F496964

General Info

Members Datasets Scaffolds Average Seq Length
2626 1067 2122 210

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10088919|Ga0105240_100889193
Length 253
Sequence MSVVESCIVAAVTAITGEPAPGDLARDAANSSGSSSDASNSPLTGASRADASRGPVRGERRSSTTEHHPENGTLFGFWLYLMSDCLVFACLFAGYAVLGRNYAGGPTGAELFDLPLVAVNTSLLLLSSITYGFAMIEMQRGRLPGTLIWLGITGLLGAGFVGIELTEFAHLIHEGAGPGRSAFLSSFFTLVGTHGLHVTCGIIWLITLMVQSGKHGLIPENRRRLMCLSMFWHFLDVVWIGVFTFVYLMGVLP

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
3 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
4 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
5 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
6 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
7 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
8 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
9 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
10 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
11 2512875024 Mesorhizobium loti R88b Isolate Nodule
12 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
13 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
14 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
15 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
16 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
17 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
18 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
19 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
20 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
21 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
22 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
23 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
24 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
25 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
26 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
27 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
28 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
29 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
30 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
31 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
32 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
33 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
34 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
35 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
36 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
37 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
38 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
39 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
40 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
41 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
42 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
43 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
44 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
45 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
46 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
47 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
48 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
49 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
50 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
51 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
52 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
53 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
54 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
55 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
56 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
57 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
58 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
59 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
60 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
61 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
62 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
63 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
64 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
65 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
66 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
67 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
68 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
69 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
70 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
71 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
72 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
73 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
74 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
75 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
76 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
77 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
78 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
79 2643221556 Massilia sp. Root1485 Isolate Unclassified
80 2643221582 Rhizobium sp. Root651 Isolate Unclassified
81 2643221594 Achromobacter sp. Root170 Isolate Unclassified
82 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
83 2643221609 Acidovorax sp. Root217 Isolate Unclassified
84 2643221611 Acidovorax sp. Root219 Isolate Unclassified
85 2643221621 Achromobacter sp. Root83 Isolate Unclassified
86 2643221638 Duganella sp. Root336D2 Isolate Unclassified
87 2643221684 Massilia sp. Root133 Isolate Unclassified
88 2643221693 Rhizobium sp. Root491 Isolate Unclassified
89 2643221720 Lysobacter sp. Root916 Isolate Unclassified
90 2643221734 Bosea sp. Root670 Isolate Unclassified
91 2643221736 Bosea sp. Root483D1 Isolate Unclassified
92 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
93 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
94 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
95 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
96 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
97 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
98 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
99 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
100 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
101 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
102 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
103 2738543013 Variovorax sp. BT01 Isolate Unclassified
104 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
105 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
106 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
107 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
108 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
109 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
110 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
111 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
112 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
113 2791355263 Rhizobium chutanense C5 Isolate Nodule
114 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
115 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
116 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
117 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
118 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
119 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
120 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
121 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
122 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
123 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
124 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
125 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
126 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
127 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
128 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
129 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
130 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
131 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
132 2818991467 Bosea vestrisii 3192 Isolate Unclassified
133 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
134 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
135 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
136 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
137 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
138 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
139 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
140 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
141 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
142 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
143 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
144 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
145 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
146 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
147 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
148 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
149 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
150 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
151 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
152 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
153 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
154 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
155 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
156 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
157 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
158 2841760612 Bosea sp. Tri-49 Isolate Nodule
159 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
160 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
161 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
162 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
163 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
164 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
165 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
166 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
167 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
168 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
169 2842711865 Duganella sp. R-73148 Isolate Unclassified
170 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
171 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
172 2844104063 Bosea sp. Tri-39 Isolate Nodule
173 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
174 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
175 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
176 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
177 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
178 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
179 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
180 2851246043 Bosea sp. Tri-54 Isolate Nodule
181 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
182 2855730933 Achromobacter sp. HZ28 Isolate Nodule
183 2855767633 Achromobacter sp. HZ34 Isolate Nodule
184 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
185 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
186 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
187 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
188 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
189 2857553236 Duganella sp. R-74557 Isolate Unclassified
190 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
191 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
192 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
193 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
194 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
195 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
196 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
197 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
198 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
199 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
200 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
201 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
202 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
203 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
204 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
205 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
206 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
207 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
208 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
209 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
210 2884411467 Dyella sp. AD56 Isolate Rhizosphere
211 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
212 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
213 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
214 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
215 2885266251 Ralstonia sp. SET104 Isolate Nodule
216 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
217 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
218 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
219 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
220 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
221 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
222 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
223 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
224 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
225 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
226 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
227 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
228 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
229 2902330777 Methylobacterium sp. 2A Isolate Unclassified
230 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
231 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
232 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
233 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
234 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
235 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
236 2904424332 Duganella sp. 1411 Isolate Rhizosphere
237 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
238 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
239 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
240 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
241 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
242 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
243 2904699407
244 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
245 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
246 2906610324
247 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
248 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
249 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
250 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
251 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
252 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
253 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
254 2909042592 Labrys sp. LIt4 Isolate Nodule
255 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
256 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
257 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
258 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
259 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
260 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
261 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
262 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
263 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
264 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
265 2919476304 Duganella sp. 3397 Isolate Unclassified
266 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
267 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
268 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
269 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
270 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
271 2922368715
272 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
273 2922425934
274 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
275 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
276 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
277 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
278 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
279 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
280 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
281 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
282 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
283 2928058823 Ralstonia sp. 1138 Isolate Unclassified
284 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
285 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
286 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
287 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
288 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
289 2928963466 Dyella japonica 1073 Isolate Unclassified
290 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
291 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
292 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
293 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
294 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
295 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
296 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
297 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
298 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
299 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
300 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
301 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
302 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
303 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
304 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
305 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
306 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
307 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
308 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
309 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
310 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
311 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
312 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
313 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
314 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
315 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
316 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
317 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
318 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
319 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
320 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
321 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
322 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
323 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
324 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
325 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
326 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
327 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
328 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
329 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
330 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
331 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
332 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
333 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
334 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
335 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
336 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
337 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
338 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
339 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
340 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
341 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
342 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
343 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
344 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
345 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
346 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
347 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
348 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
349 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
350 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
351 2936381700 Rhizobium chutanense C16 Isolate Unclassified
352 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
353 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
354 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
355 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
356 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
357 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
358 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
359 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
360 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
361 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
362 2941479691
363 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
364 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
365 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
366 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
367 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
368 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
369 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
370 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
371 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
372 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
373 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
374 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
375 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
376 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
377 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
378 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
379 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
380 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
381 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
382 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
383 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
384 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
385 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
386 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
387 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
388 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
389 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
390 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
391 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
392 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
393 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
394 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
395 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
396 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
397 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
398 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
399 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
400 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
401 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
402 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
403 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
404 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
405 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
406 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
407 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
408 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
409 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
410 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
411 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
412 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
413 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
414 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
415 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
416 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
417 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
418 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
419 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
420 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
421 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
422 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
423 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
424 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
425 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
426 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
427 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
428 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
429 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
430 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
431 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
432 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
433 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
434 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
435 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
436 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
437 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
438 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
439 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
440 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
441 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
442 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
443 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
444 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
445 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
446 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
447 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
448 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
449 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
450 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
451 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
452 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
453 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
454 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
455 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
456 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
457 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
458 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
459 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
460 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
461 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
462 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
463 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
464 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
465 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
466 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
467 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
468 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
469 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
470 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
471 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
472 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
473 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
474 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
475 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
476 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
477 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
478 3300003565 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_16_lowP_mix3_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
479 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
480 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
481 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
482 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
483 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
484 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
485 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
486 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
487 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
488 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
489 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
490 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
491 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
492 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
493 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
494 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
495 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
496 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
497 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
498 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
499 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
500 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
501 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
502 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
503 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
504 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
505 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
506 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
507 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
508 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
509 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
510 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
511 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
512 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
513 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
514 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
515 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
516 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
517 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
518 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
519 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
520 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
521 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
522 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
523 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
524 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
525 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
526 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
527 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
528 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
529 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
530 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
531 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
532 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
533 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
534 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
535 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
536 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
537 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
538 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
539 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
540 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
541 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
542 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
543 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
544 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
545 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
546 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
547 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
548 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
549 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
550 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
551 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
552 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
553 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
554 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
555 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
556 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
557 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
558 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
559 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
560 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
561 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
562 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
563 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
564 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
565 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
566 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
567 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
568 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
569 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
570 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
571 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
572 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
573 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
574 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
575 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
576 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
577 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
578 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
579 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
580 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
581 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
582 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
583 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
584 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
585 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
586 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
587 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
588 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
589 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
590 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
591 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
592 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
593 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
594 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
595 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
596 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
597 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
598 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
599 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
600 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
601 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
602 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
603 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
604 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
605 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
606 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
607 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
608 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
609 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
610 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
611 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
612 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
613 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
614 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
615 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
616 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
617 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
618 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
619 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
620 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
621 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
622 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
623 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
624 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
625 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
626 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
627 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
628 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
629 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
630 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
631 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
632 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
633 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
634 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
635 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
636 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
637 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
638 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
639 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
640 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
641 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
642 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
643 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
644 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
645 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
646 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
647 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
648 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
649 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
650 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
651 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
652 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
653 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
654 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
655 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
656 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
657 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
658 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
659 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
660 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
661 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
662 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
663 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
664 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
665 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
666 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
667 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
668 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
669 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
670 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
671 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
672 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
673 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
674 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
675 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
676 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
677 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
678 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
679 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
680 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
681 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
682 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
683 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
684 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
685 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
686 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
687 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
688 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
689 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
690 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
691 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
692 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
693 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
694 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
695 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
696 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
697 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
698 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
699 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
700 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
701 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
702 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
703 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
704 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
705 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
706 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
707 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
708 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
709 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
710 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
711 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
712 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
713 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
714 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
715 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
716 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
717 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
718 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
719 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
720 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
721 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
722 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
723 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
724 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
725 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
726 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
727 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
728 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
729 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
730 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
731 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
732 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
733 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
734 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
735 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
736 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
737 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
738 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
739 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
740 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
741 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
742 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
743 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
744 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
745 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
746 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
747 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
748 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
749 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
750 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
751 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
752 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
753 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
754 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
755 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
756 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
757 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
758 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
759 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
760 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
761 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
762 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
763 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
764 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
765 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
766 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
767 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
768 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
769 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
770 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
771 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
772 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
773 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
774 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
775 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
776 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
777 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
778 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
779 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
780 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
781 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
782 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
783 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
784 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
785 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
786 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
787 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
788 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
789 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
790 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
791 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
792 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
793 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
794 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
795 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
796 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
797 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
798 3300044650 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E Metagenome Unclassified
799 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
800 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
801 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
802 3300044671 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E Metagenome Unclassified
803 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
804 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
805 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
806 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
807 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
808 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
809 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
810 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
811 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
812 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
813 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
814 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
815 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
816 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
817 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
818 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
819 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
820 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
821 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
822 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
823 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
824 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
825 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
826 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
827 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
828 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
829 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
830 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
831 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
832 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
833 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
834 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
835 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
836 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
837 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
838 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
839 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
840 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
841 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
842 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
843 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
844 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
845 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
846 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
847 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
848 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
849 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
850 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
851 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
852 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
853 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
854 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
855 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
856 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
857 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
858 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
859 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
860 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
861 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
862 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
863 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
864 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
865 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
866 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
867 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
868 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
869 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
870 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
871 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
872 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
873 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
874 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
875 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
876 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
877 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
878 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
879 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
880 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
881 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
882 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
883 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
884 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
885 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
886 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
887 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
888 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
889 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
890 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
891 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
892 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
893 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
894 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
895 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
896 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
897 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
898 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
899 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
900 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
901 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
902 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
903 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
904 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
905 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
906 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
907 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
908 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
909 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
910 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
911 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
912 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
913 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
914 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
915 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
916 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
917 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
918 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
919 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
920 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
921 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
922 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
923 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
924 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
925 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
926 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
927 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
928 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
929 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
930 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
931 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
932 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
933 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
934 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
935 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
936 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
937 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
938 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
939 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
940 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
941 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
942 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
943 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
944 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
945 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
946 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
947 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
948 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
949 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
950 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
951 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
952 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
953 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
954 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
955 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
956 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
957 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
958 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
959 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
960 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
961 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
962 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
963 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
964 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
965 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
966 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
967 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
968 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
969 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
970 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
971 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
972 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
973 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
974 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
975 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
976 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
977 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
978 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
979 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
980 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
981 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
982 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
983 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
984 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
985 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
986 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
987 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
988 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
989 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
990 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
991 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
992 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
993 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
994 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
995 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
996 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
997 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
998 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
999 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
1000 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1001 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1002 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1003 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1004 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1005 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1006 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1007 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1008 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1009 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1010 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1011 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1012 3300059650 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1013 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
1014 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
1015 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
1016 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
1017 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
1018 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
1019 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
1020 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
1021 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
1022 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
1023 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
1024 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
1025 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
1026 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
1027 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
1028 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
1029 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
1030 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
1031 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
1032 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
1033 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
1034 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
1035 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
1036 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
1037 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
1038 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
1039 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
1040 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
1041 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
1042 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
1043 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
1044 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
1045 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
1046 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
1047 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
1048 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
1049 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
1050 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
1051 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
1052 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
1053 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
1054 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
1055 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
1056 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
1057 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
1058 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
1059 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
1060 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
1061 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
1062 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
1063 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
1064 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule
1065 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule
1066 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
1067 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 79.6
Metatranscriptomes 1.33
Isolates 19.07

Biome Distribution

Category Percentage (%)
Aerial Root 0.11
Bulb 0
Endosphere 17.9
Nodule 13.1
Rhizoplane 3.5
Rhizosphere 50.99
Stem 0
Stem Tuber 0
Unclassified 14.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2021842 2162886007 Bacteria 4282
2 JGI24740J21852_10000390 3300001979 Bacteria 18868
3 JGI24740J21852_10000951 3300001979 Bacteria 12867
4 JGI24740J21852_10002198 3300001979 Bacteria 8918
5 JGI24740J21852_10012523 3300001979 Bacteria 3195
6 JGI24739J22299_10000198 3300001989 Bacteria 19994
7 JGI24739J22299_10001541 3300001989 Bacteria 8709
8 JGI24739J22299_10003127 3300001989 Bacteria 6314
9 JGI24739J22299_10013921 3300001989 Bacteria 2930
10 JGI24739J22299_10023558 3300001989 Bacteria 2175
11 JGI24737J22298_10001661 3300001990 Bacteria 7936
12 JGI24737J22298_10003377 3300001990 Bacteria 5644
13 JGI24737J22298_10015993 3300001990 Bacteria 2423
14 JGI24735J21928_10003170 3300002067 Bacteria 5625
15 JGI24735J21928_10006466 3300002067 Bacteria 3857
16 JGI24748J21848_1001189 3300002074 Bacteria 2839
17 JGI24738J21930_10002765 3300002075 Bacteria 4512
18 JGI24738J21930_10026316 3300002075 Bacteria 1193
19 JGI25155J39150_1000075 3300002704 Bacteria 62215
20 JGI25156J39149_1000048 3300002705 Bacteria 93954
21 JGI25156J39149_1000103 3300002705 Bacteria 62289
22 JGI25162J39368_1000021 3300002737 Bacteria 248155
23 JGI25162J39368_1000970 3300002737 Bacteria 18291
24 JGI25162J39368_1001545 3300002737 Bacteria 11843
25 JGI25154J39366_1000018 3300002738 Bacteria 251612
26 JGI25154J39366_1000071 3300002738 Bacteria 93822
27 JGI25154J39366_1000692 3300002738 Bacteria 15435
28 JGI25154J39366_1005746 3300002738 Bacteria 1926
29 JGI25158J39367_1014118 3300002739 Bacteria 1036
30 JGI25157J39369_1000074 3300002741 Bacteria 88240
31 JGI25157J39369_1000588 3300002741 Bacteria 21483
32 JGI25157J39369_1002404 3300002741 Bacteria 4707
33 JGI25163J39215_1000176 3300002771 Bacteria 24906
34 JGI25163J39215_1004840 3300002771 Bacteria 906
35 JGI25164J39214_1000122 3300002772 Bacteria 74977
36 JGI25164J39214_1000343 3300002772 Bacteria 29236
37 JGI25152J39213_1008946 3300002773 Bacteria 2429
38 JGI25150J39212_1010644 3300002774 Bacteria 1700
39 JGI25159J45721_1006750 3300002987 Bacteria 3382
40 JGI25159J45721_1014430 3300002987 Bacteria 1784
41 JGI25151J46595_10000036 3300003187 Bacteria 188770
42 JGI25151J46595_10000274 3300003187 Bacteria 59318
43 JGI25151J46595_10000578 3300003187 Bacteria 32673
44 JGI25151J46595_10001431 3300003187 Bacteria 16227
45 JGI25151J46595_10062387 3300003187 Bacteria 1179
46 JGI25406J46586_10039609 3300003203 Bacteria 1678
47 JGI25165J46597_1000049 3300003214 Bacteria 248154
48 JGI25165J46597_1000241 3300003214 Bacteria 74955
49 JGI25165J46597_1000627 3300003214 Bacteria 29332
50 JGI25165J46597_1005428 3300003214 Bacteria 2456
51 JGI25153J46596_10015502 3300003215 Bacteria 3100
52 JGI25153J46596_10023022 3300003215 Bacteria 2279
53 JGI25153J46596_10023273 3300003215 Bacteria 2263
54 JGI25153J46596_10059019 3300003215 Bacteria 1052
55 JGI25153J46596_10093534 3300003215 Bacteria 721
56 rootH1_10054725 3300003316 Bacteria 1601
57 rootH1_10051241 3300003323 Bacteria 1688
58 JGI25160J50197_1000044 3300003354 Bacteria 145379
59 JGI25160J50197_1001913 3300003354 Bacteria 9965
60 JGI25160J50197_1009339 3300003354 Bacteria 3648
61 JGI25160J50197_1021034 3300003354 Bacteria 1950
62 JGI25160J50197_1022406 3300003354 Bacteria 1852
63 JGI25160J50197_1051285 3300003354 Bacteria 874
64 JGI25161J50226_1000028 3300003374 Bacteria 145379
65 JGI25161J50226_1001192 3300003374 Bacteria 8533
66 JGI25161J50226_1004780 3300003374 Bacteria 2773
67 Ga0007417J51691_1011014 3300003544 Bacteria 4420
68 Ga0006560J51390_1031751 3300003565 Bacteria 2576
69 Ga0007410J51695_1014726 3300003574 Bacteria 4447
70 Ga0006562J51391_1006334 3300003578 Bacteria 7660
71 Ga0006562J51391_1006340 3300003578 Bacteria 2580
72 Ga0032354_1007062 3300003693 Bacteria 4743
73 Ga0055538_1000002 3300003751 Bacteria 999437
74 Ga0055538_1000023 3300003751 Bacteria 248154
75 Ga0055539_1000002 3300003752 Bacteria 999437
76 Ga0055539_1000030 3300003752 Bacteria 248154
77 Ga0055539_1000062 3300003752 Bacteria 141171
78 Ga0055539_1017949 3300003752 Bacteria 853
79 Ga0055539_1019733 3300003752 Bacteria 806
80 Ga0055533_1000004 3300003756 Bacteria 999437
81 Ga0055533_1000039 3300003756 Bacteria 248154
82 Ga0055533_1002704 3300003756 Bacteria 3904
83 Ga0055533_1009200 3300003756 Bacteria 1192
84 Ga0055532_1000019 3300003758 Bacteria 286358
85 Ga0055532_1000102 3300003758 Bacteria 91562
86 Ga0055525_1000002 3300003759 Bacteria 999437
87 Ga0055525_1000048 3300003759 Bacteria 248154
88 Ga0055525_1000135 3300003759 Bacteria 108217
89 Ga0055525_1000275 3300003759 Bacteria 47849
90 Ga0055527_1000043 3300003760 Bacteria 113506
91 Ga0055527_1000079 3300003760 Bacteria 79303
92 Ga0055527_1004395 3300003760 Bacteria 1943
93 Ga0055535_1000014 3300003761 Bacteria 286358
94 Ga0055535_1000071 3300003761 Bacteria 113506
95 Ga0055535_1000166 3300003761 Bacteria 71280
96 Ga0055535_1000245 3300003761 Bacteria 57307
97 Ga0055535_1000279 3300003761 Bacteria 53696
98 Ga0055535_1000376 3300003761 Bacteria 42604
99 Ga0055542_1000096 3300003762 Bacteria 118398
100 Ga0055542_1000139 3300003762 Bacteria 90228
101 Ga0055542_1000210 3300003762 Bacteria 71284
102 Ga0055542_1000285 3300003762 Bacteria 56650
103 Ga0055542_1000588 3300003762 Bacteria 31406
104 Ga0055542_1000992 3300003762 Bacteria 18291
105 Ga0055542_1001245 3300003762 Bacteria 14078
106 Ga0055542_1001823 3300003762 Bacteria 8720
107 Ga0055542_1009181 3300003762 Bacteria 1881
108 Ga0055542_1010711 3300003762 Bacteria 1663
109 Ga0055529_1000086 3300003763 Bacteria 140681
110 Ga0055529_1000114 3300003763 Bacteria 118398
111 Ga0055529_1000304 3300003763 Bacteria 56650
112 Ga0055529_1000394 3300003763 Bacteria 46666
113 Ga0055529_1000720 3300003763 Bacteria 21735
114 Ga0055529_1010408 3300003763 Bacteria 1210
115 Ga0055526_1000001 3300003771 Bacteria 669703
116 Ga0055526_1002407 3300003771 Bacteria 12667
117 Ga0055526_1003918 3300003771 Bacteria 9188
118 Ga0055526_1007009 3300003771 Bacteria 5973
119 Ga0055526_1007108 3300003771 Bacteria 5905
120 Ga0055526_1011050 3300003771 Bacteria 4121
121 Ga0055526_1011561 3300003771 Bacteria 3959
122 Ga0055526_1047817 3300003771 Bacteria 1001
123 Ga0055526_1063866 3300003771 Bacteria 773
124 Ga0055537_1006548 3300003773 Bacteria 2934
125 Ga0055537_1020991 3300003773 Bacteria 979
126 Ga0055524_1000018 3300003775 Bacteria 234806
127 Ga0055524_1000159 3300003775 Bacteria 78586
128 Ga0055524_1000809 3300003775 Bacteria 20756
129 Ga0055524_1021588 3300003775 Bacteria 2129
130 Ga0055524_1026308 3300003775 Bacteria 1801
131 Ga0055524_1030536 3300003775 Bacteria 1569
132 Ga0055536_1000078 3300003781 Bacteria 83510
133 Ga0055536_1010784 3300003781 Bacteria 3579
134 Ga0055534_1000759 3300003784 Bacteria 15323
135 Ga0055534_1002008 3300003784 Bacteria 7403
136 Ga0055534_1002624 3300003784 Bacteria 6123
137 Ga0055528_1000162 3300003790 Bacteria 55910
138 Ga0055528_1000511 3300003790 Bacteria 30498
139 Ga0055528_1004755 3300003790 Bacteria 6467
140 Ga0055528_1009580 3300003790 Bacteria 4031
141 Ga0055530_10007054 3300003791 Bacteria 4830
142 Ga0055530_10008869 3300003791 Bacteria 3958
143 Ga0055530_10010481 3300003791 Bacteria 3421
144 Ga0055530_10033831 3300003791 Bacteria 1313
145 Ga0055530_10035165 3300003791 Bacteria 1273
146 Ga0055540_1000023 3300003792 Bacteria 201131
147 Ga0055540_1000379 3300003792 Bacteria 37172
148 Ga0055540_1007610 3300003792 Bacteria 4047
149 Ga0055540_1053736 3300003792 Bacteria 824
150 Ga0055531_10002103 3300003794 Bacteria 13685
151 Ga0055531_10002687 3300003794 Bacteria 11716
152 Ga0055531_10004698 3300003794 Bacteria 8176
153 Ga0055531_10016218 3300003794 Bacteria 3229
154 Ga0055531_10026180 3300003794 Bacteria 2089
155 Ga0055531_10027323 3300003794 Bacteria 2006
156 Ga0055541_1000002 3300003841 Bacteria 896405
157 Ga0055541_1000021 3300003841 Bacteria 248154
158 Ga0055541_1000254 3300003841 Bacteria 19058
159 Ga0055541_1005935 3300003841 Bacteria 2108
160 Ga0055543_1000295 3300004625 Bacteria 35852
161 Ga0055543_1001075 3300004625 Bacteria 11987
162 Ga0055543_1006660 3300004625 Bacteria 2758
163 Ga0055543_1025289 3300004625 Bacteria 1061
164 Ga0065165_1000055 3300005262 Bacteria 187003
165 Ga0065165_1000141 3300005262 Bacteria 125536
166 Ga0065165_1000956 3300005262 Bacteria 36338
167 Ga0065165_1005588 3300005262 Bacteria 6973
168 Ga0065165_1006686 3300005262 Bacteria 5939
169 Ga0065165_1042483 3300005262 Bacteria 1341
170 Ga0065165_1061975 3300005262 Bacteria 1021
171 Ga0065704_10000861 3300005289 Bacteria 22649
172 Ga0065704_10163521 3300005289 Bacteria 1338
173 Ga0065715_10208617 3300005293 Bacteria 1325
174 Ga0070658_10257365 3300005327 Bacteria 1482
175 Ga0070683_100207968 3300005329 Bacteria 1859
176 Ga0070683_100357100 3300005329 Bacteria 1392
177 Ga0070670_100459941 3300005331 Bacteria 1128
178 Ga0068869_100360126 3300005334 Bacteria 1188
179 Ga0070666_10015851 3300005335 Bacteria 4814
180 Ga0070666_10036206 3300005335 Bacteria 3274
181 Ga0070666_10059468 3300005335 Bacteria 2585
182 Ga0070666_10173422 3300005335 Bacteria 1511
183 Ga0070680_100010888 3300005336 Bacteria 7026
184 Ga0070680_100099020 3300005336 Bacteria 2419
185 Ga0070682_100379882 3300005337 Bacteria 1062
186 Ga0070660_100080974 3300005339 Bacteria 2549
187 Ga0070660_100989193 3300005339 Bacteria 711
188 Ga0070689_100647636 3300005340 Bacteria 919
189 Ga0070661_100000054 3300005344 Bacteria 88505
190 Ga0070661_100218432 3300005344 Bacteria 1461
191 Ga0070661_100799954 3300005344 Bacteria 774
192 Ga0070668_100000932 3300005347 Bacteria 20406
193 Ga0070668_100005822 3300005347 Bacteria 9144
194 Ga0070668_100008517 3300005347 Bacteria 7618
195 Ga0070668_100100431 3300005347 Bacteria 2292
196 Ga0070668_100326805 3300005347 Bacteria 1292
197 Ga0070669_100000081 3300005353 Bacteria 91877
198 Ga0070669_100255246 3300005353 Bacteria 1397
199 Ga0070671_100000483 3300005355 Bacteria 27720
200 Ga0070671_100002352 3300005355 Bacteria 14594
201 Ga0070674_100412026 3300005356 Bacteria 1107
202 Ga0070659_100000935 3300005366 Bacteria 21449
203 Ga0070659_100002149 3300005366 Bacteria 14045
204 Ga0070659_100017727 3300005366 Bacteria 5363
205 Ga0070659_100033531 3300005366 Bacteria 3988
206 Ga0070659_100092648 3300005366 Bacteria 2423
207 Ga0070667_100000013 3300005367 Bacteria 255674
208 Ga0070667_100105992 3300005367 Bacteria 2433
209 Ga0070667_100118180 3300005367 Bacteria 2304
210 Ga0070667_100254375 3300005367 Bacteria 1571
211 Ga0070667_100418748 3300005367 Bacteria 1221
212 Ga0070667_100560158 3300005367 Bacteria 1051
213 Ga0070667_101075416 3300005367 Bacteria 752
214 Ga0070709_10005498 3300005434 Bacteria 6865
215 Ga0070709_10132235 3300005434 Bacteria 1705
216 Ga0070714_100558932 3300005435 Bacteria 1096
217 Ga0070713_100033847 3300005436 Bacteria 4098
218 Ga0070713_100343339 3300005436 Bacteria 1384
219 Ga0070711_100023640 3300005439 Bacteria 4000
220 Ga0070708_100600295 3300005445 Bacteria 1038
221 Ga0070663_100000010 3300005455 Bacteria 158193
222 Ga0070663_100013652 3300005455 Bacteria 5188
223 Ga0070663_100049744 3300005455 Bacteria 2979
224 Ga0070663_100109176 3300005455 Bacteria 2077
225 Ga0070678_100069953 3300005456 Bacteria 2622
226 Ga0070662_100148355 3300005457 Bacteria 1823
227 Ga0070662_100258378 3300005457 Bacteria 1403
228 Ga0070681_10034527 3300005458 Bacteria 5078
229 Ga0070679_100468277 3300005530 Bacteria 1204
230 Ga0070684_100070691 3300005535 Bacteria 3072
231 Ga0070684_100282437 3300005535 Bacteria 1521
232 Ga0068853_100017417 3300005539 Bacteria 5931
233 Ga0068853_100149940 3300005539 Bacteria 2099
234 Ga0068853_100499159 3300005539 Bacteria 1149
235 Ga0068853_100556463 3300005539 Bacteria 1087
236 Ga0068853_100642643 3300005539 Bacteria 1009
237 Ga0070696_100579001 3300005546 Bacteria 903
238 Ga0070665_100019540 3300005548 Bacteria 6802
239 Ga0070665_100085827 3300005548 Bacteria 3154
240 Ga0070665_100089266 3300005548 Bacteria 3088
241 Ga0070665_100136002 3300005548 Bacteria 2460
242 Ga0070665_100301058 3300005548 Bacteria 1606
243 Ga0070665_100323861 3300005548 Bacteria 1545
244 Ga0070665_100388796 3300005548 Bacteria 1402
245 Ga0070665_100395451 3300005548 Bacteria 1390
246 Ga0070665_100454447 3300005548 Bacteria 1291
247 Ga0070665_100578008 3300005548 Bacteria 1136
248 Ga0068855_100000283 3300005563 Bacteria 62643
249 Ga0068855_100001647 3300005563 Bacteria 27987
250 Ga0068855_100026143 3300005563 Bacteria 6982
251 Ga0068855_100083407 3300005563 Bacteria 3702
252 Ga0068855_100280772 3300005563 Bacteria 1849
253 Ga0068855_100434446 3300005563 Bacteria 1435
254 Ga0068855_100717455 3300005563 Bacteria 1069
255 Ga0068855_101236062 3300005563 Bacteria 775
256 Ga0070664_100000005 3300005564 Bacteria 222746
257 Ga0070664_100198261 3300005564 Bacteria 1790
258 Ga0070664_100302975 3300005564 Bacteria 1444
259 Ga0070664_100604043 3300005564 Bacteria 1017
260 Ga0068857_100004064 3300005577 Bacteria 12317
261 Ga0068857_100047516 3300005577 Bacteria 3810
262 Ga0068857_100194560 3300005577 Bacteria 1848
263 Ga0068857_100271648 3300005577 Bacteria 1558
264 Ga0068857_100278026 3300005577 Bacteria 1539
265 Ga0068854_100000032 3300005578 Bacteria 106054
266 Ga0068854_100018848 3300005578 Bacteria 4639
267 Ga0068854_100026225 3300005578 Bacteria 4003
268 Ga0068854_100049236 3300005578 Bacteria 3009
269 Ga0068854_100094330 3300005578 Bacteria 2232
270 Ga0068854_100113279 3300005578 Bacteria 2049
271 Ga0068856_100000054 3300005614 Bacteria 104246
272 Ga0068856_100005493 3300005614 Bacteria 12487
273 Ga0068856_100015585 3300005614 Bacteria 7349
274 Ga0068856_100105690 3300005614 Bacteria 2809
275 Ga0068856_100415932 3300005614 Bacteria 1364
276 Ga0068856_100909982 3300005614 Bacteria 898
277 Ga0068852_100003121 3300005616 Bacteria 11542
278 Ga0068852_100087926 3300005616 Bacteria 2774
279 Ga0068852_100179111 3300005616 Bacteria 1992
280 Ga0068852_100276969 3300005616 Bacteria 1616
281 Ga0068852_100693867 3300005616 Bacteria 1028
282 Ga0068852_100847474 3300005616 Bacteria 929
283 Ga0068859_100000181 3300005617 Bacteria 61904
284 Ga0068859_100470294 3300005617 Bacteria 1353
285 Ga0068859_100656357 3300005617 Bacteria 1141
286 Ga0068859_100858231 3300005617 Bacteria 994
287 Ga0068864_100343212 3300005618 Bacteria 1407
288 Ga0068864_100687406 3300005618 Bacteria 999
289 Ga0068851_10041301 3300005834 Bacteria 2319
290 Ga0068851_10044097 3300005834 Bacteria 2250
291 Ga0068851_10084801 3300005834 Bacteria 1660
292 Ga0068851_10203939 3300005834 Bacteria 1105
293 Ga0068863_100001231 3300005841 Bacteria 25532
294 Ga0068863_100007434 3300005841 Bacteria 10721
295 Ga0068863_100011412 3300005841 Bacteria 8596
296 Ga0068863_100094266 3300005841 Bacteria 2841
297 Ga0068863_100557723 3300005841 Bacteria 1132
298 Ga0068858_100000734 3300005842 Bacteria 34350
299 Ga0068858_100000878 3300005842 Bacteria 31153
300 Ga0068858_100074426 3300005842 Bacteria 3153
301 Ga0068858_100194414 3300005842 Bacteria 1917
302 Ga0068858_100316009 3300005842 Bacteria 1492
303 Ga0068860_100001535 3300005843 Bacteria 24870
304 Ga0068860_100023372 3300005843 Bacteria 5974
305 Ga0068860_100024676 3300005843 Bacteria 5806
306 Ga0068860_100035096 3300005843 Bacteria 4812
307 Ga0068860_100185603 3300005843 Bacteria 2011
308 Ga0068860_100748953 3300005843 Bacteria 988
309 Ga0068862_100072422 3300005844 Bacteria 2976
310 Ga0068862_100265426 3300005844 Bacteria 1568
311 Ga0068862_100314439 3300005844 Bacteria 1444
312 Ga0068862_101079495 3300005844 Bacteria 797
313 Ga0068862_101246132 3300005844 Bacteria 743
314 Ga0081540_1042176 3300005983 Bacteria 2356
315 Ga0081540_1058347 3300005983 Bacteria 1860
316 Ga0081540_1101212 3300005983 Bacteria 1241
317 Ga0081540_1104612 3300005983 Bacteria 1211
318 Ga0081540_1124457 3300005983 Bacteria 1063
319 Ga0081539_10016704 3300005985 Bacteria 5215
320 Ga0081539_10025519 3300005985 Bacteria 3804
321 Ga0081539_10135124 3300005985 Bacteria 1206
322 Ga0075365_10006086 3300006038 Bacteria 6592
323 Ga0075365_10056118 3300006038 Bacteria 2617
324 Ga0075365_10057944 3300006038 Bacteria 2578
325 Ga0075365_10143041 3300006038 Bacteria 1661
326 Ga0075365_10166202 3300006038 Bacteria 1539
327 Ga0075365_10232927 3300006038 Bacteria 1293
328 Ga0075365_10336585 3300006038 Bacteria 1063
329 Ga0075368_10000438 3300006042 Bacteria 12305
330 Ga0075368_10001376 3300006042 Bacteria 7747
331 Ga0075368_10018779 3300006042 Bacteria 2602
332 Ga0075368_10055654 3300006042 Bacteria 1577
333 Ga0075363_100006971 3300006048 Bacteria 5167
334 Ga0075363_100018733 3300006048 Bacteria 3453
335 Ga0075363_100021008 3300006048 Bacteria 3281
336 Ga0075363_100037887 3300006048 Bacteria 2533
337 Ga0075363_100089088 3300006048 Bacteria 1697
338 Ga0075363_100094218 3300006048 Bacteria 1651
339 Ga0075363_100208713 3300006048 Bacteria 1117
340 Ga0075364_10010269 3300006051 Bacteria 5651
341 Ga0075364_10054830 3300006051 Bacteria 2608
342 Ga0075364_10120722 3300006051 Bacteria 1754
343 Ga0075362_10006177 3300006177 Bacteria 4446
344 Ga0075362_10007575 3300006177 Bacteria 4120
345 Ga0075362_10030441 3300006177 Bacteria 2331
346 Ga0075362_10038388 3300006177 Bacteria 2103
347 Ga0075367_10000052 3300006178 Bacteria 27689
348 Ga0075367_10002355 3300006178 Bacteria 8592
349 Ga0075367_10052670 3300006178 Bacteria 2409
350 Ga0075367_10251598 3300006178 Bacteria 1108
351 Ga0075367_10545070 3300006178 Bacteria 736
352 Ga0075369_10107696 3300006186 Bacteria 1255
353 Ga0075369_10250574 3300006186 Bacteria 822
354 Ga0075366_10010935 3300006195 Bacteria 5107
355 Ga0075366_10048305 3300006195 Bacteria 2523
356 Ga0075366_10051410 3300006195 Bacteria 2448
357 Ga0075366_10327098 3300006195 Bacteria 939
358 Ga0075366_10383391 3300006195 Bacteria 864
359 Ga0097621_100194523 3300006237 Bacteria 1758
360 Ga0097621_100600666 3300006237 Bacteria 1006
361 Ga0075370_10004011 3300006353 Bacteria 7075
362 Ga0075370_10011371 3300006353 Bacteria 4674
363 Ga0075370_10022951 3300006353 Bacteria 3433
364 Ga0075370_10073303 3300006353 Bacteria 1960
365 Ga0075370_10230481 3300006353 Bacteria 1096
366 Ga0068871_100383194 3300006358 Bacteria 1249
367 Ga0068871_100709842 3300006358 Bacteria 922
368 Ga0075434_100083699 3300006871 Bacteria 3188
369 Ga0097620_100000181 3300006931 Bacteria 61904
370 Ga0097620_100470285 3300006931 Bacteria 1353
371 Ga0097620_100656287 3300006931 Bacteria 1141
372 Ga0097620_100858125 3300006931 Bacteria 994
373 Ga0099825_1022559 3300006941 Bacteria 4039
374 Ga0099825_1036695 3300006941 Bacteria 1670
375 Ga0099824_1018892 3300006942 Bacteria 5529
376 Ga0099822_1016039 3300006943 Bacteria 8308
377 Ga0099823_1026401 3300006944 Bacteria 5133
378 Ga0079104_1006239 3300006946 Bacteria 4561
379 Ga0079104_1011096 3300006946 Bacteria 2921
380 Ga0099826_10150487 3300006948 Bacteria 1332
381 Ga0105251_10053702 3300009011 Bacteria 1914
382 Ga0105251_10085017 3300009011 Bacteria 1458
383 Ga0105251_10183902 3300009011 Bacteria 941
384 Ga0105244_10003165 3300009036 Bacteria 11955
385 Ga0105250_10004033 3300009092 Bacteria 6839
386 Ga0105250_10045860 3300009092 Bacteria 1752
387 Ga0105250_10057845 3300009092 Bacteria 1556
388 Ga0105240_10000410 3300009093 Bacteria 79815
389 Ga0105240_10000461 3300009093 Bacteria 74925
390 Ga0105240_10000910 3300009093 Bacteria 52855
391 Ga0105240_10001328 3300009093 Bacteria 42581
392 Ga0105240_10005838 3300009093 Bacteria 18251
393 Ga0105240_10016034 3300009093 Bacteria 10159
394 Ga0105240_10045652 3300009093 Bacteria 5557
395 Ga0105240_10088919 3300009093 Bacteria 3779
396 Ga0105240_10116596 3300009093 Bacteria 3221
397 Ga0105240_10132392 3300009093 Bacteria 2990
398 Ga0105240_10143158 3300009093 Bacteria 2856
399 Ga0105240_10176910 3300009093 Bacteria 2522
400 Ga0105240_10208135 3300009093 Bacteria 2288
401 Ga0105240_10296010 3300009093 Bacteria 1853
402 Ga0105240_10304782 3300009093 Bacteria 1821
403 Ga0105240_10493111 3300009093 Bacteria 1363
404 Ga0105240_10626273 3300009093 Bacteria 1182
405 Ga0105240_11122234 3300009093 Bacteria 836
406 Ga0111539_10446169 3300009094 Bacteria 1507
407 Ga0111539_10848350 3300009094 Bacteria 1063
408 Ga0111539_11532408 3300009094 Bacteria 773
409 Ga0105245_10175568 3300009098 Bacteria 2043
410 Ga0105245_10703261 3300009098 Bacteria 1044
411 Ga0105247_10000549 3300009101 Bacteria 30547
412 Ga0105247_10029369 3300009101 Bacteria 3331
413 Ga0105247_10305470 3300009101 Bacteria 1105
414 Ga0105247_10321899 3300009101 Bacteria 1079
415 Ga0105243_10015822 3300009148 Bacteria 5706
416 Ga0105243_10067070 3300009148 Bacteria 2888
417 Ga0105243_10121817 3300009148 Bacteria 2200
418 Ga0105243_10203654 3300009148 Bacteria 1737
419 Ga0105243_11093476 3300009148 Bacteria 805
420 Ga0105243_11185115 3300009148 Bacteria 776
421 Ga0105241_10100282 3300009174 Bacteria 2301
422 Ga0105241_10233932 3300009174 Bacteria 1550
423 Ga0105241_10298174 3300009174 Bacteria 1382
424 Ga0105241_10483118 3300009174 Bacteria 1101
425 Ga0105241_10734519 3300009174 Bacteria 904
426 Ga0105241_10824130 3300009174 Bacteria 856
427 Ga0105242_10682111 3300009176 Bacteria 1003
428 Ga0105248_10019945 3300009177 Bacteria 7422
429 Ga0105248_10025205 3300009177 Bacteria 6611
430 Ga0105248_10169144 3300009177 Bacteria 2463
431 Ga0105248_10186297 3300009177 Bacteria 2339
432 Ga0105248_10335968 3300009177 Bacteria 1701
433 Ga0105248_10555238 3300009177 Bacteria 1296
434 Ga0105237_10000023 3300009545 Bacteria 226144
435 Ga0105237_10000322 3300009545 Bacteria 67344
436 Ga0105237_10001371 3300009545 Bacteria 32139
437 Ga0105237_10014615 3300009545 Bacteria 8201
438 Ga0105237_10018789 3300009545 Bacteria 7148
439 Ga0105237_10052824 3300009545 Bacteria 4077
440 Ga0105237_10121528 3300009545 Bacteria 2606
441 Ga0105237_10204606 3300009545 Bacteria 1974
442 Ga0105237_10278816 3300009545 Bacteria 1674
443 Ga0105237_10328568 3300009545 Bacteria 1533
444 Ga0105237_10344557 3300009545 Bacteria 1494
445 Ga0105237_10438742 3300009545 Bacteria 1311
446 Ga0105237_11007312 3300009545 Bacteria 840
447 Ga0105238_10001243 3300009551 Bacteria 25672
448 Ga0105238_10004686 3300009551 Bacteria 13524
449 Ga0105238_10005278 3300009551 Bacteria 12780
450 Ga0105238_10043372 3300009551 Bacteria 4551
451 Ga0105238_10163505 3300009551 Bacteria 2201
452 Ga0105238_10207759 3300009551 Bacteria 1934
453 Ga0105238_10359619 3300009551 Bacteria 1445
454 Ga0105238_10653993 3300009551 Bacteria 1061
455 Ga0105238_10723606 3300009551 Bacteria 1008
456 Ga0105249_10056648 3300009553 Bacteria 3588
457 Ga0105249_10340964 3300009553 Bacteria 1515
458 Ga0105249_10665467 3300009553 Bacteria 1099
459 Ga0123341_1000029 3300009765 Bacteria 68558
460 Ga0123342_1016558 3300009766 Bacteria 6382
461 Ga0105239_10000063 3300010375 Bacteria 151845
462 Ga0105239_10000750 3300010375 Bacteria 46021
463 Ga0105239_10002428 3300010375 Bacteria 23740
464 Ga0105239_10019496 3300010375 Bacteria 7487
465 Ga0105239_10075729 3300010375 Bacteria 3701
466 Ga0105239_10145432 3300010375 Bacteria 2643
467 Ga0105239_10149118 3300010375 Bacteria 2610
468 Ga0105239_10257945 3300010375 Bacteria 1959
469 Ga0105239_10573770 3300010375 Bacteria 1286
470 Ga0105239_10679243 3300010375 Bacteria 1177
471 Ga0105239_10919427 3300010375 Bacteria 1004
472 Ga0105246_10007753 3300011119 Bacteria 6590
473 Ga0105246_10027028 3300011119 Bacteria 3756
474 Ga0105246_10046524 3300011119 Bacteria 2960
475 Ga0157322_1001321 3300012490 Bacteria 1206
476 Ga0157314_1000101 3300012500 Bacteria 9089
477 Ga0157373_10006041 3300013100 Bacteria 9052
478 Ga0157373_10007094 3300013100 Bacteria 8354
479 Ga0157373_10081266 3300013100 Bacteria 2285
480 Ga0157371_10000004 3300013102 Bacteria 512593
481 Ga0157371_10000103 3300013102 Bacteria 128611
482 Ga0157371_10014909 3300013102 Bacteria 5849
483 Ga0157371_10210416 3300013102 Bacteria 1395
484 Ga0157371_10239732 3300013102 Bacteria 1304
485 Ga0157370_10001047 3300013104 Bacteria 34825
486 Ga0157370_10001099 3300013104 Bacteria 33935
487 Ga0157370_10003639 3300013104 Bacteria 18016
488 Ga0157370_10293825 3300013104 Bacteria 1500
489 Ga0157370_10689054 3300013104 Bacteria 933
490 Ga0157369_10015082 3300013105 Bacteria 8722
491 Ga0157369_10030435 3300013105 Bacteria 5953
492 Ga0157369_10306639 3300013105 Bacteria 1651
493 Ga0157369_10524039 3300013105 Bacteria 1226
494 Ga0157369_10899997 3300013105 Bacteria 907
495 Ga0171462_1040 3300013250 Bacteria 73112
496 Ga0157374_10137325 3300013296 Bacteria 2371
497 Ga0157374_10250450 3300013296 Bacteria 1743
498 Ga0157378_10063329 3300013297 Bacteria 3304
499 Ga0157378_11218762 3300013297 Bacteria 792
500 Ga0163162_10086829 3300013306 Bacteria 3206
501 Ga0163162_10154210 3300013306 Bacteria 2416
502 Ga0163162_10175133 3300013306 Bacteria 2271
503 Ga0163162_10215261 3300013306 Bacteria 2051
504 Ga0163162_10274159 3300013306 Bacteria 1819
505 Ga0163162_10299982 3300013306 Bacteria 1739
506 Ga0163162_10804391 3300013306 Bacteria 1057
507 Ga0157372_10000151 3300013307 Bacteria 75926
508 Ga0157372_10080518 3300013307 Bacteria 3685
509 Ga0157372_10236532 3300013307 Bacteria 2119
510 Ga0157372_10405954 3300013307 Bacteria 1587
511 Ga0157372_10537327 3300013307 Bacteria 1363
512 Ga0157372_10756611 3300013307 Bacteria 1130
513 Ga0157372_10772585 3300013307 Bacteria 1117
514 Ga0157375_10056092 3300013308 Bacteria 3888
515 Ga0157375_10331077 3300013308 Bacteria 1688
516 Ga0157375_10398996 3300013308 Bacteria 1542
517 Ga0157375_10923248 3300013308 Bacteria 1016
518 Ga0163163_10242056 3300014325 Bacteria 1854
519 Ga0163163_10303487 3300014325 Bacteria 1649
520 Ga0163163_10658523 3300014325 Bacteria 1111
521 Ga0163163_10983240 3300014325 Bacteria 907
522 Ga0157380_10186851 3300014326 Bacteria 1826
523 Ga0157380_10757753 3300014326 Bacteria 983
524 Ga0182008_10036394 3300014497 Bacteria 2463
525 Ga0182008_10146591 3300014497 Bacteria 1183
526 Ga0157379_10112141 3300014968 Bacteria 2450
527 Ga0157379_10151951 3300014968 Bacteria 2088
528 Ga0157379_10155706 3300014968 Bacteria 2061
529 Ga0157379_10315686 3300014968 Bacteria 1426
530 Ga0157376_10009453 3300014969 Bacteria 7080
531 Ga0182006_1000008 3300015261 Bacteria 449652
532 Ga0182006_1000747 3300015261 Bacteria 22238
533 Ga0182006_1044222 3300015261 Bacteria 1738
534 Ga0182006_1084032 3300015261 Bacteria 1157
535 Ga0182006_1169356 3300015261 Bacteria 732
536 Ga0182007_10022075 3300015262 Bacteria 2252
537 Ga0182007_10082253 3300015262 Bacteria 1057
538 Ga0182005_1000008 3300015265 Bacteria 471394
539 Ga0182005_1000977 3300015265 Bacteria 12393
540 Ga0183370_1020 3300015680 Bacteria 965
541 Ga0183368_1002 3300015687 Bacteria 1865598
542 Ga0163161_10026606 3300017792 Bacteria 4097
543 Ga0163161_10080831 3300017792 Bacteria 2392
544 Ga0197907_10420922 3300020069 Bacteria 2320
545 Ga0206351_10614052 3300020077 Bacteria 7874
546 Ga0206351_10902505 3300020077 Bacteria 1314
547 Ga0154015_1002009 3300020610 Bacteria 1515
548 Ga0154015_1423277 3300020610 Bacteria 27201
549 Ga0214544_1000003 3300021320 Bacteria 643752
550 Ga0214542_1000003 3300021321 Bacteria 435700
551 Ga0214545_1000004 3300021324 Bacteria 453352
552 Ga0214543_1000007 3300021327 Bacteria 414744
553 Ga0213872_10000001 3300021361 Bacteria 662532
554 Ga0213872_10000057 3300021361 Bacteria 100906
555 Ga0213872_10002369 3300021361 Bacteria 11163
556 Ga0213872_10006716 3300021361 Bacteria 5733
557 Ga0213872_10019917 3300021361 Bacteria 3090
558 Ga0213872_10037693 3300021361 Bacteria 2208
559 Ga0228711_1000045 3300022739 Bacteria 85435
560 Ga0228710_1000036 3300022740 Bacteria 91904
561 Ga0209435_100030 3300025206 Bacteria 170822
562 Ga0209435_100044 3300025206 Bacteria 99051
563 Ga0209435_100134 3300025206 Bacteria 25335
564 Ga0209435_104233 3300025206 Bacteria 1627
565 Ga0209435_110054 3300025206 Bacteria 1026
566 Ga0209760_100385 3300025207 Bacteria 11369
567 Ga0209760_104469 3300025207 Bacteria 1198
568 Ga0209436_100884 3300025208 Bacteria 11937
569 Ga0209436_100972 3300025208 Bacteria 11145
570 Ga0209436_112459 3300025208 Bacteria 1442
571 Ga0209784_100002 3300025224 Bacteria 1753105
572 Ga0209784_100003 3300025224 Bacteria 1379451
573 Ga0209784_100004 3300025224 Bacteria 1378156
574 Ga0209784_100053 3300025224 Bacteria 182075
575 Ga0209784_100650 3300025224 Bacteria 10330
576 Ga0209566_100002 3300025225 Bacteria 2614868
577 Ga0209566_100003 3300025225 Bacteria 1753105
578 Ga0209566_100004 3300025225 Bacteria 1531866
579 Ga0209566_101350 3300025225 Bacteria 7755
580 Ga0209566_103050 3300025225 Bacteria 2749
581 Ga0209674_100004 3300025226 Bacteria 1753105
582 Ga0209674_100006 3300025226 Bacteria 1531866
583 Ga0209674_100008 3300025226 Bacteria 1076909
584 Ga0209674_100014 3300025226 Bacteria 704989
585 Ga0209674_100346 3300025226 Bacteria 27116
586 Ga0209672_100004 3300025228 Bacteria 1467504
587 Ga0209672_100109 3300025228 Bacteria 96247
588 Ga0209672_100302 3300025228 Bacteria 33548
589 Ga0209672_100537 3300025228 Bacteria 20579
590 Ga0209672_100788 3300025228 Bacteria 15117
591 Ga0209672_107550 3300025228 Bacteria 1668
592 Ga0209147_100002 3300025229 Bacteria 2158988
593 Ga0209147_100159 3300025229 Bacteria 91615
594 Ga0209147_102661 3300025229 Bacteria 4153
595 Ga0209563_100003 3300025230 Bacteria 1932942
596 Ga0209563_100004 3300025230 Bacteria 1814108
597 Ga0209563_100006 3300025230 Bacteria 1753105
598 Ga0209563_100009 3300025230 Bacteria 1378156
599 Ga0209563_100036 3300025230 Bacteria 448275
600 Ga0209563_103065 3300025230 Bacteria 3563
601 Ga0207427_100037 3300025231 Bacteria 303108
602 Ga0207427_100061 3300025231 Bacteria 182815
603 Ga0207427_100291 3300025231 Bacteria 35604
604 Ga0209437_100004 3300025233 Bacteria 1378156
605 Ga0209437_100037 3300025233 Bacteria 459730
606 Ga0209437_100284 3300025233 Bacteria 74641
607 Ga0209437_100437 3300025233 Bacteria 35556
608 Ga0209437_100961 3300025233 Bacteria 10521
609 Ga0209437_105980 3300025233 Bacteria 2046
610 Ga0209258_100002 3300025242 Bacteria 2158988
611 Ga0209258_100003 3300025242 Bacteria 1467504
612 Ga0209258_100057 3300025242 Bacteria 334259
613 Ga0209258_100138 3300025242 Bacteria 167495
614 Ga0209258_100185 3300025242 Bacteria 132820
615 Ga0209258_100259 3300025242 Bacteria 92050
616 Ga0209258_100795 3300025242 Bacteria 18748
617 Ga0209258_102228 3300025242 Bacteria 5252
618 Ga0207425_1000249 3300025245 Bacteria 41006
619 Ga0207425_1002852 3300025245 Bacteria 5813
620 Ga0207425_1005704 3300025245 Bacteria 3511
621 Ga0207425_1009208 3300025245 Bacteria 2469
622 Ga0209646_1000019 3300025246 Bacteria 475248
623 Ga0209646_1000023 3300025246 Bacteria 441100
624 Ga0209646_1000057 3300025246 Bacteria 266384
625 Ga0209646_1000100 3300025246 Bacteria 170822
626 Ga0209646_1000151 3300025246 Bacteria 99050
627 Ga0209646_1000623 3300025246 Bacteria 13543
628 Ga0209646_1001280 3300025246 Bacteria 7086
629 Ga0209646_1010426 3300025246 Bacteria 1456
630 Ga0209646_1013084 3300025246 Bacteria 1266
631 Ga0209026_1000091 3300025250 Bacteria 171170
632 Ga0209026_1000170 3300025250 Bacteria 99050
633 Ga0209026_1000471 3300025250 Bacteria 30971
634 Ga0209026_1000789 3300025250 Bacteria 17389
635 Ga0209026_1002454 3300025250 Bacteria 6960
636 Ga0209026_1002931 3300025250 Bacteria 5965
637 Ga0209026_1003665 3300025250 Bacteria 4926
638 Ga0209026_1012265 3300025250 Bacteria 1502
639 Ga0209026_1019076 3300025250 Bacteria 1078
640 Ga0209677_100003 3300025253 Bacteria 1753105
641 Ga0209677_100005 3300025253 Bacteria 1378156
642 Ga0209677_100009 3300025253 Bacteria 749530
643 Ga0209677_100368 3300025253 Bacteria 27610
644 Ga0209677_101412 3300025253 Bacteria 10402
645 Ga0209677_102220 3300025253 Bacteria 7535
646 Ga0209677_115315 3300025253 Bacteria 1014
647 Ga0209148_1000001 3300025254 Bacteria 2545271
648 Ga0209148_1000002 3300025254 Bacteria 2399500
649 Ga0209148_1000025 3300025254 Bacteria 663262
650 Ga0209148_1000042 3300025254 Bacteria 464111
651 Ga0209148_1000068 3300025254 Bacteria 335510
652 Ga0209148_1000078 3300025254 Bacteria 296101
653 Ga0209148_1000193 3300025254 Bacteria 115649
654 Ga0209148_1000469 3300025254 Bacteria 43128
655 Ga0209148_1000545 3300025254 Bacteria 36006
656 Ga0209148_1000713 3300025254 Bacteria 26678
657 Ga0209148_1008299 3300025254 Bacteria 2094
658 Ga0209759_1000084 3300025256 Bacteria 169233
659 Ga0209759_1000141 3300025256 Bacteria 124528
660 Ga0209759_1000186 3300025256 Bacteria 100413
661 Ga0209759_1000504 3300025256 Bacteria 42599
662 Ga0209759_1001583 3300025256 Bacteria 12354
663 Ga0209759_1003782 3300025256 Bacteria 5899
664 Ga0209759_1005904 3300025256 Bacteria 4190
665 Ga0209129_1001274 3300025258 Bacteria 14398
666 Ga0209129_1003518 3300025258 Bacteria 6765
667 Ga0209129_1004437 3300025258 Bacteria 5470
668 Ga0209129_1014244 3300025258 Bacteria 1703
669 Ga0209233_1000002 3300025261 Bacteria 2501366
670 Ga0209233_1000005 3300025261 Bacteria 1531866
671 Ga0209233_1000096 3300025261 Bacteria 303482
672 Ga0209233_1000320 3300025261 Bacteria 52300
673 Ga0209233_1000793 3300025261 Bacteria 14180
674 Ga0209233_1000947 3300025261 Bacteria 12594
675 Ga0209233_1002195 3300025261 Bacteria 7316
676 Ga0209233_1006116 3300025261 Bacteria 3916
677 Ga0209565_1000571 3300025263 Bacteria 25126
678 Ga0209565_1012572 3300025263 Bacteria 2015
679 Ga0209565_1014158 3300025263 Bacteria 1841
680 Ga0209455_1000004 3300025272 Bacteria 1467504
681 Ga0209455_1000016 3300025272 Bacteria 753097
682 Ga0209455_1000076 3300025272 Bacteria 284092
683 Ga0209455_1000079 3300025272 Bacteria 268778
684 Ga0209455_1000194 3300025272 Bacteria 89837
685 Ga0209455_1001555 3300025272 Bacteria 10175
686 Ga0209455_1001577 3300025272 Bacteria 10047
687 Ga0209455_1004144 3300025272 Bacteria 4856
688 Ga0209455_1011756 3300025272 Bacteria 2138
689 Ga0209673_1000005 3300025273 Bacteria 692788
690 Ga0209673_1000023 3300025273 Bacteria 411385
691 Ga0209673_1000212 3300025273 Bacteria 116031
692 Ga0209673_1001489 3300025273 Bacteria 21798
693 Ga0209673_1012846 3300025273 Bacteria 3344
694 Ga0209673_1022621 3300025273 Bacteria 2163
695 Ga0209130_1000091 3300025284 Bacteria 149502
696 Ga0209130_1000093 3300025284 Bacteria 145707
697 Ga0209130_1000178 3300025284 Bacteria 90293
698 Ga0209130_1002062 3300025284 Bacteria 10861
699 Ga0209130_1002993 3300025284 Bacteria 7655
700 Ga0209130_1008521 3300025284 Bacteria 3020
701 Ga0209130_1022442 3300025284 Bacteria 1408
702 Ga0209675_1000087 3300025291 Bacteria 147632
703 Ga0209675_1001467 3300025291 Bacteria 13553
704 Ga0209675_1001561 3300025291 Bacteria 12997
705 Ga0209675_1002312 3300025291 Bacteria 9863
706 Ga0209675_1007604 3300025291 Bacteria 4123
707 Ga0209675_1023139 3300025291 Bacteria 1615
708 Ga0209676_1000176 3300025292 Bacteria 152347
709 Ga0209676_1008273 3300025292 Bacteria 4671
710 Ga0209676_1035497 3300025292 Bacteria 1461
711 Ga0209025_1000005 3300025294 Bacteria 1272149
712 Ga0209025_1000017 3300025294 Bacteria 768983
713 Ga0209025_1000027 3300025294 Bacteria 505882
714 Ga0209025_1000046 3300025294 Bacteria 348962
715 Ga0209025_1000300 3300025294 Bacteria 110956
716 Ga0209025_1000327 3300025294 Bacteria 106055
717 Ga0209025_1000553 3300025294 Bacteria 69760
718 Ga0209025_1000594 3300025294 Bacteria 65297
719 Ga0209025_1002082 3300025294 Bacteria 22651
720 Ga0209025_1013583 3300025294 Bacteria 5103
721 Ga0209025_1040243 3300025294 Bacteria 2025
722 Ga0209564_1000002 3300025295 Bacteria 1636803
723 Ga0209564_1000059 3300025295 Bacteria 328782
724 Ga0209564_1000105 3300025295 Bacteria 218124
725 Ga0209564_1000112 3300025295 Bacteria 211939
726 Ga0209564_1000276 3300025295 Bacteria 106851
727 Ga0209564_1000402 3300025295 Bacteria 76964
728 Ga0209564_1000434 3300025295 Bacteria 72534
729 Ga0209564_1000743 3300025295 Bacteria 46196
730 Ga0209564_1005181 3300025295 Bacteria 7558
731 Ga0209564_1005329 3300025295 Bacteria 7403
732 Ga0209564_1009245 3300025295 Bacteria 4721
733 Ga0209564_1018365 3300025295 Bacteria 2670
734 Ga0209564_1041392 3300025295 Bacteria 1236
735 Ga0209758_1000030 3300025297 Bacteria 509217
736 Ga0209758_1000053 3300025297 Bacteria 337751
737 Ga0209758_1000130 3300025297 Bacteria 184456
738 Ga0209758_1002679 3300025297 Bacteria 17573
739 Ga0209758_1005701 3300025297 Bacteria 9402
740 Ga0209758_1006363 3300025297 Bacteria 8536
741 Ga0209758_1008706 3300025297 Bacteria 6491
742 Ga0209758_1030674 3300025297 Bacteria 2223
743 Ga0209758_1041709 3300025297 Bacteria 1711
744 Ga0209758_1050784 3300025297 Bacteria 1450
745 Ga0209050_1000010 3300025298 Bacteria 980454
746 Ga0209050_1001066 3300025298 Bacteria 33709
747 Ga0209050_1001298 3300025298 Bacteria 28251
748 Ga0209050_1004575 3300025298 Bacteria 9273
749 Ga0209050_1006522 3300025298 Bacteria 6878
750 Ga0209050_1016948 3300025298 Bacteria 2942
751 Ga0209050_1029568 3300025298 Bacteria 1749
752 Ga0209256_1000032 3300025299 Bacteria 395041
753 Ga0209256_1000051 3300025299 Bacteria 307241
754 Ga0209256_1000122 3300025299 Bacteria 166746
755 Ga0209256_1000128 3300025299 Bacteria 163833
756 Ga0209256_1000432 3300025299 Bacteria 65073
757 Ga0209256_1000485 3300025299 Bacteria 58920
758 Ga0209256_1000582 3300025299 Bacteria 51562
759 Ga0209256_1002863 3300025299 Bacteria 13129
760 Ga0209256_1014833 3300025299 Bacteria 2769
761 Ga0209256_1015986 3300025299 Bacteria 2587
762 Ga0209256_1068397 3300025299 Bacteria 806
763 Ga0207426_1000012 3300025302 Bacteria 730942
764 Ga0207426_1000035 3300025302 Bacteria 448327
765 Ga0207426_1000867 3300025302 Bacteria 31615
766 Ga0207426_1003362 3300025302 Bacteria 8780
767 Ga0207426_1004113 3300025302 Bacteria 7313
768 Ga0207426_1004415 3300025302 Bacteria 6877
769 Ga0207426_1017400 3300025302 Bacteria 2557
770 Ga0207426_1022870 3300025302 Bacteria 2140
771 Ga0209051_1000079 3300025303 Bacteria 201183
772 Ga0209051_1000119 3300025303 Bacteria 148746
773 Ga0209051_1002656 3300025303 Bacteria 12504
774 Ga0209051_1005295 3300025303 Bacteria 7604
775 Ga0209051_1005750 3300025303 Bacteria 7155
776 Ga0209051_1034525 3300025303 Bacteria 1894
777 Ga0209051_1037249 3300025303 Bacteria 1786
778 Ga0209051_1044084 3300025303 Bacteria 1558
779 Ga0209257_1000009 3300025304 Bacteria 1205047
780 Ga0209257_1000183 3300025304 Bacteria 156618
781 Ga0209257_1000293 3300025304 Bacteria 110422
782 Ga0209257_1003444 3300025304 Bacteria 13569
783 Ga0209257_1003910 3300025304 Bacteria 12121
784 Ga0209257_1003940 3300025304 Bacteria 12059
785 Ga0209257_1007671 3300025304 Bacteria 6449
786 Ga0209257_1009605 3300025304 Bacteria 5129
787 Ga0209257_1040232 3300025304 Bacteria 1397
788 Ga0207697_10261889 3300025315 Bacteria 766
789 Ga0207656_10057359 3300025321 Bacteria 1699
790 Ga0207656_10147631 3300025321 Bacteria 1112
791 Ga0207656_10262018 3300025321 Bacteria 849
792 Ga0207696_1003756 3300025711 Bacteria 6780
793 Ga0207696_1066310 3300025711 Bacteria 1008
794 Ga0207655_1017375 3300025728 Bacteria 3882
795 Ga0207713_1008971 3300025735 Bacteria 5688
796 Ga0207713_1132712 3300025735 Bacteria 822
797 Ga0207710_10000347 3300025900 Bacteria 33831
798 Ga0207710_10126461 3300025900 Bacteria 1225
799 Ga0207688_10172919 3300025901 Bacteria 1285
800 Ga0207680_10015290 3300025903 Bacteria 4002
801 Ga0207680_10049423 3300025903 Bacteria 2503
802 Ga0207680_10069001 3300025903 Bacteria 2183
803 Ga0207680_10159548 3300025903 Bacteria 1511
804 Ga0207680_10268774 3300025903 Bacteria 1182
805 Ga0207647_10013332 3300025904 Bacteria 5704
806 Ga0207647_10033451 3300025904 Bacteria 3292
807 Ga0207647_10035097 3300025904 Bacteria 3197
808 Ga0207647_10064254 3300025904 Bacteria 2231
809 Ga0207647_10297342 3300025904 Bacteria 920
810 Ga0207705_10103787 3300025909 Bacteria 2094
811 Ga0207705_10257660 3300025909 Bacteria 1331
812 Ga0207707_10053311 3300025912 Bacteria 3521
813 Ga0207695_10000065 3300025913 Bacteria 336949
814 Ga0207695_10000427 3300025913 Bacteria 93089
815 Ga0207695_10000633 3300025913 Bacteria 70372
816 Ga0207695_10002164 3300025913 Bacteria 29697
817 Ga0207695_10005250 3300025913 Bacteria 17292
818 Ga0207695_10005643 3300025913 Bacteria 16518
819 Ga0207695_10017514 3300025913 Bacteria 8334
820 Ga0207695_10019500 3300025913 Bacteria 7809
821 Ga0207695_10026771 3300025913 Bacteria 6430
822 Ga0207695_10033462 3300025913 Bacteria 5604
823 Ga0207695_10079016 3300025913 Bacteria 3336
824 Ga0207695_10091360 3300025913 Bacteria 3058
825 Ga0207695_10301502 3300025913 Bacteria 1493
826 Ga0207695_10318264 3300025913 Bacteria 1445
827 Ga0207695_10755026 3300025913 Bacteria 853
828 Ga0207695_10981507 3300025913 Bacteria 724
829 Ga0207671_10000020 3300025914 Bacteria 309636
830 Ga0207671_10000033 3300025914 Bacteria 245869
831 Ga0207671_10000288 3300025914 Bacteria 74500
832 Ga0207671_10001693 3300025914 Bacteria 24981
833 Ga0207671_10024760 3300025914 Bacteria 4509
834 Ga0207671_10109386 3300025914 Bacteria 2101
835 Ga0207671_10123886 3300025914 Bacteria 1978
836 Ga0207671_10125193 3300025914 Bacteria 1968
837 Ga0207671_10171071 3300025914 Bacteria 1687
838 Ga0207671_10406797 3300025914 Bacteria 1082
839 Ga0207671_10540766 3300025914 Bacteria 929
840 Ga0207660_10149706 3300025917 Bacteria 1792
841 Ga0207657_10001513 3300025919 Bacteria 24886
842 Ga0207657_10090077 3300025919 Bacteria 2560
843 Ga0207657_10191807 3300025919 Bacteria 1648
844 Ga0207649_10000087 3300025920 Bacteria 78222
845 Ga0207649_10004570 3300025920 Bacteria 7508
846 Ga0207649_10013062 3300025920 Bacteria 4631
847 Ga0207649_10044234 3300025920 Bacteria 2725
848 Ga0207649_10066813 3300025920 Bacteria 2281
849 Ga0207649_10126590 3300025920 Bacteria 1730
850 Ga0207681_10000620 3300025923 Bacteria 23726
851 Ga0207681_10064352 3300025923 Bacteria 2532
852 Ga0207681_10953137 3300025923 Bacteria 719
853 Ga0207694_10002664 3300025924 Bacteria 14468
854 Ga0207694_10004751 3300025924 Bacteria 10562
855 Ga0207694_10022951 3300025924 Bacteria 4734
856 Ga0207694_10077100 3300025924 Bacteria 2611
857 Ga0207694_10156206 3300025924 Bacteria 1840
858 Ga0207694_10236699 3300025924 Bacteria 1492
859 Ga0207694_10496103 3300025924 Bacteria 1022
860 Ga0207650_10008014 3300025925 Bacteria 7198
861 Ga0207650_10164114 3300025925 Bacteria 1762
862 Ga0207687_10154026 3300025927 Bacteria 1757
863 Ga0207700_10044632 3300025928 Bacteria 3264
864 Ga0207700_10239174 3300025928 Bacteria 1547
865 Ga0207644_10004099 3300025931 Bacteria 9445
866 Ga0207644_10006931 3300025931 Bacteria 7378
867 Ga0207644_10058919 3300025931 Bacteria 2776
868 Ga0207644_10152006 3300025931 Bacteria 1792
869 Ga0207690_10001019 3300025932 Bacteria 17938
870 Ga0207690_10006363 3300025932 Bacteria 6998
871 Ga0207690_10019374 3300025932 Bacteria 4189
872 Ga0207690_10148578 3300025932 Bacteria 1735
873 Ga0207706_10027920 3300025933 Bacteria 5044
874 Ga0207706_10041471 3300025933 Bacteria 4080
875 Ga0207706_10284962 3300025933 Bacteria 1440
876 Ga0207709_10149916 3300025935 Bacteria 1614
877 Ga0207670_10001961 3300025936 Bacteria 10795
878 Ga0207669_10209768 3300025937 Bacteria 1421
879 Ga0207704_10384880 3300025938 Bacteria 1102
880 Ga0207665_10043512 3300025939 Bacteria 3003
881 Ga0207711_10168109 3300025941 Bacteria 1989
882 Ga0207711_10185203 3300025941 Bacteria 1895
883 Ga0207711_10254811 3300025941 Bacteria 1612
884 Ga0207711_10346410 3300025941 Bacteria 1375
885 Ga0207711_10589405 3300025941 Bacteria 1037
886 Ga0207689_10200239 3300025942 Bacteria 1648
887 Ga0207689_10289886 3300025942 Bacteria 1356
888 Ga0207689_10388922 3300025942 Bacteria 1162
889 Ga0207661_10064803 3300025944 Bacteria 2964
890 Ga0207661_10626860 3300025944 Bacteria 988
891 Ga0207679_10000020 3300025945 Bacteria 225727
892 Ga0207679_10000181 3300025945 Bacteria 51923
893 Ga0207679_10009005 3300025945 Bacteria 6380
894 Ga0207679_10417759 3300025945 Bacteria 1183
895 Ga0207667_10000032 3300025949 Bacteria 322253
896 Ga0207667_10000094 3300025949 Bacteria 145771
897 Ga0207667_10000696 3300025949 Bacteria 43589
898 Ga0207667_10004822 3300025949 Bacteria 16496
899 Ga0207667_10005925 3300025949 Bacteria 14881
900 Ga0207667_10009332 3300025949 Bacteria 11568
901 Ga0207667_10087941 3300025949 Bacteria 3214
902 Ga0207667_10117392 3300025949 Bacteria 2742
903 Ga0207667_10364117 3300025949 Bacteria 1474
904 Ga0207667_10682750 3300025949 Bacteria 1030
905 Ga0207712_10076642 3300025961 Bacteria 2421
906 Ga0207668_10000063 3300025972 Bacteria 87944
907 Ga0207668_10000812 3300025972 Bacteria 19135
908 Ga0207668_10010722 3300025972 Bacteria 5547
909 Ga0207668_10121554 3300025972 Bacteria 1978
910 Ga0207668_10128589 3300025972 Bacteria 1931
911 Ga0207668_10160859 3300025972 Bacteria 1749
912 Ga0207668_10205397 3300025972 Bacteria 1572
913 Ga0207640_10000017 3300025981 Bacteria 208145
914 Ga0207640_10013401 3300025981 Bacteria 4697
915 Ga0207640_10064691 3300025981 Bacteria 2437
916 Ga0207640_10131599 3300025981 Bacteria 1809
917 Ga0207640_10585050 3300025981 Bacteria 943
918 Ga0207658_10000040 3300025986 Bacteria 142099
919 Ga0207658_10010661 3300025986 Bacteria 6247
920 Ga0207658_10013461 3300025986 Bacteria 5588
921 Ga0207658_10035546 3300025986 Bacteria 3569
922 Ga0207658_10331487 3300025986 Bacteria 1320
923 Ga0207658_10439549 3300025986 Bacteria 1153
924 Ga0207677_10200847 3300026023 Bacteria 1584
925 Ga0207677_10253538 3300026023 Bacteria 1430
926 Ga0207703_10000459 3300026035 Bacteria 42871
927 Ga0207703_10001239 3300026035 Bacteria 23890
928 Ga0207703_10245667 3300026035 Bacteria 1611
929 Ga0207703_10313635 3300026035 Bacteria 1434
930 Ga0207639_10061810 3300026041 Bacteria 2894
931 Ga0207639_10210608 3300026041 Bacteria 1673
932 Ga0207639_10359480 3300026041 Bacteria 1302
933 Ga0207678_10000008 3300026067 Bacteria 168926
934 Ga0207678_10006072 3300026067 Bacteria 10743
935 Ga0207678_10049848 3300026067 Bacteria 3618
936 Ga0207678_10096171 3300026067 Bacteria 2531
937 Ga0207678_10176378 3300026067 Bacteria 1825
938 Ga0207678_10230566 3300026067 Bacteria 1586
939 Ga0207678_10414950 3300026067 Bacteria 1167
940 Ga0207678_10561744 3300026067 Bacteria 998
941 Ga0207678_10597537 3300026067 Bacteria 967
942 Ga0207702_10000017 3300026078 Bacteria 222964
943 Ga0207702_10013539 3300026078 Bacteria 6775
944 Ga0207702_10165613 3300026078 Bacteria 2022
945 Ga0207702_10223950 3300026078 Bacteria 1754
946 Ga0207702_10231695 3300026078 Bacteria 1726
947 Ga0207702_10421046 3300026078 Bacteria 1291
948 Ga0207641_10000178 3300026088 Bacteria 88066
949 Ga0207641_10000872 3300026088 Bacteria 31574
950 Ga0207641_10007603 3300026088 Bacteria 9011
951 Ga0207641_10089355 3300026088 Bacteria 2692
952 Ga0207641_10678972 3300026088 Bacteria 1013
953 Ga0207648_10231778 3300026089 Bacteria 1642
954 Ga0207676_10141303 3300026095 Bacteria 2061
955 Ga0207674_10001770 3300026116 Bacteria 27610
956 Ga0207674_10004820 3300026116 Bacteria 16164
957 Ga0207674_10181346 3300026116 Bacteria 2057
958 Ga0207674_10208941 3300026116 Bacteria 1901
959 Ga0207674_10480278 3300026116 Bacteria 1201
960 Ga0207675_100058883 3300026118 Bacteria 3585
961 Ga0207683_10053708 3300026121 Bacteria 3533
962 Ga0207683_10093695 3300026121 Bacteria 2676
963 Ga0207683_10227634 3300026121 Bacteria 1700
964 Ga0207698_10026292 3300026142 Bacteria 4115
965 Ga0207698_10057500 3300026142 Bacteria 3010
966 Ga0207698_10240267 3300026142 Bacteria 1650
967 Ga0207698_10314308 3300026142 Bacteria 1464
968 Ga0207698_10404100 3300026142 Bacteria 1306
969 Ga0207698_10454791 3300026142 Bacteria 1237
970 Ga0209281_1000178 3300027111 Bacteria 148152
971 Ga0209281_1008525 3300027111 Bacteria 2479
972 Ga0209389_1000015 3300027296 Bacteria 188311
973 Ga0209389_1000035 3300027296 Bacteria 127089
974 Ga0209371_1000569 3300027312 Bacteria 33436
975 Ga0209371_1000597 3300027312 Bacteria 32346
976 Ga0209371_1012016 3300027312 Bacteria 2533
977 Ga0209371_1016528 3300027312 Bacteria 1943
978 Ga0209371_1018110 3300027312 Bacteria 1802
979 Ga0209589_1000039 3300027357 Bacteria 127084
980 Ga0209589_1001702 3300027357 Bacteria 36938
981 Ga0209489_100084 3300027361 Bacteria 127094
982 Ga0209489_102545 3300027361 Bacteria 36938
983 Ga0209489_102940 3300027361 Bacteria 33921
984 Ga0209700_100034 3300027363 Bacteria 197276
985 Ga0209700_102508 3300027363 Bacteria 36938
986 Ga0209282_1000017 3300027666 Bacteria 191482
987 Ga0209282_1000023 3300027666 Bacteria 173309
988 Ga0209282_1117556 3300027666 Bacteria 1336
989 Ga0209813_10000059 3300027866 Bacteria 44077
990 Ga0209813_10028858 3300027866 Bacteria 1621
991 Ga0209813_10034491 3300027866 Bacteria 1511
992 Ga0209974_10007608 3300027876 Bacteria 3731
993 Ga0268266_10005781 3300028379 Bacteria 11453
994 Ga0268266_10011589 3300028379 Bacteria 7653
995 Ga0268266_10037801 3300028379 Bacteria 4109
996 Ga0268266_10040206 3300028379 Bacteria 3985
997 Ga0268266_10073490 3300028379 Bacteria 2967
998 Ga0268266_10092303 3300028379 Bacteria 2656
999 Ga0268266_10112422 3300028379 Bacteria 2414
1000 Ga0268266_10179679 3300028379 Bacteria 1926
1001 Ga0268266_10223592 3300028379 Bacteria 1731
1002 Ga0268266_10280380 3300028379 Bacteria 1549
1003 Ga0268266_10423305 3300028379 Bacteria 1262
1004 Ga0268266_10487687 3300028379 Bacteria 1175
1005 Ga0268266_10691058 3300028379 Bacteria 983
1006 Ga0268266_11013571 3300028379 Bacteria 803
1007 Ga0268265_10025951 3300028380 Bacteria 4165
1008 Ga0268265_10145434 3300028380 Bacteria 1991
1009 Ga0268264_10000100 3300028381 Bacteria 227852
1010 Ga0268264_10006644 3300028381 Bacteria 9727
1011 Ga0268264_10024514 3300028381 Bacteria 4926
1012 Ga0268264_10238969 3300028381 Bacteria 1682
1013 Ga0265334_10019904 3300028573 Bacteria 2754
1014 Ga0307515_10000051 3300028794 Bacteria 272100
1015 Ga0307515_10000306 3300028794 Bacteria 121448
1016 Ga0307515_10009737 3300028794 Bacteria 18519
1017 Ga0307515_10052528 3300028794 Bacteria 6042
1018 Ga0268256_1005080 3300030500 Bacteria 5260
1019 Ga0268256_1008118 3300030500 Bacteria 3640
1020 Ga0268256_1013440 3300030500 Bacteria 2480
1021 Ga0268256_1018095 3300030500 Bacteria 1968
1022 Ga0307511_10000659 3300030521 Bacteria 36822
1023 Ga0307512_10095042 3300030522 Bacteria 2053
1024 Ga0307512_10153599 3300030522 Bacteria 1369
1025 Ga0265339_10279357 3300031249 Bacteria 801
1026 Ga0265331_10015671 3300031250 Bacteria 3997
1027 Ga0265327_10001789 3300031251 Bacteria 25262
1028 Ga0265327_10021339 3300031251 Bacteria 3911
1029 Ga0307513_10027606 3300031456 Bacteria 6512
1030 Ga0307513_10122189 3300031456 Bacteria 2568
1031 Ga0307509_10000034 3300031507 Bacteria 193380
1032 Ga0307509_10040475 3300031507 Bacteria 5068
1033 Ga0307509_10443146 3300031507 Bacteria 994
1034 Ga0307408_100001280 3300031548 Bacteria 18860
1035 Ga0307408_100112933 3300031548 Bacteria 2090
1036 Ga0307408_100677610 3300031548 Bacteria 924
1037 Ga0307508_10047677 3300031616 Bacteria 3819
1038 Ga0307508_10210873 3300031616 Bacteria 1543
1039 Ga0307514_10003152 3300031649 Bacteria 16186
1040 Ga0307514_10016003 3300031649 Bacteria 6178
1041 Ga0316575_10106104 3300031665 Bacteria 1144
1042 Ga0307516_10001544 3300031730 Bacteria 31641
1043 Ga0307405_10038178 3300031731 Bacteria 2892
1044 Ga0307405_10199889 3300031731 Bacteria 1451
1045 Ga0307413_10078219 3300031824 Bacteria 2109
1046 Ga0307413_10112264 3300031824 Bacteria 1827
1047 Ga0307413_10115624 3300031824 Bacteria 1806
1048 Ga0307410_10004525 3300031852 Bacteria 7201
1049 Ga0307410_10054455 3300031852 Bacteria 2712
1050 Ga0307410_10161562 3300031852 Bacteria 1679
1051 Ga0307406_10145912 3300031901 Bacteria 1681
1052 Ga0307407_10001118 3300031903 Bacteria 9380
1053 Ga0307407_10068033 3300031903 Bacteria 2108
1054 Ga0307412_10066772 3300031911 Bacteria 2439
1055 Ga0315914_1000016 3300031967 Bacteria 126814
1056 Ga0307409_100002657 3300031995 Bacteria 9415
1057 Ga0307409_100070215 3300031995 Bacteria 2779
1058 Ga0307409_100323327 3300031995 Bacteria 1445
1059 Ga0307416_100013447 3300032002 Bacteria 5562
1060 Ga0307416_100015496 3300032002 Bacteria 5268
1061 Ga0307416_100088858 3300032002 Bacteria 2643
1062 Ga0307416_100146116 3300032002 Bacteria 2159
1063 Ga0307416_100604493 3300032002 Bacteria 1177
1064 Ga0307414_10026214 3300032004 Bacteria 3748
1065 Ga0307414_10061353 3300032004 Bacteria 2663
1066 Ga0307414_10118611 3300032004 Bacteria 2030
1067 Ga0307414_10151948 3300032004 Bacteria 1828
1068 Ga0307411_10002468 3300032005 Bacteria 8195
1069 Ga0307411_10032257 3300032005 Bacteria 3234
1070 Ga0307411_10081511 3300032005 Bacteria 2229
1071 Ga0307411_10085193 3300032005 Bacteria 2188
1072 Ga0307411_10256057 3300032005 Bacteria 1379
1073 Ga0307411_10329565 3300032005 Bacteria 1236
1074 Ga0307411_10780170 3300032005 Bacteria 840
1075 Ga0307415_100043727 3300032126 Bacteria 2990
1076 Ga0307510_10000967 3300033180 Bacteria 30417
1077 Ga0307510_10002108 3300033180 Bacteria 22480
1078 Ga0307510_10210258 3300033180 Bacteria 1468
1079 Ga0315913_1000027 3300033430 Bacteria 83484
1080 Ga0315911_1000042 3300033442 Bacteria 49262
1081 Ga0315915_1000007 3300033464 Bacteria 319225
1082 Ga0373936_0020783 3300035113 Bacteria 2552
1083 Ga0373954_0213413 3300035118 Bacteria 949
1084 Ga0373927_0000106 3300035695 Bacteria 63236
1085 Ga0373947_0061485 3300035725 Bacteria 2283
1086 Ga0316584_0022282 3300036712 Bacteria 4618
1087 Ga0373925_0050634 3300037068 Bacteria 3098
1088 Ga0373925_0174200 3300037068 Bacteria 1700
1089 Ga0395899_0000072 3300037312 Bacteria 184393
1090 Ga0395899_0000264 3300037312 Bacteria 68569
1091 Ga0395899_0000854 3300037312 Bacteria 29169
1092 Ga0395899_0001880 3300037312 Bacteria 17332
1093 Ga0395899_0003144 3300037312 Bacteria 13126
1094 Ga0395899_0003332 3300037312 Bacteria 12734
1095 Ga0395899_0013246 3300037312 Bacteria 6310
1096 Ga0395899_0052313 3300037312 Bacteria 3027
1097 Ga0395899_0079649 3300037312 Bacteria 2385
1098 Ga0395899_0238442 3300037312 Bacteria 1252
1099 Ga0395899_0540257 3300037312 Bacteria 751
1100 Ga0395900_0000072 3300037418 Bacteria 187428
1101 Ga0395900_0000584 3300037418 Bacteria 50170
1102 Ga0395900_0000924 3300037418 Bacteria 38604
1103 Ga0395900_0007118 3300037418 Bacteria 11591
1104 Ga0395900_0012600 3300037418 Bacteria 8650
1105 Ga0395900_0021562 3300037418 Bacteria 6586
1106 Ga0395900_0023664 3300037418 Bacteria 6284
1107 Ga0395900_0038244 3300037418 Bacteria 4946
1108 Ga0395900_0038772 3300037418 Bacteria 4911
1109 Ga0395900_0052284 3300037418 Bacteria 4205
1110 Ga0395900_0066109 3300037418 Bacteria 3716
1111 Ga0395900_0315705 3300037418 Bacteria 1545
1112 Ga0395900_0318088 3300037418 Bacteria 1537
1113 Ga0395900_0525526 3300037418 Bacteria 1130
1114 Ga0395900_0622074 3300037418 Bacteria 1018
1115 Ga0395900_1025043 3300037418 Bacteria 744
1116 Ga0395898_0000029 3300037466 Bacteria 370667
1117 Ga0395898_0000202 3300037466 Bacteria 153541
1118 Ga0395898_0004694 3300037466 Bacteria 14873
1119 Ga0395898_0013392 3300037466 Bacteria 8447
1120 Ga0395898_0016060 3300037466 Bacteria 7669
1121 Ga0395898_0017325 3300037466 Bacteria 7360
1122 Ga0395898_0096271 3300037466 Bacteria 2843
1123 Ga0395898_0107864 3300037466 Bacteria 2670
1124 Ga0395898_0190229 3300037466 Bacteria 1961
1125 Ga0395898_0268994 3300037466 Bacteria 1625
1126 Ga0395898_0536678 3300037466 Bacteria 1111
1127 Ga0395898_0972125 3300037466 Bacteria 786
1128 Ga0395905_0001122 3300037471 Bacteria 33554
1129 Ga0395905_0021702 3300037471 Bacteria 6074
1130 Ga0395905_0025179 3300037471 Bacteria 5612
1131 Ga0395905_0039761 3300037471 Bacteria 4413
1132 Ga0395905_0062686 3300037471 Bacteria 3477
1133 Ga0395905_0068264 3300037471 Bacteria 3330
1134 Ga0395905_0117332 3300037471 Bacteria 2501
1135 Ga0395905_0146898 3300037471 Bacteria 2219
1136 Ga0395905_0160959 3300037471 Bacteria 2109
1137 Ga0395905_0309978 3300037471 Bacteria 1467
1138 Ga0395905_0319229 3300037471 Bacteria 1443
1139 Ga0395905_0395987 3300037471 Bacteria 1275
1140 Ga0436364_0098754 3300037853 Bacteria 826
1141 Ga0436364_0463021 3300037853 Bacteria 932
1142 Ga0395901_0000052 3300038443 Bacteria 165888
1143 Ga0395901_0000094 3300038443 Bacteria 120153
1144 Ga0395901_0124445 3300038443 Bacteria 2709
1145 Ga0395901_0151178 3300038443 Bacteria 2439
1146 Ga0395901_0192773 3300038443 Bacteria 2137
1147 Ga0395901_0214429 3300038443 Bacteria 2013
1148 Ga0395901_0280121 3300038443 Bacteria 1732
1149 Ga0395901_0283560 3300038443 Bacteria 1720
1150 Ga0395901_0326669 3300038443 Bacteria 1586
1151 Ga0395901_0829454 3300038443 Bacteria 911
1152 Ga0395901_0985382 3300038443 Bacteria 820
1153 Ga0237816_01079 3300039145 Bacteria 2247
1154 Ga0436365_0955522 3300039437 Bacteria 2293
1155 Ga0436365_0981578 3300039437 Bacteria 4125
1156 Ga0436365_1811392 3300039437 Bacteria 9704
1157 Ga0436360_0065549 3300039438 Bacteria 1907
1158 Ga0436361_0148264 3300039447 Bacteria 57652
1159 Ga0436361_0152256 3300039447 Bacteria 4588
1160 Ga0436361_0177374 3300039447 Bacteria 5852
1161 Ga0436361_0223084 3300039447 Bacteria 3136
1162 Ga0436361_0400142 3300039447 Bacteria 2332
1163 Ga0436361_0421745 3300039447 Bacteria 1530
1164 Ga0436361_0436689 3300039447 Bacteria 47478
1165 Ga0436361_0527052 3300039447 Bacteria 6539
1166 Ga0436361_0529332 3300039447 Bacteria 100222
1167 Ga0436361_0735588 3300039447 Bacteria 9757
1168 Ga0436361_0767394 3300039447 Bacteria 56110
1169 Ga0436361_0817425 3300039447 Bacteria 2698
1170 Ga0436361_0875320 3300039447 Bacteria 1019
1171 Ga0436361_0898788 3300039447 Bacteria 3523
1172 Ga0436362_0848885 3300039453 Bacteria 2346
1173 Ga0439436_0002379 3300041404 Bacteria 5641
1174 Ga0439436_0052367 3300041404 Bacteria 1151
1175 Ga0439439_0001395 3300041406 Bacteria 4789
1176 Ga0439447_056743 3300041407 Bacteria 926
1177 Ga0439466_0009070 3300041411 Bacteria 3733
1178 Ga0439466_0037058 3300041411 Bacteria 1644
1179 Ga0439465_0001406 3300041413 Bacteria 7785
1180 Ga0439465_0119740 3300041413 Bacteria 922
1181 Ga0451793_0495086 3300041452 Bacteria 929
1182 Ga0451793_0547434 3300041452 Bacteria 1544
1183 Ga0451797_1114440 3300041453 Bacteria 919
1184 Ga0451802_0096045 3300041460 Bacteria 2567
1185 Ga0451802_1562148 3300041460 Bacteria 1043
1186 Ga0451833_1037538 3300041491 Bacteria 930
1187 Ga0451837_0687090 3300041494 Bacteria 1537
1188 Ga0451845_0384880 3300041501 Bacteria 1063
1189 Ga0451843_0062109 3300041509 Bacteria 982
1190 Ga0451843_1289635 3300041509 Bacteria 2393
1191 Ga0451853_2619191 3300041512 Bacteria 1696
1192 Ga0439431_0057842 3300041997 Bacteria 1016
1193 Ga0439433_0002575 3300041999 Bacteria 3850
1194 Ga0439437_003911 3300042000 Bacteria 1614
1195 Ga0439445_0001144 3300042004 Bacteria 5689
1196 Ga0439448_0043264 3300042005 Bacteria 1461
1197 Ga0439432_007884 3300042006 Bacteria 3753
1198 Ga0439432_070831 3300042006 Bacteria 1063
1199 Ga0439449_0000776 3300042007 Bacteria 12298
1200 Ga0439449_0007437 3300042007 Bacteria 4165
1201 Ga0439449_0011887 3300042007 Bacteria 3273
1202 Ga0439452_005681 3300042010 Bacteria 3991
1203 Ga0439452_008677 3300042010 Bacteria 3041
1204 Ga0439452_044426 3300042010 Bacteria 1036
1205 Ga0439457_007317 3300042014 Bacteria 2656
1206 Ga0439457_017067 3300042014 Bacteria 1614
1207 Ga0439462_0011185 3300042015 Bacteria 2281
1208 Ga0450917_001327 3300042120 Bacteria 1778
1209 Ga0450890_009081 3300042127 Bacteria 1270
1210 Ga0450897_005149 3300042128 Bacteria 1123
1211 Ga0450891_002081 3300042129 Bacteria 2032
1212 Ga0450892_008277 3300042130 Bacteria 886
1213 Ga0450898_014182 3300042134 Bacteria 1337
1214 Ga0450889_001445 3300042144 Bacteria 2450
1215 Ga0439434_0000345 3300042435 Bacteria 13219
1216 Ga0450916_002094 3300042530 Bacteria 2075
1217 Ga0450918_038670 3300042531 Bacteria 853
1218 Ga0450893_0003942 3300042532 Bacteria 2353
1219 Ga0450893_0010128 3300042532 Bacteria 1546
1220 Ga0466986_0046173 3300044650 Bacteria 3008
1221 Ga0466969_0003272 3300044656 Bacteria 8609
1222 Ga0466969_0008117 3300044656 Bacteria 5572
1223 Ga0466969_0016667 3300044656 Bacteria 3843
1224 Ga0466969_0048374 3300044656 Bacteria 2102
1225 Ga0466972_0000034 3300044658 Bacteria 152086
1226 Ga0466972_0001484 3300044658 Bacteria 11412
1227 Ga0466972_0006287 3300044658 Bacteria 5965
1228 Ga0466972_0019770 3300044658 Bacteria 3367
1229 Ga0466972_0049554 3300044658 Bacteria 2028
1230 Ga0466972_0053806 3300044658 Bacteria 1938
1231 Ga0466977_0007337 3300044666 Bacteria 6006
1232 Ga0466978_0003233 3300044671 Bacteria 7402
1233 Ga0466982_0000009 3300044672 Bacteria 221166
1234 Ga0466965_0001356 3300044683 Bacteria 9815
1235 Ga0466965_0001806 3300044683 Bacteria 8874
1236 Ga0466965_0017143 3300044683 Bacteria 3457
1237 Ga0466965_0052707 3300044683 Bacteria 2021
1238 Ga0466966_0000520 3300044684 Bacteria 24509
1239 Ga0466966_0004124 3300044684 Bacteria 9597
1240 Ga0466966_0026747 3300044684 Bacteria 3765
1241 Ga0466966_0032967 3300044684 Bacteria 3353
1242 Ga0466966_0081222 3300044684 Bacteria 2018
1243 Ga0466966_0090696 3300044684 Bacteria 1898
1244 Ga0466966_0105461 3300044684 Bacteria 1740
1245 Ga0466961_0000046 3300044693 Bacteria 74500
1246 Ga0466961_0001185 3300044693 Bacteria 16072
1247 Ga0466961_0001449 3300044693 Bacteria 14742
1248 Ga0466961_0001611 3300044693 Bacteria 13995
1249 Ga0466961_0004029 3300044693 Bacteria 9204
1250 Ga0466961_0012413 3300044693 Bacteria 5449
1251 Ga0466961_0036026 3300044693 Bacteria 3176
1252 Ga0466961_0049510 3300044693 Bacteria 2685
1253 Ga0466961_0148179 3300044693 Bacteria 1466
1254 Ga0466961_0212923 3300044693 Bacteria 1192
1255 Ga0466964_0002239 3300044706 Bacteria 6856
1256 Ga0466964_0142977 3300044706 Bacteria 1101
1257 Ga0466964_0178396 3300044706 Bacteria 1005
1258 Ga0466964_0216881 3300044706 Bacteria 927
1259 Ga0466971_0000766 3300044719 Bacteria 12899
1260 Ga0466971_0038637 3300044719 Bacteria 2142
1261 Ga0466971_0104563 3300044719 Bacteria 1303
1262 Ga0466971_0112511 3300044719 Bacteria 1257
1263 Ga0466968_0003118 3300044735 Bacteria 6115
1264 Ga0466968_0010151 3300044735 Bacteria 3642
1265 Ga0466968_0042969 3300044735 Bacteria 1912
1266 Ga0466968_0235459 3300044735 Bacteria 866
1267 Ga0466970_0000195 3300044765 Bacteria 29413
1268 Ga0466970_0009347 3300044765 Bacteria 4952
1269 Ga0466970_0031509 3300044765 Bacteria 2800
1270 Ga0466970_0038826 3300044765 Bacteria 2526
1271 Ga0466970_0070452 3300044765 Bacteria 1880
1272 Ga0466970_0073710 3300044765 Bacteria 1837
1273 Ga0466970_0161637 3300044765 Bacteria 1239
1274 Ga0466970_0344828 3300044765 Bacteria 845
1275 Ga0466957_0003671 3300044842 Bacteria 8471
1276 Ga0466957_0154548 3300044842 Bacteria 1486
1277 Ga0466960_0007309 3300044901 Bacteria 4478
1278 Ga0466960_0058914 3300044901 Bacteria 1877
1279 Ga0466959_0001233 3300045049 Bacteria 15451
1280 Ga0466959_0002155 3300045049 Bacteria 12502
1281 Ga0466959_0003192 3300045049 Bacteria 10651
1282 Ga0466959_0020120 3300045049 Bacteria 4914
1283 Ga0466959_0027783 3300045049 Bacteria 4196
1284 Ga0466959_0053383 3300045049 Bacteria 2955
1285 Ga0466959_0122278 3300045049 Bacteria 1849
1286 Ga0466959_0134957 3300045049 Bacteria 1747
1287 Ga0466959_0145969 3300045049 Bacteria 1669
1288 Ga0466959_0313414 3300045049 Bacteria 1073
1289 Ga0451576_0294393 3300045051 Bacteria 1697
1290 Ga0466958_0070150 3300045836 Bacteria 2144
1291 Ga0466958_0070685 3300045836 Bacteria 2136
1292 Ga0466958_0128508 3300045836 Bacteria 1590
1293 Ga0466967_0275595 3300045976 Bacteria 1613
1294 Ga0466967_0960965 3300045976 Bacteria 850
1295 Ga0495617_003539 3300046452 Bacteria 5847
1296 Ga0495617_025076 3300046452 Bacteria 2011
1297 Ga0495617_098033 3300046452 Bacteria 954
1298 Ga0495627_000001 3300046453 Bacteria 1104709
1299 Ga0495627_000213 3300046453 Bacteria 62885
1300 Ga0495627_000256 3300046453 Bacteria 54510
1301 Ga0495592_0005242 3300046454 Bacteria 9559
1302 Ga0495592_0031501 3300046454 Bacteria 4008
1303 Ga0495592_0036030 3300046454 Bacteria 3727
1304 Ga0495592_0177494 3300046454 Bacteria 1453
1305 Ga0495590_0000015 3300046457 Bacteria 241989
1306 Ga0495591_000033 3300046458 Bacteria 171402
1307 Ga0495629_0008209 3300046459 Bacteria 7678
1308 Ga0495629_0019543 3300046459 Bacteria 4838
1309 Ga0495629_0450367 3300046459 Bacteria 871
1310 Ga0495638_0000072 3300046460 Bacteria 164926
1311 Ga0495638_0000272 3300046460 Bacteria 69973
1312 Ga0495638_0000290 3300046460 Bacteria 66116
1313 Ga0495638_0041698 3300046460 Bacteria 2902
1314 Ga0495638_0063671 3300046460 Bacteria 2273
1315 Ga0495651_0017763 3300046462 Bacteria 5507
1316 Ga0495653_0000005 3300046463 Bacteria 367438
1317 Ga0495653_0125769 3300046463 Bacteria 1821
1318 Ga0495653_0157219 3300046463 Bacteria 1582
1319 Ga0495650_0000210 3300046471 Bacteria 125249
1320 Ga0495650_0000687 3300046471 Bacteria 43702
1321 Ga0495650_0002084 3300046471 Bacteria 17255
1322 Ga0495650_0011752 3300046471 Bacteria 4762
1323 Ga0495650_0021338 3300046471 Bacteria 3134
1324 Ga0495650_0051503 3300046471 Bacteria 1696
1325 Ga0495650_0076463 3300046471 Bacteria 1301
1326 Ga0495650_0094525 3300046471 Bacteria 1131
1327 Ga0495605_0000058 3300046474 Bacteria 150303
1328 Ga0495605_0003568 3300046474 Bacteria 9220
1329 Ga0495605_0012201 3300046474 Bacteria 4771
1330 Ga0495605_0044904 3300046474 Bacteria 2181
1331 Ga0495605_0063636 3300046474 Bacteria 1759
1332 Ga0495639_0087075 3300046475 Bacteria 1461
1333 Ga0495662_0006436 3300046476 Bacteria 5864
1334 Ga0495662_0079851 3300046476 Bacteria 1591
1335 Ga0495664_0013389 3300046477 Bacteria 4651
1336 Ga0495584_0000119 3300046491 Bacteria 54120
1337 Ga0495584_0009878 3300046491 Bacteria 4908
1338 Ga0495584_0018571 3300046491 Bacteria 3534
1339 Ga0495584_0030302 3300046491 Bacteria 2740
1340 Ga0495584_0102022 3300046491 Bacteria 1450
1341 Ga0495585_0000257 3300046492 Bacteria 54605
1342 Ga0495585_0001214 3300046492 Bacteria 20870
1343 Ga0495585_0002716 3300046492 Bacteria 12373
1344 Ga0495585_0010377 3300046492 Bacteria 5546
1345 Ga0495585_0025158 3300046492 Bacteria 3412
1346 Ga0495585_0066316 3300046492 Bacteria 1976
1347 Ga0495585_0079938 3300046492 Bacteria 1772
1348 Ga0495585_0082734 3300046492 Bacteria 1737
1349 Ga0495585_0146534 3300046492 Bacteria 1233
1350 Ga0495594_0009740 3300046499 Bacteria 4972
1351 Ga0495596_0000041 3300046500 Bacteria 93277
1352 Ga0495596_0000408 3300046500 Bacteria 27478
1353 Ga0495596_0007208 3300046500 Bacteria 5031
1354 Ga0495596_0007855 3300046500 Bacteria 4780
1355 Ga0495596_0008610 3300046500 Bacteria 4531
1356 Ga0495596_0018900 3300046500 Bacteria 2836
1357 Ga0495596_0023216 3300046500 Bacteria 2518
1358 Ga0495596_0028066 3300046500 Bacteria 2260
1359 Ga0495596_0032470 3300046500 Bacteria 2080
1360 Ga0495607_0000878 3300046501 Bacteria 28026
1361 Ga0495607_0035566 3300046501 Bacteria 3011
1362 Ga0495607_0039809 3300046501 Bacteria 2804
1363 Ga0495607_0040281 3300046501 Bacteria 2783
1364 Ga0495607_0050477 3300046501 Bacteria 2421
1365 Ga0495607_0056943 3300046501 Bacteria 2242
1366 Ga0495607_0059324 3300046501 Bacteria 2183
1367 Ga0495607_0059530 3300046501 Bacteria 2178
1368 Ga0495607_0147154 3300046501 Bacteria 1209
1369 Ga0495607_0224376 3300046501 Bacteria 917
1370 Ga0495607_0234601 3300046501 Bacteria 890
1371 Ga0495583_0000003 3300046506 Bacteria 709273
1372 Ga0495583_0000030 3300046506 Bacteria 254970
1373 Ga0495583_0000040 3300046506 Bacteria 236558
1374 Ga0495583_0000148 3300046506 Bacteria 118749
1375 Ga0495583_0000394 3300046506 Bacteria 66597
1376 Ga0495583_0001793 3300046506 Bacteria 20372
1377 Ga0495583_0003643 3300046506 Bacteria 11501
1378 Ga0495583_0043475 3300046506 Bacteria 2091
1379 Ga0495583_0098702 3300046506 Bacteria 1248
1380 Ga0495606_0000006 3300046507 Bacteria 357021
1381 Ga0495606_0000016 3300046507 Bacteria 284865
1382 Ga0495606_0000449 3300046507 Bacteria 67234
1383 Ga0495606_0000607 3300046507 Bacteria 56692
1384 Ga0495606_0001435 3300046507 Bacteria 31977
1385 Ga0495606_0005156 3300046507 Bacteria 12659
1386 Ga0495606_0012527 3300046507 Bacteria 6792
1387 Ga0495606_0032515 3300046507 Bacteria 3612
1388 Ga0495606_0047202 3300046507 Bacteria 2840
1389 Ga0495606_0055753 3300046507 Bacteria 2554
1390 Ga0495606_0096342 3300046507 Bacteria 1810
1391 Ga0495606_0105124 3300046507 Bacteria 1712
1392 Ga0495606_0125810 3300046507 Bacteria 1529
1393 Ga0495606_0129293 3300046507 Bacteria 1503
1394 Ga0495606_0194980 3300046507 Bacteria 1158
1395 Ga0495606_0199113 3300046507 Bacteria 1143
1396 Ga0495606_0225330 3300046507 Bacteria 1054
1397 Ga0495608_0006077 3300046511 Bacteria 8571
1398 Ga0495608_0044623 3300046511 Bacteria 2958
1399 Ga0495610_0000220 3300046512 Bacteria 61190
1400 Ga0495610_0000337 3300046512 Bacteria 49536
1401 Ga0495610_0002602 3300046512 Bacteria 14967
1402 Ga0495610_0003833 3300046512 Bacteria 11453
1403 Ga0495610_0047506 3300046512 Bacteria 2111
1404 Ga0495610_0072807 3300046512 Bacteria 1599
1405 Ga0495610_0073695 3300046512 Bacteria 1585
1406 Ga0495610_0080898 3300046512 Bacteria 1492
1407 Ga0495610_0082625 3300046512 Bacteria 1472
1408 Ga0495616_0000123 3300046513 Bacteria 67114
1409 Ga0495616_0003728 3300046513 Bacteria 9721
1410 Ga0495616_0011097 3300046513 Bacteria 5176
1411 Ga0495616_0013463 3300046513 Bacteria 4613
1412 Ga0495616_0014710 3300046513 Bacteria 4372
1413 Ga0495616_0028263 3300046513 Bacteria 2969
1414 Ga0495616_0051030 3300046513 Bacteria 2065
1415 Ga0495616_0066747 3300046513 Bacteria 1750
1416 Ga0495616_0069287 3300046513 Bacteria 1710
1417 Ga0495616_0105506 3300046513 Bacteria 1315
1418 Ga0495616_0120699 3300046513 Bacteria 1210
1419 Ga0495620_0112915 3300046515 Bacteria 1075
1420 Ga0495620_0139770 3300046515 Bacteria 947
1421 Ga0495628_0091403 3300046516 Bacteria 2355
1422 Ga0495631_0003448 3300046518 Bacteria 8652
1423 Ga0495631_0007794 3300046518 Bacteria 5431
1424 Ga0495631_0008206 3300046518 Bacteria 5267
1425 Ga0495631_0034294 3300046518 Bacteria 2276
1426 Ga0495631_0042117 3300046518 Bacteria 2018
1427 Ga0495632_0000084 3300046519 Bacteria 96469
1428 Ga0495632_0001112 3300046519 Bacteria 23059
1429 Ga0495632_0001875 3300046519 Bacteria 16875
1430 Ga0495632_0002772 3300046519 Bacteria 13020
1431 Ga0495632_0006187 3300046519 Bacteria 7747
1432 Ga0495632_0011470 3300046519 Bacteria 5167
1433 Ga0495632_0054778 3300046519 Bacteria 1954
1434 Ga0495632_0072416 3300046519 Bacteria 1654
1435 Ga0495637_0000002 3300046520 Bacteria 629280
1436 Ga0495643_0000193 3300046522 Bacteria 96406
1437 Ga0495643_0017910 3300046522 Bacteria 4130
1438 Ga0495643_0031305 3300046522 Bacteria 2961
1439 Ga0495643_0040345 3300046522 Bacteria 2550
1440 Ga0495643_0061242 3300046522 Bacteria 1996
1441 Ga0495643_0081910 3300046522 Bacteria 1677
1442 Ga0495643_0087462 3300046522 Bacteria 1612
1443 Ga0495643_0093522 3300046522 Bacteria 1548
1444 Ga0495643_0111411 3300046522 Bacteria 1391
1445 Ga0495643_0142573 3300046522 Bacteria 1193
1446 Ga0495644_0003946 3300046523 Bacteria 5830
1447 Ga0495644_0010279 3300046523 Bacteria 3605
1448 Ga0495644_0018480 3300046523 Bacteria 2664
1449 Ga0495644_0024506 3300046523 Bacteria 2295
1450 Ga0495644_0028055 3300046523 Bacteria 2131
1451 Ga0495644_0033596 3300046523 Bacteria 1937
1452 Ga0495644_0173076 3300046523 Bacteria 829
1453 Ga0495648_0000037 3300046524 Bacteria 195401
1454 Ga0495648_0002897 3300046524 Bacteria 15430
1455 Ga0495648_0008531 3300046524 Bacteria 8052
1456 Ga0495648_0015811 3300046524 Bacteria 5457
1457 Ga0495648_0022260 3300046524 Bacteria 4367
1458 Ga0495648_0160326 3300046524 Bacteria 1163
1459 Ga0495648_0192151 3300046524 Bacteria 1029
1460 Ga0495663_0057378 3300046525 Bacteria 1218
1461 Ga0495663_0131556 3300046525 Bacteria 844
1462 Ga0495642_0000072 3300046528 Bacteria 59857
1463 Ga0495642_0000107 3300046528 Bacteria 46885
1464 Ga0495642_0012471 3300046528 Bacteria 3277
1465 Ga0495642_0024775 3300046528 Bacteria 2375
1466 Ga0495642_0059901 3300046528 Bacteria 1578
1467 Ga0495642_0099188 3300046528 Bacteria 1238
1468 Ga0495642_0127436 3300046528 Bacteria 1095
1469 Ga0495642_0129904 3300046528 Bacteria 1084
1470 Ga0495642_0153059 3300046528 Bacteria 998
1471 Ga0495652_0004750 3300046529 Bacteria 12933
1472 Ga0495652_0030167 3300046529 Bacteria 4758
1473 Ga0495652_0144054 3300046529 Bacteria 1870
1474 Ga0495652_0288336 3300046529 Bacteria 1199
1475 Ga0495654_0041482 3300046530 Bacteria 2288
1476 Ga0495609_0000001 3300046538 Bacteria 1060094
1477 Ga0495609_0000797 3300046538 Bacteria 23617
1478 Ga0495609_0000909 3300046538 Bacteria 21488
1479 Ga0495609_0002271 3300046538 Bacteria 11984
1480 Ga0495609_0002284 3300046538 Bacteria 11937
1481 Ga0495609_0007357 3300046538 Bacteria 5506
1482 Ga0495609_0009546 3300046538 Bacteria 4691
1483 Ga0495609_0018625 3300046538 Bacteria 3217
1484 Ga0495609_0022496 3300046538 Bacteria 2903
1485 Ga0495609_0032303 3300046538 Bacteria 2378
1486 Ga0495609_0152485 3300046538 Bacteria 982
1487 Ga0495609_0291268 3300046538 Bacteria 666
1488 Ga0495597_0000093 3300046542 Bacteria 79411
1489 Ga0495597_0000953 3300046542 Bacteria 22360
1490 Ga0495597_0034159 3300046542 Bacteria 2299
1491 Ga0495597_0047988 3300046542 Bacteria 1890
1492 Ga0495597_0050935 3300046542 Bacteria 1827
1493 Ga0495645_0003664 3300046543 Bacteria 10439
1494 Ga0495645_0050937 3300046543 Bacteria 3013
1495 Ga0495645_0143462 3300046543 Bacteria 1664
1496 Ga0495645_0154396 3300046543 Bacteria 1592
1497 Ga0495645_0161784 3300046543 Bacteria 1547
1498 Ga0495622_0000002 3300046557 Bacteria 321742
1499 Ga0495622_0000040 3300046557 Bacteria 118542
1500 Ga0495622_0005869 3300046557 Bacteria 5700
1501 Ga0495622_0181923 3300046557 Bacteria 942
1502 Ga0495633_0000121 3300046558 Bacteria 105197
1503 Ga0495633_0000258 3300046558 Bacteria 62715
1504 Ga0495633_0005001 3300046558 Bacteria 8269
1505 Ga0495633_0014146 3300046558 Bacteria 4182
1506 Ga0495633_0017595 3300046558 Bacteria 3650
1507 Ga0495633_0047978 3300046558 Bacteria 2017
1508 Ga0495633_0097173 3300046558 Bacteria 1368
1509 Ga0495633_0176259 3300046558 Bacteria 984
1510 Ga0495633_0252573 3300046558 Bacteria 804
1511 Ga0495633_0286685 3300046558 Bacteria 749
1512 Ga0495667_0101333 3300046559 Bacteria 1863
1513 Ga0495668_0000020 3300046616 Bacteria 411641
1514 Ga0495668_0000706 3300046616 Bacteria 40250
1515 Ga0495668_0000874 3300046616 Bacteria 33966
1516 Ga0495668_0005244 3300046616 Bacteria 8879
1517 Ga0495668_0008275 3300046616 Bacteria 6513
1518 Ga0495668_0020567 3300046616 Bacteria 3794
1519 Ga0495668_0052133 3300046616 Bacteria 2264
1520 Ga0495668_0070933 3300046616 Bacteria 1915
1521 Ga0495634_0091285 3300046642 Bacteria 1977
1522 Ga0495611_0000587 3300046648 Bacteria 20974
1523 Ga0495611_0002244 3300046648 Bacteria 8968
1524 Ga0495611_0006948 3300046648 Bacteria 4808
1525 Ga0495611_0009748 3300046648 Bacteria 4060
1526 Ga0495611_0013951 3300046648 Bacteria 3428
1527 Ga0495611_0036569 3300046648 Bacteria 2180
1528 Ga0495611_0092857 3300046648 Bacteria 1396
1529 Ga0495625_0001389 3300046660 Bacteria 29685
1530 Ga0495625_0001675 3300046660 Bacteria 25868
1531 Ga0495625_0008625 3300046660 Bacteria 8672
1532 Ga0495625_0022171 3300046660 Bacteria 4873
1533 Ga0495625_0035822 3300046660 Bacteria 3654
1534 Ga0495625_0063208 3300046660 Bacteria 2614
1535 Ga0495625_0066518 3300046660 Bacteria 2538
1536 Ga0495625_0367527 3300046660 Bacteria 905
1537 Ga0495625_0572172 3300046660 Bacteria 682
1538 Ga0495635_0017175 3300046663 Bacteria 5053
1539 Ga0495635_0159597 3300046663 Bacteria 1534
1540 Ga0495635_0189618 3300046663 Bacteria 1396
1541 Ga0495659_0003273 3300046664 Bacteria 5195
1542 Ga0495659_0013187 3300046664 Bacteria 2688
1543 Ga0495661_0000175 3300046665 Bacteria 73957
1544 Ga0495661_0000260 3300046665 Bacteria 60822
1545 Ga0495661_0000958 3300046665 Bacteria 26178
1546 Ga0495661_0001726 3300046665 Bacteria 17686
1547 Ga0495661_0002182 3300046665 Bacteria 15279
1548 Ga0495661_0024480 3300046665 Bacteria 3907
1549 Ga0495661_0025742 3300046665 Bacteria 3796
1550 Ga0495661_0026225 3300046665 Bacteria 3755
1551 Ga0495661_0056836 3300046665 Bacteria 2338
1552 Ga0495661_0072671 3300046665 Bacteria 2006
1553 Ga0495661_0090893 3300046665 Bacteria 1736
1554 Ga0495661_0094681 3300046665 Bacteria 1692
1555 Ga0495661_0100933 3300046665 Bacteria 1624
1556 Ga0495661_0102223 3300046665 Bacteria 1611
1557 Ga0495661_0141606 3300046665 Bacteria 1307
1558 Ga0495661_0152048 3300046665 Bacteria 1250
1559 Ga0495588_0000095 3300046674 Bacteria 175627
1560 Ga0495588_0027805 3300046674 Bacteria 2828
1561 Ga0495588_0082937 3300046674 Bacteria 1674
1562 Ga0495588_0140787 3300046674 Bacteria 1274
1563 Ga0495588_0155849 3300046674 Bacteria 1207
1564 Ga0495657_0107623 3300046675 Bacteria 1769
1565 Ga0495657_0119815 3300046675 Bacteria 1658
1566 Ga0495657_0121914 3300046675 Bacteria 1641
1567 Ga0495599_0038101 3300046678 Bacteria 3020
1568 Ga0495623_0030775 3300046679 Bacteria 3453
1569 Ga0495623_0038134 3300046679 Bacteria 3073
1570 Ga0495623_0140420 3300046679 Bacteria 1438
1571 Ga0495646_0008158 3300046680 Bacteria 6658
1572 Ga0495646_0092665 3300046680 Bacteria 1742
1573 Ga0495646_0157655 3300046680 Bacteria 1258
1574 Ga0495646_0184574 3300046680 Bacteria 1143
1575 Ga0495669_0000029 3300046684 Bacteria 105945
1576 Ga0495669_0006138 3300046684 Bacteria 5010
1577 Ga0495669_0042896 3300046684 Bacteria 2012
1578 Ga0495669_0043860 3300046684 Bacteria 1991
1579 Ga0495669_0059326 3300046684 Bacteria 1728
1580 Ga0495669_0139036 3300046684 Bacteria 1146
1581 Ga0495613_0031974 3300046689 Bacteria 3909
1582 Ga0495624_0156792 3300046690 Bacteria 1391
1583 Ga0495670_0005938 3300046691 Bacteria 5976
1584 Ga0495670_0020512 3300046691 Bacteria 3259
1585 Ga0495670_0032783 3300046691 Bacteria 2583
1586 Ga0495670_0048239 3300046691 Bacteria 2130
1587 Ga0495670_0052672 3300046691 Bacteria 2038
1588 Ga0495670_0090186 3300046691 Bacteria 1568
1589 Ga0495670_0159625 3300046691 Bacteria 1184
1590 Ga0495670_0190397 3300046691 Bacteria 1084
1591 Ga0495671_0000292 3300046692 Bacteria 41819
1592 Ga0495671_0000373 3300046692 Bacteria 36795
1593 Ga0495671_0001441 3300046692 Bacteria 15977
1594 Ga0495671_0058653 3300046692 Bacteria 1904
1595 Ga0495671_0103059 3300046692 Bacteria 1394
1596 Ga0495649_0000024 3300046694 Bacteria 175713
1597 Ga0495649_0000949 3300046694 Bacteria 22882
1598 Ga0495649_0001640 3300046694 Bacteria 16636
1599 Ga0495649_0007477 3300046694 Bacteria 6653
1600 Ga0495649_0055889 3300046694 Bacteria 2132
1601 Ga0495649_0089086 3300046694 Bacteria 1645
1602 Ga0495649_0128881 3300046694 Bacteria 1335
1603 Ga0495589_0000029 3300046794 Bacteria 173640
1604 Ga0495589_0084906 3300046794 Bacteria 1538
1605 Ga0495589_0125935 3300046794 Bacteria 1232
1606 Ga0495600_0003322 3300046809 Bacteria 9445
1607 Ga0495600_0009990 3300046809 Bacteria 5882
1608 Ga0495660_0023108 3300046810 Bacteria 3548
1609 Ga0495660_0061659 3300046810 Bacteria 2012
1610 Ga0495660_0104290 3300046810 Bacteria 1455
1611 Ga0495660_0128549 3300046810 Bacteria 1273
1612 Ga0495660_0129342 3300046810 Bacteria 1268
1613 Ga0495581_0108066 3300047315 Bacteria 1617
1614 Ga0495604_0011368 3300047317 Bacteria 7064
1615 Ga0495604_0044464 3300047317 Bacteria 3469
1616 Ga0495636_0004169 3300047318 Bacteria 5674
1617 Ga0495636_0075360 3300047318 Bacteria 1446
1618 Ga0495636_0112035 3300047318 Bacteria 1201
1619 Ga0495674_0022726 3300047319 Bacteria 5781
1620 Ga0495674_0023350 3300047319 Bacteria 5701
1621 Ga0495672_0000030 3300047320 Bacteria 305021
1622 Ga0495672_0000065 3300047320 Bacteria 193941
1623 Ga0495672_0003913 3300047320 Bacteria 12501
1624 Ga0495672_0039384 3300047320 Bacteria 2873
1625 Ga0495676_0035737 3300047321 Bacteria 4154
1626 Ga0495676_0209289 3300047321 Bacteria 1350
1627 Ga0495680_0007641 3300047322 Bacteria 9871
1628 Ga0495683_0043790 3300047323 Bacteria 2252
1629 Ga0495683_0138746 3300047323 Bacteria 1141
1630 Ga0495683_0242556 3300047323 Bacteria 794
1631 Ga0495687_000002 3300047443 Bacteria 1085770
1632 Ga0495687_000003 3300047443 Bacteria 859509
1633 Ga0495687_000007 3300047443 Bacteria 552679
1634 Ga0495687_002847 3300047443 Bacteria 13295
1635 Ga0495687_002862 3300047443 Bacteria 13223
1636 Ga0495687_055012 3300047443 Bacteria 1666
1637 Ga0495675_0010586 3300047444 Bacteria 5764
1638 Ga0495675_0049987 3300047444 Bacteria 2657
1639 Ga0495677_0000001 3300047445 Bacteria 715000
1640 Ga0495677_0003998 3300047445 Bacteria 5695
1641 Ga0495677_0010819 3300047445 Bacteria 3342
1642 Ga0495677_0021902 3300047445 Bacteria 2315
1643 Ga0495677_0024390 3300047445 Bacteria 2193
1644 Ga0495677_0052254 3300047445 Bacteria 1506
1645 Ga0495685_006685 3300047447 Bacteria 3784
1646 Ga0495685_015439 3300047447 Bacteria 2604
1647 Ga0495685_018732 3300047447 Bacteria 2377
1648 Ga0495685_022408 3300047447 Bacteria 2174
1649 Ga0495685_033775 3300047447 Bacteria 1757
1650 Ga0495685_043481 3300047447 Bacteria 1533
1651 Ga0495685_068076 3300047447 Bacteria 1195
1652 Ga0495673_0000003 3300047469 Bacteria 1491337
1653 Ga0495673_0000136 3300047469 Bacteria 134839
1654 Ga0495673_0007850 3300047469 Bacteria 6069
1655 Ga0495673_0013927 3300047469 Bacteria 4202
1656 Ga0495673_0116820 3300047469 Bacteria 1060
1657 Ga0495673_0118252 3300047469 Bacteria 1052
1658 Ga0495681_0000065 3300047470 Bacteria 97979
1659 Ga0495681_0000482 3300047470 Bacteria 30599
1660 Ga0495681_0016088 3300047470 Bacteria 4210
1661 Ga0495681_0018876 3300047470 Bacteria 3784
1662 Ga0495681_0028301 3300047470 Bacteria 2885
1663 Ga0495681_0041280 3300047470 Bacteria 2240
1664 Ga0495681_0079263 3300047470 Bacteria 1469
1665 Ga0495686_0000015 3300047472 Bacteria 471703
1666 Ga0495686_0000344 3300047472 Bacteria 76585
1667 Ga0495686_0000453 3300047472 Bacteria 61817
1668 Ga0495686_0000520 3300047472 Bacteria 55657
1669 Ga0495686_0001255 3300047472 Bacteria 28821
1670 Ga0495686_0004390 3300047472 Bacteria 11624
1671 Ga0495686_0022030 3300047472 Bacteria 4219
1672 Ga0495686_0054480 3300047472 Bacteria 2504
1673 Ga0495686_0119271 3300047472 Bacteria 1574
1674 Ga0495602_0013736 3300048088 Bacteria 8258
1675 Ga0495602_0057953 3300048088 Bacteria 3394
1676 Ga0495602_0110852 3300048088 Bacteria 2229
1677 Ga0495602_0266486 3300048088 Bacteria 1268
1678 Ga0495602_0266857 3300048088 Bacteria 1267
1679 Ga0495626_0005067 3300048091 Bacteria 7857
1680 Ga0495626_0005337 3300048091 Bacteria 7562
1681 Ga0495626_0005378 3300048091 Bacteria 7517
1682 Ga0495626_0023251 3300048091 Bacteria 3054
1683 Ga0495626_0027729 3300048091 Bacteria 2751
1684 Ga0495626_0032025 3300048091 Bacteria 2527
1685 Ga0495626_0035014 3300048091 Bacteria 2398
1686 Ga0495626_0042843 3300048091 Bacteria 2125
1687 Ga0495626_0051328 3300048091 Bacteria 1902
1688 Ga0495626_0079543 3300048091 Bacteria 1458
1689 Ga0496100_0024428 3300048903 Bacteria 3686
1690 Ga0496100_0069046 3300048903 Bacteria 2352
1691 Ga0496100_0069937 3300048903 Bacteria 2339
1692 Ga0496100_0241635 3300048903 Bacteria 1332
1693 Ga0496100_0376898 3300048903 Bacteria 1077
1694 Ga0496101_0029187 3300048904 Bacteria 3857
1695 Ga0496101_0034931 3300048904 Bacteria 3553
1696 Ga0496102_0000141 3300048905 Bacteria 97499
1697 Ga0496102_0003808 3300048905 Bacteria 12756
1698 Ga0496102_0006244 3300048905 Bacteria 10160
1699 Ga0496102_0071675 3300048905 Bacteria 3182
1700 Ga0496102_0074295 3300048905 Bacteria 3124
1701 Ga0496102_0077536 3300048905 Bacteria 3058
1702 Ga0496102_0243291 3300048905 Bacteria 1696
1703 Ga0496102_0522411 3300048905 Bacteria 1109
1704 Ga0496103_0000172 3300048906 Bacteria 67575
1705 Ga0496103_0009377 3300048906 Bacteria 5797
1706 Ga0496103_0016108 3300048906 Bacteria 4460
1707 Ga0496103_0052970 3300048906 Bacteria 2514
1708 Ga0496103_0092796 3300048906 Bacteria 1906
1709 Ga0496103_0160959 3300048906 Bacteria 1439
1710 Ga0496104_0000759 3300048907 Bacteria 27626
1711 Ga0496104_0013685 3300048907 Bacteria 7314
1712 Ga0496104_0136901 3300048907 Bacteria 2353
1713 Ga0496104_0138222 3300048907 Bacteria 2341
1714 Ga0496104_0290097 3300048907 Bacteria 1548
1715 Ga0496104_0358830 3300048907 Bacteria 1370
1716 Ga0496104_0622269 3300048907 Bacteria 989
1717 Ga0496105_0000073 3300048908 Bacteria 76800
1718 Ga0496105_0029522 3300048908 Bacteria 4488
1719 Ga0496105_0035687 3300048908 Bacteria 4093
1720 Ga0496105_0123582 3300048908 Bacteria 2133
1721 Ga0496105_0223293 3300048908 Bacteria 1533
1722 Ga0496106_0054355 3300048909 Bacteria 3025
1723 Ga0496106_0117909 3300048909 Bacteria 2072
1724 Ga0496106_0162547 3300048909 Bacteria 1766
1725 Ga0496106_0225905 3300048909 Bacteria 1494
1726 Ga0496106_0504940 3300048909 Bacteria 971
1727 Ga0496107_0014627 3300048910 Bacteria 5494
1728 Ga0496107_0080294 3300048910 Bacteria 2378
1729 Ga0496107_0142831 3300048910 Bacteria 1769
1730 Ga0496107_0160068 3300048910 Bacteria 1668
1731 Ga0496107_0250731 3300048910 Bacteria 1317
1732 Ga0496108_0023441 3300048911 Bacteria 5079
1733 Ga0496108_0078835 3300048911 Bacteria 2788
1734 Ga0496108_0246671 3300048911 Bacteria 1553
1735 Ga0496108_0449408 3300048911 Bacteria 1126
1736 Ga0496108_0669682 3300048911 Bacteria 901
1737 Ga0496109_0049788 3300048912 Bacteria 3815
1738 Ga0496109_0143121 3300048912 Bacteria 2236
1739 Ga0496110_0000002 3300048913 Bacteria 166613
1740 Ga0496110_0028902 3300048913 Bacteria 4766
1741 Ga0496110_0035927 3300048913 Bacteria 4302
1742 Ga0496110_0378321 3300048913 Bacteria 1290
1743 Ga0496111_0146713 3300048914 Bacteria 1749
1744 Ga0496111_0146723 3300048914 Bacteria 1749
1745 Ga0496111_0386782 3300048914 Bacteria 1034
1746 Ga0496112_0013518 3300048915 Bacteria 7540
1747 Ga0496112_0114560 3300048915 Bacteria 2666
1748 Ga0496112_0339789 3300048915 Bacteria 1445
1749 Ga0496112_0356446 3300048915 Bacteria 1405
1750 Ga0496112_0468843 3300048915 Bacteria 1196
1751 Ga0496112_0636052 3300048915 Bacteria 997
1752 Ga0496113_0000128 3300048916 Bacteria 33054
1753 Ga0496113_0030074 3300048916 Bacteria 3928
1754 Ga0496113_0063529 3300048916 Bacteria 2790
1755 Ga0496113_0118907 3300048916 Bacteria 2064
1756 Ga0496113_0200181 3300048916 Bacteria 1587
1757 Ga0496113_0566352 3300048916 Bacteria 911
1758 Ga0496114_0068956 3300048917 Bacteria 2969
1759 Ga0496114_0124653 3300048917 Bacteria 2219
1760 Ga0496114_0162909 3300048917 Bacteria 1940
1761 Ga0496114_0259632 3300048917 Bacteria 1529
1762 Ga0496114_0655971 3300048917 Bacteria 923
1763 Ga0496115_0000089 3300048918 Bacteria 85894
1764 Ga0496115_0001375 3300048918 Bacteria 17384
1765 Ga0496115_0023325 3300048918 Bacteria 4801
1766 Ga0496115_0026627 3300048918 Bacteria 4515
1767 Ga0496115_0084493 3300048918 Bacteria 2588
1768 Ga0496115_0106356 3300048918 Bacteria 2303
1769 Ga0496115_0411352 3300048918 Bacteria 1097
1770 Ga0496115_0421359 3300048918 Bacteria 1081
1771 Ga0496116_0000017 3300048919 Bacteria 554463
1772 Ga0496116_0003405 3300048919 Bacteria 15741
1773 Ga0496116_0016255 3300048919 Bacteria 5834
1774 Ga0496116_0029591 3300048919 Bacteria 3945
1775 Ga0496116_0029871 3300048919 Bacteria 3922
1776 Ga0496116_0046692 3300048919 Bacteria 2921
1777 Ga0496116_0064356 3300048919 Bacteria 2357
1778 Ga0496116_0077051 3300048919 Bacteria 2085
1779 Ga0496116_0121427 3300048919 Bacteria 1511
1780 Ga0496116_0124461 3300048919 Bacteria 1484
1781 Ga0496116_0168393 3300048919 Bacteria 1190
1782 Ga0496117_0000002 3300048920 Bacteria 2483758
1783 Ga0496117_0002640 3300048920 Bacteria 22229
1784 Ga0496117_0005584 3300048920 Bacteria 13155
1785 Ga0496117_0006642 3300048920 Bacteria 11602
1786 Ga0496117_0011691 3300048920 Bacteria 7832
1787 Ga0496117_0028999 3300048920 Bacteria 4273
1788 Ga0496117_0057626 3300048920 Bacteria 2696
1789 Ga0496117_0099449 3300048920 Bacteria 1845
1790 Ga0496117_0140450 3300048920 Bacteria 1448
1791 Ga0496118_0000038 3300048921 Bacteria 315464
1792 Ga0496118_0001167 3300048921 Bacteria 40506
1793 Ga0496118_0001680 3300048921 Bacteria 32392
1794 Ga0496118_0002045 3300048921 Bacteria 28505
1795 Ga0496118_0002967 3300048921 Bacteria 21954
1796 Ga0496118_0003211 3300048921 Bacteria 20861
1797 Ga0496118_0014930 3300048921 Bacteria 7228
1798 Ga0496118_0032545 3300048921 Bacteria 4292
1799 Ga0496118_0042339 3300048921 Bacteria 3594
1800 Ga0496118_0056839 3300048921 Bacteria 2938
1801 Ga0496118_0101816 3300048921 Bacteria 1938
1802 Ga0496118_0105497 3300048921 Bacteria 1889
1803 Ga0496118_0122402 3300048921 Bacteria 1692
1804 Ga0496118_0277937 3300048921 Bacteria 934
1805 Ga0496119_0000040 3300048922 Bacteria 208180
1806 Ga0496119_0000093 3300048922 Bacteria 130450
1807 Ga0496119_0004280 3300048922 Bacteria 14289
1808 Ga0496119_0008044 3300048922 Bacteria 9365
1809 Ga0496119_0020076 3300048922 Bacteria 4887
1810 Ga0496119_0029331 3300048922 Bacteria 3733
1811 Ga0496119_0040238 3300048922 Bacteria 2992
1812 Ga0496119_0045318 3300048922 Bacteria 2758
1813 Ga0496119_0083192 3300048922 Bacteria 1839
1814 Ga0496119_0089585 3300048922 Bacteria 1751
1815 Ga0496119_0144727 3300048922 Bacteria 1280
1816 Ga0496119_0195358 3300048922 Bacteria 1051
1817 Ga0496120_0000170 3300048923 Bacteria 110378
1818 Ga0496120_0000591 3300048923 Bacteria 54957
1819 Ga0496120_0001244 3300048923 Bacteria 32116
1820 Ga0496120_0002729 3300048923 Bacteria 17241
1821 Ga0496120_0004164 3300048923 Bacteria 12412
1822 Ga0496120_0015907 3300048923 Bacteria 4939
1823 Ga0496120_0023172 3300048923 Bacteria 3890
1824 Ga0496120_0027674 3300048923 Bacteria 3482
1825 Ga0496120_0048096 3300048923 Bacteria 2456
1826 Ga0496120_0052254 3300048923 Bacteria 2328
1827 Ga0496121_0000001 3300048924 Bacteria 1830318
1828 Ga0496121_0000013 3300048924 Bacteria 614976
1829 Ga0496121_0000091 3300048924 Bacteria 216685
1830 Ga0496121_0000192 3300048924 Bacteria 136529
1831 Ga0496121_0000296 3300048924 Bacteria 103215
1832 Ga0496121_0000706 3300048924 Bacteria 62169
1833 Ga0496121_0000761 3300048924 Bacteria 59223
1834 Ga0496121_0001289 3300048924 Bacteria 43185
1835 Ga0496121_0002995 3300048924 Bacteria 24532
1836 Ga0496121_0006917 3300048924 Bacteria 13831
1837 Ga0496121_0008386 3300048924 Bacteria 12184
1838 Ga0496121_0011488 3300048924 Bacteria 9817
1839 Ga0496121_0015919 3300048924 Bacteria 7811
1840 Ga0496121_0028121 3300048924 Bacteria 5241
1841 Ga0496121_0056123 3300048924 Bacteria 3274
1842 Ga0496121_0060050 3300048924 Bacteria 3131
1843 Ga0496121_0087238 3300048924 Bacteria 2450
1844 Ga0496121_0090438 3300048924 Bacteria 2393
1845 Ga0496121_0126548 3300048924 Bacteria 1919
1846 Ga0496121_0177711 3300048924 Bacteria 1540
1847 Ga0496121_0194575 3300048924 Bacteria 1451
1848 Ga0496121_0224832 3300048924 Bacteria 1319
1849 Ga0496121_0251481 3300048924 Bacteria 1225
1850 Ga0496121_0297443 3300048924 Bacteria 1097
1851 Ga0496121_0416467 3300048924 Bacteria 875
1852 Ga0496122_0000001 3300048925 Bacteria 1827766
1853 Ga0496122_0000047 3300048925 Bacteria 274226
1854 Ga0496122_0000218 3300048925 Bacteria 127770
1855 Ga0496122_0000456 3300048925 Bacteria 84896
1856 Ga0496122_0000567 3300048925 Bacteria 75763
1857 Ga0496122_0000748 3300048925 Bacteria 63291
1858 Ga0496122_0005245 3300048925 Bacteria 15537
1859 Ga0496122_0005731 3300048925 Bacteria 14641
1860 Ga0496122_0009891 3300048925 Bacteria 9939
1861 Ga0496122_0010332 3300048925 Bacteria 9649
1862 Ga0496122_0042171 3300048925 Bacteria 3594
1863 Ga0496122_0054845 3300048925 Bacteria 2989
1864 Ga0496123_0000001 3300048926 Bacteria 1831497
1865 Ga0496123_0000077 3300048926 Bacteria 192607
1866 Ga0496123_0000089 3300048926 Bacteria 179941
1867 Ga0496123_0000389 3300048926 Bacteria 82399
1868 Ga0496123_0001196 3300048926 Bacteria 38152
1869 Ga0496123_0001251 3300048926 Bacteria 36743
1870 Ga0496123_0001560 3300048926 Bacteria 31380
1871 Ga0496123_0007656 3300048926 Bacteria 10103
1872 Ga0496123_0008857 3300048926 Bacteria 9164
1873 Ga0496123_0036723 3300048926 Bacteria 3468
1874 Ga0496123_0131292 3300048926 Bacteria 1387
1875 Ga0496123_0157369 3300048926 Bacteria 1216
1876 Ga0496123_0251676 3300048926 Bacteria 871
1877 Ga0496124_0000004 3300048927 Bacteria 976131
1878 Ga0496124_0001448 3300048927 Bacteria 35062
1879 Ga0496124_0003230 3300048927 Bacteria 20118
1880 Ga0496124_0019697 3300048927 Bacteria 6268
1881 Ga0496124_0034120 3300048927 Bacteria 4470
1882 Ga0496124_0047180 3300048927 Bacteria 3686
1883 Ga0496124_0057195 3300048927 Bacteria 3287
1884 Ga0496124_0097732 3300048927 Bacteria 2383
1885 Ga0496124_0146922 3300048927 Bacteria 1854
1886 Ga0496124_0168860 3300048927 Bacteria 1697
1887 Ga0496124_0225289 3300048927 Bacteria 1406
1888 Ga0496124_0244404 3300048927 Bacteria 1332
1889 Ga0496124_0329579 3300048927 Bacteria 1089
1890 Ga0496125_0000001 3300048928 Bacteria 1766138
1891 Ga0496125_0000106 3300048928 Bacteria 199193
1892 Ga0496125_0000325 3300048928 Bacteria 92684
1893 Ga0496125_0000957 3300048928 Bacteria 45410
1894 Ga0496125_0000959 3300048928 Bacteria 45332
1895 Ga0496125_0001213 3300048928 Bacteria 38770
1896 Ga0496125_0001681 3300048928 Bacteria 30940
1897 Ga0496125_0002023 3300048928 Bacteria 27465
1898 Ga0496125_0002121 3300048928 Bacteria 26658
1899 Ga0496125_0008813 3300048928 Bacteria 10491
1900 Ga0496125_0009147 3300048928 Bacteria 10244
1901 Ga0496125_0023654 3300048928 Bacteria 5666
1902 Ga0496125_0024805 3300048928 Bacteria 5505
1903 Ga0496125_0029015 3300048928 Bacteria 4981
1904 Ga0496125_0049403 3300048928 Bacteria 3496
1905 Ga0496125_0056991 3300048928 Bacteria 3168
1906 Ga0496125_0074332 3300048928 Bacteria 2635
1907 Ga0496125_0077365 3300048928 Bacteria 2565
1908 Ga0496125_0139976 3300048928 Bacteria 1684
1909 Ga0496125_0167829 3300048928 Bacteria 1480
1910 Ga0496125_0229402 3300048928 Bacteria 1189
1911 Ga0496126_0000044 3300048929 Bacteria 335904
1912 Ga0496126_0000715 3300048929 Bacteria 60276
1913 Ga0496126_0002698 3300048929 Bacteria 23462
1914 Ga0496126_0003106 3300048929 Bacteria 21438
1915 Ga0496126_0006650 3300048929 Bacteria 12865
1916 Ga0496126_0007394 3300048929 Bacteria 12047
1917 Ga0496126_0012251 3300048929 Bacteria 8797
1918 Ga0496126_0079329 3300048929 Bacteria 2906
1919 Ga0496126_0120575 3300048929 Bacteria 2275
1920 Ga0496126_0160190 3300048929 Bacteria 1923
1921 Ga0496126_0201601 3300048929 Bacteria 1680
1922 Ga0496126_0247889 3300048929 Bacteria 1485
1923 Ga0496126_0303067 3300048929 Bacteria 1317
1924 Ga0496126_0315020 3300048929 Bacteria 1287
1925 Ga0496126_0344902 3300048929 Bacteria 1219
1926 Ga0496126_0363554 3300048929 Bacteria 1181
1927 Ga0501305_028445 3300049161 Bacteria 861
1928 Ga0495678_000002 3300049459 Bacteria 999613
1929 Ga0495678_000050 3300049459 Bacteria 160887
1930 Ga0495678_000115 3300049459 Bacteria 96173
1931 Ga0495678_000651 3300049459 Bacteria 31960
1932 Ga0495678_000940 3300049459 Bacteria 25289
1933 Ga0495678_006761 3300049459 Bacteria 6042
1934 Ga0495678_012922 3300049459 Bacteria 3938
1935 Ga0495678_047882 3300049459 Bacteria 1671
1936 Ga0495678_059821 3300049459 Bacteria 1435
1937 Ga0495682_0022683 3300049460 Bacteria 2347
1938 Ga0495682_0067532 3300049460 Bacteria 1288
1939 Ga0501031_0020310 3300049568 Bacteria 4331
1940 Ga0501031_0025552 3300049568 Bacteria 3851
1941 Ga0501032_0006017 3300049569 Bacteria 8949
1942 Ga0501032_0032755 3300049569 Bacteria 3561
1943 Ga0501032_0110351 3300049569 Bacteria 1821
1944 Ga0501032_0209421 3300049569 Bacteria 1271
1945 Ga0501033_0007935 3300049570 Bacteria 8221
1946 Ga0501033_0074013 3300049570 Bacteria 2501
1947 Ga0501033_0139861 3300049570 Bacteria 1750
1948 Ga0501033_0152372 3300049570 Bacteria 1667
1949 Ga0501034_0000067 3300049571 Bacteria 184398
1950 Ga0501034_0035952 3300049571 Bacteria 5022
1951 Ga0501034_0185114 3300049571 Bacteria 2046
1952 Ga0501034_0230308 3300049571 Bacteria 1802
1953 Ga0501036_0001698 3300049572 Bacteria 17103
1954 Ga0501036_0251969 3300049572 Bacteria 1480
1955 Ga0501036_0628102 3300049572 Bacteria 890
1956 Ga0501037_0095212 3300049573 Bacteria 2152
1957 Ga0501038_0155419 3300049574 Bacteria 1863
1958 Ga0501038_0327759 3300049574 Bacteria 1197
1959 Ga0501039_0200995 3300049575 Bacteria 1567
1960 Ga0501039_0551255 3300049575 Bacteria 905
1961 Ga0501043_0014288 3300049579 Bacteria 6213
1962 Ga0501043_0040982 3300049579 Bacteria 3639
1963 Ga0501043_0196817 3300049579 Bacteria 1565
1964 Ga0501046_0005504 3300049580 Bacteria 11313
1965 Ga0501046_0008710 3300049580 Bacteria 8817
1966 Ga0501047_0006048 3300049581 Bacteria 11382
1967 Ga0501047_0008178 3300049581 Bacteria 9879
1968 Ga0501047_0014710 3300049581 Bacteria 7446
1969 Ga0501047_0141138 3300049581 Bacteria 2288
1970 Ga0501047_0341867 3300049581 Bacteria 1334
1971 Ga0501047_0402228 3300049581 Bacteria 1202
1972 Ga0501047_0511600 3300049581 Bacteria 1027
1973 Ga0501048_0191407 3300049582 Bacteria 1449
1974 Ga0501249_001240 3300049679 Bacteria 5352
1975 Ga0501249_001430 3300049679 Bacteria 4917
1976 Ga0501080_0261564 3300049742 Bacteria 1576
1977 Ga0501241_006613 3300049758 Bacteria 2131
1978 Ga0501269_000232 3300049766 Bacteria 16257
1979 Ga0501035_0002463 3300049822 Bacteria 18074
1980 Ga0501035_0011712 3300049822 Bacteria 8124
1981 Ga0501035_0077913 3300049822 Bacteria 2929
1982 Ga0501035_0107787 3300049822 Bacteria 2442
1983 Ga0501035_0158092 3300049822 Bacteria 1963
1984 Ga0501035_0229292 3300049822 Bacteria 1583
1985 Ga0501035_0527551 3300049822 Bacteria 969
1986 Ga0501044_0011117 3300049823 Bacteria 9762
1987 Ga0501044_0019416 3300049823 Bacteria 7272
1988 Ga0501044_0037635 3300049823 Bacteria 5055
1989 Ga0501044_0098937 3300049823 Bacteria 2936
1990 Ga0501044_0117909 3300049823 Bacteria 2658
1991 Ga0501044_0556191 3300049823 Bacteria 1044
1992 Ga0501044_0668773 3300049823 Bacteria 926
1993 nmdc:mga03683_1359_c1 3300050489 Bacteria 7250
1994 nmdc:mga03683_21404_c1 3300050489 Bacteria 2492
1995 nmdc:mga03683_27674_c1 3300050489 Bacteria 2248
1996 nmdc:mga03683_3396_c1 3300050489 Bacteria 5130
1997 nmdc:mga03n38_141316_c1 3300050490 Bacteria 1203
1998 nmdc:mga03n38_76237_c1 3300050490 Bacteria 1564
1999 nmdc:mga00v17_103655_c1 3300050491 Bacteria 1798
2000 nmdc:mga00v17_169813_c1 3300050491 Bacteria 1406
2001 nmdc:mga00v17_611_c1 3300050491 Bacteria 19769
2002 nmdc:mga00v17_93930_c1 3300050491 Bacteria 1887
2003 nmdc:mga0yw44_149_c1 3300050492 Bacteria 21613
2004 nmdc:mga0yw44_260464_c1 3300050492 Bacteria 1156
2005 nmdc:mga0yw44_9479_c1 3300050492 Bacteria 4927
2006 nmdc:mga0k408_27672_c1 3300050493 Bacteria 3221
2007 nmdc:mga0k408_39979_c1 3300050493 Bacteria 2697
2008 nmdc:mga0k408_48206_c1 3300050493 Bacteria 2464
2009 nmdc:mga0k408_48782_c1 3300050493 Bacteria 2450
2010 nmdc:mga0k408_56494_c1 3300050493 Bacteria 2278
2011 nmdc:mga0k408_5872_c1 3300050493 Bacteria 6541
2012 nmdc:mga0k408_59964_c1 3300050493 Bacteria 2211
2013 nmdc:mga0k408_59995_c1 3300050493 Bacteria 2210
2014 nmdc:mga0k408_71113_c1 3300050493 Bacteria 2031
2015 nmdc:mga0k408_7902_c1 3300050493 Bacteria 5696
2016 nmdc:mga06z11_161863_c1 3300050494 Bacteria 1280
2017 nmdc:mga06z11_2132_c1 3300050494 Bacteria 7506
2018 nmdc:mga06z11_214770_c1 3300050494 Bacteria 1122
2019 nmdc:mga06z11_241627_c1 3300050494 Bacteria 1061
2020 nmdc:mga06z11_84340_c1 3300050494 Bacteria 1712
2021 nmdc:mga04h51_164945_c1 3300050495 Bacteria 855
2022 nmdc:mga04h51_51495_c1 3300050495 Bacteria 1384
2023 nmdc:mga07m45_116063_c1 3300050496 Bacteria 1544
2024 nmdc:mga07m45_128729_c1 3300050496 Bacteria 1465
2025 nmdc:mga07m45_160586_c1 3300050496 Bacteria 1305
2026 nmdc:mga07m45_165909_c1 3300050496 Bacteria 1283
2027 nmdc:mga07m45_25782_c1 3300050496 Bacteria 3228
2028 nmdc:mga07m45_49774_c1 3300050496 Bacteria 2360
2029 nmdc:mga08y16_265796_c1 3300050511 Bacteria 1771
2030 nmdc:mga0n895_780210_c1 3300050512 Bacteria 947
2031 nmdc:mga0sz30_156948_c1 3300050516 Bacteria 1007
2032 nmdc:mga0sz30_25943_c1 3300050516 Bacteria 2399
2033 nmdc:mga0sz30_28989_c1 3300050516 Bacteria 2279
2034 nmdc:mga0sz30_55584_c2 3300050516 Bacteria 801
2035 nmdc:mga0sz30_70813_c1 3300050516 Bacteria 1501
2036 nmdc:mga0sz30_72792_c1 3300050516 Bacteria 1481
2037 Ga0495601_0173146 3300053077 Bacteria 1411
2038 Ga0495601_0199255 3300053077 Bacteria 1309
2039 Ga0495601_0253670 3300053077 Bacteria 1149
2040 Ga0495655_0027242 3300053083 Bacteria 1354
2041 Ga0495619_0188613 3300053085 Bacteria 1427
2042 Ga0495619_0258907 3300053085 Bacteria 1206
2043 Ga0500578_0056501 3300053086 Bacteria 2510
2044 Ga0500578_0380726 3300053086 Bacteria 818
2045 Ga0500643_000117 3300053087 Bacteria 82982
2046 Ga0500583_0193152 3300053092 Bacteria 1013
2047 Ga0500651_0040579 3300053093 Bacteria 2932
2048 Ga0500566_0007716 3300053094 Bacteria 6381
2049 Ga0500641_0053038 3300053096 Bacteria 1673
2050 Ga0500650_0320335 3300053098 Bacteria 683
2051 Ga0500555_000797 3300053103 Bacteria 11377
2052 Ga0500557_000089 3300053105 Bacteria 31156
2053 Ga0500562_030261 3300053108 Bacteria 1426
2054 Ga0500569_014792 3300053109 Bacteria 1940
2055 Ga0500592_014157 3300053116 Bacteria 1278
2056 Ga0500594_0031640 3300053118 Bacteria 1397
2057 Ga0500595_013795 3300053119 Bacteria 3087
2058 Ga0500595_018902 3300053119 Bacteria 2511
2059 Ga0500595_072222 3300053119 Bacteria 1022
2060 Ga0500607_101692 3300053121 Bacteria 1426
2061 Ga0500607_211952 3300053121 Bacteria 818
2062 Ga0500608_085600 3300053122 Bacteria 1481
2063 Ga0500614_035414 3300053123 Bacteria 1244
2064 Ga0500642_0002259 3300053130 Bacteria 5623
2065 Ga0500642_0222351 3300053130 Bacteria 874
2066 Ga0500652_172717 3300053131 Bacteria 889
2067 Ga0500655_024958 3300053133 Bacteria 1133
2068 Ga0500658_0004088 3300053134 Bacteria 5486
2069 Ga0500559_0079724 3300053136 Bacteria 1486
2070 Ga0500559_0316016 3300053136 Bacteria 732
2071 Ga0500561_0004183 3300053137 Bacteria 2586
2072 Ga0500564_105300 3300053138 Bacteria 1243
2073 Ga0500568_0150786 3300053139 Bacteria 860
2074 Ga0500573_0064119 3300053140 Bacteria 2102
2075 Ga0500574_009735 3300053141 Bacteria 2100
2076 Ga0500590_000786 3300053148 Bacteria 11757
2077 Ga0500600_0021842 3300053149 Bacteria 3832
2078 Ga0500616_0008389 3300053153 Bacteria 6426
2079 Ga0500616_0036268 3300053153 Bacteria 2676
2080 Ga0500616_0036627 3300053153 Bacteria 2662
2081 Ga0500616_0078384 3300053153 Bacteria 1666
2082 Ga0500619_086502 3300053154 Bacteria 1056
2083 Ga0500622_0013039 3300053156 Bacteria 4490
2084 Ga0500622_0034202 3300053156 Bacteria 2663
2085 Ga0500624_000057 3300053157 Bacteria 71174
2086 Ga0500624_000450 3300053157 Bacteria 12360
2087 Ga0500627_0015540 3300053158 Bacteria 2946
2088 Ga0500634_0010092 3300053161 Bacteria 4812
2089 Ga0500638_131179 3300053162 Bacteria 1136
2090 Ga0500645_012943 3300053730 Bacteria 2687
2091 Ga0500645_049689 3300053730 Bacteria 1226
2092 Ga0500609_001488 3300053731 Bacteria 3421
2093 Ga0500601_001865 3300053737 Bacteria 2260
2094 Ga0500587_035755 3300053739 Bacteria 697
2095 Ga0500661_013954 3300055283 Bacteria 1447
2096 Ga0587070_040259 3300059491 Bacteria 891
2097 Ga0587080_019496 3300059503 Bacteria 1099
2098 Ga0587080_050086 3300059503 Bacteria 787
2099 Ga0587082_005460 3300059504 Bacteria 1655
2100 Ga0587083_0001629 3300059505 Bacteria 2581
2101 Ga0587088_006508 3300059508 Bacteria 1580
2102 Ga0587090_004237 3300059510 Bacteria 1727
2103 Ga0587090_004793 3300059510 Bacteria 1662
2104 Ga0587090_014503 3300059510 Bacteria 1153
2105 Ga0587090_037493 3300059510 Bacteria 839
2106 Ga0587098_000472 3300059604 Bacteria 2462
2107 Ga0587106_015656 3300059605 Bacteria 1062
2108 Ga0587106_015991 3300059605 Bacteria 1056
2109 Ga0587067_000552 3300059640 Bacteria 3369
2110 Ga0587068_000094 3300059641 Bacteria 5700
2111 Ga0587068_007073 3300059641 Bacteria 1590
2112 Ga0587068_014039 3300059641 Bacteria 1244
2113 Ga0587068_063121 3300059641 Bacteria 717
2114 Ga0587072_000090 3300059643 Bacteria 6986
2115 Ga0587072_009330 3300059643 Bacteria 1566
2116 Ga0587072_049475 3300059643 Bacteria 838
2117 Ga0587076_009179 3300059645 Bacteria 1399
2118 Ga0587104_000826 3300059650 Bacteria 1473
2119 Ga0501082_0477470 3300060353 Bacteria 1090
2120 Ga0466962_0000390 3300061719 Bacteria 18948
2121 Ga0466962_0003130 3300061719 Bacteria 7867
2122 Ga0466962_0174154 3300061719 Bacteria 1048

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046538 Ga0495609_0291268 Ga0495609_0291268_22_651 193
2 3300031665 Ga0316575_10106104 Ga0316575_101061042 194
3 3300036712 Ga0316584_0022282 Ga0316584_0022282_3596_4210 194
4 3300005457 Ga0070662_100148355 Ga0070662_1001483552 195
5 3300005577 Ga0068857_100194560 Ga0068857_1001945602 195
6 3300009148 Ga0105243_10015822 Ga0105243_100158224 195
7 3300009551 Ga0105238_10163505 Ga0105238_101635052 195
8 3300010375 Ga0105239_10679243 Ga0105239_106792431 195
9 3300011119 Ga0105246_10046524 Ga0105246_100465242 195
10 3300013297 Ga0157378_10063329 Ga0157378_100633293 195
11 3300013308 Ga0157375_10923248 Ga0157375_109232482 195
12 3300041452 Ga0451793_0495086 Ga0451793_0495086_284_901 195
13 3300046453 Ga0495627_000213 Ga0495627_000213_58004_58639 196
14 3300046471 Ga0495650_0094525 Ga0495650_0094525_435_1070 196
15 3300046474 Ga0495605_0000058 Ga0495605_0000058_100530_101165 196
16 3300046492 Ga0495585_0082734 Ga0495585_0082734_237_872 196
17 3300046500 Ga0495596_0007855 Ga0495596_0007855_755_1390 196
18 3300046501 Ga0495607_0040281 Ga0495607_0040281_802_1437 196
19 3300046513 Ga0495616_0000123 Ga0495616_0000123_717_1352 196
20 3300046518 Ga0495631_0007794 Ga0495631_0007794_2553_3188 196
21 3300046519 Ga0495632_0000084 Ga0495632_0000084_840_1475 196
22 3300046519 Ga0495632_0001112 Ga0495632_0001112_21699_22334 196
23 3300046519 Ga0495632_0006187 Ga0495632_0006187_6277_6912 196
24 3300046522 Ga0495643_0031305 Ga0495643_0031305_937_1572 196
25 3300046523 Ga0495644_0173076 Ga0495644_0173076_31_666 196
26 3300046524 Ga0495648_0002897 Ga0495648_0002897_14049_14684 196
27 3300046528 Ga0495642_0000072 Ga0495642_0000072_58356_58991 196
28 3300046528 Ga0495642_0000107 Ga0495642_0000107_1409_2044 196
29 3300046538 Ga0495609_0152485 Ga0495609_0152485_125_760 196
30 3300046660 Ga0495625_0367527 Ga0495625_0367527_65_700 196
31 3300046665 Ga0495661_0002182 Ga0495661_0002182_882_1517 196
32 3300046665 Ga0495661_0102223 Ga0495661_0102223_529_1164 196
33 3300046684 Ga0495669_0006138 Ga0495669_0006138_4268_4903 196
34 3300046692 Ga0495671_0000292 Ga0495671_0000292_900_1535 196
35 3300046810 Ga0495660_0061659 Ga0495660_0061659_792_1427 196
36 3300046810 Ga0495660_0128549 Ga0495660_0128549_605_1240 196
37 3300047443 Ga0495687_000002 Ga0495687_000002_112423_113058 196
38 3300048905 Ga0496102_0003808 Ga0496102_0003808_11384_12019 196
39 3300048915 Ga0496112_0339789 Ga0496112_0339789_759_1394 196
40 3300049459 Ga0495678_000651 Ga0495678_000651_764_1399 196
41 3300059508 Ga0587088_006508 Ga0587088_006508_662_1297 196
42 3300009094 Ga0111539_10446169 Ga0111539_104461692 197
43 3300005327 Ga0070658_10257365 Ga0070658_102573652 198
44 3300005548 Ga0070665_100019540 Ga0070665_1000195406 198
45 3300009093 Ga0105240_10208135 Ga0105240_102081352 198
46 3300009174 Ga0105241_10483118 Ga0105241_104831181 198
47 3300014325 Ga0163163_10242056 Ga0163163_102420563 198
48 3300028379 Ga0268266_10037801 Ga0268266_100378015 198
49 3300028794 Ga0307515_10052528 Ga0307515_100525287 198
50 3300048929 Ga0496126_0006650 Ga0496126_0006650_3073_3696 198
51 3300059510 Ga0587090_004793 Ga0587090_004793_364_990 198
52 3300059645 Ga0587076_009179 Ga0587076_009179_543_1169 198
53 iso_pu_bacteria 2511231026 2511387308 198
54 iso_pu_bacteria 2513237084 2513569794 198
55 iso_pu_bacteria 2513237085 2513576650 198
56 iso_pu_bacteria 2515154113 2515636107 198
57 iso_pu_bacteria 2515154114 2515644735 198
58 iso_pu_bacteria 2517093000 2517099089 198
59 iso_pu_bacteria 2517287029 2517410684 198
60 iso_pu_bacteria 2521172590 2521558424 198
61 iso_pu_bacteria 2551306416 2553003406 198
62 iso_pu_bacteria 2643221638 2644215719 198
63 iso_pu_bacteria 2724679232 2725951972 198
64 iso_pu_bacteria 2765235838 2765569541 198
65 iso_pu_bacteria 2765235942 2766068662 198
66 iso_pu_bacteria 2791355263 2793340294 198
67 iso_pu_bacteria 2802429606 2805933755 198
68 iso_pu_bacteria 2808606386 2808982028 198
69 iso_pu_bacteria 2808606415 2809131651 198
70 iso_pu_bacteria 2808606419 2809151273 198
71 iso_pu_bacteria 2818991449 2819614344 198
72 iso_pu_bacteria 2839094727 2839095577 198
73 iso_pu_bacteria 2852618963 2852622445 198
74 iso_pu_bacteria 2904439833 2904445040 198
75 iso_pu_bacteria 2904530477 2904534131 198
76 iso_pu_bacteria 2904584206 2904589027 198
77 iso_pu_bacteria 2904589729 2904590492 198
78 iso_pu_bacteria 2904601388 2904603634 198
79 iso_pu_bacteria 2919046199 2919046858 198
80 iso_pu_bacteria 2919079590 2919080353 198
81 iso_pu_bacteria 2923510766 2923511534 198
82 iso_pu_bacteria 2928130867 2928131639 198
83 iso_pu_bacteria 2933586486 2933590550 198
84 iso_pu_bacteria 2936367885 2936370484 198
85 iso_pu_bacteria 2936381700 2936385437 198
86 iso_pu_bacteria 8005460587 8005466604 198
87 iso_pu_bacteria 8005695170 8005696897 198
88 iso_pu_bacteria 8024479707 8024484000 198
89 iso_pu_bacteria 8057874678 8057880785 198
90 3300005335 Ga0070666_10015851 Ga0070666_100158513 199
91 3300005456 Ga0070678_100069953 Ga0070678_1000699532 199
92 3300005535 Ga0070684_100282437 Ga0070684_1002824372 199
93 3300005539 Ga0068853_100149940 Ga0068853_1001499401 199
94 3300005548 Ga0070665_100085827 Ga0070665_1000858274 199
95 3300005548 Ga0070665_100323861 Ga0070665_1003238612 199
96 3300005614 Ga0068856_100105690 Ga0068856_1001056902 199
97 3300005617 Ga0068859_100470294 Ga0068859_1004702942 199
98 3300005834 Ga0068851_10041301 Ga0068851_100413013 199
99 3300005841 Ga0068863_100011412 Ga0068863_1000114129 199
100 3300005842 Ga0068858_100000734 Ga0068858_10000073422 199
101 3300005843 Ga0068860_100001535 Ga0068860_10000153519 199
102 3300006237 Ga0097621_100194523 Ga0097621_1001945232 199
103 3300006931 Ga0097620_100470285 Ga0097620_1004702852 199
104 3300009545 Ga0105237_10121528 Ga0105237_101215285 199
105 3300013308 Ga0157375_10056092 Ga0157375_100560925 199
106 3300025245 Ga0207425_1002852 Ga0207425_10028523 199
107 3300025294 Ga0209025_1000005 Ga0209025_1000005824 199
108 3300025903 Ga0207680_10069001 Ga0207680_100690012 199
109 3300025913 Ga0207695_10079016 Ga0207695_100790163 199
110 3300025913 Ga0207695_10981507 Ga0207695_109815071 199
111 3300025924 Ga0207694_10077100 Ga0207694_100771002 199
112 3300025941 Ga0207711_10185203 Ga0207711_101852031 199
113 3300025949 Ga0207667_10364117 Ga0207667_103641172 199
114 3300026035 Ga0207703_10001239 Ga0207703_1000123910 199
115 3300026041 Ga0207639_10359480 Ga0207639_103594802 199
116 3300026067 Ga0207678_10049848 Ga0207678_100498483 199
117 3300026088 Ga0207641_10000872 Ga0207641_1000087216 199
118 3300026121 Ga0207683_10093695 Ga0207683_100936953 199
119 3300028379 Ga0268266_10005781 Ga0268266_100057811 199
120 3300039447 Ga0436361_0817425 Ga0436361_0817425_1456_2115 199
121 3300046675 Ga0495657_0107623 Ga0495657_0107623_736_1356 199
122 3300048905 Ga0496102_0077536 Ga0496102_0077536_2215_2886 199
123 3300048920 Ga0496117_0002640 Ga0496117_0002640_21250_21921 199
124 3300048928 Ga0496125_0000325 Ga0496125_0000325_47049_47720 199
125 3300053085 Ga0495619_0188613 Ga0495619_0188613_522_1142 199
126 3300053121 Ga0500607_211952 Ga0500607_211952_23_643 199
127 iso_pu_bacteria 2537561587 2537877282 199
128 iso_pu_bacteria 2551306086 2551694067 199
129 iso_pu_bacteria 2551306092 2551733392 199
130 iso_pu_bacteria 2554235003 2554246178 199
131 iso_pu_bacteria 2558860242 2559293401 199
132 iso_pu_bacteria 2643221582 2643920558 199
133 iso_pu_bacteria 2643221693 2644519633 199
134 iso_pu_bacteria 2808606387 2808986830 199
135 iso_pu_bacteria 2842718218 2842719680 199
136 iso_pu_bacteria 2855730933 2855735904 199
137 iso_pu_bacteria 2855767633 2855772842 199
138 iso_pu_bacteria 2857576091 2857577084 199
139 iso_pu_bacteria 2881412998 2881416366 199
140 iso_pu_bacteria 2899792073 2899794308 199
141 iso_pu_bacteria 2899845264 2899845688 199
142 iso_pu_bacteria 2926760298 2926761922 199
143 iso_pu_bacteria 2928115317 2928119638 199
144 iso_pu_bacteria 2929138655 2929138758 199
145 iso_pu_bacteria 2974320154 2974323751 199
146 iso_pu_bacteria 2979089926 2979092811 199
147 iso_pu_bacteria 2979095461 2979099800 199
148 iso_pu_bacteria 639633055 639651388 199
149 iso_pu_bacteria 650716007 650738637 199
150 iso_pu_bacteria 8003400568 8003405188 199
151 iso_pu_bacteria 8003570095 8003572183 199
152 3300001979 JGI24740J21852_10012523 JGI24740J21852_100125232 200
153 3300001989 JGI24739J22299_10000198 JGI24739J22299_1000019811 200
154 3300001989 JGI24739J22299_10003127 JGI24739J22299_100031272 200
155 3300001990 JGI24737J22298_10003377 JGI24737J22298_100033773 200
156 3300002771 JGI25163J39215_1004840 JGI25163J39215_10048402 200
157 3300002773 JGI25152J39213_1008946 JGI25152J39213_10089463 200
158 3300003187 JGI25151J46595_10000274 JGI25151J46595_1000027419 200
159 3300003354 JGI25160J50197_1001913 JGI25160J50197_10019132 200
160 3300003374 JGI25161J50226_1004780 JGI25161J50226_10047803 200
161 3300003578 Ga0006562J51391_1006334 Ga0006562J51391_10063344 200
162 3300003578 Ga0006562J51391_1006340 Ga0006562J51391_10063404 200
163 3300003771 Ga0055526_1003918 Ga0055526_10039182 200
164 3300003771 Ga0055526_1007108 Ga0055526_10071083 200
165 3300003775 Ga0055524_1000809 Ga0055524_10008097 200
166 3300004625 Ga0055543_1006660 Ga0055543_10066602 200
167 3300005262 Ga0065165_1042483 Ga0065165_10424831 200
168 3300005329 Ga0070683_100357100 Ga0070683_1003571002 200
169 3300005336 Ga0070680_100010888 Ga0070680_1000108883 200
170 3300005367 Ga0070667_100560158 Ga0070667_1005601581 200
171 3300005434 Ga0070709_10132235 Ga0070709_101322352 200
172 3300005436 Ga0070713_100343339 Ga0070713_1003433392 200
173 3300005455 Ga0070663_100049744 Ga0070663_1000497444 200
174 3300005458 Ga0070681_10034527 Ga0070681_100345274 200
175 3300005530 Ga0070679_100468277 Ga0070679_1004682772 200
176 3300005535 Ga0070684_100070691 Ga0070684_1000706912 200
177 3300005563 Ga0068855_100280772 Ga0068855_1002807721 200
178 3300005577 Ga0068857_100004064 Ga0068857_1000040646 200
179 3300005578 Ga0068854_100026225 Ga0068854_1000262251 200
180 3300005616 Ga0068852_100087926 Ga0068852_1000879263 200
181 3300005834 Ga0068851_10203939 Ga0068851_102039392 200
182 3300005842 Ga0068858_100316009 Ga0068858_1003160092 200
183 3300006038 Ga0075365_10006086 Ga0075365_100060865 200
184 3300006042 Ga0075368_10018779 Ga0075368_100187792 200
185 3300006048 Ga0075363_100089088 Ga0075363_1000890882 200
186 3300006177 Ga0075362_10007575 Ga0075362_100075752 200
187 3300006178 Ga0075367_10002355 Ga0075367_100023557 200
188 3300006195 Ga0075366_10051410 Ga0075366_100514102 200
189 3300006353 Ga0075370_10004011 Ga0075370_100040112 200
190 3300006353 Ga0075370_10230481 Ga0075370_102304812 200
191 3300006358 Ga0068871_100383194 Ga0068871_1003831943 200
192 3300009092 Ga0105250_10045860 Ga0105250_100458602 200
193 3300009093 Ga0105240_10000461 Ga0105240_1000046130 200
194 3300009093 Ga0105240_10493111 Ga0105240_104931112 200
195 3300009093 Ga0105240_10626273 Ga0105240_106262732 200
196 3300009177 Ga0105248_10186297 Ga0105248_101862973 200
197 3300009545 Ga0105237_10000023 Ga0105237_10000023211 200
198 3300009551 Ga0105238_10359619 Ga0105238_103596193 200
199 3300009553 Ga0105249_10340964 Ga0105249_103409642 200
200 3300009765 Ga0123341_1000029 Ga0123341_100002923 200
201 3300009766 Ga0123342_1016558 Ga0123342_10165583 200
202 3300010375 Ga0105239_10019496 Ga0105239_100194962 200
203 3300012500 Ga0157314_1000101 Ga0157314_10001016 200
204 3300013307 Ga0157372_10236532 Ga0157372_102365322 200
205 3300015261 Ga0182006_1044222 Ga0182006_10442223 200
206 3300015265 Ga0182005_1000977 Ga0182005_10009778 200
207 3300025245 Ga0207425_1005704 Ga0207425_10057043 200
208 3300025250 Ga0209026_1002454 Ga0209026_10024544 200
209 3300025250 Ga0209026_1019076 Ga0209026_10190762 200
210 3300025258 Ga0209129_1001274 Ga0209129_100127412 200
211 3300025258 Ga0209129_1003518 Ga0209129_10035183 200
212 3300025258 Ga0209129_1014244 Ga0209129_10142442 200
213 3300025273 Ga0209673_1000005 Ga0209673_1000005366 200
214 3300025273 Ga0209673_1000212 Ga0209673_100021245 200
215 3300025294 Ga0209025_1000300 Ga0209025_100030044 200
216 3300025294 Ga0209025_1013583 Ga0209025_10135833 200
217 3300025295 Ga0209564_1000402 Ga0209564_100040244 200
218 3300025295 Ga0209564_1009245 Ga0209564_10092453 200
219 3300025295 Ga0209564_1041392 Ga0209564_10413922 200
220 3300025297 Ga0209758_1000053 Ga0209758_1000053288 200
221 3300025297 Ga0209758_1002679 Ga0209758_10026798 200
222 3300025297 Ga0209758_1030674 Ga0209758_10306742 200
223 3300025297 Ga0209758_1050784 Ga0209758_10507843 200
224 3300025299 Ga0209256_1000122 Ga0209256_100012264 200
225 3300025299 Ga0209256_1000582 Ga0209256_100058230 200
226 3300025299 Ga0209256_1014833 Ga0209256_10148332 200
227 3300025302 Ga0207426_1000035 Ga0207426_1000035377 200
228 3300025321 Ga0207656_10147631 Ga0207656_101476312 200
229 3300025904 Ga0207647_10035097 Ga0207647_100350975 200
230 3300025912 Ga0207707_10053311 Ga0207707_100533113 200
231 3300025913 Ga0207695_10026771 Ga0207695_100267714 200
232 3300025913 Ga0207695_10755026 Ga0207695_107550261 200
233 3300025914 Ga0207671_10000020 Ga0207671_1000002025 200
234 3300025914 Ga0207671_10000033 Ga0207671_10000033230 200
235 3300025920 Ga0207649_10126590 Ga0207649_101265903 200
236 3300025928 Ga0207700_10239174 Ga0207700_102391743 200
237 3300025944 Ga0207661_10064803 Ga0207661_100648032 200
238 3300025949 Ga0207667_10000094 Ga0207667_1000009423 200
239 3300025949 Ga0207667_10009332 Ga0207667_100093329 200
240 3300025981 Ga0207640_10131599 Ga0207640_101315991 200
241 3300026035 Ga0207703_10245667 Ga0207703_102456672 200
242 3300026067 Ga0207678_10176378 Ga0207678_101763781 200
243 3300026116 Ga0207674_10004820 Ga0207674_100048209 200
244 3300026142 Ga0207698_10057500 Ga0207698_100575002 200
245 3300028573 Ga0265334_10019904 Ga0265334_100199042 200
246 3300028794 Ga0307515_10009737 Ga0307515_1000973711 200
247 3300031250 Ga0265331_10015671 Ga0265331_100156712 200
248 3300031456 Ga0307513_10122189 Ga0307513_101221891 200
249 3300032002 Ga0307416_100604493 Ga0307416_1006044932 200
250 3300037471 Ga0395905_0001122 Ga0395905_0001122_23349_23969 200
251 3300038443 Ga0395901_0192773 Ga0395901_0192773_339_974 200
252 3300039447 Ga0436361_0177374 Ga0436361_0177374_1263_1898 200
253 3300039447 Ga0436361_0735588 Ga0436361_0735588_798_1433 200
254 3300041404 Ga0439436_0052367 Ga0439436_0052367_22_642 200
255 3300041491 Ga0451833_1037538 Ga0451833_1037538_300_920 200
256 3300041509 Ga0451843_1289635 Ga0451843_1289635_1700_2320 200
257 3300044658 Ga0466972_0000034 Ga0466972_0000034_77580_78215 200
258 3300044658 Ga0466972_0049554 Ga0466972_0049554_1110_1745 200
259 3300044666 Ga0466977_0007337 Ga0466977_0007337_256_912 200
260 3300044672 Ga0466982_0000009 Ga0466982_0000009_47935_48570 200
261 3300044683 Ga0466965_0017143 Ga0466965_0017143_577_1212 200
262 3300044684 Ga0466966_0032967 Ga0466966_0032967_1195_1830 200
263 3300044684 Ga0466966_0081222 Ga0466966_0081222_684_1316 200
264 3300044719 Ga0466971_0038637 Ga0466971_0038637_619_1254 200
265 3300044735 Ga0466968_0010151 Ga0466968_0010151_1481_2116 200
266 3300044765 Ga0466970_0031509 Ga0466970_0031509_1032_1658 200
267 3300044765 Ga0466970_0038826 Ga0466970_0038826_848_1483 200
268 3300045049 Ga0466959_0053383 Ga0466959_0053383_453_1079 200
269 3300046492 Ga0495585_0146534 Ga0495585_0146534_42_662 200
270 3300046511 Ga0495608_0006077 Ga0495608_0006077_6962_7576 200
271 3300046516 Ga0495628_0091403 Ga0495628_0091403_1256_1879 200
272 3300046519 Ga0495632_0011470 Ga0495632_0011470_2325_2945 200
273 3300046524 Ga0495648_0022260 Ga0495648_0022260_370_993 200
274 3300046529 Ga0495652_0144054 Ga0495652_0144054_266_880 200
275 3300046543 Ga0495645_0003664 Ga0495645_0003664_4664_5287 200
276 3300046558 Ga0495633_0097173 Ga0495633_0097173_276_896 200
277 3300046678 Ga0495599_0038101 Ga0495599_0038101_393_1007 200
278 3300046680 Ga0495646_0157655 Ga0495646_0157655_164_787 200
279 3300046809 Ga0495600_0003322 Ga0495600_0003322_1049_1663 200
280 3300047318 Ga0495636_0112035 Ga0495636_0112035_464_1090 200
281 3300047321 Ga0495676_0209289 Ga0495676_0209289_272_886 200
282 3300048088 Ga0495602_0110852 Ga0495602_0110852_458_1072 200
283 3300048910 Ga0496107_0250731 Ga0496107_0250731_370_1002 200
284 3300048920 Ga0496117_0005584 Ga0496117_0005584_1025_1645 200
285 3300048921 Ga0496118_0014930 Ga0496118_0014930_579_1199 200
286 3300048921 Ga0496118_0101816 Ga0496118_0101816_992_1612 200
287 3300048922 Ga0496119_0083192 Ga0496119_0083192_869_1489 200
288 3300048924 Ga0496121_0000013 Ga0496121_0000013_66620_67252 200
289 3300048924 Ga0496121_0056123 Ga0496121_0056123_754_1389 200
290 3300048924 Ga0496121_0416467 Ga0496121_0416467_11_640 200
291 3300048925 Ga0496122_0010332 Ga0496122_0010332_2476_3096 200
292 3300048925 Ga0496122_0042171 Ga0496122_0042171_2755_3375 200
293 3300048925 Ga0496122_0054845 Ga0496122_0054845_1391_2011 200
294 3300048928 Ga0496125_0000106 Ga0496125_0000106_3295_3915 200
295 3300048928 Ga0496125_0001213 Ga0496125_0001213_34721_35341 200
296 3300048928 Ga0496125_0002023 Ga0496125_0002023_4046_4681 200
297 3300048928 Ga0496125_0029015 Ga0496125_0029015_3998_4618 200
298 3300048928 Ga0496125_0229402 Ga0496125_0229402_416_1036 200
299 3300048929 Ga0496126_0247889 Ga0496126_0247889_350_991 200
300 3300049459 Ga0495678_047882 Ga0495678_047882_255_875 200
301 3300049569 Ga0501032_0032755 Ga0501032_0032755_259_879 200
302 3300049569 Ga0501032_0110351 Ga0501032_0110351_453_1073 200
303 3300049570 Ga0501033_0152372 Ga0501033_0152372_643_1263 200
304 3300049571 Ga0501034_0185114 Ga0501034_0185114_693_1313 200
305 3300049573 Ga0501037_0095212 Ga0501037_0095212_403_1023 200
306 3300049574 Ga0501038_0327759 Ga0501038_0327759_455_1075 200
307 3300049575 Ga0501039_0200995 Ga0501039_0200995_571_1215 200
308 3300049575 Ga0501039_0551255 Ga0501039_0551255_153_773 200
309 3300049579 Ga0501043_0196817 Ga0501043_0196817_456_1076 200
310 3300049742 Ga0501080_0261564 Ga0501080_0261564_555_1175 200
311 3300049822 Ga0501035_0107787 Ga0501035_0107787_798_1418 200
312 3300050489 nmdc:mga03683_3396_c1 nmdc:mga03683_3396_c1_1123_1743 200
313 3300050493 nmdc:mga0k408_27672_c1 nmdc:mga0k408_27672_c1_1684_2304 200
314 3300050494 nmdc:mga06z11_84340_c1 nmdc:mga06z11_84340_c1_977_1597 200
315 3300053077 Ga0495601_0199255 Ga0495601_0199255_474_1088 200
316 3300053119 Ga0500595_013795 Ga0500595_013795_1146_1769 200
317 3300053141 Ga0500574_009735 Ga0500574_009735_1027_1641 200
318 3300053156 Ga0500622_0013039 Ga0500622_0013039_914_1534 200
319 3300059503 Ga0587080_019496 Ga0587080_019496_313_927 200
320 3300059504 Ga0587082_005460 Ga0587082_005460_461_1096 200
321 3300059605 Ga0587106_015991 Ga0587106_015991_121_735 200
322 iso_pu_bacteria 2507262055 2507505664 200
323 iso_pu_bacteria 2508501009 2508539555 200
324 iso_pu_bacteria 2508501042 2508695922 200
325 iso_pu_bacteria 2511231003 2511249050 200
326 iso_pu_bacteria 2511231028 2511398987 200
327 iso_pu_bacteria 2512875026 2512969701 200
328 iso_pu_bacteria 2513237086 2513581779 200
329 iso_pu_bacteria 2513237089 2513603144 200
330 iso_pu_bacteria 2513237092 2513625021 200
331 iso_pu_bacteria 2513237094 2513640816 200
332 iso_pu_bacteria 2513237095 2513651801 200
333 iso_pu_bacteria 2513237096 2513659399 200
334 iso_pu_bacteria 2513237098 2513673978 200
335 iso_pu_bacteria 2513237102 2513699778 200
336 iso_pu_bacteria 2513237104 2513722031 200
337 iso_pu_bacteria 2513237137 2513860658 200
338 iso_pu_bacteria 2513237139 2513876884 200
339 iso_pu_bacteria 2513237145 2513919066 200
340 iso_pu_bacteria 2513237156 2513985216 200
341 iso_pu_bacteria 2513237160 2514004486 200
342 iso_pu_bacteria 2513237161 2514010293 200
343 iso_pu_bacteria 2515154112 2515624061 200
344 iso_pu_bacteria 2517093001 2517106580 200
345 iso_pu_bacteria 2517487022 2517565421 200
346 iso_pu_bacteria 2517572143 2517888389 200
347 iso_pu_bacteria 2524023207 2524451488 200
348 iso_pu_bacteria 2524023209 2524461937 200
349 iso_pu_bacteria 2524023228 2524535308 200
350 iso_pu_bacteria 2528768022 2528854415 200
351 iso_pu_bacteria 2548876994 2550696012 200
352 iso_pu_bacteria 2551306084 2551677178 200
353 iso_pu_bacteria 2551306085 2551688330 200
354 iso_pu_bacteria 2551306090 2551721291 200
355 iso_pu_bacteria 2551306090 2551722755 200
356 iso_pu_bacteria 2582581308 2585283496 200
357 iso_pu_bacteria 2582581315 2585328280 200
358 iso_pu_bacteria 2582581316 2585330687 200
359 iso_pu_bacteria 2585427527 2585535935 200
360 iso_pu_bacteria 2585427530 2585556718 200
361 iso_pu_bacteria 2585427608 2585900237 200
362 iso_pu_bacteria 2595698237 2596371267 200
363 iso_pu_bacteria 2615840626 2616312855 200
364 iso_pu_bacteria 2615840698 2616555995 200
365 iso_pu_bacteria 2617270735 2617350067 200
366 iso_pu_bacteria 2617270741 2617374135 200
367 iso_pu_bacteria 2617270742 2617386210 200
368 iso_pu_bacteria 2643221556 2643797455 200
369 iso_pu_bacteria 2643221594 2643982390 200
370 iso_pu_bacteria 2643221603 2644031247 200
371 iso_pu_bacteria 2643221621 2644121590 200
372 iso_pu_bacteria 2643221684 2644474003 200
373 iso_pu_bacteria 2690316117 2692319152 200
374 iso_pu_bacteria 2728368998 2728747920 200
375 iso_pu_bacteria 2775507266 2778179419 200
376 iso_pu_bacteria 2791355196 2793065964 200
377 iso_pu_bacteria 2791355197 2793067203 200
378 iso_pu_bacteria 2802428858 2802716127 200
379 iso_pu_bacteria 2802428859 2802722835 200
380 iso_pu_bacteria 2802428860 2802729020 200
381 iso_pu_bacteria 2802428861 2802735414 200
382 iso_pu_bacteria 2802428862 2802742010 200
383 iso_pu_bacteria 2802428863 2802748460 200
384 iso_pu_bacteria 2802429603 2805922211 200
385 iso_pu_bacteria 2808606395 2809034500 200
386 iso_pu_bacteria 2816332527 2818239293 200
387 iso_pu_bacteria 2818991445 2819593511 200
388 iso_pu_bacteria 2818991453 2819643370 200
389 iso_pu_bacteria 2824600985 2824606266 200
390 iso_pu_bacteria 2824609381 2824616114 200
391 iso_pu_bacteria 2824617872 2824625510 200
392 iso_pu_bacteria 2824626560 2824634382 200
393 iso_pu_bacteria 2824635225 2824641659 200
394 iso_pu_bacteria 2824644064 2824648944 200
395 iso_pu_bacteria 2824653114 2824658287 200
396 iso_pu_bacteria 2824661429 2824669725 200
397 iso_pu_bacteria 2824671348 2824677076 200
398 iso_pu_bacteria 2824679649 2824684862 200
399 iso_pu_bacteria 2824687955 2824693565 200
400 iso_pu_bacteria 2824696289 2824701790 200
401 iso_pu_bacteria 2824704595 2824711976 200
402 iso_pu_bacteria 2824714736 2824718981 200
403 iso_pu_bacteria 2824723954 2824729176 200
404 iso_pu_bacteria 2824732956 2824734863 200
405 iso_pu_bacteria 2824746037 2824748130 200
406 iso_pu_bacteria 2824753945 2824762579 200
407 iso_pu_bacteria 2824763712 2824772753 200
408 iso_pu_bacteria 2824773399 2824780035 200
409 iso_pu_bacteria 2837678835 2837679719 200
410 iso_pu_bacteria 2838122688 2838125790 200
411 iso_pu_bacteria 2841941048 2841948384 200
412 iso_pu_bacteria 2841949485 2841952831 200
413 iso_pu_bacteria 2841957949 2841965661 200
414 iso_pu_bacteria 2841966195 2841972828 200
415 iso_pu_bacteria 2841974524 2841977603 200
416 iso_pu_bacteria 2841983080 2841984836 200
417 iso_pu_bacteria 2842038055 2842041412 200
418 iso_pu_bacteria 2842045827 2842049454 200
419 iso_pu_bacteria 2842298080 2842300005 200
420 iso_pu_bacteria 2842357229 2842362601 200
421 iso_pu_bacteria 2842711865 2842712405 200
422 iso_pu_bacteria 2844315083 2844315894 200
423 iso_pu_bacteria 2847417321 2847422341 200
424 iso_pu_bacteria 2847930680 2847939880 200
425 iso_pu_bacteria 2847939898 2847942724 200
426 iso_pu_bacteria 2849076700 2849076718 200
427 iso_pu_bacteria 2855825444 2855828451 200
428 iso_pu_bacteria 2855839649 2855843563 200
429 iso_pu_bacteria 2857509624 2857515673 200
430 iso_pu_bacteria 2857553236 2857555164 200
431 iso_pu_bacteria 2874590934 2874593216 200
432 iso_pu_bacteria 2874612657 2874617182 200
433 iso_pu_bacteria 2874620515 2874621409 200
434 iso_pu_bacteria 2874628541 2874629211 200
435 iso_pu_bacteria 2874645413 2874647807 200
436 iso_pu_bacteria 2876761206 2876762865 200
437 iso_pu_bacteria 2876771140 2876773256 200
438 iso_pu_bacteria 2876818435 2876820563 200
439 iso_pu_bacteria 2879074833 2879076798 200
440 iso_pu_bacteria 2879083081 2879083561 200
441 iso_pu_bacteria 2879099564 2879101207 200
442 iso_pu_bacteria 2879127579 2879128743 200
443 iso_pu_bacteria 2879142872 2879145530 200
444 iso_pu_bacteria 2881364244 2881367171 200
445 iso_pu_bacteria 2881665667 2881668458 200
446 iso_pu_bacteria 2884811622 2884816511 200
447 iso_pu_bacteria 2884836552 2884837740 200
448 iso_pu_bacteria 2884852848 2884854032 200
449 iso_pu_bacteria 2885366525 2885368977 200
450 iso_pu_bacteria 2885409591 2885414246 200
451 iso_pu_bacteria 2888378607 2888379074 200
452 iso_pu_bacteria 2888388044 2888390249 200
453 iso_pu_bacteria 2888419890 2888427478 200
454 iso_pu_bacteria 2889306138 2889306338 200
455 iso_pu_bacteria 2896154374 2896154851 200
456 iso_pu_bacteria 2901300506 2901306642 200
457 iso_pu_bacteria 2902330777 2902334954 200
458 iso_pu_bacteria 2902405164 2902408070 200
459 iso_pu_bacteria 2903727486 2903731844 200
460 iso_pu_bacteria 2904424332 2904424983 200
461 iso_pu_bacteria 2904666416 2904668079 200
462 iso_pu_bacteria 2904699407 2904707779 200
463 iso_pu_bacteria 2904711408 2904718211 200
464 iso_pu_bacteria 2906602504 2906603629 200
465 iso_pu_bacteria 2906610324 2906614257 200
466 iso_pu_bacteria 2906626472 2906631755 200
467 iso_pu_bacteria 2906635258 2906640746 200
468 iso_pu_bacteria 2906643746 2906646263 200
469 iso_pu_bacteria 2906660503 2906660864 200
470 iso_pu_bacteria 2908756301 2908758919 200
471 iso_pu_bacteria 2908775508 2908776609 200
472 iso_pu_bacteria 2915980308 2915983824 200
473 iso_pu_bacteria 2915986958 2915990770 200
474 iso_pu_bacteria 2916007675 2916009946 200
475 iso_pu_bacteria 2916061851 2916068429 200
476 iso_pu_bacteria 2916068649 2916074408 200
477 iso_pu_bacteria 2919476304 2919477514 200
478 iso_pu_bacteria 2921201388 2921203712 200
479 iso_pu_bacteria 2921244191 2921247620 200
480 iso_pu_bacteria 2921250672 2921257032 200
481 iso_pu_bacteria 2921282425 2921287093 200
482 iso_pu_bacteria 2921289301 2921296077 200
483 iso_pu_bacteria 2922368715 2922378802 200
484 iso_pu_bacteria 2922393267 2922400365 200
485 iso_pu_bacteria 2922425934 2922426080 200
486 iso_pu_bacteria 2924144063 2924149556 200
487 iso_pu_bacteria 2924150972 2924151489 200
488 iso_pu_bacteria 2924186466 2924188011 200
489 iso_pu_bacteria 2924200457 2924205305 200
490 iso_pu_bacteria 2924214083 2924218550 200
491 iso_pu_bacteria 2924228884 2924232602 200
492 iso_pu_bacteria 2928125067 2928126196 200
493 iso_pu_bacteria 2929615660 2929619043 200
494 iso_pu_bacteria 2929624759 2929631120 200
495 iso_pu_bacteria 2932784394 2932789085 200
496 iso_pu_bacteria 2932794094 2932800182 200
497 iso_pu_bacteria 2932801729 2932808235 200
498 iso_pu_bacteria 2932809354 2932814278 200
499 iso_pu_bacteria 2932818245 2932820404 200
500 iso_pu_bacteria 2932828146 2932834334 200
501 iso_pu_bacteria 2933577622 2933580247 200
502 iso_pu_bacteria 2935608549 2935614718 200
503 iso_pu_bacteria 2935616580 2935620019 200
504 iso_pu_bacteria 2935630451 2935632492 200
505 iso_pu_bacteria 2935638405 2935640338 200
506 iso_pu_bacteria 2935648319 2935649105 200
507 iso_pu_bacteria 2935656913 2935658123 200
508 iso_pu_bacteria 2935665750 2935673375 200
509 iso_pu_bacteria 2935675223 2935683856 200
510 iso_pu_bacteria 2935684952 2935686833 200
511 iso_pu_bacteria 2935694250 2935702121 200
512 iso_pu_bacteria 2935703347 2935710539 200
513 iso_pu_bacteria 2935713505 2935716521 200
514 iso_pu_bacteria 2935722832 2935723354 200
515 iso_pu_bacteria 2935732158 2935734910 200
516 iso_pu_bacteria 2935741537 2935744299 200
517 iso_pu_bacteria 2935750917 2935752799 200
518 iso_pu_bacteria 2935760218 2935764653 200
519 iso_pu_bacteria 2935769743 2935774711 200
520 iso_pu_bacteria 2935777560 2935785075 200
521 iso_pu_bacteria 2935785616 2935789774 200
522 iso_pu_bacteria 2935793552 2935797858 200
523 iso_pu_bacteria 2935801545 2935806236 200
524 iso_pu_bacteria 2935810662 2935818092 200
525 iso_pu_bacteria 2935819856 2935826242 200
526 iso_pu_bacteria 2935827899 2935837153 200
527 iso_pu_bacteria 2935837841 2935841326 200
528 iso_pu_bacteria 2935847175 2935853738 200
529 iso_pu_bacteria 2935855204 2935858905 200
530 iso_pu_bacteria 2935864058 2935864086 200
531 iso_pu_bacteria 2935873716 2935875600 200
532 iso_pu_bacteria 2935883170 2935883339 200
533 iso_pu_bacteria 2935908558 2935910960 200
534 iso_pu_bacteria 2935916978 2935924121 200
535 iso_pu_bacteria 2935926038 2935932826 200
536 iso_pu_bacteria 2935934488 2935937389 200
537 iso_pu_bacteria 2935942939 2935949410 200
538 iso_pu_bacteria 2935951376 2935958191 200
539 iso_pu_bacteria 2935959822 2935964111 200
540 iso_pu_bacteria 2935967501 2935971154 200
541 iso_pu_bacteria 2935975950 2935982254 200
542 iso_pu_bacteria 2935984226 2935985389 200
543 iso_pu_bacteria 2935992306 2935995456 200
544 iso_pu_bacteria 2936002035 2936007879 200
545 iso_pu_bacteria 2936011229 2936012342 200
546 iso_pu_bacteria 2936019824 2936020577 200
547 iso_pu_bacteria 2936028420 2936029635 200
548 iso_pu_bacteria 2936037263 2936044702 200
549 iso_pu_bacteria 2936046547 2936051900 200
550 iso_pu_bacteria 2936055302 2936056844 200
551 iso_pu_bacteria 2937029754 2937035144 200
552 iso_pu_bacteria 2937036028 2937038251 200
553 iso_pu_bacteria 2937049772 2937051482 200
554 iso_pu_bacteria 2937056579 2937063219 200
555 iso_pu_bacteria 2937078374 2937084199 200
556 iso_pu_bacteria 2937084907 2937089733 200
557 iso_pu_bacteria 2937106411 2937111787 200
558 iso_pu_bacteria 2937126314 2937131339 200
559 iso_pu_bacteria 2940556831 2940558712 200
560 iso_pu_bacteria 2941479691 2941480218 200
561 iso_pu_bacteria 2941485952 2941488807 200
562 iso_pu_bacteria 2941507105 2941508844 200
563 iso_pu_bacteria 2941515067 2941516674 200
564 iso_pu_bacteria 2941523033 2941524310 200
565 iso_pu_bacteria 2941531003 2941535742 200
566 iso_pu_bacteria 2941538514 2941543553 200
567 iso_pu_bacteria 2957375807 2957378495 200
568 iso_pu_bacteria 2957388812 2957393566 200
569 iso_pu_bacteria 2957415311 2957422157 200
570 iso_pu_bacteria 2957422303 2957422650 200
571 iso_pu_bacteria 2957437181 2957440014 200
572 iso_pu_bacteria 2957464669 2957469670 200
573 iso_pu_bacteria 2957471148 2957476979 200
574 iso_pu_bacteria 2957484790 2957487168 200
575 iso_pu_bacteria 2957498199 2957500435 200
576 iso_pu_bacteria 2957505466 2957506422 200
577 iso_pu_bacteria 2960591022 2960596615 200
578 iso_pu_bacteria 2960631154 2960634512 200
579 iso_pu_bacteria 2960652885 2960657313 200
580 iso_pu_bacteria 2960680706 2960683123 200
581 iso_pu_bacteria 2960693952 2960698641 200
582 iso_pu_bacteria 2964607997 2964613502 200
583 iso_pu_bacteria 2964621998 2964626860 200
584 iso_pu_bacteria 2964628898 2964631824 200
585 iso_pu_bacteria 2964649959 2964653516 200
586 iso_pu_bacteria 2964678106 2964679534 200
587 iso_pu_bacteria 2964685014 2964689943 200
588 iso_pu_bacteria 2967664464 2967670823 200
589 iso_pu_bacteria 2967686174 2967687812 200
590 iso_pu_bacteria 2967693043 2967696592 200
591 iso_pu_bacteria 2967706974 2967709424 200
592 iso_pu_bacteria 2967728569 2967728934 200
593 iso_pu_bacteria 2967735183 2967740105 200
594 iso_pu_bacteria 2967762386 2967766125 200
595 iso_pu_bacteria 2967769361 2967771812 200
596 iso_pu_bacteria 2970026789 2970032082 200
597 iso_pu_bacteria 2970040964 2970046179 200
598 iso_pu_bacteria 2970054988 2970055320 200
599 iso_pu_bacteria 2970061556 2970067086 200
600 iso_pu_bacteria 2970109326 2970109691 200
601 iso_pu_bacteria 2970116247 2970122257 200
602 iso_pu_bacteria 2970122695 2970125035 200
603 iso_pu_bacteria 2970129317 2970132474 200
604 iso_pu_bacteria 2970136068 2970137238 200
605 iso_pu_bacteria 2970143518 2970143821 200
606 iso_pu_bacteria 2970149975 2970156125 200
607 iso_pu_bacteria 2970177841 2970184094 200
608 iso_pu_bacteria 2970191845 2970198922 200
609 iso_pu_bacteria 2977530762 2977532785 200
610 iso_pu_bacteria 2977544691 2977547845 200
611 iso_pu_bacteria 2977558990 2977565816 200
612 iso_pu_bacteria 2977572785 2977573002 200
613 iso_pu_bacteria 2977579622 2977583060 200
614 iso_pu_bacteria 3005483717 3005488918 200
615 iso_pu_bacteria 3005506211 3005506331 200
616 iso_pu_bacteria 3005587118 3005592694 200
617 iso_pu_bacteria 3005594810 3005595481 200
618 iso_pu_bacteria 3005710791 3005711447 200
619 iso_pu_bacteria 3005718088 3005718709 200
620 iso_pu_bacteria 643692032 643823734 200
621 iso_pu_bacteria 8003999396 8004003903 200
622 iso_pu_bacteria 8005682033 8005687542 200
623 iso_pu_bacteria 8006933436 8006936778 200
624 iso_pu_bacteria 8006973647 8006976749 200
625 iso_pu_bacteria 8016511872 8016517715 200
626 iso_pu_bacteria 8016522445 8016525768 200
627 iso_pu_bacteria 8016530956 8016539368 200
628 iso_pu_bacteria 8016539877 8016543658 200
629 iso_pu_bacteria 8016548790 8016549638 200
630 iso_pu_bacteria 8016557553 8016558056 200
631 iso_pu_bacteria 8016566248 8016569063 200
632 iso_pu_bacteria 8016575299 8016581697 200
633 iso_pu_bacteria 8016583857 8016585872 200
634 iso_pu_bacteria 8016595262 8016596067 200
635 iso_pu_bacteria 8016603502 8016606954 200
636 iso_pu_bacteria 8016613128 8016618860 200
637 iso_pu_bacteria 8016622563 8016622684 200
638 iso_pu_bacteria 8016630954 8016635182 200
639 iso_pu_bacteria 8017057580 8017058913 200
640 iso_pu_bacteria 8019530166 8019530645 200
641 iso_pu_bacteria 8019538911 8019540939 200
642 iso_pu_bacteria 8019547302 8019549680 200
643 iso_pu_bacteria 8019565922 8019571984 200
644 iso_pu_bacteria 8019576017 8019576737 200
645 iso_pu_bacteria 8019586578 8019594789 200
646 iso_pu_bacteria 8019597564 8019606947 200
647 iso_pu_bacteria 8019608314 8019611560 200
648 iso_pu_bacteria 8019619141 8019623411 200
649 iso_pu_bacteria 8019629233 8019638729 200
650 iso_pu_bacteria 8019638758 8019640936 200
651 iso_pu_bacteria 8019648815 8019653025 200
652 iso_pu_bacteria 8019659431 8019666530 200
653 iso_pu_bacteria 8019668869 8019676228 200
654 iso_pu_bacteria 8019687851 8019695743 200
655 iso_pu_bacteria 8047673197 8047679631 200
656 iso_pu_bacteria 8055742211 8055742892 200
657 iso_pu_bacteria 8056681323 8056683146 200
658 iso_pu_bacteria 8056689827 8056692658 200
659 iso_pu_bacteria 8056967851 8056970804 200
660 iso_pu_bacteria 8057575449 8057582544 200
661 3300002737 JGI25162J39368_1000970 JGI25162J39368_10009702 201
662 3300002739 JGI25158J39367_1014118 JGI25158J39367_10141182 201
663 3300002741 JGI25157J39369_1000588 JGI25157J39369_10005888 201
664 3300002771 JGI25163J39215_1000176 JGI25163J39215_100017614 201
665 3300002772 JGI25164J39214_1000343 JGI25164J39214_100034314 201
666 3300002774 JGI25150J39212_1010644 JGI25150J39212_10106443 201
667 3300002987 JGI25159J45721_1014430 JGI25159J45721_10144303 201
668 3300003214 JGI25165J46597_1000627 JGI25165J46597_100062713 201
669 3300003316 rootH1_10054725 rootH1_100547252 201
670 3300003354 JGI25160J50197_1009339 JGI25160J50197_10093394 201
671 3300003374 JGI25161J50226_1001192 JGI25161J50226_10011922 201
672 3300003751 Ga0055538_1000002 Ga0055538_1000002137 201
673 3300003752 Ga0055539_1000002 Ga0055539_1000002137 201
674 3300003756 Ga0055533_1000004 Ga0055533_1000004137 201
675 3300003759 Ga0055525_1000002 Ga0055525_1000002137 201
676 3300003761 Ga0055535_1000376 Ga0055535_100037624 201
677 3300003762 Ga0055542_1000992 Ga0055542_10009922 201
678 3300003763 Ga0055529_1000720 Ga0055529_100072013 201
679 3300003771 Ga0055526_1007009 Ga0055526_10070093 201
680 3300003773 Ga0055537_1006548 Ga0055537_10065482 201
681 3300003773 Ga0055537_1020991 Ga0055537_10209912 201
682 3300003775 Ga0055524_1026308 Ga0055524_10263083 201
683 3300003775 Ga0055524_1030536 Ga0055524_10305361 201
684 3300003784 Ga0055534_1002008 Ga0055534_10020086 201
685 3300003790 Ga0055528_1009580 Ga0055528_10095802 201
686 3300003791 Ga0055530_10008869 Ga0055530_100088693 201
687 3300003791 Ga0055530_10033831 Ga0055530_100338312 201
688 3300003791 Ga0055530_10035165 Ga0055530_100351652 201
689 3300003794 Ga0055531_10026180 Ga0055531_100261802 201
690 3300003841 Ga0055541_1000002 Ga0055541_1000002705 201
691 3300004625 Ga0055543_1001075 Ga0055543_10010752 201
692 3300005262 Ga0065165_1005588 Ga0065165_10055882 201
693 3300005293 Ga0065715_10208617 Ga0065715_102086172 201
694 3300005445 Ga0070708_100600295 Ga0070708_1006002952 201
695 3300005546 Ga0070696_100579001 Ga0070696_1005790011 201
696 3300005563 Ga0068855_100001647 Ga0068855_1000016477 201
697 3300005578 Ga0068854_100018848 Ga0068854_1000188484 201
698 3300005614 Ga0068856_100909982 Ga0068856_1009099822 201
699 3300005985 Ga0081539_10135124 Ga0081539_101351242 201
700 3300006871 Ga0075434_100083699 Ga0075434_1000836992 201
701 3300006948 Ga0099826_10150487 Ga0099826_101504872 201
702 3300009093 Ga0105240_10088919 Ga0105240_100889193 201
703 3300009094 Ga0111539_10848350 Ga0111539_108483502 201
704 3300009545 Ga0105237_11007312 Ga0105237_110073121 201
705 3300009551 Ga0105238_10001243 Ga0105238_1000124322 201
706 3300010375 Ga0105239_10145432 Ga0105239_101454323 201
707 3300025207 Ga0209760_100385 Ga0209760_1003853 201
708 3300025208 Ga0209436_100884 Ga0209436_1008842 201
709 3300025208 Ga0209436_100972 Ga0209436_1009722 201
710 3300025224 Ga0209784_100002 Ga0209784_100002371 201
711 3300025224 Ga0209784_100053 Ga0209784_10005313 201
712 3300025225 Ga0209566_100003 Ga0209566_100003371 201
713 3300025226 Ga0209674_100004 Ga0209674_100004371 201
714 3300025228 Ga0209672_107550 Ga0209672_1075502 201
715 3300025230 Ga0209563_100006 Ga0209563_100006371 201
716 3300025231 Ga0207427_100061 Ga0207427_100061144 201
717 3300025233 Ga0209437_100037 Ga0209437_100037303 201
718 3300025245 Ga0207425_1000249 Ga0207425_100024932 201
719 3300025250 Ga0209026_1000471 Ga0209026_100047113 201
720 3300025253 Ga0209677_100003 Ga0209677_100003371 201
721 3300025254 Ga0209148_1000001 Ga0209148_1000001207 201
722 3300025256 Ga0209759_1000504 Ga0209759_100050424 201
723 3300025258 Ga0209129_1004437 Ga0209129_10044377 201
724 3300025261 Ga0209233_1000002 Ga0209233_10000022024 201
725 3300025263 Ga0209565_1000571 Ga0209565_100057123 201
726 3300025263 Ga0209565_1014158 Ga0209565_10141582 201
727 3300025272 Ga0209455_1000079 Ga0209455_1000079144 201
728 3300025273 Ga0209673_1022621 Ga0209673_10226212 201
729 3300025284 Ga0209130_1002993 Ga0209130_10029938 201
730 3300025284 Ga0209130_1008521 Ga0209130_10085212 201
731 3300025291 Ga0209675_1001467 Ga0209675_100146711 201
732 3300025291 Ga0209675_1023139 Ga0209675_10231392 201
733 3300025295 Ga0209564_1000743 Ga0209564_100074345 201
734 3300025295 Ga0209564_1005329 Ga0209564_10053294 201
735 3300025295 Ga0209564_1018365 Ga0209564_10183652 201
736 3300025298 Ga0209050_1006522 Ga0209050_10065222 201
737 3300025299 Ga0209256_1002863 Ga0209256_10028632 201
738 3300025302 Ga0207426_1004415 Ga0207426_10044155 201
739 3300025303 Ga0209051_1005295 Ga0209051_10052952 201
740 3300025304 Ga0209257_1000293 Ga0209257_100029317 201
741 3300025913 Ga0207695_10005250 Ga0207695_100052504 201
742 3300025914 Ga0207671_10123886 Ga0207671_101238861 201
743 3300025924 Ga0207694_10002664 Ga0207694_1000266410 201
744 3300025949 Ga0207667_10000032 Ga0207667_10000032178 201
745 3300025981 Ga0207640_10013401 Ga0207640_100134014 201
746 3300027312 Ga0209371_1000569 Ga0209371_100056918 201
747 3300027312 Ga0209371_1000597 Ga0209371_100059715 201
748 3300027666 Ga0209282_1117556 Ga0209282_11175562 201
749 3300030500 Ga0268256_1008118 Ga0268256_10081182 201
750 3300031548 Ga0307408_100001280 Ga0307408_10000128014 201
751 3300032005 Ga0307411_10780170 Ga0307411_107801702 201
752 3300035113 Ga0373936_0020783 Ga0373936_0020783_1355_2053 201
753 3300037068 Ga0373925_0174200 Ga0373925_0174200_930_1571 201
754 3300039437 Ga0436365_0981578 Ga0436365_0981578_2589_3215 201
755 3300039447 Ga0436361_0152256 Ga0436361_0152256_1848_2474 201
756 3300039447 Ga0436361_0421745 Ga0436361_0421745_848_1474 201
757 3300041509 Ga0451843_0062109 Ga0451843_0062109_91_744 201
758 3300044693 Ga0466961_0004029 Ga0466961_0004029_8545_9168 201
759 3300045049 Ga0466959_0020120 Ga0466959_0020120_208_831 201
760 3300046471 Ga0495650_0021338 Ga0495650_0021338_901_1533 201
761 3300046507 Ga0495606_0125810 Ga0495606_0125810_77_700 201
762 3300046525 Ga0495663_0057378 Ga0495663_0057378_440_1069 201
763 3300046665 Ga0495661_0026225 Ga0495661_0026225_2364_2987 201
764 3300046684 Ga0495669_0139036 Ga0495669_0139036_210_875 201
765 3300047323 Ga0495683_0138746 Ga0495683_0138746_334_969 201
766 3300047447 Ga0495685_018732 Ga0495685_018732_143_772 201
767 3300047472 Ga0495686_0001255 Ga0495686_0001255_14613_15236 201
768 3300048907 Ga0496104_0358830 Ga0496104_0358830_220_861 201
769 3300048917 Ga0496114_0655971 Ga0496114_0655971_242_883 201
770 3300048918 Ga0496115_0001375 Ga0496115_0001375_3654_4283 201
771 3300048919 Ga0496116_0016255 Ga0496116_0016255_271_1470 201
772 3300048921 Ga0496118_0000038 Ga0496118_0000038_124641_125780 201
773 3300048922 Ga0496119_0004280 Ga0496119_0004280_1587_2540 201
774 3300048922 Ga0496119_0008044 Ga0496119_0008044_7152_8117 201
775 3300048923 Ga0496120_0000591 Ga0496120_0000591_1203_2168 201
776 3300048923 Ga0496120_0023172 Ga0496120_0023172_2427_3380 201
777 3300048924 Ga0496121_0126548 Ga0496121_0126548_466_1419 201
778 3300048927 Ga0496124_0244404 Ga0496124_0244404_562_1182 201
779 3300048928 Ga0496125_0023654 Ga0496125_0023654_3624_4577 201
780 3300048929 Ga0496126_0363554 Ga0496126_0363554_41_994 201
781 3300049161 Ga0501305_028445 Ga0501305_028445_49_666 201
782 3300049459 Ga0495678_012922 Ga0495678_012922_800_1441 201
783 3300049459 Ga0495678_059821 Ga0495678_059821_743_1384 201
784 3300049568 Ga0501031_0020310 Ga0501031_0020310_825_1466 201
785 3300049568 Ga0501031_0025552 Ga0501031_0025552_830_1477 201
786 3300049569 Ga0501032_0006017 Ga0501032_0006017_2556_3203 201
787 3300049570 Ga0501033_0007935 Ga0501033_0007935_6433_7080 201
788 3300049570 Ga0501033_0074013 Ga0501033_0074013_266_907 201
789 3300049570 Ga0501033_0139861 Ga0501033_0139861_256_882 201
790 3300049571 Ga0501034_0035952 Ga0501034_0035952_798_1439 201
791 3300049572 Ga0501036_0001698 Ga0501036_0001698_1165_1812 201
792 3300049572 Ga0501036_0251969 Ga0501036_0251969_81_707 201
793 3300049572 Ga0501036_0628102 Ga0501036_0628102_24_665 201
794 3300049579 Ga0501043_0014288 Ga0501043_0014288_4446_5093 201
795 3300049580 Ga0501046_0005504 Ga0501046_0005504_10084_10710 201
796 3300049580 Ga0501046_0008710 Ga0501046_0008710_951_1598 201
797 3300049581 Ga0501047_0006048 Ga0501047_0006048_8183_8809 201
798 3300049581 Ga0501047_0141138 Ga0501047_0141138_1013_1639 201
799 3300049581 Ga0501047_0402228 Ga0501047_0402228_188_817 201
800 3300049582 Ga0501048_0191407 Ga0501048_0191407_638_1264 201
801 3300049822 Ga0501035_0011712 Ga0501035_0011712_6308_6955 201
802 3300049822 Ga0501035_0229292 Ga0501035_0229292_880_1506 201
803 3300049823 Ga0501044_0019416 Ga0501044_0019416_1843_2469 201
804 3300049823 Ga0501044_0037635 Ga0501044_0037635_3407_4054 201
805 3300049823 Ga0501044_0098937 Ga0501044_0098937_1675_2301 201
806 3300049823 Ga0501044_0117909 Ga0501044_0117909_484_1110 201
807 3300050511 nmdc:mga08y16_265796_c1 nmdc:mga08y16_265796_c1_563_1201 201
808 3300050512 nmdc:mga0n895_780210_c1 nmdc:mga0n895_780210_c1_178_819 201
809 3300059510 Ga0587090_004237 Ga0587090_004237_656_1279 201
810 3300059643 Ga0587072_009330 Ga0587072_009330_238_861 201
811 iso_pu_bacteria 2509276022 2509395532 201
812 iso_pu_bacteria 2512875016 2512929026 201
813 iso_pu_bacteria 2512875024 2512963590 201
814 iso_pu_bacteria 2513237090 2513612446 201
815 iso_pu_bacteria 2513237164 2514038151 201
816 iso_pu_bacteria 2588253730 2588514559 201
817 iso_pu_bacteria 2596583598 2597032436 201
818 iso_pu_bacteria 2599185178 2599444316 201
819 iso_pu_bacteria 2599185292 2599905225 201
820 iso_pu_bacteria 2599185301 2599935916 201
821 iso_pu_bacteria 2643221720 2644661089 201
822 iso_pu_bacteria 2643221736 2644745010 201
823 iso_pu_bacteria 2667528175 2671124212 201
824 iso_pu_bacteria 2693429783 2694633527 201
825 iso_pu_bacteria 2693429784 2694635231 201
826 iso_pu_bacteria 2841760612 2841760969 201
827 iso_pu_bacteria 2844104063 2844106626 201
828 iso_pu_bacteria 2851246043 2851246982 201
829 iso_pu_bacteria 2857349434 2857354169 201
830 iso_pu_bacteria 2857542790 2857547462 201
831 iso_pu_bacteria 2869278585 2869284339 201
832 iso_pu_bacteria 2876363079 2876369492 201
833 iso_pu_bacteria 2884411467 2884415629 201
834 iso_pu_bacteria 2885192300 2885192615 201
835 iso_pu_bacteria 2885266251 2885268525 201
836 iso_pu_bacteria 2885374607 2885380447 201
837 iso_pu_bacteria 2900577576 2900580934 201
838 iso_pu_bacteria 2903448605 2903453080 201
839 iso_pu_bacteria 2903521522 2903526906 201
840 iso_pu_bacteria 2903528002 2903530239 201
841 iso_pu_bacteria 2908739725 2908746915 201
842 iso_pu_bacteria 2917699015 2917699385 201
843 iso_pu_bacteria 2919450847 2919454175 201
844 iso_pu_bacteria 2928058823 2928063201 201
845 iso_pu_bacteria 2928963466 2928967011 201
846 iso_pu_bacteria 2937848649 2937851431 201
847 iso_pu_bacteria 2958034702 2958038436 201
848 iso_pu_bacteria 2958041894 2958056047 201
849 iso_pu_bacteria 2958092219 2958096749 201
850 iso_pu_bacteria 2958100919 2958101103 201
851 iso_pu_bacteria 2958172287 2958179729 201
852 iso_pu_bacteria 2963644680 2963650208 201
853 iso_pu_bacteria 2968016561 2968021259 201
854 iso_pu_bacteria 2968083720 2968086446 201
855 iso_pu_bacteria 2970469710 2970476364 201
856 iso_pu_bacteria 2970593180 2970598954 201
857 iso_pu_bacteria 2977922695 2977923270 201
858 iso_pu_bacteria 2977942078 2977949679 201
859 iso_pu_bacteria 2977986579 2977986690 201
860 iso_pu_bacteria 2979710463 2979710996 201
861 iso_pu_bacteria 2987636660 2987642421 201
862 iso_pu_bacteria 2996348954 2996356434 201
863 iso_pu_bacteria 3003665799 3003667380 201
864 iso_pu_bacteria 3004211236 3004213439 201
865 iso_pu_bacteria 3004218560 3004221274 201
866 iso_pu_bacteria 3004275668 3004282739 201
867 iso_pu_bacteria 3004289098 3004291788 201
868 iso_pu_bacteria 3004334049 3004338459 201
869 iso_pu_bacteria 3005474847 3005483460 201
870 iso_pu_bacteria 8001845381 8001846249 201
871 iso_pu_bacteria 8057529695 8057530833 201
872 3300002704 JGI25155J39150_1000075 JGI25155J39150_10000758 202
873 3300002705 JGI25156J39149_1000103 JGI25156J39149_100010351 202
874 3300002738 JGI25154J39366_1000018 JGI25154J39366_1000018183 202
875 3300002741 JGI25157J39369_1000074 JGI25157J39369_10000749 202
876 3300003187 JGI25151J46595_10001431 JGI25151J46595_100014318 202
877 3300003214 JGI25165J46597_1005428 JGI25165J46597_10054282 202
878 3300003354 JGI25160J50197_1000044 JGI25160J50197_100004428 202
879 3300003374 JGI25161J50226_1000028 JGI25161J50226_1000028111 202
880 3300003544 Ga0007417J51691_1011014 Ga0007417J51691_10110144 202
881 3300003574 Ga0007410J51695_1014726 Ga0007410J51695_10147263 202
882 3300003752 Ga0055539_1019733 Ga0055539_10197331 202
883 3300003762 Ga0055542_1001823 Ga0055542_10018237 202
884 3300003771 Ga0055526_1000001 Ga0055526_1000001373 202
885 3300003775 Ga0055524_1000159 Ga0055524_100015934 202
886 3300003790 Ga0055528_1000511 Ga0055528_10005112 202
887 3300003790 Ga0055528_1004755 Ga0055528_10047554 202
888 3300003792 Ga0055540_1000379 Ga0055540_100037912 202
889 3300003794 Ga0055531_10027323 Ga0055531_100273233 202
890 3300004625 Ga0055543_1000295 Ga0055543_100029530 202
891 3300005262 Ga0065165_1000956 Ga0065165_100095630 202
892 3300005289 Ga0065704_10163521 Ga0065704_101635212 202
893 3300005344 Ga0070661_100799954 Ga0070661_1007999541 202
894 3300005347 Ga0070668_100100431 Ga0070668_1001004313 202
895 3300005366 Ga0070659_100000935 Ga0070659_10000093515 202
896 3300005366 Ga0070659_100092648 Ga0070659_1000926484 202
897 3300005367 Ga0070667_100254375 Ga0070667_1002543753 202
898 3300005367 Ga0070667_101075416 Ga0070667_1010754161 202
899 3300005539 Ga0068853_100556463 Ga0068853_1005564632 202
900 3300005548 Ga0070665_100388796 Ga0070665_1003887962 202
901 3300005564 Ga0070664_100302975 Ga0070664_1003029752 202
902 3300005577 Ga0068857_100271648 Ga0068857_1002716482 202
903 3300005578 Ga0068854_100049236 Ga0068854_1000492364 202
904 3300005616 Ga0068852_100693867 Ga0068852_1006938672 202
905 3300005834 Ga0068851_10044097 Ga0068851_100440972 202
906 3300006038 Ga0075365_10056118 Ga0075365_100561182 202
907 3300006038 Ga0075365_10166202 Ga0075365_101662021 202
908 3300006042 Ga0075368_10001376 Ga0075368_100013766 202
909 3300006048 Ga0075363_100021008 Ga0075363_1000210083 202
910 3300006048 Ga0075363_100037887 Ga0075363_1000378872 202
911 3300006048 Ga0075363_100094218 Ga0075363_1000942182 202
912 3300006051 Ga0075364_10010269 Ga0075364_100102694 202
913 3300006051 Ga0075364_10054830 Ga0075364_100548302 202
914 3300006177 Ga0075362_10030441 Ga0075362_100304412 202
915 3300006178 Ga0075367_10052670 Ga0075367_100526703 202
916 3300006178 Ga0075367_10545070 Ga0075367_105450701 202
917 3300006195 Ga0075366_10327098 Ga0075366_103270981 202
918 3300006353 Ga0075370_10073303 Ga0075370_100733032 202
919 3300009036 Ga0105244_10003165 Ga0105244_100031654 202
920 3300009093 Ga0105240_10000910 Ga0105240_1000091019 202
921 3300009093 Ga0105240_10001328 Ga0105240_100013284 202
922 3300009093 Ga0105240_10304782 Ga0105240_103047822 202
923 3300009093 Ga0105240_11122234 Ga0105240_111222342 202
924 3300009098 Ga0105245_10703261 Ga0105245_107032612 202
925 3300009101 Ga0105247_10029369 Ga0105247_100293695 202
926 3300009101 Ga0105247_10305470 Ga0105247_103054702 202
927 3300009148 Ga0105243_10067070 Ga0105243_100670702 202
928 3300009174 Ga0105241_10734519 Ga0105241_107345192 202
929 3300009177 Ga0105248_10169144 Ga0105248_101691442 202
930 3300009545 Ga0105237_10001371 Ga0105237_1000137119 202
931 3300009551 Ga0105238_10004686 Ga0105238_1000468610 202
932 3300009553 Ga0105249_10665467 Ga0105249_106654672 202
933 3300010375 Ga0105239_10000063 Ga0105239_100000634 202
934 3300010375 Ga0105239_10002428 Ga0105239_1000242810 202
935 3300010375 Ga0105239_10257945 Ga0105239_102579452 202
936 3300010375 Ga0105239_10573770 Ga0105239_105737703 202
937 3300012490 Ga0157322_1001321 Ga0157322_10013212 202
938 3300013100 Ga0157373_10007094 Ga0157373_100070946 202
939 3300013102 Ga0157371_10000004 Ga0157371_1000000478 202
940 3300013104 Ga0157370_10001047 Ga0157370_100010476 202
941 3300013104 Ga0157370_10003639 Ga0157370_100036392 202
942 3300013104 Ga0157370_10293825 Ga0157370_102938252 202
943 3300013105 Ga0157369_10306639 Ga0157369_103066392 202
944 3300013105 Ga0157369_10899997 Ga0157369_108999972 202
945 3300013296 Ga0157374_10137325 Ga0157374_101373253 202
946 3300013306 Ga0163162_10086829 Ga0163162_100868292 202
947 3300014325 Ga0163163_10658523 Ga0163163_106585232 202
948 3300014497 Ga0182008_10036394 Ga0182008_100363942 202
949 3300014968 Ga0157379_10112141 Ga0157379_101121412 202
950 3300014969 Ga0157376_10009453 Ga0157376_1000945310 202
951 3300015261 Ga0182006_1000008 Ga0182006_1000008216 202
952 3300015262 Ga0182007_10022075 Ga0182007_100220752 202
953 3300015265 Ga0182005_1000008 Ga0182005_1000008381 202
954 3300021361 Ga0213872_10019917 Ga0213872_100199174 202
955 3300025206 Ga0209435_100044 Ga0209435_10004418 202
956 3300025228 Ga0209672_100537 Ga0209672_10053712 202
957 3300025246 Ga0209646_1000023 Ga0209646_1000023249 202
958 3300025246 Ga0209646_1000151 Ga0209646_100015118 202
959 3300025250 Ga0209026_1000170 Ga0209026_100017018 202
960 3300025253 Ga0209677_100368 Ga0209677_10036810 202
961 3300025254 Ga0209148_1000078 Ga0209148_1000078268 202
962 3300025256 Ga0209759_1000186 Ga0209759_100018620 202
963 3300025261 Ga0209233_1000793 Ga0209233_10007937 202
964 3300025272 Ga0209455_1000194 Ga0209455_10001947 202
965 3300025273 Ga0209673_1000023 Ga0209673_100002398 202
966 3300025273 Ga0209673_1001489 Ga0209673_10014892 202
967 3300025284 Ga0209130_1000093 Ga0209130_100009328 202
968 3300025292 Ga0209676_1035497 Ga0209676_10354972 202
969 3300025294 Ga0209025_1000027 Ga0209025_1000027113 202
970 3300025294 Ga0209025_1000553 Ga0209025_10005535 202
971 3300025295 Ga0209564_1000002 Ga0209564_1000002194 202
972 3300025295 Ga0209564_1000112 Ga0209564_1000112115 202
973 3300025299 Ga0209256_1000051 Ga0209256_1000051138 202
974 3300025299 Ga0209256_1000485 Ga0209256_10004853 202
975 3300025302 Ga0207426_1000012 Ga0207426_1000012689 202
976 3300025303 Ga0209051_1000119 Ga0209051_1000119130 202
977 3300025304 Ga0209257_1003940 Ga0209257_10039402 202
978 3300025321 Ga0207656_10057359 Ga0207656_100573592 202
979 3300025728 Ga0207655_1017375 Ga0207655_10173753 202
980 3300025913 Ga0207695_10000427 Ga0207695_1000042719 202
981 3300025913 Ga0207695_10000633 Ga0207695_100006334 202
982 3300025914 Ga0207671_10000288 Ga0207671_1000028854 202
983 3300025914 Ga0207671_10540766 Ga0207671_105407662 202
984 3300025919 Ga0207657_10191807 Ga0207657_101918072 202
985 3300025920 Ga0207649_10044234 Ga0207649_100442342 202
986 3300025924 Ga0207694_10156206 Ga0207694_101562063 202
987 3300025925 Ga0207650_10008014 Ga0207650_100080146 202
988 3300025932 Ga0207690_10001019 Ga0207690_1000101910 202
989 3300025941 Ga0207711_10168109 Ga0207711_101681092 202
990 3300025942 Ga0207689_10289886 Ga0207689_102898862 202
991 3300025945 Ga0207679_10000181 Ga0207679_1000018145 202
992 3300025961 Ga0207712_10076642 Ga0207712_100766423 202
993 3300025972 Ga0207668_10121554 Ga0207668_101215542 202
994 3300025986 Ga0207658_10035546 Ga0207658_100355461 202
995 3300026041 Ga0207639_10210608 Ga0207639_102106082 202
996 3300026067 Ga0207678_10414950 Ga0207678_104149503 202
997 3300026078 Ga0207702_10165613 Ga0207702_101656133 202
998 3300026116 Ga0207674_10181346 Ga0207674_101813463 202
999 3300026116 Ga0207674_10480278 Ga0207674_104802782 202
1000 3300026142 Ga0207698_10454791 Ga0207698_104547912 202
1001 3300027111 Ga0209281_1008525 Ga0209281_10085252 202
1002 3300027312 Ga0209371_1018110 Ga0209371_10181102 202
1003 3300027866 Ga0209813_10034491 Ga0209813_100344912 202
1004 3300028379 Ga0268266_10011589 Ga0268266_100115891 202
1005 3300028379 Ga0268266_10092303 Ga0268266_100923032 202
1006 3300028379 Ga0268266_11013571 Ga0268266_110135711 202
1007 3300028381 Ga0268264_10000100 Ga0268264_10000100199 202
1008 3300030500 Ga0268256_1005080 Ga0268256_10050802 202
1009 3300031507 Ga0307509_10000034 Ga0307509_1000003489 202
1010 3300035118 Ga0373954_0213413 Ga0373954_0213413_313_933 202
1011 3300035695 Ga0373927_0000106 Ga0373927_0000106_45426_46058 202
1012 3300035725 Ga0373947_0061485 Ga0373947_0061485_356_988 202
1013 3300037068 Ga0373925_0050634 Ga0373925_0050634_493_1125 202
1014 3300037312 Ga0395899_0540257 Ga0395899_0540257_100_723 202
1015 3300037418 Ga0395900_0000584 Ga0395900_0000584_32695_33321 202
1016 3300037418 Ga0395900_0007118 Ga0395900_0007118_681_1307 202
1017 3300037418 Ga0395900_0318088 Ga0395900_0318088_381_1004 202
1018 3300037466 Ga0395898_0004694 Ga0395898_0004694_7620_8246 202
1019 3300037466 Ga0395898_0013392 Ga0395898_0013392_6868_7491 202
1020 3300037471 Ga0395905_0068264 Ga0395905_0068264_1037_1663 202
1021 3300037853 Ga0436364_0463021 Ga0436364_0463021_270_902 202
1022 3300038443 Ga0395901_0124445 Ga0395901_0124445_1149_1775 202
1023 3300039447 Ga0436361_0223084 Ga0436361_0223084_623_1240 202
1024 3300039447 Ga0436361_0436689 Ga0436361_0436689_43629_44246 202
1025 3300041494 Ga0451837_0687090 Ga0451837_0687090_690_1316 202
1026 3300041512 Ga0451853_2619191 Ga0451853_2619191_706_1332 202
1027 3300042000 Ga0439437_003911 Ga0439437_003911_670_1293 202
1028 3300042120 Ga0450917_001327 Ga0450917_001327_463_1086 202
1029 3300042127 Ga0450890_009081 Ga0450890_009081_225_848 202
1030 3300042129 Ga0450891_002081 Ga0450891_002081_247_870 202
1031 3300042130 Ga0450892_008277 Ga0450892_008277_193_816 202
1032 3300042144 Ga0450889_001445 Ga0450889_001445_600_1223 202
1033 3300042530 Ga0450916_002094 Ga0450916_002094_132_755 202
1034 3300044658 Ga0466972_0053806 Ga0466972_0053806_1300_1926 202
1035 3300045051 Ga0451576_0294393 Ga0451576_0294393_345_968 202
1036 3300046452 Ga0495617_003539 Ga0495617_003539_4343_4972 202
1037 3300046452 Ga0495617_025076 Ga0495617_025076_1051_1680 202
1038 3300046452 Ga0495617_098033 Ga0495617_098033_270_896 202
1039 3300046453 Ga0495627_000001 Ga0495627_000001_434103_434732 202
1040 3300046460 Ga0495638_0000072 Ga0495638_0000072_117082_117711 202
1041 3300046460 Ga0495638_0000272 Ga0495638_0000272_23840_24472 202
1042 3300046460 Ga0495638_0000290 Ga0495638_0000290_14878_15510 202
1043 3300046460 Ga0495638_0041698 Ga0495638_0041698_360_989 202
1044 3300046463 Ga0495653_0000005 Ga0495653_0000005_358982_359611 202
1045 3300046471 Ga0495650_0000210 Ga0495650_0000210_14900_15532 202
1046 3300046471 Ga0495650_0000687 Ga0495650_0000687_12588_13217 202
1047 3300046471 Ga0495650_0002084 Ga0495650_0002084_720_1349 202
1048 3300046471 Ga0495650_0076463 Ga0495650_0076463_495_1121 202
1049 3300046491 Ga0495584_0000119 Ga0495584_0000119_1012_1641 202
1050 3300046491 Ga0495584_0018571 Ga0495584_0018571_999_1631 202
1051 3300046492 Ga0495585_0066316 Ga0495585_0066316_945_1574 202
1052 3300046499 Ga0495594_0009740 Ga0495594_0009740_3356_3988 202
1053 3300046501 Ga0495607_0035566 Ga0495607_0035566_1088_1717 202
1054 3300046501 Ga0495607_0050477 Ga0495607_0050477_1012_1641 202
1055 3300046501 Ga0495607_0059324 Ga0495607_0059324_331_957 202
1056 3300046506 Ga0495583_0000148 Ga0495583_0000148_116985_117614 202
1057 3300046507 Ga0495606_0000006 Ga0495606_0000006_132070_132699 202
1058 3300046507 Ga0495606_0000016 Ga0495606_0000016_89479_90111 202
1059 3300046507 Ga0495606_0000449 Ga0495606_0000449_65523_66152 202
1060 3300046507 Ga0495606_0000607 Ga0495606_0000607_55240_55869 202
1061 3300046507 Ga0495606_0005156 Ga0495606_0005156_1225_1854 202
1062 3300046507 Ga0495606_0012527 Ga0495606_0012527_674_1303 202
1063 3300046507 Ga0495606_0199113 Ga0495606_0199113_178_879 202
1064 3300046512 Ga0495610_0002602 Ga0495610_0002602_13763_14392 202
1065 3300046512 Ga0495610_0073695 Ga0495610_0073695_149_778 202
1066 3300046512 Ga0495610_0080898 Ga0495610_0080898_631_1260 202
1067 3300046513 Ga0495616_0013463 Ga0495616_0013463_300_929 202
1068 3300046519 Ga0495632_0072416 Ga0495632_0072416_376_1077 202
1069 3300046522 Ga0495643_0000193 Ga0495643_0000193_1021_1650 202
1070 3300046522 Ga0495643_0111411 Ga0495643_0111411_183_812 202
1071 3300046523 Ga0495644_0033596 Ga0495644_0033596_726_1355 202
1072 3300046524 Ga0495648_0000037 Ga0495648_0000037_78260_78889 202
1073 3300046524 Ga0495648_0008531 Ga0495648_0008531_4969_5598 202
1074 3300046538 Ga0495609_0000909 Ga0495609_0000909_4375_5004 202
1075 3300046538 Ga0495609_0022496 Ga0495609_0022496_381_1010 202
1076 3300046542 Ga0495597_0047988 Ga0495597_0047988_310_942 202
1077 3300046557 Ga0495622_0000002 Ga0495622_0000002_198153_198782 202
1078 3300046557 Ga0495622_0000040 Ga0495622_0000040_931_1560 202
1079 3300046558 Ga0495633_0000121 Ga0495633_0000121_81276_81905 202
1080 3300046558 Ga0495633_0000258 Ga0495633_0000258_61163_61792 202
1081 3300046558 Ga0495633_0005001 Ga0495633_0005001_2485_3114 202
1082 3300046558 Ga0495633_0047978 Ga0495633_0047978_645_1274 202
1083 3300046558 Ga0495633_0252573 Ga0495633_0252573_117_746 202
1084 3300046616 Ga0495668_0000874 Ga0495668_0000874_32435_33064 202
1085 3300046648 Ga0495611_0002244 Ga0495611_0002244_297_929 202
1086 3300046648 Ga0495611_0013951 Ga0495611_0013951_2071_2700 202
1087 3300046648 Ga0495611_0092857 Ga0495611_0092857_604_1230 202
1088 3300046660 Ga0495625_0001389 Ga0495625_0001389_27852_28481 202
1089 3300046660 Ga0495625_0022171 Ga0495625_0022171_53_679 202
1090 3300046660 Ga0495625_0035822 Ga0495625_0035822_782_1411 202
1091 3300046660 Ga0495625_0066518 Ga0495625_0066518_719_1339 202
1092 3300046665 Ga0495661_0072671 Ga0495661_0072671_1325_1954 202
1093 3300046674 Ga0495588_0027805 Ga0495588_0027805_1809_2435 202
1094 3300046691 Ga0495670_0020512 Ga0495670_0020512_2122_2751 202
1095 3300046691 Ga0495670_0159625 Ga0495670_0159625_516_1145 202
1096 3300046694 Ga0495649_0001640 Ga0495649_0001640_8959_9591 202
1097 3300047318 Ga0495636_0075360 Ga0495636_0075360_34_663 202
1098 3300047320 Ga0495672_0000030 Ga0495672_0000030_94464_95093 202
1099 3300047323 Ga0495683_0242556 Ga0495683_0242556_146_775 202
1100 3300047443 Ga0495687_002847 Ga0495687_002847_1139_1768 202
1101 3300047443 Ga0495687_002862 Ga0495687_002862_11509_12138 202
1102 3300047469 Ga0495673_0000003 Ga0495673_0000003_452895_453524 202
1103 3300047469 Ga0495673_0000136 Ga0495673_0000136_86821_87450 202
1104 3300047470 Ga0495681_0016088 Ga0495681_0016088_1069_1695 202
1105 3300047470 Ga0495681_0018876 Ga0495681_0018876_1047_1676 202
1106 3300047472 Ga0495686_0000453 Ga0495686_0000453_53644_54270 202
1107 3300047472 Ga0495686_0004390 Ga0495686_0004390_970_1599 202
1108 3300048905 Ga0496102_0071675 Ga0496102_0071675_1420_2058 202
1109 3300048906 Ga0496103_0052970 Ga0496103_0052970_1120_1749 202
1110 3300048907 Ga0496104_0622269 Ga0496104_0622269_31_663 202
1111 3300048914 Ga0496111_0386782 Ga0496111_0386782_165_794 202
1112 3300048916 Ga0496113_0118907 Ga0496113_0118907_1033_1659 202
1113 3300048916 Ga0496113_0566352 Ga0496113_0566352_104_730 202
1114 3300048917 Ga0496114_0068956 Ga0496114_0068956_2140_2769 202
1115 3300048917 Ga0496114_0259632 Ga0496114_0259632_495_1127 202
1116 3300048918 Ga0496115_0000089 Ga0496115_0000089_74192_74824 202
1117 3300048918 Ga0496115_0023325 Ga0496115_0023325_2430_3062 202
1118 3300048918 Ga0496115_0421359 Ga0496115_0421359_360_998 202
1119 3300048919 Ga0496116_0121427 Ga0496116_0121427_313_942 202
1120 3300048919 Ga0496116_0168393 Ga0496116_0168393_455_1081 202
1121 3300048920 Ga0496117_0000002 Ga0496117_0000002_2403846_2404472 202
1122 3300048920 Ga0496117_0028999 Ga0496117_0028999_3028_3654 202
1123 3300048920 Ga0496117_0099449 Ga0496117_0099449_845_1483 202
1124 3300048921 Ga0496118_0001167 Ga0496118_0001167_24128_24754 202
1125 3300048921 Ga0496118_0001680 Ga0496118_0001680_26997_27635 202
1126 3300048921 Ga0496118_0003211 Ga0496118_0003211_19145_19783 202
1127 3300048921 Ga0496118_0042339 Ga0496118_0042339_2331_2957 202
1128 3300048922 Ga0496119_0000093 Ga0496119_0000093_69818_70456 202
1129 3300048922 Ga0496119_0040238 Ga0496119_0040238_1744_2370 202
1130 3300048922 Ga0496119_0045318 Ga0496119_0045318_1862_2488 202
1131 3300048922 Ga0496119_0195358 Ga0496119_0195358_238_864 202
1132 3300048923 Ga0496120_0000170 Ga0496120_0000170_108786_109424 202
1133 3300048923 Ga0496120_0002729 Ga0496120_0002729_15660_16286 202
1134 3300048923 Ga0496120_0004164 Ga0496120_0004164_10827_11465 202
1135 3300048923 Ga0496120_0015907 Ga0496120_0015907_141_767 202
1136 3300048923 Ga0496120_0048096 Ga0496120_0048096_1409_2038 202
1137 3300048924 Ga0496121_0000001 Ga0496121_0000001_193243_193869 202
1138 3300048924 Ga0496121_0000761 Ga0496121_0000761_5356_5985 202
1139 3300048924 Ga0496121_0087238 Ga0496121_0087238_1186_1818 202
1140 3300048924 Ga0496121_0177711 Ga0496121_0177711_136_762 202
1141 3300048925 Ga0496122_0000001 Ga0496122_0000001_1747854_1748480 202
1142 3300048926 Ga0496123_0000001 Ga0496123_0000001_1751585_1752211 202
1143 3300048926 Ga0496123_0007656 Ga0496123_0007656_990_1619 202
1144 3300048926 Ga0496123_0036723 Ga0496123_0036723_1393_2019 202
1145 3300048927 Ga0496124_0034120 Ga0496124_0034120_3305_3931 202
1146 3300048927 Ga0496124_0057195 Ga0496124_0057195_349_975 202
1147 3300048927 Ga0496124_0168860 Ga0496124_0168860_190_819 202
1148 3300048928 Ga0496125_0000001 Ga0496125_0000001_305126_305752 202
1149 3300048928 Ga0496125_0024805 Ga0496125_0024805_4030_4668 202
1150 3300048928 Ga0496125_0074332 Ga0496125_0074332_1921_2547 202
1151 3300048929 Ga0496126_0000715 Ga0496126_0000715_31131_31769 202
1152 3300048929 Ga0496126_0002698 Ga0496126_0002698_16170_16799 202
1153 3300048929 Ga0496126_0079329 Ga0496126_0079329_922_1554 202
1154 3300048929 Ga0496126_0303067 Ga0496126_0303067_456_1082 202
1155 3300048929 Ga0496126_0344902 Ga0496126_0344902_367_999 202
1156 3300049459 Ga0495678_000002 Ga0495678_000002_76465_77094 202
1157 3300049459 Ga0495678_000115 Ga0495678_000115_94747_95376 202
1158 3300049459 Ga0495678_006761 Ga0495678_006761_4144_4776 202
1159 3300049460 Ga0495682_0067532 Ga0495682_0067532_195_827 202
1160 3300049679 Ga0501249_001430 Ga0501249_001430_774_1403 202
1161 3300049766 Ga0501269_000232 Ga0501269_000232_14886_15515 202
1162 3300049822 Ga0501035_0527551 Ga0501035_0527551_216_839 202
1163 3300050489 nmdc:mga03683_27674_c1 nmdc:mga03683_27674_c1_72_698 202
1164 3300050490 nmdc:mga03n38_141316_c1 nmdc:mga03n38_141316_c1_459_1085 202
1165 3300050491 nmdc:mga00v17_169813_c1 nmdc:mga00v17_169813_c1_265_891 202
1166 3300050491 nmdc:mga00v17_611_c1 nmdc:mga00v17_611_c1_9667_10293 202
1167 3300050491 nmdc:mga00v17_93930_c1 nmdc:mga00v17_93930_c1_336_962 202
1168 3300050492 nmdc:mga0yw44_149_c1 nmdc:mga0yw44_149_c1_7361_7987 202
1169 3300050493 nmdc:mga0k408_59995_c1 nmdc:mga0k408_59995_c1_680_1303 202
1170 3300050494 nmdc:mga06z11_2132_c1 nmdc:mga06z11_2132_c1_6259_6885 202
1171 3300050494 nmdc:mga06z11_241627_c1 nmdc:mga06z11_241627_c1_403_1029 202
1172 3300050495 nmdc:mga04h51_164945_c1 nmdc:mga04h51_164945_c1_217_843 202
1173 3300050495 nmdc:mga04h51_51495_c1 nmdc:mga04h51_51495_c1_640_1266 202
1174 3300050496 nmdc:mga07m45_160586_c1 nmdc:mga07m45_160586_c1_669_1295 202
1175 3300050496 nmdc:mga07m45_25782_c1 nmdc:mga07m45_25782_c1_2592_3218 202
1176 3300050516 nmdc:mga0sz30_156948_c1 nmdc:mga0sz30_156948_c1_82_708 202
1177 3300050516 nmdc:mga0sz30_25943_c1 nmdc:mga0sz30_25943_c1_990_1616 202
1178 3300053077 Ga0495601_0253670 Ga0495601_0253670_70_696 202
1179 3300053119 Ga0500595_018902 Ga0500595_018902_1058_1684 202
1180 3300053122 Ga0500608_085600 Ga0500608_085600_499_1128 202
1181 3300053134 Ga0500658_0004088 Ga0500658_0004088_911_1537 202
1182 3300053137 Ga0500561_0004183 Ga0500561_0004183_1077_1703 202
1183 3300053138 Ga0500564_105300 Ga0500564_105300_471_1085 202
1184 3300053153 Ga0500616_0036268 Ga0500616_0036268_730_1356 202
1185 3300053157 Ga0500624_000450 Ga0500624_000450_258_884 202
1186 3300053161 Ga0500634_0010092 Ga0500634_0010092_3100_3726 202
1187 3300059641 Ga0587068_014039 Ga0587068_014039_65_703 202
1188 3300059641 Ga0587068_063121 Ga0587068_063121_53_682 202
1189 iso_pu_bacteria 2513237141 2513889950 202
1190 iso_pu_bacteria 2513237165 2514043552 202
1191 iso_pu_bacteria 2582581304 2585257781 202
1192 iso_pu_bacteria 2643221734 2644734370 202
1193 iso_pu_bacteria 2671180139 2671694039 202
1194 iso_pu_bacteria 2738543013 2739252158 202
1195 iso_pu_bacteria 2818991467 2819721064 202
1196 iso_pu_bacteria 2821443989 2821447210 202
1197 iso_pu_bacteria 2842775625 2842778546 202
1198 iso_pu_bacteria 2903748898 2903753285 202
1199 iso_pu_bacteria 2919171160 2919176095 202
1200 iso_pu_bacteria 644736347 644752242 202
1201 iso_pu_bacteria 8054563764 8054568783 202
1202 3300001989 JGI24739J22299_10023558 JGI24739J22299_100235582 203
1203 3300002075 JGI24738J21930_10026316 JGI24738J21930_100263162 203
1204 3300002705 JGI25156J39149_1000048 JGI25156J39149_10000482 203
1205 3300002737 JGI25162J39368_1000021 JGI25162J39368_1000021217 203
1206 3300002738 JGI25154J39366_1000071 JGI25154J39366_100007178 203
1207 3300003214 JGI25165J46597_1000049 JGI25165J46597_10000496 203
1208 3300003215 JGI25153J46596_10015502 JGI25153J46596_100155022 203
1209 3300003215 JGI25153J46596_10023273 JGI25153J46596_100232731 203
1210 3300003215 JGI25153J46596_10059019 JGI25153J46596_100590191 203
1211 3300003215 JGI25153J46596_10093534 JGI25153J46596_100935341 203
1212 3300003354 JGI25160J50197_1021034 JGI25160J50197_10210342 203
1213 3300003354 JGI25160J50197_1022406 JGI25160J50197_10224062 203
1214 3300003354 JGI25160J50197_1051285 JGI25160J50197_10512851 203
1215 3300003693 Ga0032354_1007062 Ga0032354_10070624 203
1216 3300003751 Ga0055538_1000023 Ga0055538_1000023217 203
1217 3300003752 Ga0055539_1000030 Ga0055539_1000030217 203
1218 3300003752 Ga0055539_1017949 Ga0055539_10179491 203
1219 3300003756 Ga0055533_1000039 Ga0055533_1000039217 203
1220 3300003758 Ga0055532_1000102 Ga0055532_100010213 203
1221 3300003759 Ga0055525_1000048 Ga0055525_10000486 203
1222 3300003762 Ga0055542_1009181 Ga0055542_10091812 203
1223 3300003763 Ga0055529_1010408 Ga0055529_10104082 203
1224 3300003771 Ga0055526_1011050 Ga0055526_10110502 203
1225 3300003771 Ga0055526_1047817 Ga0055526_10478172 203
1226 3300003775 Ga0055524_1021588 Ga0055524_10215883 203
1227 3300003790 Ga0055528_1000162 Ga0055528_10001627 203
1228 3300003791 Ga0055530_10007054 Ga0055530_100070546 203
1229 3300003791 Ga0055530_10010481 Ga0055530_100104812 203
1230 3300003792 Ga0055540_1000023 Ga0055540_100002327 203
1231 3300003794 Ga0055531_10002103 Ga0055531_1000210316 203
1232 3300003794 Ga0055531_10004698 Ga0055531_100046987 203
1233 3300003794 Ga0055531_10016218 Ga0055531_100162182 203
1234 3300003841 Ga0055541_1000021 Ga0055541_10000216 203
1235 3300004625 Ga0055543_1025289 Ga0055543_10252892 203
1236 3300005262 Ga0065165_1000055 Ga0065165_1000055177 203
1237 3300005262 Ga0065165_1006686 Ga0065165_10066862 203
1238 3300005262 Ga0065165_1061975 Ga0065165_10619751 203
1239 3300005331 Ga0070670_100459941 Ga0070670_1004599412 203
1240 3300005334 Ga0068869_100360126 Ga0068869_1003601262 203
1241 3300005335 Ga0070666_10059468 Ga0070666_100594684 203
1242 3300005336 Ga0070680_100099020 Ga0070680_1000990203 203
1243 3300005339 Ga0070660_100989193 Ga0070660_1009891931 203
1244 3300005340 Ga0070689_100647636 Ga0070689_1006476361 203
1245 3300005344 Ga0070661_100218432 Ga0070661_1002184323 203
1246 3300005347 Ga0070668_100326805 Ga0070668_1003268052 203
1247 3300005356 Ga0070674_100412026 Ga0070674_1004120262 203
1248 3300005366 Ga0070659_100002149 Ga0070659_1000021498 203
1249 3300005366 Ga0070659_100033531 Ga0070659_1000335312 203
1250 3300005434 Ga0070709_10005498 Ga0070709_100054985 203
1251 3300005436 Ga0070713_100033847 Ga0070713_1000338476 203
1252 3300005439 Ga0070711_100023640 Ga0070711_1000236402 203
1253 3300005455 Ga0070663_100013652 Ga0070663_1000136525 203
1254 3300005457 Ga0070662_100258378 Ga0070662_1002583781 203
1255 3300005539 Ga0068853_100642643 Ga0068853_1006426432 203
1256 3300005548 Ga0070665_100089266 Ga0070665_1000892662 203
1257 3300005548 Ga0070665_100301058 Ga0070665_1003010582 203
1258 3300005548 Ga0070665_100454447 Ga0070665_1004544472 203
1259 3300005548 Ga0070665_100578008 Ga0070665_1005780082 203
1260 3300005563 Ga0068855_100434446 Ga0068855_1004344463 203
1261 3300005563 Ga0068855_100717455 Ga0068855_1007174552 203
1262 3300005563 Ga0068855_101236062 Ga0068855_1012360622 203
1263 3300005564 Ga0070664_100198261 Ga0070664_1001982612 203
1264 3300005564 Ga0070664_100604043 Ga0070664_1006040432 203
1265 3300005577 Ga0068857_100278026 Ga0068857_1002780263 203
1266 3300005578 Ga0068854_100113279 Ga0068854_1001132792 203
1267 3300005614 Ga0068856_100015585 Ga0068856_1000155852 203
1268 3300005614 Ga0068856_100415932 Ga0068856_1004159322 203
1269 3300005616 Ga0068852_100276969 Ga0068852_1002769692 203
1270 3300005616 Ga0068852_100847474 Ga0068852_1008474742 203
1271 3300005617 Ga0068859_100656357 Ga0068859_1006563572 203
1272 3300005617 Ga0068859_100858231 Ga0068859_1008582312 203
1273 3300005618 Ga0068864_100343212 Ga0068864_1003432122 203
1274 3300005618 Ga0068864_100687406 Ga0068864_1006874061 203
1275 3300005834 Ga0068851_10084801 Ga0068851_100848013 203
1276 3300005841 Ga0068863_100094266 Ga0068863_1000942662 203
1277 3300005841 Ga0068863_100557723 Ga0068863_1005577232 203
1278 3300005842 Ga0068858_100074426 Ga0068858_1000744263 203
1279 3300005842 Ga0068858_100194414 Ga0068858_1001944142 203
1280 3300005843 Ga0068860_100185603 Ga0068860_1001856033 203
1281 3300005843 Ga0068860_100748953 Ga0068860_1007489531 203
1282 3300005844 Ga0068862_100265426 Ga0068862_1002654261 203
1283 3300005844 Ga0068862_101079495 Ga0068862_1010794951 203
1284 3300005844 Ga0068862_101246132 Ga0068862_1012461321 203
1285 3300005983 Ga0081540_1042176 Ga0081540_10421763 203
1286 3300005983 Ga0081540_1058347 Ga0081540_10583473 203
1287 3300005983 Ga0081540_1104612 Ga0081540_11046123 203
1288 3300005983 Ga0081540_1124457 Ga0081540_11244572 203
1289 3300005985 Ga0081539_10025519 Ga0081539_100255193 203
1290 3300006038 Ga0075365_10057944 Ga0075365_100579443 203
1291 3300006038 Ga0075365_10143041 Ga0075365_101430412 203
1292 3300006038 Ga0075365_10232927 Ga0075365_102329272 203
1293 3300006038 Ga0075365_10336585 Ga0075365_103365852 203
1294 3300006042 Ga0075368_10055654 Ga0075368_100556542 203
1295 3300006048 Ga0075363_100018733 Ga0075363_1000187332 203
1296 3300006051 Ga0075364_10120722 Ga0075364_101207222 203
1297 3300006177 Ga0075362_10038388 Ga0075362_100383883 203
1298 3300006178 Ga0075367_10251598 Ga0075367_102515982 203
1299 3300006186 Ga0075369_10250574 Ga0075369_102505741 203
1300 3300006195 Ga0075366_10048305 Ga0075366_100483052 203
1301 3300006358 Ga0068871_100709842 Ga0068871_1007098422 203
1302 3300006931 Ga0097620_100656287 Ga0097620_1006562871 203
1303 3300006931 Ga0097620_100858125 Ga0097620_1008581252 203
1304 3300006941 Ga0099825_1022559 Ga0099825_10225593 203
1305 3300006941 Ga0099825_1036695 Ga0099825_10366952 203
1306 3300006942 Ga0099824_1018892 Ga0099824_10188926 203
1307 3300006943 Ga0099822_1016039 Ga0099822_10160395 203
1308 3300006944 Ga0099823_1026401 Ga0099823_10264013 203
1309 3300006946 Ga0079104_1011096 Ga0079104_10110964 203
1310 3300009011 Ga0105251_10053702 Ga0105251_100537022 203
1311 3300009093 Ga0105240_10000410 Ga0105240_100004102 203
1312 3300009093 Ga0105240_10005838 Ga0105240_1000583810 203
1313 3300009094 Ga0111539_11532408 Ga0111539_115324081 203
1314 3300009098 Ga0105245_10175568 Ga0105245_101755682 203
1315 3300009101 Ga0105247_10321899 Ga0105247_103218992 203
1316 3300009148 Ga0105243_10121817 Ga0105243_101218172 203
1317 3300009148 Ga0105243_11093476 Ga0105243_110934761 203
1318 3300009174 Ga0105241_10100282 Ga0105241_101002822 203
1319 3300009174 Ga0105241_10233932 Ga0105241_102339322 203
1320 3300009174 Ga0105241_10298174 Ga0105241_102981742 203
1321 3300009174 Ga0105241_10824130 Ga0105241_108241302 203
1322 3300009176 Ga0105242_10682111 Ga0105242_106821113 203
1323 3300009177 Ga0105248_10555238 Ga0105248_105552382 203
1324 3300009545 Ga0105237_10018789 Ga0105237_100187892 203
1325 3300009545 Ga0105237_10052824 Ga0105237_100528242 203
1326 3300009545 Ga0105237_10204606 Ga0105237_102046062 203
1327 3300009545 Ga0105237_10344557 Ga0105237_103445572 203
1328 3300009545 Ga0105237_10438742 Ga0105237_104387422 203
1329 3300009551 Ga0105238_10043372 Ga0105238_100433724 203
1330 3300009551 Ga0105238_10653993 Ga0105238_106539932 203
1331 3300010375 Ga0105239_10149118 Ga0105239_101491183 203
1332 3300010375 Ga0105239_10919427 Ga0105239_109194272 203
1333 3300011119 Ga0105246_10007753 Ga0105246_100077537 203
1334 3300011119 Ga0105246_10027028 Ga0105246_100270282 203
1335 3300013100 Ga0157373_10081266 Ga0157373_100812661 203
1336 3300013102 Ga0157371_10210416 Ga0157371_102104162 203
1337 3300013102 Ga0157371_10239732 Ga0157371_102397322 203
1338 3300013105 Ga0157369_10524039 Ga0157369_105240391 203
1339 3300013296 Ga0157374_10250450 Ga0157374_102504502 203
1340 3300013306 Ga0163162_10274159 Ga0163162_102741592 203
1341 3300013306 Ga0163162_10804391 Ga0163162_108043912 203
1342 3300013307 Ga0157372_10756611 Ga0157372_107566111 203
1343 3300013308 Ga0157375_10331077 Ga0157375_103310772 203
1344 3300014325 Ga0163163_10983240 Ga0163163_109832401 203
1345 3300014326 Ga0157380_10186851 Ga0157380_101868512 203
1346 3300014326 Ga0157380_10757753 Ga0157380_107577532 203
1347 3300014497 Ga0182008_10146591 Ga0182008_101465912 203
1348 3300014968 Ga0157379_10151951 Ga0157379_101519512 203
1349 3300014968 Ga0157379_10315686 Ga0157379_103156862 203
1350 3300015261 Ga0182006_1084032 Ga0182006_10840322 203
1351 3300015261 Ga0182006_1169356 Ga0182006_11693561 203
1352 3300015262 Ga0182007_10082253 Ga0182007_100822532 203
1353 3300017792 Ga0163161_10080831 Ga0163161_100808313 203
1354 3300020077 Ga0206351_10902505 Ga0206351_109025052 203
1355 3300020610 Ga0154015_1002009 Ga0154015_10020092 203
1356 3300021320 Ga0214544_1000003 Ga0214544_1000003131 203
1357 3300021321 Ga0214542_1000003 Ga0214542_1000003121 203
1358 3300021324 Ga0214545_1000004 Ga0214545_1000004134 203
1359 3300021327 Ga0214543_1000007 Ga0214543_1000007283 203
1360 3300021361 Ga0213872_10002369 Ga0213872_100023692 203
1361 3300021361 Ga0213872_10006716 Ga0213872_100067162 203
1362 3300025206 Ga0209435_100030 Ga0209435_100030143 203
1363 3300025206 Ga0209435_100134 Ga0209435_10013413 203
1364 3300025207 Ga0209760_104469 Ga0209760_1044692 203
1365 3300025224 Ga0209784_100004 Ga0209784_1000041259 203
1366 3300025225 Ga0209566_100004 Ga0209566_1000041416 203
1367 3300025226 Ga0209674_100006 Ga0209674_1000061416 203
1368 3300025229 Ga0209147_100159 Ga0209147_10015964 203
1369 3300025230 Ga0209563_100003 Ga0209563_1000031372 203
1370 3300025230 Ga0209563_100009 Ga0209563_1000091259 203
1371 3300025230 Ga0209563_103065 Ga0209563_1030653 203
1372 3300025231 Ga0207427_100291 Ga0207427_1002916 203
1373 3300025233 Ga0209437_100004 Ga0209437_1000041259 203
1374 3300025233 Ga0209437_100284 Ga0209437_10028456 203
1375 3300025242 Ga0209258_100259 Ga0209258_10025964 203
1376 3300025246 Ga0209646_1000057 Ga0209646_100005715 203
1377 3300025246 Ga0209646_1000100 Ga0209646_1000100143 203
1378 3300025250 Ga0209026_1000091 Ga0209026_100009113 203
1379 3300025250 Ga0209026_1003665 Ga0209026_10036656 203
1380 3300025253 Ga0209677_100005 Ga0209677_1000051259 203
1381 3300025253 Ga0209677_101412 Ga0209677_10141211 203
1382 3300025253 Ga0209677_102220 Ga0209677_1022203 203
1383 3300025254 Ga0209148_1000469 Ga0209148_10004693 203
1384 3300025254 Ga0209148_1000713 Ga0209148_10007134 203
1385 3300025256 Ga0209759_1000084 Ga0209759_1000084141 203
1386 3300025256 Ga0209759_1000141 Ga0209759_100014115 203
1387 3300025261 Ga0209233_1000005 Ga0209233_10000051416 203
1388 3300025261 Ga0209233_1000947 Ga0209233_10009477 203
1389 3300025261 Ga0209233_1002195 Ga0209233_10021954 203
1390 3300025261 Ga0209233_1006116 Ga0209233_10061162 203
1391 3300025272 Ga0209455_1001577 Ga0209455_10015772 203
1392 3300025272 Ga0209455_1011756 Ga0209455_10117562 203
1393 3300025284 Ga0209130_1000091 Ga0209130_1000091138 203
1394 3300025284 Ga0209130_1022442 Ga0209130_10224422 203
1395 3300025295 Ga0209564_1000105 Ga0209564_1000105106 203
1396 3300025295 Ga0209564_1005181 Ga0209564_10051812 203
1397 3300025297 Ga0209758_1000030 Ga0209758_1000030206 203
1398 3300025297 Ga0209758_1005701 Ga0209758_10057016 203
1399 3300025297 Ga0209758_1008706 Ga0209758_10087064 203
1400 3300025297 Ga0209758_1041709 Ga0209758_10417092 203
1401 3300025298 Ga0209050_1000010 Ga0209050_1000010175 203
1402 3300025298 Ga0209050_1001298 Ga0209050_10012982 203
1403 3300025299 Ga0209256_1015986 Ga0209256_10159862 203
1404 3300025299 Ga0209256_1068397 Ga0209256_10683972 203
1405 3300025302 Ga0207426_1000867 Ga0207426_10008672 203
1406 3300025302 Ga0207426_1003362 Ga0207426_10033625 203
1407 3300025302 Ga0207426_1004113 Ga0207426_10041136 203
1408 3300025302 Ga0207426_1022870 Ga0207426_10228702 203
1409 3300025303 Ga0209051_1000079 Ga0209051_1000079159 203
1410 3300025303 Ga0209051_1037249 Ga0209051_10372492 203
1411 3300025304 Ga0209257_1000009 Ga0209257_1000009940 203
1412 3300025304 Ga0209257_1000183 Ga0209257_1000183117 203
1413 3300025304 Ga0209257_1007671 Ga0209257_10076717 203
1414 3300025315 Ga0207697_10261889 Ga0207697_102618891 203
1415 3300025321 Ga0207656_10262018 Ga0207656_102620181 203
1416 3300025900 Ga0207710_10126461 Ga0207710_101264611 203
1417 3300025901 Ga0207688_10172919 Ga0207688_101729192 203
1418 3300025903 Ga0207680_10268774 Ga0207680_102687742 203
1419 3300025904 Ga0207647_10064254 Ga0207647_100642542 203
1420 3300025909 Ga0207705_10103787 Ga0207705_101037872 203
1421 3300025913 Ga0207695_10000065 Ga0207695_1000006532 203
1422 3300025913 Ga0207695_10002164 Ga0207695_1000216421 203
1423 3300025914 Ga0207671_10024760 Ga0207671_100247602 203
1424 3300025914 Ga0207671_10171071 Ga0207671_101710713 203
1425 3300025917 Ga0207660_10149706 Ga0207660_101497063 203
1426 3300025919 Ga0207657_10001513 Ga0207657_100015132 203
1427 3300025919 Ga0207657_10090077 Ga0207657_100900774 203
1428 3300025920 Ga0207649_10004570 Ga0207649_100045705 203
1429 3300025924 Ga0207694_10496103 Ga0207694_104961032 203
1430 3300025925 Ga0207650_10164114 Ga0207650_101641142 203
1431 3300025927 Ga0207687_10154026 Ga0207687_101540263 203
1432 3300025928 Ga0207700_10044632 Ga0207700_100446322 203
1433 3300025931 Ga0207644_10058919 Ga0207644_100589192 203
1434 3300025932 Ga0207690_10006363 Ga0207690_100063634 203
1435 3300025933 Ga0207706_10027920 Ga0207706_100279205 203
1436 3300025933 Ga0207706_10284962 Ga0207706_102849622 203
1437 3300025935 Ga0207709_10149916 Ga0207709_101499162 203
1438 3300025937 Ga0207669_10209768 Ga0207669_102097683 203
1439 3300025938 Ga0207704_10384880 Ga0207704_103848801 203
1440 3300025939 Ga0207665_10043512 Ga0207665_100435122 203
1441 3300025941 Ga0207711_10254811 Ga0207711_102548112 203
1442 3300025941 Ga0207711_10589405 Ga0207711_105894052 203
1443 3300025942 Ga0207689_10200239 Ga0207689_102002392 203
1444 3300025944 Ga0207661_10626860 Ga0207661_106268602 203
1445 3300025945 Ga0207679_10009005 Ga0207679_100090057 203
1446 3300025945 Ga0207679_10417759 Ga0207679_104177592 203
1447 3300025949 Ga0207667_10004822 Ga0207667_100048222 203
1448 3300025949 Ga0207667_10117392 Ga0207667_101173924 203
1449 3300025949 Ga0207667_10682750 Ga0207667_106827501 203
1450 3300025972 Ga0207668_10128589 Ga0207668_101285893 203
1451 3300025972 Ga0207668_10160859 Ga0207668_101608593 203
1452 3300025981 Ga0207640_10585050 Ga0207640_105850502 203
1453 3300025986 Ga0207658_10331487 Ga0207658_103314871 203
1454 3300026023 Ga0207677_10200847 Ga0207677_102008471 203
1455 3300026023 Ga0207677_10253538 Ga0207677_102535381 203
1456 3300026035 Ga0207703_10313635 Ga0207703_103136353 203
1457 3300026067 Ga0207678_10006072 Ga0207678_100060725 203
1458 3300026067 Ga0207678_10561744 Ga0207678_105617442 203
1459 3300026078 Ga0207702_10223950 Ga0207702_102239502 203
1460 3300026078 Ga0207702_10231695 Ga0207702_102316952 203
1461 3300026078 Ga0207702_10421046 Ga0207702_104210462 203
1462 3300026088 Ga0207641_10089355 Ga0207641_100893554 203
1463 3300026095 Ga0207676_10141303 Ga0207676_101413032 203
1464 3300026116 Ga0207674_10208941 Ga0207674_102089412 203
1465 3300026118 Ga0207675_100058883 Ga0207675_1000588834 203
1466 3300026142 Ga0207698_10240267 Ga0207698_102402672 203
1467 3300026142 Ga0207698_10314308 Ga0207698_103143081 203
1468 3300026142 Ga0207698_10404100 Ga0207698_104041002 203
1469 3300027296 Ga0209389_1000015 Ga0209389_100001513 203
1470 3300027296 Ga0209389_1000035 Ga0209389_100003510 203
1471 3300027312 Ga0209371_1012016 Ga0209371_10120162 203
1472 3300027357 Ga0209589_1000039 Ga0209589_100003910 203
1473 3300027357 Ga0209589_1001702 Ga0209589_100170221 203
1474 3300027361 Ga0209489_100084 Ga0209489_10008410 203
1475 3300027361 Ga0209489_102545 Ga0209489_10254521 203
1476 3300027361 Ga0209489_102940 Ga0209489_10294028 203
1477 3300027363 Ga0209700_100034 Ga0209700_100034172 203
1478 3300027363 Ga0209700_102508 Ga0209700_10250821 203
1479 3300027866 Ga0209813_10028858 Ga0209813_100288582 203
1480 3300027876 Ga0209974_10007608 Ga0209974_100076082 203
1481 3300028379 Ga0268266_10073490 Ga0268266_100734902 203
1482 3300028379 Ga0268266_10179679 Ga0268266_101796792 203
1483 3300028379 Ga0268266_10223592 Ga0268266_102235922 203
1484 3300028379 Ga0268266_10423305 Ga0268266_104233052 203
1485 3300028379 Ga0268266_10487687 Ga0268266_104876872 203
1486 3300028379 Ga0268266_10691058 Ga0268266_106910582 203
1487 3300028381 Ga0268264_10238969 Ga0268264_102389692 203
1488 3300030500 Ga0268256_1013440 Ga0268256_10134403 203
1489 3300030522 Ga0307512_10153599 Ga0307512_101535992 203
1490 3300031548 Ga0307408_100112933 Ga0307408_1001129333 203
1491 3300031616 Ga0307508_10210873 Ga0307508_102108732 203
1492 3300031731 Ga0307405_10199889 Ga0307405_101998892 203
1493 3300031824 Ga0307413_10078219 Ga0307413_100782192 203
1494 3300031824 Ga0307413_10115624 Ga0307413_101156243 203
1495 3300031852 Ga0307410_10054455 Ga0307410_100544552 203
1496 3300031901 Ga0307406_10145912 Ga0307406_101459122 203
1497 3300031995 Ga0307409_100070215 Ga0307409_1000702154 203
1498 3300032002 Ga0307416_100013447 Ga0307416_1000134473 203
1499 3300032005 Ga0307411_10081511 Ga0307411_100815111 203
1500 3300032005 Ga0307411_10085193 Ga0307411_100851932 203
1501 3300032126 Ga0307415_100043727 Ga0307415_1000437273 203
1502 3300033180 Ga0307510_10210258 Ga0307510_102102582 203
1503 3300033442 Ga0315911_1000042 Ga0315911_100004223 203
1504 3300037312 Ga0395899_0000072 Ga0395899_0000072_164031_164663 203
1505 3300037312 Ga0395899_0001880 Ga0395899_0001880_14932_15567 203
1506 3300037312 Ga0395899_0003332 Ga0395899_0003332_2679_3323 203
1507 3300037312 Ga0395899_0013246 Ga0395899_0013246_4062_4697 203
1508 3300037312 Ga0395899_0052313 Ga0395899_0052313_1651_2286 203
1509 3300037312 Ga0395899_0238442 Ga0395899_0238442_54_689 203
1510 3300037418 Ga0395900_0000924 Ga0395900_0000924_32954_33583 203
1511 3300037418 Ga0395900_0021562 Ga0395900_0021562_69_704 203
1512 3300037418 Ga0395900_0023664 Ga0395900_0023664_1178_1804 203
1513 3300037418 Ga0395900_0038772 Ga0395900_0038772_3819_4454 203
1514 3300037418 Ga0395900_0052284 Ga0395900_0052284_2898_3533 203
1515 3300037418 Ga0395900_0066109 Ga0395900_0066109_325_954 203
1516 3300037418 Ga0395900_0315705 Ga0395900_0315705_566_1195 203
1517 3300037418 Ga0395900_0622074 Ga0395900_0622074_324_959 203
1518 3300037466 Ga0395898_0000029 Ga0395898_0000029_246339_246971 203
1519 3300037466 Ga0395898_0016060 Ga0395898_0016060_1661_2290 203
1520 3300037466 Ga0395898_0107864 Ga0395898_0107864_304_939 203
1521 3300037466 Ga0395898_0268994 Ga0395898_0268994_669_1304 203
1522 3300037466 Ga0395898_0972125 Ga0395898_0972125_106_732 203
1523 3300037471 Ga0395905_0039761 Ga0395905_0039761_854_1489 203
1524 3300037471 Ga0395905_0117332 Ga0395905_0117332_459_1088 203
1525 3300037471 Ga0395905_0146898 Ga0395905_0146898_933_1577 203
1526 3300037471 Ga0395905_0160959 Ga0395905_0160959_1253_1882 203
1527 3300037471 Ga0395905_0395987 Ga0395905_0395987_352_987 203
1528 3300037853 Ga0436364_0098754 Ga0436364_0098754_150_785 203
1529 3300038443 Ga0395901_0000094 Ga0395901_0000094_1426_2061 203
1530 3300038443 Ga0395901_0151178 Ga0395901_0151178_631_1266 203
1531 3300038443 Ga0395901_0214429 Ga0395901_0214429_750_1385 203
1532 3300038443 Ga0395901_0280121 Ga0395901_0280121_223_852 203
1533 3300038443 Ga0395901_0985382 Ga0395901_0985382_125_760 203
1534 3300039437 Ga0436365_0955522 Ga0436365_0955522_1201_1830 203
1535 3300039438 Ga0436360_0065549 Ga0436360_0065549_116_745 203
1536 3300039447 Ga0436361_0148264 Ga0436361_0148264_128_760 203
1537 3300039447 Ga0436361_0400142 Ga0436361_0400142_880_1509 203
1538 3300039447 Ga0436361_0527052 Ga0436361_0527052_398_1030 203
1539 3300039447 Ga0436361_0529332 Ga0436361_0529332_99463_100095 203
1540 3300039447 Ga0436361_0767394 Ga0436361_0767394_8881_9516 203
1541 3300039447 Ga0436361_0875320 Ga0436361_0875320_91_720 203
1542 3300039453 Ga0436362_0848885 Ga0436362_0848885_1248_1877 203
1543 3300041413 Ga0439465_0119740 Ga0439465_0119740_65_694 203
1544 3300041453 Ga0451797_1114440 Ga0451797_1114440_42_671 203
1545 3300041501 Ga0451845_0384880 Ga0451845_0384880_294_923 203
1546 3300042005 Ga0439448_0043264 Ga0439448_0043264_630_1265 203
1547 3300042007 Ga0439449_0007437 Ga0439449_0007437_1190_1825 203
1548 3300042532 Ga0450893_0010128 Ga0450893_0010128_888_1523 203
1549 3300044656 Ga0466969_0008117 Ga0466969_0008117_4767_5402 203
1550 3300044658 Ga0466972_0006287 Ga0466972_0006287_4209_4838 203
1551 3300044658 Ga0466972_0019770 Ga0466972_0019770_184_813 203
1552 3300044683 Ga0466965_0052707 Ga0466965_0052707_381_1010 203
1553 3300044684 Ga0466966_0004124 Ga0466966_0004124_5741_6376 203
1554 3300044684 Ga0466966_0026747 Ga0466966_0026747_2385_3014 203
1555 3300044684 Ga0466966_0105461 Ga0466966_0105461_161_790 203
1556 3300044693 Ga0466961_0001449 Ga0466961_0001449_9935_10564 203
1557 3300044693 Ga0466961_0012413 Ga0466961_0012413_1314_1949 203
1558 3300044693 Ga0466961_0036026 Ga0466961_0036026_1237_1872 203
1559 3300044693 Ga0466961_0049510 Ga0466961_0049510_248_880 203
1560 3300044706 Ga0466964_0178396 Ga0466964_0178396_23_652 203
1561 3300044706 Ga0466964_0216881 Ga0466964_0216881_60_704 203
1562 3300044719 Ga0466971_0112511 Ga0466971_0112511_474_1115 203
1563 3300044735 Ga0466968_0003118 Ga0466968_0003118_5053_5682 203
1564 3300044735 Ga0466968_0235459 Ga0466968_0235459_213_845 203
1565 3300044765 Ga0466970_0070452 Ga0466970_0070452_234_869 203
1566 3300044765 Ga0466970_0161637 Ga0466970_0161637_179_808 203
1567 3300044901 Ga0466960_0007309 Ga0466960_0007309_413_1042 203
1568 3300044901 Ga0466960_0058914 Ga0466960_0058914_1158_1787 203
1569 3300045049 Ga0466959_0003192 Ga0466959_0003192_9913_10542 203
1570 3300045049 Ga0466959_0122278 Ga0466959_0122278_331_966 203
1571 3300045836 Ga0466958_0128508 Ga0466958_0128508_89_724 203
1572 3300045976 Ga0466967_0275595 Ga0466967_0275595_540_1166 203
1573 3300045976 Ga0466967_0960965 Ga0466967_0960965_101_736 203
1574 3300046454 Ga0495592_0031501 Ga0495592_0031501_411_1043 203
1575 3300046454 Ga0495592_0036030 Ga0495592_0036030_610_1239 203
1576 3300046454 Ga0495592_0177494 Ga0495592_0177494_49_678 203
1577 3300046457 Ga0495590_0000015 Ga0495590_0000015_1694_2329 203
1578 3300046458 Ga0495591_000033 Ga0495591_000033_169673_170308 203
1579 3300046459 Ga0495629_0008209 Ga0495629_0008209_773_1402 203
1580 3300046459 Ga0495629_0019543 Ga0495629_0019543_2744_3379 203
1581 3300046459 Ga0495629_0450367 Ga0495629_0450367_68_703 203
1582 3300046460 Ga0495638_0063671 Ga0495638_0063671_824_1453 203
1583 3300046462 Ga0495651_0017763 Ga0495651_0017763_4234_4863 203
1584 3300046463 Ga0495653_0125769 Ga0495653_0125769_1130_1759 203
1585 3300046463 Ga0495653_0157219 Ga0495653_0157219_615_1244 203
1586 3300046471 Ga0495650_0051503 Ga0495650_0051503_423_1052 203
1587 3300046474 Ga0495605_0012201 Ga0495605_0012201_826_1461 203
1588 3300046474 Ga0495605_0044904 Ga0495605_0044904_765_1400 203
1589 3300046474 Ga0495605_0063636 Ga0495605_0063636_609_1244 203
1590 3300046476 Ga0495662_0006436 Ga0495662_0006436_1013_1645 203
1591 3300046476 Ga0495662_0079851 Ga0495662_0079851_182_811 203
1592 3300046477 Ga0495664_0013389 Ga0495664_0013389_3581_4210 203
1593 3300046491 Ga0495584_0009878 Ga0495584_0009878_3462_4097 203
1594 3300046491 Ga0495584_0030302 Ga0495584_0030302_1314_1949 203
1595 3300046491 Ga0495584_0102022 Ga0495584_0102022_23_658 203
1596 3300046492 Ga0495585_0000257 Ga0495585_0000257_52272_52907 203
1597 3300046492 Ga0495585_0001214 Ga0495585_0001214_19348_19983 203
1598 3300046492 Ga0495585_0002716 Ga0495585_0002716_758_1393 203
1599 3300046492 Ga0495585_0010377 Ga0495585_0010377_888_1523 203
1600 3300046492 Ga0495585_0025158 Ga0495585_0025158_793_1428 203
1601 3300046492 Ga0495585_0079938 Ga0495585_0079938_105_740 203
1602 3300046500 Ga0495596_0007208 Ga0495596_0007208_1733_2368 203
1603 3300046500 Ga0495596_0008610 Ga0495596_0008610_1120_1755 203
1604 3300046500 Ga0495596_0018900 Ga0495596_0018900_585_1220 203
1605 3300046500 Ga0495596_0023216 Ga0495596_0023216_1280_1915 203
1606 3300046500 Ga0495596_0028066 Ga0495596_0028066_596_1231 203
1607 3300046500 Ga0495596_0032470 Ga0495596_0032470_937_1572 203
1608 3300046501 Ga0495607_0000878 Ga0495607_0000878_23322_23957 203
1609 3300046501 Ga0495607_0039809 Ga0495607_0039809_1376_2011 203
1610 3300046501 Ga0495607_0059530 Ga0495607_0059530_944_1579 203
1611 3300046501 Ga0495607_0224376 Ga0495607_0224376_152_781 203
1612 3300046501 Ga0495607_0234601 Ga0495607_0234601_53_688 203
1613 3300046506 Ga0495583_0000003 Ga0495583_0000003_1263_1901 203
1614 3300046506 Ga0495583_0000030 Ga0495583_0000030_172380_173009 203
1615 3300046506 Ga0495583_0000040 Ga0495583_0000040_199715_200350 203
1616 3300046506 Ga0495583_0000394 Ga0495583_0000394_65933_66568 203
1617 3300046506 Ga0495583_0001793 Ga0495583_0001793_18814_19449 203
1618 3300046506 Ga0495583_0003643 Ga0495583_0003643_10131_10766 203
1619 3300046506 Ga0495583_0043475 Ga0495583_0043475_1427_2062 203
1620 3300046506 Ga0495583_0098702 Ga0495583_0098702_540_1175 203
1621 3300046507 Ga0495606_0001435 Ga0495606_0001435_26996_27631 203
1622 3300046507 Ga0495606_0032515 Ga0495606_0032515_2085_2720 203
1623 3300046507 Ga0495606_0047202 Ga0495606_0047202_1038_1673 203
1624 3300046507 Ga0495606_0055753 Ga0495606_0055753_538_1167 203
1625 3300046507 Ga0495606_0194980 Ga0495606_0194980_261_896 203
1626 3300046511 Ga0495608_0044623 Ga0495608_0044623_1470_2099 203
1627 3300046512 Ga0495610_0003833 Ga0495610_0003833_9778_10413 203
1628 3300046512 Ga0495610_0082625 Ga0495610_0082625_119_748 203
1629 3300046513 Ga0495616_0014710 Ga0495616_0014710_735_1370 203
1630 3300046513 Ga0495616_0028263 Ga0495616_0028263_469_1104 203
1631 3300046513 Ga0495616_0051030 Ga0495616_0051030_1070_1705 203
1632 3300046513 Ga0495616_0069287 Ga0495616_0069287_695_1330 203
1633 3300046513 Ga0495616_0105506 Ga0495616_0105506_626_1261 203
1634 3300046513 Ga0495616_0120699 Ga0495616_0120699_387_1016 203
1635 3300046518 Ga0495631_0003448 Ga0495631_0003448_7225_7860 203
1636 3300046518 Ga0495631_0008206 Ga0495631_0008206_1565_2200 203
1637 3300046518 Ga0495631_0042117 Ga0495631_0042117_628_1263 203
1638 3300046519 Ga0495632_0002772 Ga0495632_0002772_727_1362 203
1639 3300046520 Ga0495637_0000002 Ga0495637_0000002_276537_277172 203
1640 3300046522 Ga0495643_0017910 Ga0495643_0017910_2793_3428 203
1641 3300046522 Ga0495643_0061242 Ga0495643_0061242_615_1244 203
1642 3300046522 Ga0495643_0081910 Ga0495643_0081910_244_879 203
1643 3300046522 Ga0495643_0093522 Ga0495643_0093522_125_760 203
1644 3300046523 Ga0495644_0003946 Ga0495644_0003946_4403_5038 203
1645 3300046523 Ga0495644_0010279 Ga0495644_0010279_2219_2854 203
1646 3300046523 Ga0495644_0024506 Ga0495644_0024506_1336_1971 203
1647 3300046523 Ga0495644_0028055 Ga0495644_0028055_887_1522 203
1648 3300046524 Ga0495648_0015811 Ga0495648_0015811_4007_4642 203
1649 3300046525 Ga0495663_0131556 Ga0495663_0131556_168_803 203
1650 3300046528 Ga0495642_0012471 Ga0495642_0012471_1938_2573 203
1651 3300046528 Ga0495642_0024775 Ga0495642_0024775_26_661 203
1652 3300046528 Ga0495642_0059901 Ga0495642_0059901_702_1337 203
1653 3300046528 Ga0495642_0099188 Ga0495642_0099188_578_1213 203
1654 3300046528 Ga0495642_0127436 Ga0495642_0127436_293_922 203
1655 3300046528 Ga0495642_0129904 Ga0495642_0129904_360_995 203
1656 3300046528 Ga0495642_0153059 Ga0495642_0153059_283_918 203
1657 3300046529 Ga0495652_0004750 Ga0495652_0004750_758_1402 203
1658 3300046529 Ga0495652_0030167 Ga0495652_0030167_537_1166 203
1659 3300046529 Ga0495652_0288336 Ga0495652_0288336_306_938 203
1660 3300046530 Ga0495654_0041482 Ga0495654_0041482_1046_1681 203
1661 3300046538 Ga0495609_0000001 Ga0495609_0000001_814863_815498 203
1662 3300046538 Ga0495609_0000797 Ga0495609_0000797_22001_22636 203
1663 3300046538 Ga0495609_0002271 Ga0495609_0002271_10342_10977 203
1664 3300046538 Ga0495609_0009546 Ga0495609_0009546_3240_3875 203
1665 3300046538 Ga0495609_0018625 Ga0495609_0018625_1699_2328 203
1666 3300046538 Ga0495609_0032303 Ga0495609_0032303_766_1401 203
1667 3300046542 Ga0495597_0000953 Ga0495597_0000953_21146_21781 203
1668 3300046542 Ga0495597_0034159 Ga0495597_0034159_1308_1937 203
1669 3300046542 Ga0495597_0050935 Ga0495597_0050935_793_1428 203
1670 3300046543 Ga0495645_0050937 Ga0495645_0050937_1591_2226 203
1671 3300046543 Ga0495645_0143462 Ga0495645_0143462_718_1347 203
1672 3300046543 Ga0495645_0161784 Ga0495645_0161784_60_695 203
1673 3300046557 Ga0495622_0005869 Ga0495622_0005869_2795_3430 203
1674 3300046557 Ga0495622_0181923 Ga0495622_0181923_244_879 203
1675 3300046558 Ga0495633_0017595 Ga0495633_0017595_702_1337 203
1676 3300046558 Ga0495633_0176259 Ga0495633_0176259_183_818 203
1677 3300046559 Ga0495667_0101333 Ga0495667_0101333_809_1438 203
1678 3300046616 Ga0495668_0000020 Ga0495668_0000020_72569_73204 203
1679 3300046616 Ga0495668_0000706 Ga0495668_0000706_503_1138 203
1680 3300046616 Ga0495668_0005244 Ga0495668_0005244_7405_8040 203
1681 3300046616 Ga0495668_0008275 Ga0495668_0008275_793_1428 203
1682 3300046616 Ga0495668_0020567 Ga0495668_0020567_416_1051 203
1683 3300046616 Ga0495668_0052133 Ga0495668_0052133_1307_1936 203
1684 3300046616 Ga0495668_0070933 Ga0495668_0070933_515_1150 203
1685 3300046642 Ga0495634_0091285 Ga0495634_0091285_680_1309 203
1686 3300046648 Ga0495611_0000587 Ga0495611_0000587_758_1393 203
1687 3300046648 Ga0495611_0006948 Ga0495611_0006948_801_1436 203
1688 3300046648 Ga0495611_0009748 Ga0495611_0009748_758_1393 203
1689 3300046648 Ga0495611_0036569 Ga0495611_0036569_422_1051 203
1690 3300046660 Ga0495625_0001675 Ga0495625_0001675_905_1540 203
1691 3300046660 Ga0495625_0008625 Ga0495625_0008625_2948_3583 203
1692 3300046663 Ga0495635_0017175 Ga0495635_0017175_2633_3262 203
1693 3300046663 Ga0495635_0159597 Ga0495635_0159597_599_1228 203
1694 3300046663 Ga0495635_0189618 Ga0495635_0189618_402_1034 203
1695 3300046664 Ga0495659_0003273 Ga0495659_0003273_3722_4357 203
1696 3300046664 Ga0495659_0013187 Ga0495659_0013187_1367_2002 203
1697 3300046665 Ga0495661_0000175 Ga0495661_0000175_72335_72970 203
1698 3300046665 Ga0495661_0000260 Ga0495661_0000260_59377_60012 203
1699 3300046665 Ga0495661_0000958 Ga0495661_0000958_24868_25506 203
1700 3300046665 Ga0495661_0001726 Ga0495661_0001726_16264_16899 203
1701 3300046665 Ga0495661_0024480 Ga0495661_0024480_403_1038 203
1702 3300046665 Ga0495661_0025742 Ga0495661_0025742_2553_3188 203
1703 3300046665 Ga0495661_0056836 Ga0495661_0056836_686_1321 203
1704 3300046665 Ga0495661_0090893 Ga0495661_0090893_494_1129 203
1705 3300046665 Ga0495661_0094681 Ga0495661_0094681_234_869 203
1706 3300046665 Ga0495661_0100933 Ga0495661_0100933_189_824 203
1707 3300046665 Ga0495661_0141606 Ga0495661_0141606_245_880 203
1708 3300046674 Ga0495588_0000095 Ga0495588_0000095_174056_174691 203
1709 3300046674 Ga0495588_0082937 Ga0495588_0082937_576_1211 203
1710 3300046674 Ga0495588_0140787 Ga0495588_0140787_13_648 203
1711 3300046674 Ga0495588_0155849 Ga0495588_0155849_442_1077 203
1712 3300046675 Ga0495657_0119815 Ga0495657_0119815_424_1053 203
1713 3300046675 Ga0495657_0121914 Ga0495657_0121914_871_1500 203
1714 3300046679 Ga0495623_0030775 Ga0495623_0030775_1310_1954 203
1715 3300046679 Ga0495623_0038134 Ga0495623_0038134_115_744 203
1716 3300046679 Ga0495623_0140420 Ga0495623_0140420_534_1169 203
1717 3300046680 Ga0495646_0008158 Ga0495646_0008158_1089_1724 203
1718 3300046680 Ga0495646_0092665 Ga0495646_0092665_987_1622 203
1719 3300046680 Ga0495646_0184574 Ga0495646_0184574_354_986 203
1720 3300046684 Ga0495669_0000029 Ga0495669_0000029_945_1580 203
1721 3300046684 Ga0495669_0042896 Ga0495669_0042896_381_1016 203
1722 3300046684 Ga0495669_0043860 Ga0495669_0043860_694_1329 203
1723 3300046689 Ga0495613_0031974 Ga0495613_0031974_1501_2130 203
1724 3300046690 Ga0495624_0156792 Ga0495624_0156792_271_900 203
1725 3300046691 Ga0495670_0005938 Ga0495670_0005938_2432_3067 203
1726 3300046691 Ga0495670_0032783 Ga0495670_0032783_1507_2142 203
1727 3300046691 Ga0495670_0052672 Ga0495670_0052672_386_1015 203
1728 3300046691 Ga0495670_0090186 Ga0495670_0090186_528_1163 203
1729 3300046691 Ga0495670_0190397 Ga0495670_0190397_342_968 203
1730 3300046692 Ga0495671_0001441 Ga0495671_0001441_14844_15479 203
1731 3300046692 Ga0495671_0103059 Ga0495671_0103059_422_1051 203
1732 3300046694 Ga0495649_0000024 Ga0495649_0000024_174136_174771 203
1733 3300046694 Ga0495649_0000949 Ga0495649_0000949_21350_21985 203
1734 3300046694 Ga0495649_0007477 Ga0495649_0007477_904_1539 203
1735 3300046694 Ga0495649_0089086 Ga0495649_0089086_483_1118 203
1736 3300046694 Ga0495649_0128881 Ga0495649_0128881_679_1314 203
1737 3300046794 Ga0495589_0000029 Ga0495589_0000029_1711_2346 203
1738 3300046794 Ga0495589_0084906 Ga0495589_0084906_346_981 203
1739 3300046794 Ga0495589_0125935 Ga0495589_0125935_170_799 203
1740 3300046809 Ga0495600_0009990 Ga0495600_0009990_581_1210 203
1741 3300046810 Ga0495660_0023108 Ga0495660_0023108_814_1449 203
1742 3300046810 Ga0495660_0104290 Ga0495660_0104290_191_826 203
1743 3300046810 Ga0495660_0129342 Ga0495660_0129342_516_1151 203
1744 3300047315 Ga0495581_0108066 Ga0495581_0108066_968_1597 203
1745 3300047317 Ga0495604_0011368 Ga0495604_0011368_6129_6758 203
1746 3300047317 Ga0495604_0044464 Ga0495604_0044464_617_1246 203
1747 3300047318 Ga0495636_0004169 Ga0495636_0004169_2265_2900 203
1748 3300047319 Ga0495674_0022726 Ga0495674_0022726_4160_4789 203
1749 3300047319 Ga0495674_0023350 Ga0495674_0023350_4951_5586 203
1750 3300047320 Ga0495672_0000065 Ga0495672_0000065_192146_192781 203
1751 3300047320 Ga0495672_0003913 Ga0495672_0003913_11124_11759 203
1752 3300047320 Ga0495672_0039384 Ga0495672_0039384_611_1246 203
1753 3300047321 Ga0495676_0035737 Ga0495676_0035737_2618_3247 203
1754 3300047322 Ga0495680_0007641 Ga0495680_0007641_8572_9201 203
1755 3300047323 Ga0495683_0043790 Ga0495683_0043790_710_1345 203
1756 3300047443 Ga0495687_000003 Ga0495687_000003_685303_685938 203
1757 3300047443 Ga0495687_000007 Ga0495687_000007_163055_163690 203
1758 3300047443 Ga0495687_055012 Ga0495687_055012_291_920 203
1759 3300047444 Ga0495675_0010586 Ga0495675_0010586_4734_5363 203
1760 3300047444 Ga0495675_0049987 Ga0495675_0049987_1511_2146 203
1761 3300047445 Ga0495677_0000001 Ga0495677_0000001_473216_473851 203
1762 3300047445 Ga0495677_0003998 Ga0495677_0003998_4125_4763 203
1763 3300047445 Ga0495677_0010819 Ga0495677_0010819_984_1619 203
1764 3300047445 Ga0495677_0021902 Ga0495677_0021902_740_1375 203
1765 3300047445 Ga0495677_0024390 Ga0495677_0024390_248_883 203
1766 3300047445 Ga0495677_0052254 Ga0495677_0052254_378_1013 203
1767 3300047447 Ga0495685_006685 Ga0495685_006685_2420_3055 203
1768 3300047447 Ga0495685_015439 Ga0495685_015439_627_1262 203
1769 3300047447 Ga0495685_022408 Ga0495685_022408_625_1260 203
1770 3300047447 Ga0495685_033775 Ga0495685_033775_889_1524 203
1771 3300047447 Ga0495685_068076 Ga0495685_068076_321_968 203
1772 3300047469 Ga0495673_0007850 Ga0495673_0007850_1978_2613 203
1773 3300047469 Ga0495673_0013927 Ga0495673_0013927_2714_3343 203
1774 3300047469 Ga0495673_0116820 Ga0495673_0116820_24_653 203
1775 3300047469 Ga0495673_0118252 Ga0495673_0118252_35_664 203
1776 3300047470 Ga0495681_0000482 Ga0495681_0000482_29139_29774 203
1777 3300047470 Ga0495681_0028301 Ga0495681_0028301_748_1383 203
1778 3300047470 Ga0495681_0041280 Ga0495681_0041280_896_1531 203
1779 3300047470 Ga0495681_0079263 Ga0495681_0079263_382_1017 203
1780 3300047472 Ga0495686_0000015 Ga0495686_0000015_334406_335041 203
1781 3300047472 Ga0495686_0000344 Ga0495686_0000344_36384_37019 203
1782 3300047472 Ga0495686_0000520 Ga0495686_0000520_1016_1651 203
1783 3300047472 Ga0495686_0022030 Ga0495686_0022030_3086_3721 203
1784 3300047472 Ga0495686_0119271 Ga0495686_0119271_840_1475 203
1785 3300048088 Ga0495602_0013736 Ga0495602_0013736_6956_7585 203
1786 3300048088 Ga0495602_0057953 Ga0495602_0057953_2129_2758 203
1787 3300048088 Ga0495602_0266486 Ga0495602_0266486_584_1216 203
1788 3300048088 Ga0495602_0266857 Ga0495602_0266857_324_959 203
1789 3300048091 Ga0495626_0005337 Ga0495626_0005337_758_1393 203
1790 3300048091 Ga0495626_0005378 Ga0495626_0005378_1290_1925 203
1791 3300048091 Ga0495626_0023251 Ga0495626_0023251_815_1450 203
1792 3300048091 Ga0495626_0027729 Ga0495626_0027729_1396_2031 203
1793 3300048091 Ga0495626_0032025 Ga0495626_0032025_206_841 203
1794 3300048091 Ga0495626_0035014 Ga0495626_0035014_648_1283 203
1795 3300048091 Ga0495626_0042843 Ga0495626_0042843_758_1393 203
1796 3300048091 Ga0495626_0051328 Ga0495626_0051328_419_1054 203
1797 3300048091 Ga0495626_0079543 Ga0495626_0079543_735_1370 203
1798 3300048903 Ga0496100_0069046 Ga0496100_0069046_1089_1718 203
1799 3300048903 Ga0496100_0241635 Ga0496100_0241635_364_999 203
1800 3300048903 Ga0496100_0376898 Ga0496100_0376898_339_974 203
1801 3300048904 Ga0496101_0034931 Ga0496101_0034931_334_969 203
1802 3300048905 Ga0496102_0074295 Ga0496102_0074295_1542_2159 203
1803 3300048905 Ga0496102_0243291 Ga0496102_0243291_965_1600 203
1804 3300048906 Ga0496103_0009377 Ga0496103_0009377_4956_5573 203
1805 3300048906 Ga0496103_0016108 Ga0496103_0016108_2881_3510 203
1806 3300048906 Ga0496103_0160959 Ga0496103_0160959_345_980 203
1807 3300048907 Ga0496104_0138222 Ga0496104_0138222_821_1450 203
1808 3300048907 Ga0496104_0290097 Ga0496104_0290097_896_1525 203
1809 3300048908 Ga0496105_0029522 Ga0496105_0029522_950_1579 203
1810 3300048908 Ga0496105_0123582 Ga0496105_0123582_595_1224 203
1811 3300048908 Ga0496105_0223293 Ga0496105_0223293_164_805 203
1812 3300048909 Ga0496106_0117909 Ga0496106_0117909_1381_2010 203
1813 3300048909 Ga0496106_0162547 Ga0496106_0162547_651_1280 203
1814 3300048910 Ga0496107_0080294 Ga0496107_0080294_784_1413 203
1815 3300048910 Ga0496107_0142831 Ga0496107_0142831_226_861 203
1816 3300048911 Ga0496108_0078835 Ga0496108_0078835_1445_2074 203
1817 3300048911 Ga0496108_0449408 Ga0496108_0449408_113_748 203
1818 3300048911 Ga0496108_0669682 Ga0496108_0669682_207_842 203
1819 3300048912 Ga0496109_0143121 Ga0496109_0143121_1167_1796 203
1820 3300048913 Ga0496110_0000002 Ga0496110_0000002_164953_165588 203
1821 3300048913 Ga0496110_0378321 Ga0496110_0378321_330_965 203
1822 3300048915 Ga0496112_0114560 Ga0496112_0114560_869_1498 203
1823 3300048915 Ga0496112_0356446 Ga0496112_0356446_691_1320 203
1824 3300048916 Ga0496113_0030074 Ga0496113_0030074_441_1070 203
1825 3300048916 Ga0496113_0063529 Ga0496113_0063529_828_1463 203
1826 3300048916 Ga0496113_0200181 Ga0496113_0200181_193_822 203
1827 3300048917 Ga0496114_0124653 Ga0496114_0124653_1178_1807 203
1828 3300048918 Ga0496115_0026627 Ga0496115_0026627_686_1321 203
1829 3300048918 Ga0496115_0084493 Ga0496115_0084493_1205_1834 203
1830 3300048918 Ga0496115_0106356 Ga0496115_0106356_677_1306 203
1831 3300048919 Ga0496116_0046692 Ga0496116_0046692_1676_2320 203
1832 3300048919 Ga0496116_0064356 Ga0496116_0064356_1222_1857 203
1833 3300048919 Ga0496116_0077051 Ga0496116_0077051_526_1167 203
1834 3300048919 Ga0496116_0124461 Ga0496116_0124461_70_699 203
1835 3300048921 Ga0496118_0032545 Ga0496118_0032545_2086_2727 203
1836 3300048921 Ga0496118_0122402 Ga0496118_0122402_396_1037 203
1837 3300048922 Ga0496119_0020076 Ga0496119_0020076_1494_2135 203
1838 3300048922 Ga0496119_0029331 Ga0496119_0029331_2125_2754 203
1839 3300048922 Ga0496119_0089585 Ga0496119_0089585_616_1245 203
1840 3300048923 Ga0496120_0027674 Ga0496120_0027674_754_1383 203
1841 3300048923 Ga0496120_0052254 Ga0496120_0052254_1419_2060 203
1842 3300048924 Ga0496121_0000091 Ga0496121_0000091_149686_150315 203
1843 3300048924 Ga0496121_0000296 Ga0496121_0000296_92261_92890 203
1844 3300048924 Ga0496121_0000706 Ga0496121_0000706_17478_18119 203
1845 3300048924 Ga0496121_0006917 Ga0496121_0006917_3904_4533 203
1846 3300048924 Ga0496121_0015919 Ga0496121_0015919_1993_2622 203
1847 3300048924 Ga0496121_0028121 Ga0496121_0028121_3715_4350 203
1848 3300048924 Ga0496121_0090438 Ga0496121_0090438_59_688 203
1849 3300048924 Ga0496121_0297443 Ga0496121_0297443_52_681 203
1850 3300048925 Ga0496122_0000047 Ga0496122_0000047_132527_133168 203
1851 3300048925 Ga0496122_0000567 Ga0496122_0000567_1441_2076 203
1852 3300048925 Ga0496122_0000748 Ga0496122_0000748_45262_45897 203
1853 3300048925 Ga0496122_0009891 Ga0496122_0009891_860_1495 203
1854 3300048926 Ga0496123_0000077 Ga0496123_0000077_89534_90175 203
1855 3300048926 Ga0496123_0001196 Ga0496123_0001196_17395_18030 203
1856 3300048926 Ga0496123_0001251 Ga0496123_0001251_786_1421 203
1857 3300048926 Ga0496123_0157369 Ga0496123_0157369_240_881 203
1858 3300048927 Ga0496124_0019697 Ga0496124_0019697_639_1274 203
1859 3300048927 Ga0496124_0047180 Ga0496124_0047180_269_910 203
1860 3300048927 Ga0496124_0146922 Ga0496124_0146922_785_1414 203
1861 3300048927 Ga0496124_0225289 Ga0496124_0225289_658_1293 203
1862 3300048927 Ga0496124_0329579 Ga0496124_0329579_385_1020 203
1863 3300048928 Ga0496125_0000957 Ga0496125_0000957_10695_11336 203
1864 3300048928 Ga0496125_0000959 Ga0496125_0000959_1740_2375 203
1865 3300048928 Ga0496125_0009147 Ga0496125_0009147_100_744 203
1866 3300048928 Ga0496125_0056991 Ga0496125_0056991_2258_2893 203
1867 3300048928 Ga0496125_0139976 Ga0496125_0139976_640_1269 203
1868 3300048928 Ga0496125_0167829 Ga0496125_0167829_140_769 203
1869 3300048929 Ga0496126_0007394 Ga0496126_0007394_3481_4110 203
1870 3300048929 Ga0496126_0120575 Ga0496126_0120575_1428_2057 203
1871 3300048929 Ga0496126_0160190 Ga0496126_0160190_980_1609 203
1872 3300048929 Ga0496126_0201601 Ga0496126_0201601_668_1309 203
1873 3300048929 Ga0496126_0315020 Ga0496126_0315020_603_1232 203
1874 3300049459 Ga0495678_000050 Ga0495678_000050_159439_160074 203
1875 3300049459 Ga0495678_000940 Ga0495678_000940_23862_24497 203
1876 3300049460 Ga0495682_0022683 Ga0495682_0022683_1162_1797 203
1877 3300049579 Ga0501043_0040982 Ga0501043_0040982_178_813 203
1878 3300049581 Ga0501047_0008178 Ga0501047_0008178_1862_2497 203
1879 3300049581 Ga0501047_0014710 Ga0501047_0014710_5229_5858 203
1880 3300049581 Ga0501047_0341867 Ga0501047_0341867_119_754 203
1881 3300049581 Ga0501047_0511600 Ga0501047_0511600_365_991 203
1882 3300049758 Ga0501241_006613 Ga0501241_006613_811_1446 203
1883 3300049822 Ga0501035_0002463 Ga0501035_0002463_11134_11769 203
1884 3300049822 Ga0501035_0077913 Ga0501035_0077913_1361_1996 203
1885 3300049823 Ga0501044_0668773 Ga0501044_0668773_96_731 203
1886 3300050489 nmdc:mga03683_21404_c1 nmdc:mga03683_21404_c1_1288_1917 203
1887 3300050490 nmdc:mga03n38_76237_c1 nmdc:mga03n38_76237_c1_751_1380 203
1888 3300050491 nmdc:mga00v17_103655_c1 nmdc:mga00v17_103655_c1_892_1521 203
1889 3300050492 nmdc:mga0yw44_260464_c1 nmdc:mga0yw44_260464_c1_17_646 203
1890 3300050492 nmdc:mga0yw44_9479_c1 nmdc:mga0yw44_9479_c1_3833_4465 203
1891 3300050493 nmdc:mga0k408_48782_c1 nmdc:mga0k408_48782_c1_1331_1960 203
1892 3300050493 nmdc:mga0k408_5872_c1 nmdc:mga0k408_5872_c1_5226_5861 203
1893 3300050493 nmdc:mga0k408_7902_c1 nmdc:mga0k408_7902_c1_2184_2813 203
1894 3300050494 nmdc:mga06z11_161863_c1 nmdc:mga06z11_161863_c1_509_1138 203
1895 3300050496 nmdc:mga07m45_165909_c1 nmdc:mga07m45_165909_c1_359_988 203
1896 3300050516 nmdc:mga0sz30_70813_c1 nmdc:mga0sz30_70813_c1_730_1359 203
1897 3300053077 Ga0495601_0173146 Ga0495601_0173146_688_1320 203
1898 3300053083 Ga0495655_0027242 Ga0495655_0027242_657_1286 203
1899 3300053085 Ga0495619_0258907 Ga0495619_0258907_364_993 203
1900 3300053086 Ga0500578_0380726 Ga0500578_0380726_146_775 203
1901 3300053087 Ga0500643_000117 Ga0500643_000117_22295_22924 203
1902 3300053092 Ga0500583_0193152 Ga0500583_0193152_365_994 203
1903 3300053093 Ga0500651_0040579 Ga0500651_0040579_2175_2804 203
1904 3300053094 Ga0500566_0007716 Ga0500566_0007716_1268_1897 203
1905 3300053096 Ga0500641_0053038 Ga0500641_0053038_544_1173 203
1906 3300053098 Ga0500650_0320335 Ga0500650_0320335_34_663 203
1907 3300053103 Ga0500555_000797 Ga0500555_000797_7720_8349 203
1908 3300053105 Ga0500557_000089 Ga0500557_000089_18194_18823 203
1909 3300053108 Ga0500562_030261 Ga0500562_030261_109_738 203
1910 3300053109 Ga0500569_014792 Ga0500569_014792_656_1285 203
1911 3300053116 Ga0500592_014157 Ga0500592_014157_391_1020 203
1912 3300053118 Ga0500594_0031640 Ga0500594_0031640_636_1265 203
1913 3300053119 Ga0500595_072222 Ga0500595_072222_296_925 203
1914 3300053121 Ga0500607_101692 Ga0500607_101692_748_1377 203
1915 3300053130 Ga0500642_0002259 Ga0500642_0002259_1182_1811 203
1916 3300053130 Ga0500642_0222351 Ga0500642_0222351_22_651 203
1917 3300053131 Ga0500652_172717 Ga0500652_172717_250_879 203
1918 3300053133 Ga0500655_024958 Ga0500655_024958_424_1053 203
1919 3300053136 Ga0500559_0079724 Ga0500559_0079724_316_945 203
1920 3300053136 Ga0500559_0316016 Ga0500559_0316016_92_721 203
1921 3300053139 Ga0500568_0150786 Ga0500568_0150786_211_840 203
1922 3300053140 Ga0500573_0064119 Ga0500573_0064119_1023_1652 203
1923 3300053148 Ga0500590_000786 Ga0500590_000786_1179_1811 203
1924 3300053153 Ga0500616_0036627 Ga0500616_0036627_1399_2028 203
1925 3300053153 Ga0500616_0078384 Ga0500616_0078384_678_1307 203
1926 3300053154 Ga0500619_086502 Ga0500619_086502_136_765 203
1927 3300053158 Ga0500627_0015540 Ga0500627_0015540_557_1186 203
1928 3300053162 Ga0500638_131179 Ga0500638_131179_87_716 203
1929 3300053730 Ga0500645_049689 Ga0500645_049689_445_1074 203
1930 3300053731 Ga0500609_001488 Ga0500609_001488_129_758 203
1931 3300053737 Ga0500601_001865 Ga0500601_001865_1205_1834 203
1932 3300055283 Ga0500661_013954 Ga0500661_013954_268_897 203
1933 3300059491 Ga0587070_040259 Ga0587070_040259_140_775 203
1934 3300059503 Ga0587080_050086 Ga0587080_050086_99_728 203
1935 3300059510 Ga0587090_014503 Ga0587090_014503_162_803 203
1936 3300059510 Ga0587090_037493 Ga0587090_037493_177_812 203
1937 3300059605 Ga0587106_015656 Ga0587106_015656_259_894 203
1938 3300059641 Ga0587068_000094 Ga0587068_000094_552_1187 203
1939 3300059643 Ga0587072_049475 Ga0587072_049475_141_776 203
1940 iso_pu_bacteria 2585427633 2585992759 203
1941 iso_pu_bacteria 2585427634 2586003469 203
1942 iso_pu_bacteria 2738543032 2739352727 203
1943 iso_pu_bacteria 2909042592 2909048401 203
1944 3300001979 JGI24740J21852_10000390 JGI24740J21852_100003905 204
1945 3300001979 JGI24740J21852_10000951 JGI24740J21852_100009518 204
1946 3300001979 JGI24740J21852_10002198 JGI24740J21852_100021986 204
1947 3300001989 JGI24739J22299_10001541 JGI24739J22299_100015418 204
1948 3300001989 JGI24739J22299_10013921 JGI24739J22299_100139213 204
1949 3300001990 JGI24737J22298_10001661 JGI24737J22298_100016615 204
1950 3300001990 JGI24737J22298_10015993 JGI24737J22298_100159932 204
1951 3300002067 JGI24735J21928_10003170 JGI24735J21928_100031702 204
1952 3300002067 JGI24735J21928_10006466 JGI24735J21928_100064662 204
1953 3300002075 JGI24738J21930_10002765 JGI24738J21930_100027652 204
1954 3300002737 JGI25162J39368_1001545 JGI25162J39368_10015453 204
1955 3300002738 JGI25154J39366_1000692 JGI25154J39366_10006927 204
1956 3300002738 JGI25154J39366_1005746 JGI25154J39366_10057461 204
1957 3300002741 JGI25157J39369_1002404 JGI25157J39369_10024043 204
1958 3300002772 JGI25164J39214_1000122 JGI25164J39214_100012226 204
1959 3300002987 JGI25159J45721_1006750 JGI25159J45721_10067503 204
1960 3300003187 JGI25151J46595_10000036 JGI25151J46595_10000036175 204
1961 3300003187 JGI25151J46595_10062387 JGI25151J46595_100623872 204
1962 3300003214 JGI25165J46597_1000241 JGI25165J46597_100024134 204
1963 3300003323 rootH1_10051241 rootH1_100512412 204
1964 3300003565 Ga0006560J51390_1031751 Ga0006560J51390_10317512 204
1965 3300003752 Ga0055539_1000062 Ga0055539_100006287 204
1966 3300003756 Ga0055533_1002704 Ga0055533_10027046 204
1967 3300003756 Ga0055533_1009200 Ga0055533_10092002 204
1968 3300003758 Ga0055532_1000019 Ga0055532_1000019170 204
1969 3300003759 Ga0055525_1000135 Ga0055525_100013527 204
1970 3300003759 Ga0055525_1000275 Ga0055525_100027511 204
1971 3300003760 Ga0055527_1000043 Ga0055527_100004343 204
1972 3300003760 Ga0055527_1000079 Ga0055527_10000798 204
1973 3300003760 Ga0055527_1004395 Ga0055527_10043951 204
1974 3300003761 Ga0055535_1000014 Ga0055535_1000014110 204
1975 3300003761 Ga0055535_1000071 Ga0055535_100007143 204
1976 3300003761 Ga0055535_1000166 Ga0055535_100016657 204
1977 3300003761 Ga0055535_1000245 Ga0055535_100024549 204
1978 3300003761 Ga0055535_1000279 Ga0055535_10002794 204
1979 3300003762 Ga0055542_1000096 Ga0055542_100009656 204
1980 3300003762 Ga0055542_1000139 Ga0055542_100013922 204
1981 3300003762 Ga0055542_1000210 Ga0055542_10002102 204
1982 3300003762 Ga0055542_1000285 Ga0055542_100028545 204
1983 3300003762 Ga0055542_1000588 Ga0055542_100058816 204
1984 3300003762 Ga0055542_1001245 Ga0055542_100124511 204
1985 3300003762 Ga0055542_1010711 Ga0055542_10107112 204
1986 3300003763 Ga0055529_1000086 Ga0055529_100008689 204
1987 3300003763 Ga0055529_1000114 Ga0055529_100011449 204
1988 3300003763 Ga0055529_1000304 Ga0055529_100030445 204
1989 3300003763 Ga0055529_1000394 Ga0055529_10003942 204
1990 3300003771 Ga0055526_1002407 Ga0055526_100240713 204
1991 3300003771 Ga0055526_1011561 Ga0055526_10115611 204
1992 3300003771 Ga0055526_1063866 Ga0055526_10638661 204
1993 3300003775 Ga0055524_1000018 Ga0055524_100001863 204
1994 3300003781 Ga0055536_1000078 Ga0055536_100007838 204
1995 3300003784 Ga0055534_1000759 Ga0055534_10007594 204
1996 3300003784 Ga0055534_1002624 Ga0055534_10026247 204
1997 3300003792 Ga0055540_1053736 Ga0055540_10537361 204
1998 3300003841 Ga0055541_1000254 Ga0055541_100025413 204
1999 3300003841 Ga0055541_1005935 Ga0055541_10059352 204
2000 3300005262 Ga0065165_1000141 Ga0065165_100014184 204
2001 3300005329 Ga0070683_100207968 Ga0070683_1002079683 204
2002 3300005337 Ga0070682_100379882 Ga0070682_1003798822 204
2003 3300005339 Ga0070660_100080974 Ga0070660_1000809742 204
2004 3300005344 Ga0070661_100000054 Ga0070661_1000000549 204
2005 3300005347 Ga0070668_100000932 Ga0070668_1000009325 204
2006 3300005347 Ga0070668_100005822 Ga0070668_1000058228 204
2007 3300005353 Ga0070669_100255246 Ga0070669_1002552462 204
2008 3300005366 Ga0070659_100017727 Ga0070659_1000177274 204
2009 3300005367 Ga0070667_100000013 Ga0070667_100000013265 204
2010 3300005367 Ga0070667_100418748 Ga0070667_1004187481 204
2011 3300005435 Ga0070714_100558932 Ga0070714_1005589322 204
2012 3300005455 Ga0070663_100000010 Ga0070663_10000001092 204
2013 3300005539 Ga0068853_100017417 Ga0068853_1000174172 204
2014 3300005548 Ga0070665_100136002 Ga0070665_1001360023 204
2015 3300005563 Ga0068855_100026143 Ga0068855_1000261432 204
2016 3300005563 Ga0068855_100083407 Ga0068855_1000834073 204
2017 3300005564 Ga0070664_100000005 Ga0070664_100000005106 204
2018 3300005577 Ga0068857_100047516 Ga0068857_1000475163 204
2019 3300005578 Ga0068854_100000032 Ga0068854_10000003220 204
2020 3300005578 Ga0068854_100094330 Ga0068854_1000943303 204
2021 3300005614 Ga0068856_100000054 Ga0068856_10000005493 204
2022 3300005614 Ga0068856_100005493 Ga0068856_10000549311 204
2023 3300005616 Ga0068852_100003121 Ga0068852_1000031216 204
2024 3300005616 Ga0068852_100179111 Ga0068852_1001791113 204
2025 3300005841 Ga0068863_100001231 Ga0068863_10000123122 204
2026 3300005844 Ga0068862_100314439 Ga0068862_1003144392 204
2027 3300006042 Ga0075368_10000438 Ga0075368_100004384 204
2028 3300006048 Ga0075363_100006971 Ga0075363_1000069713 204
2029 3300006177 Ga0075362_10006177 Ga0075362_100061774 204
2030 3300006178 Ga0075367_10000052 Ga0075367_100000523 204
2031 3300006237 Ga0097621_100600666 Ga0097621_1006006661 204
2032 3300006353 Ga0075370_10022951 Ga0075370_100229513 204
2033 3300006946 Ga0079104_1006239 Ga0079104_10062394 204
2034 3300009011 Ga0105251_10183902 Ga0105251_101839022 204
2035 3300009093 Ga0105240_10045652 Ga0105240_100456522 204
2036 3300009093 Ga0105240_10132392 Ga0105240_101323924 204
2037 3300009093 Ga0105240_10143158 Ga0105240_101431584 204
2038 3300009093 Ga0105240_10176910 Ga0105240_101769101 204
2039 3300009093 Ga0105240_10296010 Ga0105240_102960102 204
2040 3300009177 Ga0105248_10335968 Ga0105248_103359682 204
2041 3300009545 Ga0105237_10000322 Ga0105237_1000032238 204
2042 3300009545 Ga0105237_10278816 Ga0105237_102788162 204
2043 3300009551 Ga0105238_10005278 Ga0105238_1000527813 204
2044 3300009551 Ga0105238_10723606 Ga0105238_107236062 204
2045 3300010375 Ga0105239_10000750 Ga0105239_100007508 204
2046 3300013100 Ga0157373_10006041 Ga0157373_100060417 204
2047 3300013102 Ga0157371_10000103 Ga0157371_1000010321 204
2048 3300013102 Ga0157371_10014909 Ga0157371_100149093 204
2049 3300013104 Ga0157370_10001099 Ga0157370_1000109921 204
2050 3300013104 Ga0157370_10689054 Ga0157370_106890542 204
2051 3300013105 Ga0157369_10015082 Ga0157369_100150826 204
2052 3300013105 Ga0157369_10030435 Ga0157369_100304355 204
2053 3300013297 Ga0157378_11218762 Ga0157378_112187621 204
2054 3300013306 Ga0163162_10154210 Ga0163162_101542103 204
2055 3300013307 Ga0157372_10000151 Ga0157372_1000015148 204
2056 3300013307 Ga0157372_10080518 Ga0157372_100805183 204
2057 3300013307 Ga0157372_10537327 Ga0157372_105373272 204
2058 3300013307 Ga0157372_10772585 Ga0157372_107725852 204
2059 3300013308 Ga0157375_10398996 Ga0157375_103989962 204
2060 3300015261 Ga0182006_1000747 Ga0182006_10007475 204
2061 3300015680 Ga0183370_1020 Ga0183370_10202 204
2062 3300015687 Ga0183368_1002 Ga0183368_10021428 204
2063 3300017792 Ga0163161_10026606 Ga0163161_100266062 204
2064 3300020069 Ga0197907_10420922 Ga0197907_104209224 204
2065 3300020077 Ga0206351_10614052 Ga0206351_106140524 204
2066 3300020610 Ga0154015_1423277 Ga0154015_14232776 204
2067 3300022739 Ga0228711_1000045 Ga0228711_100004554 204
2068 3300022740 Ga0228710_1000036 Ga0228710_100003648 204
2069 3300025206 Ga0209435_104233 Ga0209435_1042332 204
2070 3300025208 Ga0209436_112459 Ga0209436_1124592 204
2071 3300025224 Ga0209784_100003 Ga0209784_1000031167 204
2072 3300025224 Ga0209784_100650 Ga0209784_1006508 204
2073 3300025225 Ga0209566_100002 Ga0209566_1000022121 204
2074 3300025225 Ga0209566_101350 Ga0209566_1013502 204
2075 3300025226 Ga0209674_100008 Ga0209674_10000864 204
2076 3300025226 Ga0209674_100014 Ga0209674_10001429 204
2077 3300025226 Ga0209674_100346 Ga0209674_1003466 204
2078 3300025228 Ga0209672_100004 Ga0209672_100004790 204
2079 3300025228 Ga0209672_100109 Ga0209672_1001092 204
2080 3300025228 Ga0209672_100302 Ga0209672_1003025 204
2081 3300025228 Ga0209672_100788 Ga0209672_10078810 204
2082 3300025229 Ga0209147_100002 Ga0209147_1000021247 204
2083 3300025229 Ga0209147_102661 Ga0209147_1026617 204
2084 3300025230 Ga0209563_100004 Ga0209563_1000041538 204
2085 3300025230 Ga0209563_100036 Ga0209563_100036104 204
2086 3300025231 Ga0207427_100037 Ga0207427_100037145 204
2087 3300025233 Ga0209437_100437 Ga0209437_1004377 204
2088 3300025233 Ga0209437_100961 Ga0209437_10096110 204
2089 3300025242 Ga0209258_100002 Ga0209258_1000021247 204
2090 3300025242 Ga0209258_100003 Ga0209258_100003790 204
2091 3300025242 Ga0209258_100057 Ga0209258_100057171 204
2092 3300025242 Ga0209258_100138 Ga0209258_10013829 204
2093 3300025242 Ga0209258_100185 Ga0209258_10018578 204
2094 3300025242 Ga0209258_100795 Ga0209258_1007953 204
2095 3300025242 Ga0209258_102228 Ga0209258_1022287 204
2096 3300025245 Ga0207425_1009208 Ga0207425_10092083 204
2097 3300025246 Ga0209646_1000019 Ga0209646_100001942 204
2098 3300025246 Ga0209646_1000623 Ga0209646_10006238 204
2099 3300025246 Ga0209646_1001280 Ga0209646_10012804 204
2100 3300025246 Ga0209646_1013084 Ga0209646_10130842 204
2101 3300025250 Ga0209026_1000789 Ga0209026_10007897 204
2102 3300025250 Ga0209026_1002931 Ga0209026_10029311 204
2103 3300025250 Ga0209026_1012265 Ga0209026_10122652 204
2104 3300025253 Ga0209677_100009 Ga0209677_10000994 204
2105 3300025253 Ga0209677_115315 Ga0209677_1153152 204
2106 3300025254 Ga0209148_1000002 Ga0209148_1000002193 204
2107 3300025254 Ga0209148_1000025 Ga0209148_100002594 204
2108 3300025254 Ga0209148_1000042 Ga0209148_1000042326 204
2109 3300025254 Ga0209148_1000068 Ga0209148_1000068171 204
2110 3300025254 Ga0209148_1000193 Ga0209148_100019343 204
2111 3300025254 Ga0209148_1000545 Ga0209148_100054511 204
2112 3300025254 Ga0209148_1008299 Ga0209148_10082992 204
2113 3300025256 Ga0209759_1001583 Ga0209759_10015832 204
2114 3300025256 Ga0209759_1005904 Ga0209759_10059042 204
2115 3300025261 Ga0209233_1000096 Ga0209233_1000096146 204
2116 3300025261 Ga0209233_1000320 Ga0209233_100032017 204
2117 3300025263 Ga0209565_1012572 Ga0209565_10125722 204
2118 3300025272 Ga0209455_1000004 Ga0209455_1000004790 204
2119 3300025272 Ga0209455_1000016 Ga0209455_1000016581 204
2120 3300025272 Ga0209455_1000076 Ga0209455_1000076169 204
2121 3300025272 Ga0209455_1001555 Ga0209455_10015553 204
2122 3300025272 Ga0209455_1004144 Ga0209455_10041442 204
2123 3300025273 Ga0209673_1012846 Ga0209673_10128462 204
2124 3300025284 Ga0209130_1000178 Ga0209130_100017885 204
2125 3300025284 Ga0209130_1002062 Ga0209130_10020623 204
2126 3300025291 Ga0209675_1000087 Ga0209675_100008739 204
2127 3300025291 Ga0209675_1001561 Ga0209675_10015617 204
2128 3300025291 Ga0209675_1002312 Ga0209675_100231210 204
2129 3300025291 Ga0209675_1007604 Ga0209675_10076043 204
2130 3300025292 Ga0209676_1000176 Ga0209676_100017645 204
2131 3300025294 Ga0209025_1000017 Ga0209025_1000017351 204
2132 3300025294 Ga0209025_1000046 Ga0209025_1000046126 204
2133 3300025294 Ga0209025_1000594 Ga0209025_10005943 204
2134 3300025294 Ga0209025_1002082 Ga0209025_100208214 204
2135 3300025294 Ga0209025_1040243 Ga0209025_10402432 204
2136 3300025295 Ga0209564_1000059 Ga0209564_1000059121 204
2137 3300025295 Ga0209564_1000276 Ga0209564_10002762 204
2138 3300025295 Ga0209564_1000434 Ga0209564_10004347 204
2139 3300025298 Ga0209050_1016948 Ga0209050_10169484 204
2140 3300025298 Ga0209050_1029568 Ga0209050_10295682 204
2141 3300025299 Ga0209256_1000032 Ga0209256_100003266 204
2142 3300025299 Ga0209256_1000128 Ga0209256_100012832 204
2143 3300025299 Ga0209256_1000432 Ga0209256_100043214 204
2144 3300025302 Ga0207426_1017400 Ga0207426_10174002 204
2145 3300025303 Ga0209051_1005750 Ga0209051_10057508 204
2146 3300025303 Ga0209051_1034525 Ga0209051_10345251 204
2147 3300025303 Ga0209051_1044084 Ga0209051_10440841 204
2148 3300025304 Ga0209257_1009605 Ga0209257_10096052 204
2149 3300025304 Ga0209257_1040232 Ga0209257_10402322 204
2150 3300025735 Ga0207713_1132712 Ga0207713_11327122 204
2151 3300025903 Ga0207680_10015290 Ga0207680_100152905 204
2152 3300025904 Ga0207647_10013332 Ga0207647_100133323 204
2153 3300025904 Ga0207647_10033451 Ga0207647_100334513 204
2154 3300025909 Ga0207705_10257660 Ga0207705_102576603 204
2155 3300025913 Ga0207695_10005643 Ga0207695_1000564312 204
2156 3300025913 Ga0207695_10017514 Ga0207695_1001751412 204
2157 3300025913 Ga0207695_10033462 Ga0207695_100334626 204
2158 3300025913 Ga0207695_10301502 Ga0207695_103015022 204
2159 3300025913 Ga0207695_10318264 Ga0207695_103182642 204
2160 3300025914 Ga0207671_10001693 Ga0207671_1000169317 204
2161 3300025914 Ga0207671_10406797 Ga0207671_104067972 204
2162 3300025920 Ga0207649_10000087 Ga0207649_100000872 204
2163 3300025920 Ga0207649_10013062 Ga0207649_100130621 204
2164 3300025923 Ga0207681_10064352 Ga0207681_100643522 204
2165 3300025923 Ga0207681_10953137 Ga0207681_109531371 204
2166 3300025924 Ga0207694_10004751 Ga0207694_100047513 204
2167 3300025931 Ga0207644_10152006 Ga0207644_101520063 204
2168 3300025932 Ga0207690_10019374 Ga0207690_100193742 204
2169 3300025932 Ga0207690_10148578 Ga0207690_101485783 204
2170 3300025933 Ga0207706_10041471 Ga0207706_100414713 204
2171 3300025945 Ga0207679_10000020 Ga0207679_10000020103 204
2172 3300025949 Ga0207667_10005925 Ga0207667_100059253 204
2173 3300025949 Ga0207667_10087941 Ga0207667_100879411 204
2174 3300025972 Ga0207668_10000063 Ga0207668_100000634 204
2175 3300025972 Ga0207668_10000812 Ga0207668_100008122 204
2176 3300025972 Ga0207668_10205397 Ga0207668_102053973 204
2177 3300025981 Ga0207640_10000017 Ga0207640_1000001720 204
2178 3300025981 Ga0207640_10064691 Ga0207640_100646913 204
2179 3300025986 Ga0207658_10000040 Ga0207658_100000404 204
2180 3300025986 Ga0207658_10439549 Ga0207658_104395492 204
2181 3300026067 Ga0207678_10000008 Ga0207678_10000008103 204
2182 3300026067 Ga0207678_10230566 Ga0207678_102305661 204
2183 3300026078 Ga0207702_10000017 Ga0207702_10000017103 204
2184 3300026078 Ga0207702_10013539 Ga0207702_100135394 204
2185 3300026088 Ga0207641_10000178 Ga0207641_100001784 204
2186 3300026089 Ga0207648_10231778 Ga0207648_102317782 204
2187 3300026116 Ga0207674_10001770 Ga0207674_100017702 204
2188 3300026121 Ga0207683_10053708 Ga0207683_100537083 204
2189 3300026121 Ga0207683_10227634 Ga0207683_102276342 204
2190 3300026142 Ga0207698_10026292 Ga0207698_100262923 204
2191 3300027111 Ga0209281_1000178 Ga0209281_100017871 204
2192 3300027666 Ga0209282_1000017 Ga0209282_1000017150 204
2193 3300027666 Ga0209282_1000023 Ga0209282_100002397 204
2194 3300027866 Ga0209813_10000059 Ga0209813_1000005919 204
2195 3300028379 Ga0268266_10112422 Ga0268266_101124223 204
2196 3300028380 Ga0268265_10145434 Ga0268265_101454342 204
2197 3300028381 Ga0268264_10024514 Ga0268264_100245144 204
2198 3300031251 Ga0265327_10001789 Ga0265327_1000178923 204
2199 3300031251 Ga0265327_10021339 Ga0265327_100213393 204
2200 3300031507 Ga0307509_10040475 Ga0307509_100404755 204
2201 3300031548 Ga0307408_100677610 Ga0307408_1006776101 204
2202 3300031649 Ga0307514_10016003 Ga0307514_100160034 204
2203 3300031967 Ga0315914_1000016 Ga0315914_100001654 204
2204 3300032002 Ga0307416_100088858 Ga0307416_1000888582 204
2205 3300032004 Ga0307414_10151948 Ga0307414_101519481 204
2206 3300032005 Ga0307411_10329565 Ga0307411_103295652 204
2207 3300033180 Ga0307510_10000967 Ga0307510_1000096710 204
2208 3300033180 Ga0307510_10002108 Ga0307510_1000210810 204
2209 3300033430 Ga0315913_1000027 Ga0315913_100002740 204
2210 3300033464 Ga0315915_1000007 Ga0315915_1000007132 204
2211 3300037312 Ga0395899_0003144 Ga0395899_0003144_6872_7510 204
2212 3300037418 Ga0395900_0012600 Ga0395900_0012600_4914_5579 204
2213 3300037418 Ga0395900_0525526 Ga0395900_0525526_220_855 204
2214 3300037466 Ga0395898_0000202 Ga0395898_0000202_87711_88349 204
2215 3300037466 Ga0395898_0536678 Ga0395898_0536678_257_892 204
2216 3300038443 Ga0395901_0326669 Ga0395901_0326669_860_1495 204
2217 3300039145 Ga0237816_01079 Ga0237816_01079_305_943 204
2218 3300039437 Ga0436365_1811392 Ga0436365_1811392_4605_5234 204
2219 3300041404 Ga0439436_0002379 Ga0439436_0002379_4220_4858 204
2220 3300041407 Ga0439447_056743 Ga0439447_056743_239_880 204
2221 3300041411 Ga0439466_0009070 Ga0439466_0009070_2836_3474 204
2222 3300041413 Ga0439465_0001406 Ga0439465_0001406_4332_4970 204
2223 3300041997 Ga0439431_0057842 Ga0439431_0057842_269_907 204
2224 3300042004 Ga0439445_0001144 Ga0439445_0001144_3753_4391 204
2225 3300042006 Ga0439432_070831 Ga0439432_070831_210_848 204
2226 3300042007 Ga0439449_0000776 Ga0439449_0000776_8574_9212 204
2227 3300042010 Ga0439452_005681 Ga0439452_005681_2589_3227 204
2228 3300042010 Ga0439452_044426 Ga0439452_044426_242_901 204
2229 3300042014 Ga0439457_017067 Ga0439457_017067_77_715 204
2230 3300042015 Ga0439462_0011185 Ga0439462_0011185_278_916 204
2231 3300042128 Ga0450897_005149 Ga0450897_005149_301_939 204
2232 3300042435 Ga0439434_0000345 Ga0439434_0000345_11233_11871 204
2233 3300042532 Ga0450893_0003942 Ga0450893_0003942_478_1119 204
2234 3300044650 Ga0466986_0046173 Ga0466986_0046173_1708_2373 204
2235 3300044656 Ga0466969_0003272 Ga0466969_0003272_2550_3212 204
2236 3300044656 Ga0466969_0016667 Ga0466969_0016667_693_1367 204
2237 3300044658 Ga0466972_0001484 Ga0466972_0001484_3934_4596 204
2238 3300044671 Ga0466978_0003233 Ga0466978_0003233_237_899 204
2239 3300044683 Ga0466965_0001356 Ga0466965_0001356_1256_1909 204
2240 3300044683 Ga0466965_0001806 Ga0466965_0001806_4084_4746 204
2241 3300044684 Ga0466966_0090696 Ga0466966_0090696_176_838 204
2242 3300044693 Ga0466961_0000046 Ga0466961_0000046_13498_14160 204
2243 3300044693 Ga0466961_0148179 Ga0466961_0148179_661_1299 204
2244 3300044706 Ga0466964_0142977 Ga0466964_0142977_420_1082 204
2245 3300044719 Ga0466971_0104563 Ga0466971_0104563_12_674 204
2246 3300044735 Ga0466968_0042969 Ga0466968_0042969_352_1005 204
2247 3300044765 Ga0466970_0000195 Ga0466970_0000195_13460_14122 204
2248 3300045049 Ga0466959_0001233 Ga0466959_0001233_13503_14165 204
2249 3300045049 Ga0466959_0027783 Ga0466959_0027783_512_1186 204
2250 3300045049 Ga0466959_0313414 Ga0466959_0313414_239_877 204
2251 3300045836 Ga0466958_0070150 Ga0466958_0070150_34_672 204
2252 3300045836 Ga0466958_0070685 Ga0466958_0070685_32_670 204
2253 3300046454 Ga0495592_0005242 Ga0495592_0005242_760_1395 204
2254 3300046474 Ga0495605_0003568 Ga0495605_0003568_7114_7773 204
2255 3300046475 Ga0495639_0087075 Ga0495639_0087075_436_1077 204
2256 3300046500 Ga0495596_0000408 Ga0495596_0000408_1289_1948 204
2257 3300046501 Ga0495607_0056943 Ga0495607_0056943_387_1046 204
2258 3300046507 Ga0495606_0129293 Ga0495606_0129293_383_1012 204
2259 3300046512 Ga0495610_0000337 Ga0495610_0000337_1346_2005 204
2260 3300046513 Ga0495616_0003728 Ga0495616_0003728_8053_8685 204
2261 3300046513 Ga0495616_0011097 Ga0495616_0011097_1056_1715 204
2262 3300046513 Ga0495616_0066747 Ga0495616_0066747_450_1094 204
2263 3300046523 Ga0495644_0018480 Ga0495644_0018480_1607_2251 204
2264 3300046524 Ga0495648_0160326 Ga0495648_0160326_352_1011 204
2265 3300046524 Ga0495648_0192151 Ga0495648_0192151_357_992 204
2266 3300046538 Ga0495609_0007357 Ga0495609_0007357_3590_4249 204
2267 3300046542 Ga0495597_0000093 Ga0495597_0000093_78028_78663 204
2268 3300046543 Ga0495645_0154396 Ga0495645_0154396_377_1018 204
2269 3300046558 Ga0495633_0286685 Ga0495633_0286685_60_701 204
2270 3300046660 Ga0495625_0572172 Ga0495625_0572172_23_661 204
2271 3300046665 Ga0495661_0152048 Ga0495661_0152048_314_973 204
2272 3300046684 Ga0495669_0059326 Ga0495669_0059326_745_1404 204
2273 3300046691 Ga0495670_0048239 Ga0495670_0048239_833_1477 204
2274 3300046692 Ga0495671_0000373 Ga0495671_0000373_1491_2150 204
2275 3300046694 Ga0495649_0055889 Ga0495649_0055889_1041_1700 204
2276 3300047447 Ga0495685_043481 Ga0495685_043481_87_728 204
2277 3300048903 Ga0496100_0069937 Ga0496100_0069937_1593_2234 204
2278 3300048904 Ga0496101_0029187 Ga0496101_0029187_951_1592 204
2279 3300048905 Ga0496102_0006244 Ga0496102_0006244_8173_8814 204
2280 3300048907 Ga0496104_0013685 Ga0496104_0013685_1352_1993 204
2281 3300048908 Ga0496105_0035687 Ga0496105_0035687_888_1529 204
2282 3300048909 Ga0496106_0054355 Ga0496106_0054355_1665_2294 204
2283 3300048910 Ga0496107_0160068 Ga0496107_0160068_426_1067 204
2284 3300048911 Ga0496108_0023441 Ga0496108_0023441_3258_3881 204
2285 3300048913 Ga0496110_0028902 Ga0496110_0028902_730_1353 204
2286 3300048913 Ga0496110_0035927 Ga0496110_0035927_2079_2720 204
2287 3300048915 Ga0496112_0636052 Ga0496112_0636052_134_805 204
2288 3300048917 Ga0496114_0162909 Ga0496114_0162909_1174_1815 204
2289 3300048919 Ga0496116_0003405 Ga0496116_0003405_14179_14868 204
2290 3300048919 Ga0496116_0029871 Ga0496116_0029871_1918_2577 204
2291 3300048920 Ga0496117_0006642 Ga0496117_0006642_944_1576 204
2292 3300048920 Ga0496117_0057626 Ga0496117_0057626_895_1539 204
2293 3300048921 Ga0496118_0002967 Ga0496118_0002967_20531_21163 204
2294 3300048921 Ga0496118_0105497 Ga0496118_0105497_537_1160 204
2295 3300048922 Ga0496119_0144727 Ga0496119_0144727_114_758 204
2296 3300048924 Ga0496121_0000192 Ga0496121_0000192_40220_40843 204
2297 3300048924 Ga0496121_0008386 Ga0496121_0008386_916_1575 204
2298 3300048924 Ga0496121_0060050 Ga0496121_0060050_1513_2154 204
2299 3300048924 Ga0496121_0194575 Ga0496121_0194575_518_1150 204
2300 3300048924 Ga0496121_0251481 Ga0496121_0251481_63_704 204
2301 3300048925 Ga0496122_0005731 Ga0496122_0005731_12650_13309 204
2302 3300048926 Ga0496123_0008857 Ga0496123_0008857_7662_8321 204
2303 3300048926 Ga0496123_0131292 Ga0496123_0131292_481_1119 204
2304 3300048926 Ga0496123_0251676 Ga0496123_0251676_192_833 204
2305 3300048927 Ga0496124_0000004 Ga0496124_0000004_960547_961188 204
2306 3300048927 Ga0496124_0097732 Ga0496124_0097732_1747_2370 204
2307 3300048928 Ga0496125_0002121 Ga0496125_0002121_20002_20667 204
2308 3300048929 Ga0496126_0012251 Ga0496126_0012251_6542_7165 204
2309 3300049569 Ga0501032_0209421 Ga0501032_0209421_472_1113 204
2310 3300049571 Ga0501034_0000067 Ga0501034_0000067_121221_121877 204
2311 3300049571 Ga0501034_0230308 Ga0501034_0230308_827_1459 204
2312 3300049822 Ga0501035_0158092 Ga0501035_0158092_318_959 204
2313 3300049823 Ga0501044_0011117 Ga0501044_0011117_4003_4644 204
2314 3300049823 Ga0501044_0556191 Ga0501044_0556191_173_805 204
2315 3300050489 nmdc:mga03683_1359_c1 nmdc:mga03683_1359_c1_3335_3976 204
2316 3300050493 nmdc:mga0k408_56494_c1 nmdc:mga0k408_56494_c1_1535_2176 204
2317 3300053086 Ga0500578_0056501 Ga0500578_0056501_370_999 204
2318 3300053123 Ga0500614_035414 Ga0500614_035414_355_1161 204
2319 3300053149 Ga0500600_0021842 Ga0500600_0021842_1662_2303 204
2320 3300053153 Ga0500616_0008389 Ga0500616_0008389_1718_2350 204
2321 3300053156 Ga0500622_0034202 Ga0500622_0034202_490_1104 204
2322 3300053730 Ga0500645_012943 Ga0500645_012943_1512_2141 204
2323 3300053739 Ga0500587_035755 Ga0500587_035755_15_644 204
2324 3300059505 Ga0587083_0001629 Ga0587083_0001629_774_1439 204
2325 3300059604 Ga0587098_000472 Ga0587098_000472_576_1241 204
2326 3300059640 Ga0587067_000552 Ga0587067_000552_1931_2596 204
2327 3300059641 Ga0587068_007073 Ga0587068_007073_150_815 204
2328 3300059643 Ga0587072_000090 Ga0587072_000090_5506_6171 204
2329 3300059650 Ga0587104_000826 Ga0587104_000826_664_1329 204
2330 3300061719 Ga0466962_0174154 Ga0466962_0174154_16_678 204
2331 iso_pu_bacteria 2510917021 2511128389 204
2332 iso_pu_bacteria 2721755763 2723879134 204
2333 iso_pu_bacteria 2818991438 2819552385 204
2334 iso_pu_bacteria 2894817345 2894822193 204
2335 iso_pu_bacteria 2946787523 2946790532 204
2336 3300005335 Ga0070666_10036206 Ga0070666_100362062 205
2337 3300005355 Ga0070671_100000483 Ga0070671_10000048316 205
2338 3300005367 Ga0070667_100118180 Ga0070667_1001181802 205
2339 3300005455 Ga0070663_100109176 Ga0070663_1001091762 205
2340 3300005548 Ga0070665_100395451 Ga0070665_1003954512 205
2341 3300005563 Ga0068855_100000283 Ga0068855_10000028315 205
2342 3300005617 Ga0068859_100000181 Ga0068859_10000018117 205
2343 3300005841 Ga0068863_100007434 Ga0068863_1000074342 205
2344 3300005842 Ga0068858_100000878 Ga0068858_10000087812 205
2345 3300005843 Ga0068860_100023372 Ga0068860_1000233723 205
2346 3300005843 Ga0068860_100024676 Ga0068860_1000246764 205
2347 3300005844 Ga0068862_100072422 Ga0068862_1000724225 205
2348 3300006195 Ga0075366_10010935 Ga0075366_100109356 205
2349 3300006195 Ga0075366_10383391 Ga0075366_103833912 205
2350 3300006353 Ga0075370_10011371 Ga0075370_100113713 205
2351 3300006931 Ga0097620_100000181 Ga0097620_10000018117 205
2352 3300009092 Ga0105250_10057845 Ga0105250_100578452 205
2353 3300009093 Ga0105240_10016034 Ga0105240_100160346 205
2354 3300009093 Ga0105240_10116596 Ga0105240_101165964 205
2355 3300009101 Ga0105247_10000549 Ga0105247_1000054912 205
2356 3300009148 Ga0105243_11185115 Ga0105243_111851152 205
2357 3300009177 Ga0105248_10019945 Ga0105248_100199452 205
2358 3300009545 Ga0105237_10014615 Ga0105237_100146153 205
2359 3300009551 Ga0105238_10207759 Ga0105238_102077592 205
2360 3300009553 Ga0105249_10056648 Ga0105249_100566482 205
2361 3300010375 Ga0105239_10075729 Ga0105239_100757294 205
2362 3300013250 Ga0171462_1040 Ga0171462_104042 205
2363 3300013306 Ga0163162_10175133 Ga0163162_101751332 205
2364 3300013306 Ga0163162_10299982 Ga0163162_102999822 205
2365 3300013307 Ga0157372_10405954 Ga0157372_104059542 205
2366 3300014325 Ga0163163_10303487 Ga0163163_103034873 205
2367 3300014968 Ga0157379_10155706 Ga0157379_101557062 205
2368 3300021361 Ga0213872_10037693 Ga0213872_100376932 205
2369 3300025206 Ga0209435_110054 Ga0209435_1100542 205
2370 3300025225 Ga0209566_103050 Ga0209566_1030503 205
2371 3300025233 Ga0209437_105980 Ga0209437_1059801 205
2372 3300025246 Ga0209646_1010426 Ga0209646_10104262 205
2373 3300025256 Ga0209759_1003782 Ga0209759_10037823 205
2374 3300025711 Ga0207696_1066310 Ga0207696_10663102 205
2375 3300025900 Ga0207710_10000347 Ga0207710_1000034723 205
2376 3300025903 Ga0207680_10049423 Ga0207680_100494232 205
2377 3300025913 Ga0207695_10019500 Ga0207695_100195003 205
2378 3300025913 Ga0207695_10091360 Ga0207695_100913602 205
2379 3300025914 Ga0207671_10109386 Ga0207671_101093863 205
2380 3300025914 Ga0207671_10125193 Ga0207671_101251932 205
2381 3300025920 Ga0207649_10066813 Ga0207649_100668132 205
2382 3300025924 Ga0207694_10022951 Ga0207694_100229513 205
2383 3300025924 Ga0207694_10236699 Ga0207694_102366992 205
2384 3300025931 Ga0207644_10006931 Ga0207644_100069316 205
2385 3300025936 Ga0207670_10001961 Ga0207670_100019614 205
2386 3300025949 Ga0207667_10000696 Ga0207667_100006963 205
2387 3300025986 Ga0207658_10013461 Ga0207658_100134612 205
2388 3300026035 Ga0207703_10000459 Ga0207703_1000045935 205
2389 3300026067 Ga0207678_10096171 Ga0207678_100961711 205
2390 3300026067 Ga0207678_10597537 Ga0207678_105975372 205
2391 3300026088 Ga0207641_10007603 Ga0207641_100076037 205
2392 3300028379 Ga0268266_10040206 Ga0268266_100402062 205
2393 3300028379 Ga0268266_10280380 Ga0268266_102803802 205
2394 3300028380 Ga0268265_10025951 Ga0268265_100259513 205
2395 3300028794 Ga0307515_10000306 Ga0307515_100003069 205
2396 3300030521 Ga0307511_10000659 Ga0307511_100006597 205
2397 3300031249 Ga0265339_10279357 Ga0265339_102793571 205
2398 3300031616 Ga0307508_10047677 Ga0307508_100476774 205
2399 3300031731 Ga0307405_10038178 Ga0307405_100381782 205
2400 3300031824 Ga0307413_10112264 Ga0307413_101122642 205
2401 3300031852 Ga0307410_10004525 Ga0307410_100045254 205
2402 3300031852 Ga0307410_10161562 Ga0307410_101615622 205
2403 3300031903 Ga0307407_10001118 Ga0307407_100011188 205
2404 3300031903 Ga0307407_10068033 Ga0307407_100680332 205
2405 3300031911 Ga0307412_10066772 Ga0307412_100667723 205
2406 3300031995 Ga0307409_100002657 Ga0307409_1000026574 205
2407 3300031995 Ga0307409_100323327 Ga0307409_1003233271 205
2408 3300032002 Ga0307416_100015496 Ga0307416_1000154967 205
2409 3300032002 Ga0307416_100146116 Ga0307416_1001461161 205
2410 3300032004 Ga0307414_10026214 Ga0307414_100262143 205
2411 3300032004 Ga0307414_10118611 Ga0307414_101186112 205
2412 3300032005 Ga0307411_10002468 Ga0307411_100024682 205
2413 3300032005 Ga0307411_10032257 Ga0307411_100322573 205
2414 3300032005 Ga0307411_10256057 Ga0307411_102560572 205
2415 3300037312 Ga0395899_0000264 Ga0395899_0000264_57745_58380 205
2416 3300037312 Ga0395899_0000854 Ga0395899_0000854_9666_10298 205
2417 3300037312 Ga0395899_0079649 Ga0395899_0079649_1305_1937 205
2418 3300037418 Ga0395900_0000072 Ga0395900_0000072_84749_85381 205
2419 3300037418 Ga0395900_0038244 Ga0395900_0038244_3236_3868 205
2420 3300037418 Ga0395900_1025043 Ga0395900_1025043_70_702 205
2421 3300037466 Ga0395898_0017325 Ga0395898_0017325_4760_5392 205
2422 3300037466 Ga0395898_0096271 Ga0395898_0096271_35_667 205
2423 3300037466 Ga0395898_0190229 Ga0395898_0190229_1031_1666 205
2424 3300037471 Ga0395905_0021702 Ga0395905_0021702_5151_5783 205
2425 3300037471 Ga0395905_0025179 Ga0395905_0025179_3345_3977 205
2426 3300037471 Ga0395905_0062686 Ga0395905_0062686_2437_3069 205
2427 3300037471 Ga0395905_0309978 Ga0395905_0309978_650_1279 205
2428 3300037471 Ga0395905_0319229 Ga0395905_0319229_335_1009 205
2429 3300038443 Ga0395901_0000052 Ga0395901_0000052_41454_42086 205
2430 3300038443 Ga0395901_0283560 Ga0395901_0283560_241_873 205
2431 3300038443 Ga0395901_0829454 Ga0395901_0829454_241_873 205
2432 3300041406 Ga0439439_0001395 Ga0439439_0001395_3132_3776 205
2433 3300041411 Ga0439466_0037058 Ga0439466_0037058_757_1401 205
2434 3300041999 Ga0439433_0002575 Ga0439433_0002575_639_1283 205
2435 3300042006 Ga0439432_007884 Ga0439432_007884_377_1021 205
2436 3300042007 Ga0439449_0011887 Ga0439449_0011887_735_1379 205
2437 3300042010 Ga0439452_008677 Ga0439452_008677_861_1505 205
2438 3300042014 Ga0439457_007317 Ga0439457_007317_453_1097 205
2439 3300042134 Ga0450898_014182 Ga0450898_014182_199_843 205
2440 3300042531 Ga0450918_038670 Ga0450918_038670_164_808 205
2441 3300044656 Ga0466969_0048374 Ga0466969_0048374_297_932 205
2442 3300044684 Ga0466966_0000520 Ga0466966_0000520_9949_10584 205
2443 3300044693 Ga0466961_0001611 Ga0466961_0001611_4820_5455 205
2444 3300044706 Ga0466964_0002239 Ga0466964_0002239_5925_6560 205
2445 3300044719 Ga0466971_0000766 Ga0466971_0000766_4454_5089 205
2446 3300044765 Ga0466970_0009347 Ga0466970_0009347_1839_2474 205
2447 3300044765 Ga0466970_0344828 Ga0466970_0344828_58_690 205
2448 3300044842 Ga0466957_0154548 Ga0466957_0154548_794_1429 205
2449 3300045049 Ga0466959_0002155 Ga0466959_0002155_7217_7852 205
2450 3300045049 Ga0466959_0134957 Ga0466959_0134957_562_1197 205
2451 3300048905 Ga0496102_0522411 Ga0496102_0522411_48_740 205
2452 3300048906 Ga0496103_0092796 Ga0496103_0092796_490_1182 205
2453 3300048907 Ga0496104_0136901 Ga0496104_0136901_77_736 205
2454 3300048909 Ga0496106_0225905 Ga0496106_0225905_595_1287 205
2455 3300048911 Ga0496108_0246671 Ga0496108_0246671_381_1073 205
2456 3300048912 Ga0496109_0049788 Ga0496109_0049788_464_1108 205
2457 3300048914 Ga0496111_0146713 Ga0496111_0146713_980_1624 205
2458 3300048915 Ga0496112_0468843 Ga0496112_0468843_377_1069 205
2459 3300048921 Ga0496118_0277937 Ga0496118_0277937_205_897 205
2460 3300048924 Ga0496121_0002995 Ga0496121_0002995_4582_5274 205
2461 3300048928 Ga0496125_0049403 Ga0496125_0049403_2844_3473 205
2462 3300048928 Ga0496125_0077365 Ga0496125_0077365_1579_2214 205
2463 3300050493 nmdc:mga0k408_48206_c1 nmdc:mga0k408_48206_c1_946_1584 205
2464 3300050496 nmdc:mga07m45_116063_c1 nmdc:mga07m45_116063_c1_495_1139 205
2465 3300050496 nmdc:mga07m45_49774_c1 nmdc:mga07m45_49774_c1_1600_2238 205
2466 3300050516 nmdc:mga0sz30_28989_c1 nmdc:mga0sz30_28989_c1_907_1554 205
2467 3300061719 Ga0466962_0000390 Ga0466962_0000390_8563_9198 205
2468 iso_pu_bacteria 2928027323 2928027418 205
2469 iso_pu_bacteria 2984555340 2984558280 205
2470 iso_pu_bacteria 2984564862 2984567340 205
2471 iso_pu_bacteria 2993356040 2993358406 205
2472 3300003187 JGI25151J46595_10000578 JGI25151J46595_1000057813 206
2473 3300003203 JGI25406J46586_10039609 JGI25406J46586_100396092 206
2474 3300003215 JGI25153J46596_10023022 JGI25153J46596_100230222 206
2475 3300003781 Ga0055536_1010784 Ga0055536_10107842 206
2476 3300003792 Ga0055540_1007610 Ga0055540_10076103 206
2477 3300003794 Ga0055531_10002687 Ga0055531_100026874 206
2478 3300005539 Ga0068853_100499159 Ga0068853_1004991592 206
2479 3300005983 Ga0081540_1101212 Ga0081540_11012121 206
2480 3300005985 Ga0081539_10016704 Ga0081539_100167042 206
2481 3300006048 Ga0075363_100208713 Ga0075363_1002087132 206
2482 3300006186 Ga0075369_10107696 Ga0075369_101076961 206
2483 3300021361 Ga0213872_10000001 Ga0213872_1000000184 206
2484 3300021361 Ga0213872_10000057 Ga0213872_100000579 206
2485 3300025292 Ga0209676_1008273 Ga0209676_10082735 206
2486 3300025294 Ga0209025_1000327 Ga0209025_100032713 206
2487 3300025297 Ga0209758_1000130 Ga0209758_100013040 206
2488 3300025297 Ga0209758_1006363 Ga0209758_10063634 206
2489 3300025298 Ga0209050_1004575 Ga0209050_10045753 206
2490 3300025303 Ga0209051_1002656 Ga0209051_10026566 206
2491 3300025304 Ga0209257_1003444 Ga0209257_10034446 206
2492 3300025304 Ga0209257_1003910 Ga0209257_10039107 206
2493 3300025904 Ga0207647_10297342 Ga0207647_102973422 206
2494 3300025942 Ga0207689_10388922 Ga0207689_103889222 206
2495 3300026041 Ga0207639_10061810 Ga0207639_100618102 206
2496 3300028794 Ga0307515_10000051 Ga0307515_10000051153 206
2497 3300030522 Ga0307512_10095042 Ga0307512_100950421 206
2498 3300031456 Ga0307513_10027606 Ga0307513_100276062 206
2499 3300031507 Ga0307509_10443146 Ga0307509_104431462 206
2500 3300031649 Ga0307514_10003152 Ga0307514_1000315211 206
2501 3300031730 Ga0307516_10001544 Ga0307516_100015445 206
2502 3300032004 Ga0307414_10061353 Ga0307414_100613532 206
2503 3300039447 Ga0436361_0898788 Ga0436361_0898788_306_944 206
2504 3300041452 Ga0451793_0547434 Ga0451793_0547434_143_796 206
2505 3300041460 Ga0451802_0096045 Ga0451802_0096045_849_1511 206
2506 3300041460 Ga0451802_1562148 Ga0451802_1562148_134_796 206
2507 3300044693 Ga0466961_0212923 Ga0466961_0212923_152_832 206
2508 3300046507 Ga0495606_0096342 Ga0495606_0096342_678_1316 206
2509 3300046512 Ga0495610_0047506 Ga0495610_0047506_723_1376 206
2510 3300046512 Ga0495610_0072807 Ga0495610_0072807_93_719 206
2511 3300046515 Ga0495620_0139770 Ga0495620_0139770_263_916 206
2512 3300046522 Ga0495643_0040345 Ga0495643_0040345_1148_1801 206
2513 3300046558 Ga0495633_0014146 Ga0495633_0014146_602_1243 206
2514 3300047472 Ga0495686_0054480 Ga0495686_0054480_87_740 206
2515 3300048091 Ga0495626_0005067 Ga0495626_0005067_503_1141 206
2516 3300050493 nmdc:mga0k408_39979_c1 nmdc:mga0k408_39979_c1_535_1188 206
2517 3300050493 nmdc:mga0k408_59964_c1 nmdc:mga0k408_59964_c1_1112_1765 206
2518 3300050493 nmdc:mga0k408_71113_c1 nmdc:mga0k408_71113_c1_1045_1698 206
2519 3300050494 nmdc:mga06z11_214770_c1 nmdc:mga06z11_214770_c1_266_919 206
2520 3300050496 nmdc:mga07m45_128729_c1 nmdc:mga07m45_128729_c1_224_877 206
2521 3300050516 nmdc:mga0sz30_72792_c1 nmdc:mga0sz30_72792_c1_240_884 206
2522 3300053157 Ga0500624_000057 Ga0500624_000057_26420_27061 206
2523 iso_pu_bacteria 2599185354 2600203925 206
2524 iso_pu_bacteria 2751185897 2753766884 206
2525 3300025298 Ga0209050_1001066 Ga0209050_10010664 207
2526 3300027312 Ga0209371_1016528 Ga0209371_10165282 207
2527 3300030500 Ga0268256_1018095 Ga0268256_10180953 207
2528 3300046453 Ga0495627_000256 Ga0495627_000256_53271_53912 207
2529 3300046471 Ga0495650_0011752 Ga0495650_0011752_3123_3764 207
2530 3300046500 Ga0495596_0000041 Ga0495596_0000041_87699_88343 207
2531 3300046501 Ga0495607_0147154 Ga0495607_0147154_260_904 207
2532 3300046507 Ga0495606_0105124 Ga0495606_0105124_997_1641 207
2533 3300046512 Ga0495610_0000220 Ga0495610_0000220_54563_55204 207
2534 3300046515 Ga0495620_0112915 Ga0495620_0112915_305_946 207
2535 3300046518 Ga0495631_0034294 Ga0495631_0034294_991_1632 207
2536 3300046519 Ga0495632_0001875 Ga0495632_0001875_15406_16047 207
2537 3300046519 Ga0495632_0054778 Ga0495632_0054778_1101_1745 207
2538 3300046522 Ga0495643_0087462 Ga0495643_0087462_919_1563 207
2539 3300046522 Ga0495643_0142573 Ga0495643_0142573_439_1083 207
2540 3300046538 Ga0495609_0002284 Ga0495609_0002284_10675_11319 207
2541 3300046660 Ga0495625_0063208 Ga0495625_0063208_1009_1653 207
2542 3300046692 Ga0495671_0058653 Ga0495671_0058653_785_1429 207
2543 3300047470 Ga0495681_0000065 Ga0495681_0000065_53795_54436 207
2544 3300048919 Ga0496116_0000017 Ga0496116_0000017_440747_441388 207
2545 3300048920 Ga0496117_0140450 Ga0496117_0140450_670_1311 207
2546 3300048924 Ga0496121_0011488 Ga0496121_0011488_927_1568 207
2547 3300048925 Ga0496122_0005245 Ga0496122_0005245_1235_1876 207
2548 3300048926 Ga0496123_0000389 Ga0496123_0000389_71735_72376 207
2549 3300048927 Ga0496124_0003230 Ga0496124_0003230_11716_12357 207
2550 3300048928 Ga0496125_0008813 Ga0496125_0008813_9670_10311 207
2551 3300048929 Ga0496126_0003106 Ga0496126_0003106_10709_11350 207
2552 iso_pu_bacteria 2597490356 2599104038 207
2553 iso_pu_bacteria 2643221609 2644063016 207
2554 iso_pu_bacteria 2643221611 2644074323 207
2555 iso_pu_bacteria 2846952575 2846957078 207
2556 iso_pu_bacteria 2848858292 2848863085 207
2557 3300046507 Ga0495606_0225330 Ga0495606_0225330_64_708 208
2558 3300049679 Ga0501249_001240 Ga0501249_001240_718_1344 208
2559 3300009545 Ga0105237_10328568 Ga0105237_103285683 209
2560 3300048921 Ga0496118_0056839 Ga0496118_0056839_990_1646 209
2561 3300048924 Ga0496121_0224832 Ga0496121_0224832_476_1132 209
2562 3300049574 Ga0501038_0155419 Ga0501038_0155419_1018_1647 209
2563 3300050516 nmdc:mga0sz30_55584_c2 nmdc:mga0sz30_55584_c2_76_732 209
2564 iso_pu_bacteria 2829745981 2829747086 210
2565 iso_pu_bacteria 2861691609 2861693939 210
2566 3300060353 Ga0501082_0477470 Ga0501082_0477470_351_1004 211
2567 3300009148 Ga0105243_10203654 Ga0105243_102036542 212
2568 3300048925 Ga0496122_0000218 Ga0496122_0000218_101214_101852 212
2569 3300048926 Ga0496123_0000089 Ga0496123_0000089_168965_169603 212
2570 3300044693 Ga0466961_0001185 Ga0466961_0001185_6342_7025 213
2571 3300044765 Ga0466970_0073710 Ga0466970_0073710_493_1176 213
2572 3300044842 Ga0466957_0003671 Ga0466957_0003671_7765_8448 213
2573 3300045049 Ga0466959_0145969 Ga0466959_0145969_707_1390 213
2574 3300061719 Ga0466962_0003130 Ga0466962_0003130_1016_1699 213
2575 iso_pu_bacteria 2738541275 2738710192 214
2576 iso_pu_bacteria 2738541301 2738848617 214
2577 iso_pu_bacteria 2738541304 2738864346 214
2578 iso_pu_bacteria 2738543022 2739296864 214
2579 iso_pu_bacteria 2738543033 2739358542 214
2580 iso_pu_bacteria 2928100450 2928101837 214
2581 iso_pu_bacteria 2928959182 2928959929 214
2582 2162886007 SwRhRL2b_contig_2021842 SwRhRL2b_0078.00007030 218
2583 3300002074 JGI24748J21848_1001189 JGI24748J21848_10011892 218
2584 3300005289 Ga0065704_10000861 Ga0065704_100008615 218
2585 3300005335 Ga0070666_10173422 Ga0070666_101734221 218
2586 3300005347 Ga0070668_100008517 Ga0070668_1000085177 218
2587 3300005353 Ga0070669_100000081 Ga0070669_10000008124 218
2588 3300005355 Ga0070671_100002352 Ga0070671_1000023526 218
2589 3300005367 Ga0070667_100105992 Ga0070667_1001059922 218
2590 3300005843 Ga0068860_100035096 Ga0068860_1000350962 218
2591 3300009011 Ga0105251_10085017 Ga0105251_100850172 218
2592 3300009092 Ga0105250_10004033 Ga0105250_100040333 218
2593 3300009177 Ga0105248_10025205 Ga0105248_100252054 218
2594 3300013306 Ga0163162_10215261 Ga0163162_102152612 218
2595 3300025711 Ga0207696_1003756 Ga0207696_10037567 218
2596 3300025735 Ga0207713_1008971 Ga0207713_10089714 218
2597 3300025903 Ga0207680_10159548 Ga0207680_101595482 218
2598 3300025923 Ga0207681_10000620 Ga0207681_1000062014 218
2599 3300025931 Ga0207644_10004099 Ga0207644_100040992 218
2600 3300025941 Ga0207711_10346410 Ga0207711_103464101 218
2601 3300025972 Ga0207668_10010722 Ga0207668_100107224 218
2602 3300025986 Ga0207658_10010661 Ga0207658_100106614 218
2603 3300026088 Ga0207641_10678972 Ga0207641_106789722 218
2604 3300028381 Ga0268264_10006644 Ga0268264_100066442 218
2605 3300048903 Ga0496100_0024428 Ga0496100_0024428_298_954 218
2606 3300048905 Ga0496102_0000141 Ga0496102_0000141_83327_83983 218
2607 3300048906 Ga0496103_0000172 Ga0496103_0000172_27930_28586 218
2608 3300048907 Ga0496104_0000759 Ga0496104_0000759_23176_23832 218
2609 3300048908 Ga0496105_0000073 Ga0496105_0000073_20004_20660 218
2610 3300048909 Ga0496106_0504940 Ga0496106_0504940_19_675 218
2611 3300048910 Ga0496107_0014627 Ga0496107_0014627_3926_4582 218
2612 3300048914 Ga0496111_0146723 Ga0496111_0146723_990_1646 218
2613 3300048915 Ga0496112_0013518 Ga0496112_0013518_592_1248 218
2614 3300048916 Ga0496113_0000128 Ga0496113_0000128_874_1530 218
2615 3300048918 Ga0496115_0411352 Ga0496115_0411352_346_1002 218
2616 3300048919 Ga0496116_0029591 Ga0496116_0029591_2641_3297 218
2617 3300048920 Ga0496117_0011691 Ga0496117_0011691_4808_5464 218
2618 3300048921 Ga0496118_0002045 Ga0496118_0002045_26071_26727 218
2619 3300048922 Ga0496119_0000040 Ga0496119_0000040_75964_76620 218
2620 3300048923 Ga0496120_0001244 Ga0496120_0001244_8331_8987 218
2621 3300048924 Ga0496121_0001289 Ga0496121_0001289_8926_9582 218
2622 3300048925 Ga0496122_0000456 Ga0496122_0000456_27931_28587 218
2623 3300048926 Ga0496123_0001560 Ga0496123_0001560_27810_28466 218
2624 3300048927 Ga0496124_0001448 Ga0496124_0001448_30714_31370 218
2625 3300048928 Ga0496125_0001681 Ga0496125_0001681_27931_28587 218
2626 3300048929 Ga0496126_0000044 Ga0496126_0000044_251656_252312 218

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00510

COX3

Cytochrome c oxidase subunit III

57

251

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
6uxt-assembly1.cif.gz_A crystal structure of unknown function protein yfdx from shigella flexneri 0.9248 86 122
7cub-assembly1.cif.gz_C 2.55-angstrom cryo-em structure of cytochrome bo3 from escherichia coli in native membrane 0.8896 36 215
7rh5-assembly1.cif.gz_S mycobacterial ciii2civ2 supercomplex, inhibitor free 0.8718 40 212
7cub-assembly1.cif.gz_C 2.55-angstrom cryo-em structure of cytochrome bo3 from escherichia coli in native membrane 0.8673 36 215
7e1v-assembly1.cif.gz_G cryo-em structure of apo hybrid respiratory supercomplex consisting of mycobacterium tuberculosis complexiii and mycobacterium smegmatis complexiv 0.8574 40 218
ID Description Score Start End Superfamily
af_Q2FZK1_13_198_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.884 34 216 1.20.120.80
af_Q2FZK1_13_198_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.8664 34 216 1.20.120.80
af_P9WP67_20_203_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.8619 40 218 1.20.120.80
af_P9WP67_20_203_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.8272 40 218 1.20.120.80
3u8vA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);IL-4 antagonist (De novo design) like domain 0.8143 85 197 1.20.120.660
ID Description Score Start End GO Terms
AF-A0A2M9TGN6-F1-model_v4 Cytochrome bo(3) ubiquinol oxidase subunit 3 (Cytochrome o ubiquinol oxidase subunit 3) (Oxidase bo(3) subunit 3) (Ubiquinol oxidase polypeptide III) (Ubiquinol oxidase subunit 3) 0.9556 62 215 GO:0004129
GO:0005886
GO:0009486
GO:0019646
GO:0020037
AF-A0A2Z3QYH4-F1-model_v4 Heme-copper oxidase subunit III family profile domain-containing protein 0.9556 80 216 GO:0004129
GO:0005886
GO:0019646
AF-A0A5U6TQ07-F1-model_v4 Cytochrome bo(3) ubiquinol oxidase subunit 3 (Cytochrome o ubiquinol oxidase subunit 3) (Oxidase bo(3) subunit 3) (Ubiquinol oxidase polypeptide III) (Ubiquinol oxidase subunit 3) 0.9555 73 215 GO:0004129
GO:0005886
GO:0009486
GO:0019646
AF-A0A6F8XYK9-F1-model_v4 cytochrome-c oxidase (EC 7.1.1.9) (Cytochrome aa3 subunit 3) (Cytochrome c oxidase polypeptide III) 0.9549 75 214 GO:0004129
GO:0005886
GO:0019646
AF-A0A316WCB9-F1-model_v4 Cytochrome o ubiquinol oxidase subunit III 0.9458 65 212 GO:0004129
GO:0005886
GO:0019646

Feature Viewer

pLDDT pTM Quality
70.47 0.63 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map