Ga0081540_1031482
3079 Ga0081540_1057327
3080 Ga0081540_1085068
3081 Ga0081539_10000365
3082 Ga0081539_10000540
3083 Ga0081539_10061282
3084 Ga0070717_10005721
3085 Ga0070717_10092601
3086 Ga0075365_10014849
3087 Ga0075365_10084521
3088 Ga0075365_10240934
3089 Ga0075365_10241974
3090 Ga0075365_10350024
3091 Ga0075365_10400373
3092 Ga0075368_10020133
3093 Ga0075363_100011478
3094 Ga0075363_100024332
3095 Ga0075363_100159166
3096 Ga0075363_100279018
3097 Ga0075364_10063358
3098 Ga0075364_10083480
3099 Ga0075364_10248691
3100 Ga0075364_10286146
3101 Ga0075364_10353579
3102 Ga0075432_10015278
3103 Ga0070715_10017370
3104 Ga0070716_100002810
3105 Ga0070716_100003846
3106 Ga0070716_100004252
3107 Ga0070716_100041903
3108 Ga0070716_100088929
3109 Ga0070716_100242653
3110 Ga0070712_100084094
3111 Ga0070712_100088469
3112 Ga0075362_10015370
3113 Ga0075362_10019441
3114 Ga0075362_10055704
3115 Ga0075362_10131837
3116 Ga0075362_10198735
3117 Ga0075367_10025670
3118 Ga0075367_10027145
3119 Ga0075367_10041067
3120 Ga0075367_10200086
3121 Ga0075367_10370367
3122 Ga0075369_10029522
3123 Ga0075369_10031432
3124 Ga0075369_10042556
3125 Ga0075369_10084710
3126 Ga0075366_10012943
3127 Ga0075366_10022411
3128 Ga0097621_100003897
3129 Ga0097621_100027109
3130 Ga0097621_100075751
3131 Ga0097621_100077737
3132 Ga0097621_100160974
3133 Ga0097621_100423254
3134 Ga0097621_100463206
3135 Ga0097621_100543470
3136 Ga0075370_10003312
3137 Ga0075370_10082078
3138 Ga0075370_10115765
3139 Ga0075370_10188265
3140 Ga0068871_100000460
3141 Ga0068871_100001642
3142 Ga0068871_100006132
3143 Ga0068871_100008734
3144 Ga0068871_100115524
3145 Ga0068871_100556210
3146 Ga0068871_100777234
3147 Ga0075428_100000165
3148 Ga0075428_100000502
3149 Ga0075428_100059007
3150 Ga0075428_100109109
3151 Ga0075428_100119714
3152 Ga0075428_100119754
3153 Ga0075428_100314088
3154 Ga0075430_100001376
3155 Ga0075430_100010738
3156 Ga0075430_100013684
3157 Ga0075431_100015657
3158 Ga0075431_100021294
3159 Ga0075431_100032774
3160 Ga0075431_100198291
3161 Ga0075431_100282828
3162 Ga0075433_10000830
3163 Ga0075433_10062410
3164 Ga0075433_10108468
3165 Ga0075433_10135307
3166 Ga0075433_10144738
3167 Ga0075433_10259247
3168 Ga0075433_10313732
3169 Ga0075433_10407994
3170 Ga0075434_100000563
3171 Ga0075434_100005940
3172 Ga0075434_100051394
3173 Ga0075434_100080461
3174 Ga0075434_100159101
3175 Ga0075434_100660454
3176 Ga0075434_100881928
3177 Ga0075434_100967403
3178 Ga0075429_100000430
3179 Ga0075429_100005823
3180 Ga0075429_100061945
3181 Ga0075429_100197400
3182 Ga0075429_100529599
3183 Ga0068865_100000043
3184 Ga0075436_100000235
3185 Ga0075436_100002224
3186 Ga0075436_100012516
3187 Ga0075436_100042321
3188 Ga0075436_100104183
3189 Ga0075436_100267084
3190 Ga0075436_100279804
3191 Ga0097620_100006932
3192 Ga0097620_100008744
3193 Ga0097620_100016531
3194 Ga0097620_100112941
3195 Ga0097620_100196080
3196 Ga0097620_100231039
3197 Ga0097620_100278729
3198 Ga0097620_100776237
3199 Ga0099825_1033281
3200 Ga0099824_1015072
3201 Ga0099822_1056894
3202 Ga0099823_1009032
3203 Ga0099826_10096933
3204 Ga0075435_100004339
3205 Ga0075435_100007138
3206 Ga0075435_100043131
3207 Ga0075435_100307024
3208 Ga0075435_100349650
3209 Ga0075435_100621164
3210 Ga0099794_10006079
3211 Ga0099794_10016216
3212 Ga0099794_10020684
3213 Ga0099794_10251700
3214 Ga0099795_10061711
3215 Ga0099795_10177507
3216 Ga0105244_10001583
3217 Ga0105244_10017280
3218 Ga0105244_10024948
3219 Ga0105244_10086775
3220 Ga0105240_10001147
3221 Ga0105240_10004081
3222 Ga0105240_10004369
3223 Ga0105240_10028379
3224 Ga0105240_10029822
3225 Ga0105240_10032533
3226 Ga0105240_10040108
3227 Ga0105240_10100172
3228 Ga0105240_10192851
3229 Ga0105240_10198099
3230 Ga0105240_10212225
3231 Ga0105240_10247515
3232 Ga0105240_10306002
3233 Ga0105240_10413806
3234 Ga0105240_10503726
3235 Ga0111539_10001265
3236 Ga0111539_10001811
3237 Ga0111539_10002049
3238 Ga0111539_10006467
3239 Ga0111539_10027439
3240 Ga0111539_10071980
3241 Ga0111539_10096765
3242 Ga0111539_10306624
3243 Ga0111539_10317527
3244 Ga0111539_10454437
3245 Ga0111539_10969529
3246 Ga0105245_10000271
3247 Ga0105245_10036282
3248 Ga0105245_10047123
3249 Ga0105245_10172957
3250 Ga0105245_10457469
3251 Ga0105245_10463281
3252 Ga0105247_10050663
3253 Ga0114129_10012670
3254 Ga0114129_10026010
3255 Ga0114129_10069818
3256 Ga0114129_10162368
3257 Ga0114129_10182254
3258 Ga0114129_10348082
3259 Ga0114129_10494526
3260 Ga0114129_10626841
3261 Ga0114129_10628535
3262 Ga0114129_10794231
3263 Ga0105243_10001687
3264 Ga0105243_10002095
3265 Ga0105243_10013075
3266 Ga0105243_10052561
3267 Ga0105243_10097617
3268 Ga0105243_10116340
3269 Ga0105243_10403003
3270 Ga0105241_10002027
3271 Ga0105241_10028793
3272 Ga0105241_10040441
3273 Ga0105241_10260789
3274 Ga0105241_10413855
3275 Ga0105242_10000296
3276 Ga0105242_10023572
3277 Ga0105242_10031643
3278 Ga0105242_10175030
3279 Ga0105242_10235366
3280 Ga0105242_10293614
3281 Ga0105242_10361968
3282 Ga0105248_10045676
3283 Ga0105248_10068375
3284 Ga0105248_10312213
3285 Ga0105248_10323655
3286 Ga0105248_10356547
3287 Ga0105248_10661745
3288 Ga0105237_10009810
3289 Ga0105237_10015336
3290 Ga0105237_10022629
3291 Ga0105237_10047338
3292 Ga0105237_10168154
3293 Ga0105237_10296450
3294 Ga0105237_10301200
3295 Ga0105237_10344650
3296 Ga0105237_10667488
3297 Ga0105238_10003092
3298 Ga0105238_10003744
3299 Ga0105238_10032944
3300 Ga0105238_10050989
3301 Ga0105238_10070942
3302 Ga0105238_10104983
3303 Ga0105238_10120834
3304 Ga0105238_10219311
3305 Ga0105238_10467016
3306 Ga0105238_10572222
3307 Ga0105238_11150584
3308 Ga0105249_10027588
3309 Ga0105249_10037767
3310 Ga0105249_10039571
3311 Ga0105249_10110829
3312 Ga0105249_10459841
3313 Ga0105249_10605775
3314 Ga0105249_11137719
3315 Ga0099796_10008928
3316 Ga0099796_10205259
3317 Ga0099796_10223348
3318 Ga0105239_10006148
3319 Ga0105239_10012109
3320 Ga0105239_10014050
3321 Ga0105239_10024321
3322 Ga0105239_10175057
3323 Ga0105239_10336797
3324 Ga0105239_10776090
3325 Ga0105239_10848369
3326 Ga0105239_11367734
3327 Ga0105246_10012990
3328 Ga0105246_10035445
3329 Ga0105246_10037532
3330 Ga0105246_10279663
3331 Ga0105246_10467709
3332 Ga0157322_1002507
3333 Ga0157345_1001502
3334 Ga0157313_1001727
3335 Ga0157326_1003283
3336 Ga0157373_10034917
3337 Ga0157373_10040289
3338 Ga0157373_10043171
3339 Ga0157373_10087865
3340 Ga0157371_10016723
3341 Ga0157371_10140325
3342 Ga0157370_10001416
3343 Ga0157370_10002820
3344 Ga0157370_10006585
3345 Ga0157370_10014250
3346 Ga0157370_10029928
3347 Ga0157370_10045381
3348 Ga0157370_10066831
3349 Ga0157370_10089974
3350 Ga0157370_10177889
3351 Ga0157370_10388372
3352 Ga0157370_10411814
3353 Ga0157369_10001367
3354 Ga0157369_10004167
3355 Ga0157369_10004364
3356 Ga0157369_10008890
3357 Ga0157369_10009086
3358 Ga0157369_10186914
3359 Ga0157369_10335036
3360 Ga0157369_10340858
3361 Ga0157374_10006868
3362 Ga0157374_10039570
3363 Ga0157374_10065079
3364 Ga0157374_10074922
3365 Ga0157378_10000140
3366 Ga0157378_10001069
3367 Ga0157378_10308986
3368 Ga0157378_10330057
3369 Ga0157378_10363706
3370 Ga0157378_10416918
3371 Ga0157378_11369419
3372 Ga0163162_10009909
3373 Ga0163162_10010390
3374 Ga0163162_10071039
3375 Ga0163162_10256925
3376 Ga0163162_10324679
3377 Ga0163162_10402192
3378 Ga0163162_10830134
3379 Ga0163162_10879491
3380 Ga0157372_10000655
3381 Ga0157372_10002479
3382 Ga0157372_10010585
3383 Ga0157372_10049135
3384 Ga0157372_10123333
3385 Ga0157372_10175882
3386 Ga0157372_10205089
3387 Ga0157372_10257640
3388 Ga0157372_10502404
3389 Ga0157372_10506191
3390 Ga0157375_10076221
3391 Ga0157375_10105819
3392 Ga0157375_10437782
3393 Ga0157375_10550728
3394 Ga0163163_10043695
3395 Ga0163163_10093822
3396 Ga0163163_10784119
3397 Ga0157380_10042442
3398 Ga0157380_10134523
3399 Ga0157380_10279652
3400 Ga0157380_10319497
3401 Ga0157380_10403665
3402 Ga0157380_11246063
3403 Ga0182008_10002205
3404 Ga0182008_10041092
3405 Ga0157377_10015707
3406 Ga0157379_10025051
3407 Ga0157379_10043705
3408 Ga0157379_10084137
3409 Ga0157379_10115785
3410 Ga0157379_10119384
3411 Ga0157379_10185802
3412 Ga0157379_10258045
3413 Ga0157379_10321241
3414 Ga0157376_10001035
3415 Ga0157376_10049928
3416 Ga0182006_1000010
3417 Ga0182007_10000021
3418 Ga0182005_1000003
3419 Ga0182005_1000009
3420 Ga0163161_10046570
3421 Ga0163161_10048622
3422 Ga0163161_10086000
3423 Ga0163161_10228346
3424 Ga0163161_10281691
3425 Ga0163161_10347523
3426 Ga0163161_10424969
3427 Ga0214544_1000003
3428 Ga0214542_1000022
3429 Ga0214545_1000010
3430 Ga0214543_1000035
3431 Ga0213872_10018271
3432 Ga0213876_10008884
3433 Ga0213876_10027632
3434 Ga0213876_10151918
3435 Ga0209436_100171
3436 Ga0209436_100322
3437 Ga0209563_102990
3438 Ga0207425_1000006
3439 Ga0207425_1000354
3440 Ga0207425_1001911
3441 Ga0209677_101351
3442 Ga0209677_101442
3443 Ga0209129_1000009
3444 Ga0209129_1002425
3445 Ga0209233_1002708
3446 Ga0209565_1000080
3447 Ga0209565_1000459
3448 Ga0209565_1000488
3449 Ga0209565_1003784
3450 Ga0209565_1006292
3451 Ga0209565_1042499
3452 Ga0207666_1000360
3453 Ga0207666_1020133
3454 Ga0209455_1002361
3455 Ga0209673_1000088
3456 Ga0209673_1036425
3457 Ga0209130_1000238
3458 Ga0209130_1000493
3459 Ga0209130_1000726
3460 Ga0209675_1002650
3461 Ga0209675_1004521
3462 Ga0209675_1005140
3463 Ga0209676_1000073
3464 Ga0209676_1000286
3465 Ga0209676_1004990
3466 Ga0209025_1000198
3467 Ga0209025_1001379
3468 Ga0209564_1000098
3469 Ga0209564_1000313
3470 Ga0209564_1006204
3471 Ga0209564_1007889
3472 Ga0209564_1007991
3473 Ga0209564_1007997
3474 Ga0209758_1000071
3475 Ga0209758_1000106
3476 Ga0209758_1000344
3477 Ga0209758_1002307
3478 Ga0209758_1013940
3479 Ga0209758_1052171
3480 Ga0209050_1000008
3481 Ga0209050_1000183
3482 Ga0209050_1001801
3483 Ga0209050_1010730
3484 Ga0209050_1031595
3485 Ga0209256_1000096
3486 Ga0209256_1000498
3487 Ga0209256_1001704
3488 Ga0209256_1005569
3489 Ga0207426_1000374
3490 Ga0207426_1000440
3491 Ga0207426_1001049
3492 Ga0207426_1001712
3493 Ga0207426_1007090
3494 Ga0207426_1016605
3495 Ga0209051_1000005
3496 Ga0209051_1017007
3497 Ga0209051_1073700
3498 Ga0209257_1000010
3499 Ga0209257_1000031
3500 Ga0209257_1000819
3501 Ga0209257_1001077
3502 Ga0209257_1029703
3503 Ga0207697_10006675
3504 Ga0207697_10044116
3505 Ga0207697_10057829
3506 Ga0207697_10166431
3507 Ga0207656_10003875
3508 Ga0207656_10005001
3509 Ga0207656_10265645
3510 Ga0207655_1002560
3511 Ga0207653_10131245
3512 Ga0207682_10005872
3513 Ga0207682_10037972
3514 Ga0207692_10002984
3515 Ga0207692_10012527
3516 Ga0207692_10015463
3517 Ga0207692_10030585
3518 Ga0207692_10174220
3519 Ga0207692_10348646
3520 Ga0207642_10000413
3521 Ga0207710_10030473
3522 Ga0207688_10002227
3523 Ga0207688_10004822
3524 Ga0207688_10056072
3525 Ga0207688_10085657
3526 Ga0207688_10096304
3527 Ga0207688_10123895
3528 Ga0207647_10002707
3529 Ga0207647_10045887
3530 Ga0207647_10066896
3531 Ga0207685_10087388
3532 Ga0207699_10050063
3533 Ga0207699_10104315
3534 Ga0207699_10136371
3535 Ga0207699_10169344
3536 Ga0207699_10187650
3537 Ga0207645_10028700
3538 Ga0207645_10054561
3539 Ga0207643_10010711
3540 Ga0207643_10011789
3541 Ga0207643_10035916
3542 Ga0207643_10068348
3543 Ga0207643_10094100
3544 Ga0207643_10193290
3545 Ga0207643_10230910
3546 Ga0207705_10083001
3547 Ga0207705_10429748
3548 Ga0207684_10004217
3549 Ga0207684_10022022
3550 Ga0207684_10054995
3551 Ga0207684_10448709
3552 Ga0207654_10015778
3553 Ga0207654_10025689
3554 Ga0207654_10076115
3555 Ga0207654_10081153
3556 Ga0207654_10133636
3557 Ga0207654_10283272
3558 Ga0207707_10000832
3559 Ga0207707_10015279
3560 Ga0207707_10023819
3561 Ga0207707_10024393
3562 Ga0207707_10029358
3563 Ga0207707_10035892
3564 Ga0207707_10035901
3565 Ga0207707_10047665
3566 Ga0207707_10052063
3567 Ga0207707_10510506
3568 Ga0207695_10000123
3569 Ga0207695_10014962
3570 Ga0207695_10019499
3571 Ga0207695_10021930
3572 Ga0207695_10033727
3573 Ga0207695_10070328
3574 Ga0207695_10084250
3575 Ga0207695_10142642
3576 Ga0207695_10242832
3577 Ga0207695_10315678
3578 Ga0207695_10455045
3579 Ga0207671_10039283
3580 Ga0207671_10062980
3581 Ga0207671_10118382
3582 Ga0207671_10162366
3583 Ga0207671_10173271
3584 Ga0207671_10431319
3585 Ga0207693_10004235
3586 Ga0207693_10018459
3587 Ga0207693_10029805
3588 Ga0207693_10220263
3589 Ga0207663_10058300
3590 Ga0207663_10103378
3591 Ga0207663_10121696
3592 Ga0207663_10210314
3593 Ga0207663_10435044
3594 Ga0207663_10602358
3595 Ga0207660_10000496
3596 Ga0207660_10032603
3597 Ga0207660_10039257
3598 Ga0207660_10047373
3599 Ga0207660_10075535
3600 Ga0207660_10089384
3601 Ga0207660_10089610
3602 Ga0207660_10160520
3603 Ga0207660_10453508
3604 Ga0207660_10520501
3605 Ga0207662_10000024
3606 Ga0207662_10017512
3607 Ga0207657_10000213
3608 Ga0207657_10002516
3609 Ga0207657_10002601
3610 Ga0207657_10008209
3611 Ga0207657_10039462
3612 Ga0207657_10041830
3613 Ga0207657_10085135
3614 Ga0207657_10279261
3615 Ga0207649_10007000
3616 Ga0207649_10034845
3617 Ga0207649_10064534
3618 Ga0207649_10074057
3619 Ga0207649_10100561
3620 Ga0207649_10114971
3621 Ga0207649_10128469
3622 Ga0207649_10136715
3623 Ga0207649_10161768
3624 Ga0207649_10251362
3625 Ga0207652_10007795
3626 Ga0207652_10096614
3627 Ga0207652_10105544
3628 Ga0207652_10106458
3629 Ga0207652_10125065
3630 Ga0207652_10179941
3631 Ga0207652_10286100
3632 Ga0207652_10402414
3633 Ga0207652_10899963
3634 Ga0207646_10000250
3635 Ga0207646_10017586
3636 Ga0207646_10123418
3637 Ga0207646_10332362
3638 Ga0207646_10821450
3639 Ga0207681_10000501
3640 Ga0207681_10026353
3641 Ga0207681_10156138
3642 Ga0207694_10004773
3643 Ga0207694_10008491
3644 Ga0207694_10028337
3645 Ga0207694_10080146
3646 Ga0207694_10121530
3647 Ga0207694_10123973
3648 Ga0207694_10155717
3649 Ga0207694_10220734
3650 Ga0207694_10714848
3651 Ga0207659_10003439
3652 Ga0207659_10065981
3653 Ga0207659_10158512
3654 Ga0207687_10000191
3655 Ga0207687_10025694
3656 Ga0207687_10046573
3657 Ga0207687_10385163
3658 Ga0207687_10432613
3659 Ga0207700_10002748
3660 Ga0207700_10041184
3661 Ga0207700_10051441
3662 Ga0207700_10087384
3663 Ga0207700_10649656
3664 Ga0207664_10009532
3665 Ga0207664_10036482
3666 Ga0207664_10039956
3667 Ga0207664_10107075
3668 Ga0207664_10113403
3669 Ga0207664_10373424
3670 Ga0207644_10013321
3671 Ga0207690_10009141
3672 Ga0207690_10037314
3673 Ga0207690_10085135
3674 Ga0207690_10391662
3675 Ga0207706_10008286
3676 Ga0207706_10022812
3677 Ga0207706_10158949
3678 Ga0207706_10188267
3679 Ga0207706_10257937
3680 Ga0207686_10004451
3681 Ga0207686_10023376
3682 Ga0207686_10082758
3683 Ga0207686_10215777
3684 Ga0207686_10346538
3685 Ga0207686_10649759
3686 Ga0207709_10001103
3687 Ga0207709_10012170
3688 Ga0207709_10198780
3689 Ga0207670_10001307
3690 Ga0207670_10005004
3691 Ga0207670_10083983
3692 Ga0207670_10089649
3693 Ga0207670_10153812
3694 Ga0207670_10197667
3695 Ga0207670_10212020
3696 Ga0207670_10471440
3697 Ga0207669_10118546
3698 Ga0207669_10595437
3699 Ga0207704_10003022
3700 Ga0207704_10034436
3701 Ga0207704_10232050
3702 Ga0207704_10269547
3703 Ga0207704_10410488
3704 Ga0207665_10025588
3705 Ga0207665_10082253
3706 Ga0207665_10263562
3707 Ga0207665_10719364
3708 Ga0207691_10064525
3709 Ga0207691_10111337
3710 Ga0207691_10112267
3711 Ga0207691_10221997
3712 Ga0207691_10408993
3713 Ga0207711_10079916
3714 Ga0207711_10115974
3715 Ga0207711_10170056
3716 Ga0207711_10282360
3717 Ga0207711_10303626
3718 Ga0207711_10339808
3719 Ga0207711_10368394
3720 Ga0207689_10000162
3721 Ga0207689_10015031
3722 Ga0207689_10033361
3723 Ga0207689_10072508
3724 Ga0207689_10112283
3725 Ga0207689_10181606
3726 Ga0207689_10242572
3727 Ga0207661_10000159
3728 Ga0207661_10080520
3729 Ga0207661_10180818
3730 Ga0207661_10390606
3731 Ga0207679_10011745
3732 Ga0207679_10017031
3733 Ga0207679_10113399
3734 Ga0207679_10141765
3735 Ga0207679_10415991
3736 Ga0207667_10003531
3737 Ga0207667_10013860
3738 Ga0207667_10015478
3739 Ga0207667_10043798
3740 Ga0207667_10055833
3741 Ga0207667_10057334
3742 Ga0207667_10058745
3743 Ga0207667_10065863
3744 Ga0207667_10076547
3745 Ga0207667_10080619
3746 Ga0207667_10083788
3747 Ga0207667_10116278
3748 Ga0207667_10119661
3749 Ga0207667_10275500
3750 Ga0207667_10411728
3751 Ga0207667_10559931
3752 Ga0207651_10027062
3753 Ga0207651_10036708
3754 Ga0207651_10105440
3755 Ga0207651_10317921
3756 Ga0207712_10010705
3757 Ga0207712_10020536
3758 Ga0207712_10021692
3759 Ga0207712_10069958
3760 Ga0207712_10402805
3761 Ga0207668_10042192
3762 Ga0207668_10080992
3763 Ga0207668_10117361
3764 Ga0207668_10174913
3765 Ga0207668_10209680
3766 Ga0207668_10308050
3767 Ga0207668_10354639
3768 Ga0207668_10469755
3769 Ga0207668_10494170
3770 Ga0207640_10001819
3771 Ga0207640_10006883
3772 Ga0207640_10061581
3773 Ga0207640_10239344
3774 Ga0207640_10442502
3775 Ga0207658_10115517
3776 Ga0207658_10319496
3777 Ga0207677_10001045
3778 Ga0207677_10013644
3779 Ga0207677_10016949
3780 Ga0207677_10076774
3781 Ga0207677_10138374
3782 Ga0207677_10161747
3783 Ga0207677_10319417
3784 Ga0207703_10006243
3785 Ga0207703_10066956
3786 Ga0207703_10085690
3787 Ga0207703_10094309
3788 Ga0207703_10386393
3789 Ga0207703_10412436
3790 Ga0207639_10035205
3791 Ga0207639_10054563
3792 Ga0207639_10060162
3793 Ga0207639_10092480
3794 Ga0207639_10163382
3795 Ga0207639_10259443
3796 Ga0207678_10011369
3797 Ga0207678_10016015
3798 Ga0207678_10018537
3799 Ga0207678_10066745
3800 Ga0207678_10209095
3801 Ga0207678_10383506
3802 Ga0207708_10003836
3803 Ga0207708_10009517
3804 Ga0207708_10012979
3805 Ga0207708_10021210
3806 Ga0207708_10031300
3807 Ga0207702_10007391
3808 Ga0207702_10014575
3809 Ga0207702_10018575
3810 Ga0207702_10024254
3811 Ga0207702_10047626
3812 Ga0207702_10120984
3813 Ga0207702_10603791
3814 Ga0207641_10024950
3815 Ga0207641_10099073
3816 Ga0207641_10119847
3817 Ga0207641_10406026
3818 Ga0207641_10571168
3819 Ga0207648_10000147
3820 Ga0207648_10035967
3821 Ga0207648_10062180
3822 Ga0207648_10081011
3823 Ga0207648_10129755
3824 Ga0207676_10039899
3825 Ga0207676_10133592
3826 Ga0207676_10141473
3827 Ga0207676_10211754
3828 Ga0207676_10428785
3829 Ga0207674_10000045
3830 Ga0207674_10000398
3831 Ga0207674_10118754
3832 Ga0207674_10415628
3833 Ga0207674_10437246
3834 Ga0207675_100000104
3835 Ga0207675_100014678
3836 Ga0207675_100043575
3837 Ga0207675_100048747
3838 Ga0207675_100206117
3839 Ga0207675_100286897
3840 Ga0207675_100415780
3841 Ga0207675_100472299
3842 Ga0207675_100968325
3843 Ga0207683_10014746
3844 Ga0207683_10015816
3845 Ga0207683_10026022
3846 Ga0207683_10247949
3847 Ga0207683_10385062
3848 Ga0207698_10001067
3849 Ga0207698_10002878
3850 Ga0207698_10008305
3851 Ga0207698_10065674
3852 Ga0207698_10118374
3853 Ga0207698_10164819
3854 Ga0207698_10428335
3855 Ga0207698_10661045
3856 Ga0207698_10825276
3857 Ga0209281_1007516
3858 Ga0209281_1017209
3859 Ga0209389_1000016
3860 Ga0209389_1000027
3861 Ga0209589_1000031
3862 Ga0209969_1007842
3863 Ga0209489_100057
3864 Ga0209489_100063
3865 Ga0209700_100012
3866 Ga0209967_1000518
3867 Ga0209967_1001872
3868 Ga0209967_1004238
3869 Ga0209981_1001333
3870 Ga0209996_1001330
3871 Ga0209996_1009654
3872 Ga0210000_1004651
3873 Ga0210000_1011340
3874 Ga0209995_1001365
3875 Ga0209179_1008247
3876 Ga0209179_1031365
3877 Ga0209999_1002550
3878 Ga0209588_1001152
3879 Ga0209588_1003670
3880 Ga0209588_1021988
3881 Ga0209588_1090861
3882 Ga0209971_1004901
3883 Ga0209998_10000276
3884 Ga0209998_10026954
3885 Ga0209998_10047323
3886 Ga0209813_10005677
3887 Ga0209974_10004290
3888 Ga0209974_10051012
3889 Ga0209974_10061019
3890 Ga0207428_10000176
3891 Ga0207428_10000619
3892 Ga0207428_10001497
3893 Ga0207428_10020049
3894 Ga0207428_10054922
3895 Ga0268266_10090737
3896 Ga0268266_11082872
3897 Ga0268265_10000585
3898 Ga0268265_10000875
3899 Ga0268265_10163404
3900 Ga0268265_10173444
3901 Ga0268265_10180549
3902 Ga0268265_10188807
3903 Ga0268265_10316534
3904 Ga0268265_10339910
3905 Ga0268264_10000042
3906 Ga0268264_10000841
3907 Ga0268264_10086873
3908 Ga0268264_10114602
3909 Ga0268264_10123348
3910 Ga0268264_10151675
3911 Ga0268264_10199553
3912 Ga0268264_10528660
3913 Ga0265318_10021729
3914 Ga0307515_10518134
3915 Ga0316177_1120927
3916 Ga0316180_1146035
3917 Ga0316183_1005661
3918 Ga0316181_1069339
3919 Ga0316182_1284474
3920 Ga0316182_1296919
3921 Ga0316182_1315656
3922 Ga0265330_10006187
3923 Ga0265332_10008912
3924 Ga0265328_10028349
3925 Ga0265320_10054730
3926 Ga0265340_10043423
3927 Ga0265339_10005071
3928 Ga0265339_10039372
3929 Ga0265331_10004784
3930 Ga0265331_10054949
3931 Ga0265316_10148147
3932 Ga0307513_10392083
3933 Ga0307509_10141452
3934 Ga0307509_10360630
3935 Ga0307509_10364655
3936 Ga0307408_100000312
3937 Ga0307408_100000569
3938 Ga0307408_100001191
3939 Ga0307408_100122752
3940 Ga0307408_100363271
3941 Ga0307408_100477612
3942 Ga0307408_100560859
3943 Ga0307408_100621071
3944 Ga0307508_10000019
3945 Ga0307508_10252920
3946 Ga0265314_10004441
3947 Ga0265314_10023881
3948 Ga0265342_10004046
3949 Ga0307516_10067084
3950 Ga0307516_10105847
3951 Ga0307516_10119426
3952 Ga0307516_10137400
3953 Ga0307405_10319532
3954 Ga0307413_10026366
3955 Ga0307413_10512559
3956 Ga0307410_10004635
3957 Ga0307410_10038312
3958 Ga0307406_10011520
3959 Ga0307406_10198142
3960 Ga0307406_10514538
3961 Ga0307407_10041597
3962 Ga0307407_10159760
3963 Ga0307412_10000120
3964 Ga0307412_10213883
3965 Ga0307409_100051813
3966 Ga0307409_100200883
3967 Ga0307416_100101547
3968 Ga0307416_100232394
3969 Ga0307416_100336166
3970 Ga0307416_100453011
3971 Ga0307416_100466082
3972 Ga0307416_100673535
3973 Ga0307416_100854118
3974 Ga0307414_10117685
3975 Ga0307414_10527757
3976 Ga0307411_10043483
3977 Ga0307411_10297230
3978 Ga0307411_10499380
3979 Ga0307415_100127668
3980 Ga0307415_100425467
3981 Ga0307507_10066258
3982 Ga0307507_10296378
3983 Ga0307510_10009428
3984 Ga0307510_10028111
3985 Ga0307510_10196764
3986 Ga0373930_0002929
3987 Ga0373948_0000161
3988 Ga0373950_0000909
3989 Ga0373950_0014933
3990 Ga0373958_0000134
3991 Ga0373959_0001053
3992 Ga0373938_0000080
3993 Ga0373938_0066185
3994 Ga0373938_0089552
3995 Ga0373926_0000738
3996 Ga0373926_0041629
3997 Ga0373926_0042124
3998 Ga0373928_0000094
3999 Ga0373928_0028739
4000 Ga0373929_0003690
4001 Ga0373934_0034885
4002 Ga0373940_0000238
4003 Ga0373940_0018810
4004 Ga0373944_0015004
4005 Ga0373944_0029677
4006 Ga0373949_0001061
4007 Ga0373949_0007783
4008 Ga0373951_0000639
4009 Ga0373951_0005084
4010 Ga0373952_0018072
4011 Ga0373923_0043733
4012 Ga0373932_0004896
4013 Ga0373932_0015713
4014 Ga0373932_0036299
4015 Ga0373932_0088397
4016 Ga0373936_0001313
4017 Ga0373936_0018632
4018 Ga0373936_0021347
4019 Ga0373936_0159829
4020 Ga0373939_0001226
4021 Ga0373939_0010972
4022 Ga0373939_0013675
4023 Ga0373941_0000298
4024 Ga0373945_0055674
4025 Ga0373945_0197762
4026 Ga0373954_0021802
4027 Ga0373960_0000044
4028 Ga0373960_0087472
4029 Ga0373943_0048150
4030 Ga0373943_0138921
4031 Ga0373943_0201660
4032 Ga0373946_0018863
4033 Ga0373946_0103306
4034 Ga0373946_0160900
4035 Ga0373955_0240461
4036 Ga0373942_0000449
4037 Ga0373961_0002586
4038 Ga0373961_0096252
4039 Ga0373962_0003079
4040 Ga0373962_0023177
4041 Ga0373924_0002604
4042 Ga0373924_0002729
4043 Ga0373924_0017277
4044 Ga0373924_0050977
4045 Ga0373931_0000648
4046 Ga0373931_0017630
4047 Ga0373931_0026288
4048 Ga0373931_0026426
4049 Ga0373931_0030064
4050 Ga0373931_0196352
4051 Ga0373935_0012874
4052 Ga0373935_0022134
4053 Ga0373935_0072720
4054 Ga0373935_0114596
4055 Ga0373927_0003632
4056 Ga0373927_0023086
4057 Ga0373927_0546573
4058 Ga0373933_0035762
4059 Ga0373933_0430398
4060 Ga0373947_0099341
4061 Ga0373937_0021155
4062 Ga0373937_0039088
4063 Ga0373937_0076356
4064 Ga0373937_0159572
4065 Ga0372808_009087
4066 Ga0373925_0008382
4067 Ga0373925_0045274
4068 Ga0373925_0065105
4069 Ga0373925_0318965
4070 Ga0395899_0003193
4071 Ga0395899_0058237
4072 Ga0395900_0008352
4073 Ga0395900_0109588
4074 Ga0395900_0113344
4075 Ga0395900_0402796
4076 Ga0395900_0442625
4077 Ga0395898_0008065
4078 Ga0395898_0036730
4079 Ga0395898_0086534
4080 Ga0395898_0245640
4081 Ga0395898_0281724
4082 Ga0395898_0345790
4083 Ga0395905_0002724
4084 Ga0395905_0012352
4085 Ga0395905_0023299
4086 Ga0395905_0029515
4087 Ga0395905_0053940
4088 Ga0395905_0316500
4089 Ga0395905_0369659
4090 Ga0395905_0629341
4091 Ga0395905_0687645
4092 Ga0436364_1230166
4093 Ga0395901_0014698
4094 Ga0395901_0036429
4095 Ga0395901_0073927
4096 Ga0395901_0103394
4097 Ga0395901_0182224
4098 Ga0395901_0236141
4099 Ga0395901_0260784
4100 Ga0395901_0674465
4101 Ga0242420_018932
4102 Ga0242420_026115
4103 Ga0242420_038916
4104 Ga0436365_0038561
4105 Ga0436365_0318115
4106 Ga0436365_0633843
4107 Ga0436365_0846950
4108 Ga0436365_1019690
4109 Ga0436365_1452548
4110 Ga0436365_1533291
4111 Ga0436360_0329047
4112 Ga0436360_0887353
4113 Ga0436361_0586765
4114 Ga0436363_1496104
4115 Ga0436362_0546340
4116 Ga0436362_0883250
4117 Ga0439436_0090670
4118 Ga0451789_0251368
4119 Ga0451807_1408311
4120 Ga0451837_1330906
4121 Ga0451853_0489163
4122 Ga0439441_005277
4123 Ga0439441_025771
4124 Ga0439441_067732
4125 Ga0439451_013662
4126 Ga0450891_018125
4127 Ga0439446_0002327
4128 Ga0439434_0000438
4129 Ga0439435_0000537
4130 Ga0439435_0001751
4131 Ga0439444_0006262
4132 Ga0439460_0001193
4133 Ga0451577_0138443
4134 Ga0451577_0306811
4135 Ga0451577_0761094
4136 Ga0466972_0000179
4137 Ga0466972_0000224
4138 Ga0466972_0006460
4139 Ga0466972_0242456
4140 Ga0453683_0022477
4141 Ga0453683_0166871
4142 Ga0466965_0001368
4143 Ga0466965_0254164
4144 Ga0466966_0000830
4145 Ga0466961_0000023
4146 Ga0466961_0155865
4147 Ga0466961_0225968
4148 Ga0466963_0142486
4149 Ga0466964_0052467
4150 Ga0466964_0069652
4151 Ga0466964_0142915
4152 Ga0466964_0143567
4153 Ga0453684_0020509
4154 Ga0453684_0127987
4155 Ga0453684_0244215
4156 Ga0453684_0595873
4157 Ga0466970_0029846
4158 Ga0466970_0085049
4159 Ga0466970_0125960
4160 Ga0466957_0055189
4161 Ga0466957_0240285
4162 Ga0466957_0310705
4163 Ga0466960_0016870
4164 Ga0466960_0151436
4165 Ga0466959_0032575
4166 Ga0466959_0035127
4167 Ga0451576_0026409
4168 Ga0451576_0076491
4169 Ga0451576_0126884
4170 Ga0451576_0224612
4171 Ga0451576_0274158
4172 Ga0451576_0356016
4173 Ga0451576_0358519
4174 Ga0451576_0692128
4175 Ga0451576_0732007
4176 Ga0466958_0013122
4177 Ga0466967_0071411
4178 Ga0466967_0104727
4179 Ga0466967_0299929
4180 Ga0466967_0788334
4181 Ga0495617_000959
4182 Ga0495617_039279
4183 Ga0495627_000046
4184 Ga0495627_000054
4185 Ga0495627_001968
4186 Ga0495592_0136776
4187 Ga0495603_0045648
4188 Ga0495603_0054409
4189 Ga0495603_0079661
4190 Ga0495603_0164509
4191 Ga0495590_0000030
4192 Ga0495629_0001925
4193 Ga0495629_0237190
4194 Ga0495638_0009377
4195 Ga0495638_0024282
4196 Ga0495638_0118341
4197 Ga0495638_0175647
4198 Ga0495641_0139973
4199 Ga0495651_0034303
4200 Ga0495651_0050526
4201 Ga0495651_0100483
4202 Ga0495653_0020946
4203 Ga0495653_0317959
4204 Ga0495650_0000777
4205 Ga0495650_0078745
4206 Ga0495580_0002026
4207 Ga0495580_0005633
4208 Ga0495580_0014551
4209 Ga0495580_0018723
4210 Ga0495582_0018041
4211 Ga0495582_0038107
4212 Ga0495605_0026314
4213 Ga0495605_0043566
4214 Ga0495605_0108345
4215 Ga0495639_0007882
4216 Ga0495639_0008211
4217 Ga0495662_0006209
4218 Ga0495662_0020809
4219 Ga0495662_0100446
4220 Ga0495664_0007694
4221 Ga0495664_0110171
4222 Ga0495664_0184198
4223 Ga0495584_0001261
4224 Ga0495584_0002680
4225 Ga0495584_0077592
4226 Ga0495584_0207014
4227 Ga0495585_0040181
4228 Ga0495585_0117475
4229 Ga0495585_0128148
4230 Ga0495585_0170185
4231 Ga0495585_0196801
4232 Ga0495594_0033287
4233 Ga0495596_0009715
4234 Ga0495596_0056293
4235 Ga0495607_0000016
4236 Ga0495607_0104584
4237 Ga0495607_0109537
4238 Ga0495607_0112887
4239 Ga0495583_0000134
4240 Ga0495583_0000989
4241 Ga0495583_0003100
4242 Ga0495583_0010587
4243 Ga0495583_0030698
4244 Ga0495583_0119927
4245 Ga0495606_0000807
4246 Ga0495606_0009374
4247 Ga0495606_0014677
4248 Ga0495606_0047144
4249 Ga0495606_0053830
4250 Ga0495606_0069493
4251 Ga0495606_0083387
4252 Ga0495606_0128980
4253 Ga0495606_0210273
4254 Ga0495606_0279324
4255 Ga0495606_0384391
4256 Ga0495608_0001832
4257 Ga0495608_0008777
4258 Ga0495608_0027684
4259 Ga0495608_0361789
4260 Ga0495610_0005246
4261 Ga0495610_0141028
4262 Ga0495616_0007134
4263 Ga0495616_0012903
4264 Ga0495616_0018431
4265 Ga0495618_0057258
4266 Ga0495618_0128448
4267 Ga0495628_0002925
4268 Ga0495628_0048418
4269 Ga0495628_0055740
4270 Ga0495628_0066501
4271 Ga0495630_0001970
4272 Ga0495630_0059924
4273 Ga0495630_0101844
4274 Ga0495630_0275581
4275 Ga0495632_0116473
4276 Ga0495643_0000639
4277 Ga0495643_0001431
4278 Ga0495643_0028845
4279 Ga0495643_0029940
4280 Ga0495643_0105788
4281 Ga0495644_0014657
4282 Ga0495644_0025791
4283 Ga0495644_0030050
4284 Ga0495644_0050171
4285 Ga0495648_0005565
4286 Ga0495648_0006734
4287 Ga0495648_0024566
4288 Ga0495648_0024760
4289 Ga0495648_0040368
4290 Ga0495663_0027579
4291 Ga0495666_0004607
4292 Ga0495666_0007942
4293 Ga0495642_0008146
4294 Ga0495642_0023811
4295 Ga0495642_0027671
4296 Ga0495642_0028152
4297 Ga0495642_0147515
4298 Ga0495652_0003201
4299 Ga0495652_0114176
4300 Ga0495652_0168772
4301 Ga0495652_0199796
4302 Ga0495652_0203603
4303 Ga0495654_0027387
4304 Ga0495654_0177316
4305 Ga0495665_0011144
4306 Ga0495665_0036939
4307 Ga0495665_0107753
4308 Ga0495640_0015232
4309 Ga0495640_0027942
4310 Ga0495640_0029794
4311 Ga0495640_0052256
4312 Ga0495586_0001220
4313 Ga0495586_0010359
4314 Ga0495587_0017938
4315 Ga0495587_0051950
4316 Ga0495587_0054175
4317 Ga0495598_0009081
4318 Ga0495598_0010798
4319 Ga0495598_0099104
4320 Ga0495609_0002146
4321 Ga0495609_0004314
4322 Ga0495609_0012684
4323 Ga0495609_0018086
4324 Ga0495609_0022023
4325 Ga0495609_0057157
4326 Ga0495609_0188331
4327 Ga0495621_0014454
4328 Ga0495621_0068326
4329 Ga0495621_0123789
4330 Ga0495597_0000630
4331 Ga0495597_0001389
4332 Ga0495597_0035388
4333 Ga0495645_0002965
4334 Ga0495645_0029507
4335 Ga0495645_0048632
4336 Ga0495622_0011694
4337 Ga0495622_0022983
4338 Ga0495622_0043843
4339 Ga0495622_0086509
4340 Ga0495633_0000738
4341 Ga0495633_0002417
4342 Ga0495633_0013946
4343 Ga0495633_0015230
4344 Ga0495633_0083370
4345 Ga0495667_0004813
4346 Ga0495667_0027311
4347 Ga0495667_0157469
4348 Ga0495656_0041044
4349 Ga0495656_0129291
4350 Ga0495668_0000875
4351 Ga0495668_0011677
4352 Ga0495668_0029895
4353 Ga0495668_0032070
4354 Ga0495668_0037250
4355 Ga0495668_0149732
4356 Ga0495668_0402661
4357 Ga0495634_0003016
4358 Ga0495634_0091748
4359 Ga0495634_0112839
4360 Ga0495611_0012931
4361 Ga0495611_0024624
4362 Ga0495611_0109080
4363 Ga0495625_0002719
4364 Ga0495625_0006919
4365 Ga0495625_0007076
4366 Ga0495625_0010836
4367 Ga0495625_0017497
4368 Ga0495625_0018949
4369 Ga0495625_0103309
4370 Ga0495625_0233511
4371 Ga0495635_0009317
4372 Ga0495635_0023830
4373 Ga0495635_0163520
4374 Ga0495659_0000007
4375 Ga0495659_0000741
4376 Ga0495659_0002385
4377 Ga0495661_0000008
4378 Ga0495661_0005792
4379 Ga0495661_0084090
4380 Ga0495661_0153239
4381 Ga0495661_0312445
4382 Ga0495588_0001390
4383 Ga0495588_0009976
4384 Ga0495588_0324279
4385 Ga0495657_0003474
4386 Ga0495599_0012568
4387 Ga0495599_0030716
4388 Ga0495599_0178057
4389 Ga0495623_0031617
4390 Ga0495623_0090100
4391 Ga0495623_0281608
4392 Ga0495646_0291946
4393 Ga0495647_0004595
4394 Ga0495647_0014637
4395 Ga0495647_0024147
4396 Ga0495658_0008157
4397 Ga0495658_0008470
4398 Ga0495658_0053588
4399 Ga0495658_0083029
4400 Ga0495658_0138195
4401 Ga0495669_0002019
4402 Ga0495669_0012169
4403 Ga0495669_0022577
4404 Ga0495669_0057763
4405 Ga0495669_0072507
4406 Ga0495613_0012954
4407 Ga0495613_0028419
4408 Ga0495613_0081477
4409 Ga0495613_0312084
4410 Ga0495624_0005122
4411 Ga0495624_0006495
4412 Ga0495624_0034068
4413 Ga0495624_0071884
4414 Ga0495670_0001574
4415 Ga0495670_0009279
4416 Ga0495670_0021697
4417 Ga0495670_0042676
4418 Ga0495671_0000521
4419 Ga0495671_0179511
4420 Ga0495649_0003458
4421 Ga0495649_0007278
4422 Ga0495649_0129623
4423 Ga0495649_0158700
4424 Ga0495589_0156595
4425 Ga0495589_0258258
4426 Ga0495600_0002113
4427 Ga0495600_0008815
4428 Ga0495660_0000088
4429 Ga0495660_0000476
4430 Ga0495660_0001105
4431 Ga0495660_0002203
4432 Ga0495660_0022170
4433 Ga0495581_0010897
4434 Ga0495581_0012078
4435 Ga0495604_0005104
4436 Ga0495604_0005897
4437 Ga0495604_0044714
4438 Ga0495636_0001121
4439 Ga0495636_0011491
4440 Ga0495636_0073667
4441 Ga0495674_0001841
4442 Ga0495674_0028067
4443 Ga0495672_0000014
4444 Ga0495672_0000285
4445 Ga0495672_0001228
4446 Ga0495672_0032327
4447 Ga0495672_0067513
4448 Ga0495676_0067445
4449 Ga0495676_0085843
4450 Ga0495676_0223523
4451 Ga0495680_0001322
4452 Ga0495683_0000809
4453 Ga0495683_0047413
4454 Ga0495683_0083039
4455 Ga0495683_0188793
4456 Ga0495687_001324
4457 Ga0495687_001794
4458 Ga0495687_003369
4459 Ga0495687_009276
4460 Ga0495687_021501
4461 Ga0495675_0004442
4462 Ga0495677_0010538
4463 Ga0495677_0118055
4464 Ga0495679_022024
4465 Ga0495679_034079
4466 Ga0495685_000624
4467 Ga0495685_018083
4468 Ga0495673_0000525
4469 Ga0495673_0029487
4470 Ga0495673_0107676
4471 Ga0495684_0065461
4472 Ga0495684_0124558
4473 Ga0495686_0004524
4474 Ga0495686_0249618
4475 Ga0495593_0003267
4476 Ga0495593_0011754
4477 Ga0495593_0159933
4478 Ga0495602_0001522
4479 Ga0495614_0102366
4480 Ga0496100_0158786
4481 Ga0496101_0013436
4482 Ga0496101_0102541
4483 Ga0496101_0412582
4484 Ga0496102_0001172
4485 Ga0496102_0004735
4486 Ga0496102_0010080
4487 Ga0496102_0039427
4488 Ga0496102_0044182
4489 Ga0496102_0095294
4490 Ga0496103_0022306
4491 Ga0496103_0029262
4492 Ga0496103_0052043
4493 Ga0496103_0112760
4494 Ga0496103_0141553
4495 Ga0496103_0418200
4496 Ga0496104_0013714
4497 Ga0496104_0013828
4498 Ga0496104_0052425
4499 Ga0496104_0072227
4500 Ga0496104_0144591
4501 Ga0496104_0317260
4502 Ga0496105_0019607
4503 Ga0496105_0040611
4504 Ga0496105_0042979
4505 Ga0496105_0177806
4506 Ga0496106_0106122
4507 Ga0496106_0146589
4508 Ga0496106_0154299
4509 Ga0496106_0236249
4510 Ga0496106_0690443
4511 Ga0496107_0046877
4512 Ga0496107_0066793
4513 Ga0496107_0076307
4514 Ga0496107_0112675
4515 Ga0496107_0249449
4516 Ga0496107_0485477
4517 Ga0496108_0007768
4518 Ga0496108_0030580
4519 Ga0496108_0606575
4520 Ga0496109_0013203
4521 Ga0496109_0016571
4522 Ga0496109_0164136
4523 Ga0496109_0226271
4524 Ga0496109_0615170
4525 Ga0496110_0013454
4526 Ga0496110_0022480
4527 Ga0496110_0123893
4528 Ga0496110_0140607
4529 Ga0496110_0206945
4530 Ga0496110_0207997
4531 Ga0496110_0299417
4532 Ga0496110_0463767
4533 Ga0496110_0544306
4534 Ga0496111_0021330
4535 Ga0496111_0034953
4536 Ga0496111_0039106
4537 Ga0496111_0115267
4538 Ga0496111_0118117
4539 Ga0496111_0144725
4540 Ga0496111_0151644
4541 Ga0496112_0067770
4542 Ga0496112_0139760
4543 Ga0496112_0170604
4544 Ga0496112_0296922
4545 Ga0496112_0331874
4546 Ga0496112_0546107
4547 Ga0496112_0786749
4548 Ga0496113_0005324
4549 Ga0496113_0096372
4550 Ga0496113_0098211
4551 Ga0496113_0283331
4552 Ga0496113_0378976
4553 Ga0496114_0055275
4554 Ga0496114_0062448
4555 Ga0496114_0094418
4556 Ga0496114_0158043
4557 Ga0496114_0170208
4558 Ga0496114_0352680
4559 Ga0496114_0572495
4560 Ga0496114_0685038
4561 Ga0496115_0008912
4562 Ga0496115_0039349
4563 Ga0496115_0087048
4564 Ga0496115_0311506
4565 Ga0496116_0015318
4566 Ga0496116_0017629
4567 Ga0496116_0021466
4568 Ga0496116_0086191
4569 Ga0496117_0000010
4570 Ga0496117_0054805
4571 Ga0496117_0076542
4572 Ga0496117_0141061
4573 Ga0496118_0000009
4574 Ga0496118_0019784
4575 Ga0496118_0021278
4576 Ga0496118_0025820
4577 Ga0496118_0042073
4578 Ga0496118_0045289
4579 Ga0496118_0094892
4580 Ga0496118_0195979
4581 Ga0496119_0020769
4582 Ga0496119_0057610
4583 Ga0496119_0105480
4584 Ga0496119_0143213
4585 Ga0496119_0275698
4586 Ga0496120_0023889
4587 Ga0496120_0031549
4588 Ga0496121_0000479
4589 Ga0496121_0003573
4590 Ga0496121_0005384
4591 Ga0496121_0008714
4592 Ga0496121_0019117
4593 Ga0496121_0026869
4594 Ga0496121_0041119
4595 Ga0496121_0054152
4596 Ga0496121_0058920
4597 Ga0496121_0063515
4598 Ga0496121_0067062
4599 Ga0496121_0164215
4600 Ga0496121_0168464
4601 Ga0496122_0000320
4602 Ga0496122_0000878
4603 Ga0496122_0003066
4604 Ga0496122_0046042
4605 Ga0496122_0153054
4606 Ga0496123_0000258
4607 Ga0496123_0000603
4608 Ga0496123_0004181
4609 Ga0496123_0137995
4610 Ga0496123_0138924
4611 Ga0496124_0002457
4612 Ga0496124_0007078
4613 Ga0496124_0028933
4614 Ga0496124_0035805
4615 Ga0496124_0040925
4616 Ga0496124_0158046
4617 Ga0496124_0160111
4618 Ga0496124_0229539
4619 Ga0496124_0419853
4620 Ga0496125_0000168
4621 Ga0496125_0012765
4622 Ga0496125_0047258
4623 Ga0496125_0061710
4624 Ga0496125_0075479
4625 Ga0496125_0083732
4626 Ga0496125_0101613
4627 Ga0496125_0272888
4628 Ga0496126_0007773
4629 Ga0496126_0016969
4630 Ga0496126_0021091
4631 Ga0496126_0029480
4632 Ga0496126_0036823
4633 Ga0496126_0053954
4634 Ga0496126_0081237
4635 Ga0496126_0133797
4636 Ga0496126_0135289
4637 Ga0496126_0173860
4638 Ga0496126_0257893
4639 Ga0496126_0412030
4640 Ga0495678_000241
4641 Ga0495678_003780
4642 Ga0495682_0000675
4643 Ga0495682_0007891
4644 Ga0495682_0018652
4645 Ga0495682_0021435
4646 Ga0495682_0076044
4647 Ga0501291_012982
4648 Ga0501298_018222
4649 Ga0501298_026608
4650 Ga0501298_058088
4651 Ga0501031_0008748
4652 Ga0501031_0133063
4653 Ga0501031_0240445
4654 Ga0501032_0000017
4655 Ga0501032_0027373
4656 Ga0501032_0073017
4657 Ga0501033_0000029
4658 Ga0501033_0002889
4659 Ga0501033_0018642
4660 Ga0501033_0038550
4661 Ga0501033_0093760
4662 Ga0501034_0000102
4663 Ga0501034_0000364
4664 Ga0501034_0004358
4665 Ga0501034_0021404
4666 Ga0501034_0341971
4667 Ga0501034_0362495
4668 Ga0501034_0407256
4669 Ga0501034_0435830
4670 Ga0501036_0000011
4671 Ga0501036_0001177
4672 Ga0501036_0070613
4673 Ga0501036_0189033
4674 Ga0501036_0294005
4675 Ga0501036_0321115
4676 Ga0501036_0363197
4677 Ga0501036_0393523
4678 Ga0501037_0000015
4679 Ga0501037_0068814
4680 Ga0501037_0080883
4681 Ga0501037_0235433
4682 Ga0501038_0000016
4683 Ga0501038_0032182
4684 Ga0501038_0345160
4685 Ga0501038_0579442
4686 Ga0501039_0000023
4687 Ga0501039_0016154
4688 Ga0501039_0023535
4689 Ga0501039_0130627
4690 Ga0501039_0563473
4691 Ga0501039_0667607
4692 Ga0501040_0002138
4693 Ga0501040_0026194
4694 Ga0501040_0027827
4695 Ga0501040_0327789
4696 Ga0501040_0693838
4697 Ga0501041_0000193
4698 Ga0501041_0024077
4699 Ga0501041_0072591
4700 Ga0501041_0077125
4701 Ga0501041_0098276
4702 Ga0501042_0004565
4703 Ga0501042_0090866
4704 Ga0501042_0136282
4705 Ga0501043_0001694
4706 Ga0501043_0017400
4707 Ga0501043_0088181
4708 Ga0501046_0036927
4709 Ga0501046_0062516
4710 Ga0501046_0236852
4711 Ga0501046_0431171
4712 Ga0501047_0002883
4713 Ga0501047_0004523
4714 Ga0501047_0010121
4715 Ga0501047_0047731
4716 Ga0501047_0084472
4717 Ga0501047_0220757
4718 Ga0501047_0254770
4719 Ga0501048_0098248
4720 Ga0501048_0199254
4721 Ga0501067_0003557
4722 Ga0501068_0029366
4723 Ga0501068_0040430
4724 Ga0501068_0043517
4725 Ga0501068_0157162
4726 Ga0501068_0191929
4727 Ga0501069_0067446
4728 Ga0501069_0321767
4729 Ga0501070_0000831
4730 Ga0501070_0214440
4731 Ga0501070_0245868
4732 Ga0501071_0013067
4733 Ga0501071_0112715
4734 Ga0501071_0457811
4735 Ga0501072_0019551
4736 Ga0501072_0029256
4737 Ga0501072_0042997
4738 Ga0501072_0054043
4739 Ga0501072_0532452
4740 Ga0501073_0003485
4741 Ga0501073_0212076
4742 Ga0501073_0344306
4743 Ga0501073_0433509
4744 Ga0501074_0036921
4745 Ga0501074_0053439
4746 Ga0501074_0207685
4747 Ga0501074_0281342
4748 Ga0501075_0000888
4749 Ga0501075_0003954
4750 Ga0501075_0007178
4751 Ga0501075_0011908
4752 Ga0501075_0372108
4753 Ga0501076_0003340
4754 Ga0501076_0004337
4755 Ga0501076_0010586
4756 Ga0501076_0013603
4757 Ga0501076_0033611
4758 Ga0501076_0066200
4759 Ga0501076_0139395
4760 Ga0501076_0188527
4761 Ga0501076_0965950
4762 Ga0501077_0002416
4763 Ga0501077_0019630
4764 Ga0501077_0021769
4765 Ga0501077_0042340
4766 Ga0501077_0177679
4767 Ga0501222_004481
4768 Ga0501227_001267
4769 Ga0501227_009588
4770 Ga0501249_015779
4771 Ga0501249_038294
4772 Ga0501221_016924
4773 Ga0501079_0000582
4774 Ga0501079_0004666
4775 Ga0501079_0008816
4776 Ga0501079_0181739
4777 Ga0501079_0226343
4778 Ga0501079_0237396
4779 Ga0501079_0283333
4780 Ga0501080_0003730
4781 Ga0501080_0011958
4782 Ga0501080_0013237
4783 Ga0501080_0021885
4784 Ga0501080_0032138
4785 Ga0501080_0093877
4786 Ga0501080_0317392
4787 Ga0501080_0586869
4788 Ga0501081_0000369
4789 Ga0501081_0002042
4790 Ga0501081_0007011
4791 Ga0501083_0001666
4792 Ga0501083_0029357
4793 Ga0501083_0068530
4794 Ga0501241_015477
4795 Ga0501269_000671
4796 Ga0501283_011716
4797 Ga0501283_015171
4798 Ga0501035_0000038
4799 Ga0501035_0018125
4800 Ga0501035_0023460
4801 Ga0501035_0153478
4802 Ga0501035_0160127
4803 Ga0501035_0179758
4804 Ga0501035_0194833
4805 Ga0501035_0605562
4806 Ga0501044_0000850
4807 Ga0501044_0003435
4808 Ga0501044_0004489
4809 Ga0501044_0008000
4810 Ga0501044_0223494
4811 Ga0501045_0000091
4812 Ga0501045_0016917
4813 Ga0501045_0019665
4814 Ga0501045_0023900
4815 Ga0501045_0591800
4816 nmdc:mga03683_27233_c1
4817 nmdc:mga03683_85154_c1
4818 nmdc:mga03n38_117581_c1
4819 nmdc:mga03n38_123061_c1
4820 nmdc:mga03n38_168774_c1
4821 nmdc:mga00v17_128410_c1
4822 nmdc:mga00v17_244838_c1
4823 nmdc:mga00v17_298933_c1
4824 nmdc:mga00v17_70112_c1
4825 nmdc:mga00v17_704929_c1
4826 nmdc:mga0yw44_14514_c1
4827 nmdc:mga0yw44_298167_c1
4828 nmdc:mga0yw44_45730_c1
4829 nmdc:mga0yw44_68185_c1
4830 nmdc:mga0yw44_76443_c1
4831 nmdc:mga0k408_26665_c1
4832 nmdc:mga0k408_90556_c1
4833 nmdc:mga0k408_94375_c1
4834 nmdc:mga06z11_10443_c1
4835 nmdc:mga04h51_94543_c1
4836 nmdc:mga07m45_223816_c1
4837 nmdc:mga05p37_108903_c1
4838 nmdc:mga05p37_1105_c1
4839 nmdc:mga05p37_1115788_c1
4840 nmdc:mga05p37_154762_c1
4841 nmdc:mga05p37_16768_c1
4842 nmdc:mga05p37_375381_c1
4843 nmdc:mga05p37_382900_c1
4844 nmdc:mga05p37_82199_c1
4845 nmdc:mga05p37_946_c1
4846 nmdc:mga09592_138609_c1
4847 nmdc:mga09592_14281_c1
4848 nmdc:mga09592_148_c1
4849 nmdc:mga09592_223_c1
4850 nmdc:mga09592_37143_c1
4851 nmdc:mga09592_47913_c1
4852 nmdc:mga09592_95302_c1
4853 nmdc:mga0qj67_13203_c1
4854 nmdc:mga0qj67_287556_c1
4855 nmdc:mga0qj67_368224_c1
4856 nmdc:mga0qj67_6761_c1
4857 nmdc:mga0qj67_81159_c1
4858 nmdc:mga06r32_2367_c1
4859 nmdc:mga06r32_24322_c1
4860 nmdc:mga06r32_371314_c1
4861 nmdc:mga06r32_385365_c1
4862 nmdc:mga06r32_595429_c1
4863 nmdc:mga08y16_11195_c1
4864 nmdc:mga08y16_141849_c1
4865 nmdc:mga08y16_15627_c1
4866 nmdc:mga08y16_160778_c1
4867 nmdc:mga08y16_181845_c1
4868 nmdc:mga08y16_2868_c1
4869 nmdc:mga08y16_310150_c1
4870 nmdc:mga08y16_36399_c1
4871 nmdc:mga08y16_384315_c1
4872 nmdc:mga08y16_5540_c1
4873 nmdc:mga08y16_72310_c1
4874 nmdc:mga0n895_141779_c1
4875 nmdc:mga0n895_222600_c1
4876 nmdc:mga0n895_2429_c1
4877 nmdc:mga0n895_344403_c1
4878 nmdc:mga0n895_363643_c1
4879 nmdc:mga0n895_393347_c1
4880 nmdc:mga0n895_461356_c1
4881 nmdc:mga0n895_4960_c1
4882 nmdc:mga0n895_799508_c1
4883 nmdc:mga0n895_8012_c1
4884 nmdc:mga0n895_87597_c1
4885 nmdc:mga0rr50_17877_c1
4886 nmdc:mga0rr50_179011_c1
4887 nmdc:mga0rr50_2208_c1
4888 nmdc:mga0rr50_291077_c1
4889 nmdc:mga0rr50_330413_c1
4890 nmdc:mga0rr50_616202_c1
4891 nmdc:mga0rr50_636136_c1
4892 nmdc:mga0rr50_914_c1
4893 nmdc:mga08x19_171797_c1
4894 nmdc:mga08x19_19887_c1
4895 nmdc:mga08x19_219137_c1
4896 nmdc:mga08x19_258238_c1
4897 nmdc:mga08x19_29107_c1
4898 nmdc:mga08x19_388064_c1
4899 nmdc:mga08x19_41196_c1
4900 nmdc:mga08x19_724_c1
4901 nmdc:mga08x19_8960_c1
4902 nmdc:mga0a205_119665_c1
4903 nmdc:mga0a205_148545_c1
4904 nmdc:mga0a205_187_c1
4905 nmdc:mga0a205_244041_c1
4906 nmdc:mga0a205_314855_c1
4907 nmdc:mga0a205_371_c1
4908 nmdc:mga0a205_399017_c1
4909 nmdc:mga0a205_510668_c1
4910 nmdc:mga0a205_623288_c1
4911 nmdc:mga0a205_62609_c1
4912 nmdc:mga0sz30_37313_c1
4913 nmdc:mga0sz30_78981_c1
4914 Ga0495601_0060495
4915 Ga0495601_0198513
4916 Ga0500610_0068549
4917 Ga0500635_0000979
4918 Ga0500635_0007194
4919 Ga0500635_0121307
4920 Ga0495655_0002112
4921 Ga0495655_0008570
4922 Ga0495595_0045651
4923 Ga0495619_0018931
4924 Ga0500643_000052
4925 Ga0500647_0123876
4926 Ga0500583_0178299
4927 Ga0500566_0000181
4928 Ga0500566_0057395
4929 Ga0500566_0067942
4930 Ga0500640_006447
4931 Ga0500641_0030645
4932 Ga0500641_0033383
4933 Ga0500555_044960
4934 Ga0500557_000046
4935 Ga0500572_000837
4936 Ga0500572_001605
4937 Ga0500591_014440
4938 Ga0500595_014551
4939 Ga0500595_017928
4940 Ga0500595_022350
4941 Ga0500608_015000
4942 Ga0500614_005405
4943 Ga0500618_001833
4944 Ga0500642_0000038
4945 Ga0500642_0010337
4946 Ga0500642_0073992
4947 Ga0500559_0000695
4948 Ga0500559_0000713
4949 Ga0500559_0030345
4950 Ga0500564_068772
4951 Ga0500568_0037435
4952 Ga0500573_0002705
4953 Ga0500573_0018205
4954 Ga0500573_0024618
4955 Ga0500589_078260
4956 Ga0500590_031550
4957 Ga0500590_033219
4958 Ga0500603_002928
4959 Ga0500603_011859
4960 Ga0500603_042704
4961 Ga0500620_135237
4962 Ga0500622_0008750
4963 Ga0500624_042000
4964 Ga0500630_005801
4965 Ga0500634_0007991
4966 Ga0500639_000035
4967 Ga0500639_003323
4968 Ga0500639_106247
4969 Ga0500636_0004059
4970 Ga0500636_0218200
4971 Ga0500637_0114339
4972 Ga0500637_0211359
4973 Ga0500576_070163
4974 Ga0500576_109747
4975 Ga0500609_003220
4976 Ga0500552_001241
4977 Ga0500596_000368
4978 Ga0500596_001567
4979 Ga0500599_001055
4980 Ga0500601_002196
4981 Ga0501084_0002360
4982 Ga0501084_0093182
4983 Ga0501084_0123528
4984 Ga0587077_000034
4985 Ga0587077_000440
4986 Ga0501082_0002452
4987 Ga0501082_0010757
4988 Ga0501082_0015587
4989 Ga0501082_0019165
4990 Ga0501082_0043148
4991 Ga0501082_0043247
4992 Ga0501082_0047946
4993 Ga0501082_0144607
4994 Ga0466962_0020654
4995 Ga0466962_0182994
4996 Ga0466962_0220412
4997 Ga0466962_0291041
4998 Ga0530510_0000042
4999 Ga0530510_0000505
5000 Ga0530510_0000628
5001 Ga0530510_0257708
5002 Ga0530510_0269324
5003 2507512056
5004 2508545717
5005 2508694540
5006 2509151269
5007 2511249780
5008 2511401145
5009 2513624547
5010 2513638592
5011 2513650025
5012 2513678480
5013 2513704172
5014 2513720176
5015 2513874310
5016 2513892334
5017 2514014793
5018 2514016802
5019 2515624530
5020 2517104541
5021 2524438500
5022 2524466286
5023 2524534970
5024 2528850203
5025 2596374091
5026 2599902959
5027 2601666792
5028 2617353159
5029 2617374516
5030 2643790205
5031 2643861782
5032 2643983183
5033 2644028046
5034 2644123444
5035 2644131911
5036 2644215199
5037 2644249142
5038 2644355927
5039 2644401261
5040 2692315000
5041 2738740577
5042 2738844897
5043 2739277312
5044 2739346355
5045 2745077279
5046 2793059448
5047 2805916076
5048 2809033292
5049 2818242988
5050 2823425252
5051 2824604468
5052 2824614991
5053 2824624297
5054 2824633070
5055 2824640660
5056 2824650121
5057 2824657486
5058 2824665169
5059 2824674021
5060 2824680215
5061 2824691236
5062 2824700925
5063 2824709732
5064 2824720019
5065 2824728147
5066 2824736146
5067 2824748022
5068 2824759309
5069 2824768573
5070 2824778296
5071 2829747098
5072 2838128577
5073 2838740239
5074 2841843636
5075 2841942433
5076 2841952057
5077 2841953221
5078 2841960751
5079 2841973890
5080 2841982955
5081 2841984450
5082 2842041827
5083 2842049869
5084 2842143356
5085 2842714074
5086 2844321284
5087 2847419942
5088 2847932125
5089 2847943356
5090 2849077080
5091 2855732706
5092 2855771458
5093 2855877012
5094 2857514627
5095 2857536723
5096 2857538218
5097 2857548558
5098 2857562535
5099 2857580831
5100 2858952041
5101 2861694355
5102 2874595763
5103 2874614963
5104 2874624184
5105 2874630362
5106 2874651605
5107 2876767610
5108 2876775960
5109 2876808693
5110 2876821168
5111 2879080049
5112 2879083520
5113 2879106475
5114 2879111961
5115 2879132723
5116 2879146508
5117 2881367558
5118 2881416662
5119 2881669271
5120 2881929202
5121 2885083244
5122 2885374558
5123 2885392401
5124 2885417342
5125 2887377444
5126 2887378605
5127 2888387582
5128 2888391622
5129 2888426802
5130 2889311532
5131 2895513628
5132 2902334061
5133 2902411843
5134 2903731525
5135 2903751785
5136 2903775640
5137 2904430684
5138 2904670895
5139 2904711030
5140 2904713490
5141 2906607898
5142 2906633119
5143 2906645695
5144 2908740208
5145 2908776995
5146 2919481328
5147 2922376559
5148 2922393389
5149 2928130095
5150 2929619940
5151 2929629252
5152 2932413153
5153 2932420668
5154 2932789622
5155 2932796703
5156 2932802515
5157 2932814872
5158 2932824271
5159 2932834001
5160 2933581858
5161 2935613301
5162 2935623609
5163 2935644996
5164 2935653825
5165 2935662574
5166 2935672045
5167 2935683029
5168 2935689199
5169 2935697543
5170 2935711120
5171 2935720145
5172 2935728238
5173 2935737165
5174 2935746774
5175 2935757741
5176 2935764121
5177 2935776404
5178 2935784335
5179 2935792371
5180 2935800534
5181 2935808709
5182 2935817505
5183 2935824845
5184 2935834158
5185 2935844760
5186 2935852065
5187 2935861784
5188 2935868580
5189 2935879354
5190 2935887044
5191 2935911412
5192 2935920946
5193 2935928441
5194 2935938086
5195 2935945368
5196 2935954126
5197 2935965937
5198 2935971606
5199 2935980009
5200 2935989435
5201 2935998478
5202 2936009061
5203 2936016778
5204 2936025411
5205 2936034351
5206 2936044302
5207 2936052408
5208 2936060690
5209 2939633758
5210 2940563437
5211 2941482456
5212 2941531864
5213 2941545345
5214 2954769234
5215 3003667219
5216 3005485852
5217 3005506717
5218 3005588843
5219 3005601621
5220 3005717356
5221 3005724315
5222 8006937526
5223 8006977554
5224 8016525060
5225 8016538637
5226 8016542926
5227 8016550365
5228 8016558775
5229 8016580979
5230 8016587766
5231 8016596750
5232 8016619429
5233 8016630176
5234 8016636988
5235 8017066234
5236 8019538307
5237 8019541669
5238 8019549115
5239 8019596428
5240 8019613275
5241 8019623946
5242 8019638090
5243 8019641547
5244 8019653460
5245 8019666008
5246 8019675526
5247 8019680572
5248 8019695185
5249 8034963248
5250 8055750308
5251 8056694793
5252 8056976083

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

36

251

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ymu-assembly1.cif.gz_C crystal structure of an amino acid abc transporter complex with arginines and atps 0.8714 6 225
4ymu-assembly1.cif.gz_C crystal structure of an amino acid abc transporter complex with arginines and atps 0.8522 6 225
3fh6-assembly2.cif.gz_H crystal structure of the resting state maltose transporter from e. coli 0.78 17 219
4jbw-assembly1.cif.gz_F crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.7785 25 214
7ahc-assembly1.cif.gz_B opua apo inward-facing 0.7727 25 223
ID Description Score Start End Superfamily
af_P0AFT2_3_219_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9336 8 226 1.10.3720.10
af_P0AEQ6_1_218_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9196 4 227 1.10.3720.10
af_P45768_144_364_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.919 21 226 1.10.3720.10
af_P0AEQ6_1_218_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9077 4 227 1.10.3720.10
af_P0AEU3_9_230_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9021 21 227 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A7W6EIY8-F1-model_v4 Glutamate/aspartate transport system permease protein 0.99 1 230 GO:0006865
GO:0022857
GO:0043190
AF-A0A446CQE5-F1-model_v4 Glutamate/aspartate import permease protein GltK 0.9878 4 225 GO:0006865
GO:0022857
GO:0043190
AF-A0A095UT51-F1-model_v4 Amino acid ABC transporter permease 0.9871 4 225 GO:0006865
GO:0022857
GO:0043190
AF-A0A6B3SJW9-F1-model_v4 ABC transporter permease subunit 0.9712 1 152 GO:0006865
GO:0022857
GO:0043190
AF-A0A0X1T1I2-F1-model_v4 Amino acid ABC transporter permease 0.9628 1 225 GO:0006865
GO:0022857
GO:0043190

Map