metagRoot

F496979

General Info

Members	Datasets	Scaffolds	Average Seq Length
2651	1425	5302	556

Family's Representative Sequence

Representative Sequence	3300050491\|nmdc:mga00v17_824_c1\|nmdc:mga00v17_824_c1_1314_3317
Length	667
Sequence	MLGRNGYSKFAFEPAYFFRFKPLKRTFVGFCSNFTLFQRFMLISNGWFRGFMPFVLYSRRYNGRRFCLLLFSIVRFRFLIDGDGVAQGLAVSGRFSDFPRSLFQGDTILPTVASDIEIARAAAKKPITEIGARLGISPEDLVPYGHDKAKISAEFIKAQSTKNDGKLILVTAINPTPAGEGKTTTTVGLGDGLNRIGKNAMICVREPSLGPCFGTKGGAAGGGYAQVVPMEDINLHFTGDFHAITSAHNLLAAMVDNHIYWGNELNIDVRRVTWRRVMDMNDRALREIVGSLGGVANGFPREGGFDITVASEVMAILCLASDLEDLERRLGNIIVAYRTDKTPVFARDLKADGAMAVLLKDAMQPNLVQTLENNPAFVHGGPFANIAHGCNSVIATKTALKLVDYVVTEAGFGADLGAEKFFDIKCRKAGLKPDAAVIVATVRALKMNGGVAKEDLGQENVEALTRGCSNLGRHVANVRKFGVPVVVAINHFISDTDAEVQAVKDYVAHLGAEAILCRHWAEGSAGIEELAWKVVEMAQSDTAKFEPIYPDDMPLMEKIEAVAAKIYHAGEVTATKAVRDQLKAWEEQGYGKLPVCMAKTQYSFSTDPTLRGAPEGHVVPVREVRLSAGAGFIVVITGEIMTMPGLPRSPAAERIMLNEQGYIEGLF

Samples

	Sample ID	Description	Type	Environment
1	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
2	3300001915	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7	Metagenome	Rhizosphere
3	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
4	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
5	3300001990	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3	Metagenome	Rhizosphere
6	3300002704	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB	Metagenome	Unclassified
7	3300002705	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS	Metagenome	Unclassified
8	3300002737	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA	Metagenome	Endosphere
9	3300002738	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA	Metagenome	Unclassified
10	3300002739	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA	Metagenome	Endosphere
11	3300002741	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL	Metagenome	Unclassified
12	3300002773	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS	Metagenome	Endosphere
13	3300002774	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA	Metagenome	Endosphere
14	3300002987	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB	Metagenome	Endosphere
15	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
16	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
17	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
18	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
19	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
20	3300003374	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF	Metagenome	Endosphere
21	3300003578	Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Unclassified
22	3300003759	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2	Metagenome	Endosphere
23	3300003762	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2	Metagenome	Endosphere
24	3300003763	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2	Metagenome	Endosphere
25	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
26	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
27	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
28	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
29	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
30	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
31	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
32	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
33	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
34	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
35	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
36	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
37	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
38	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
39	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
40	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
41	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
42	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
43	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
44	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
45	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
46	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
47	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
48	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
49	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
50	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
51	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
52	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
53	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
54	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
55	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
56	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
57	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
58	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
59	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
60	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
61	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
62	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
63	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
64	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
65	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
66	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
67	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
68	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
69	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
70	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
71	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
72	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
73	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
74	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
75	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
76	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
77	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
78	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
79	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
80	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
81	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
82	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
83	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
84	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
85	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
86	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
87	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
88	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
89	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
90	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
91	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
92	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
93	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
94	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
95	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
96	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
97	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
98	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
99	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
100	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
101	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
102	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
103	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
104	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
105	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
106	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
107	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
108	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
109	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
110	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
111	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
112	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
113	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
114	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
115	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
116	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
117	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
118	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
119	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
120	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
121	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
122	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
123	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
124	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
125	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
126	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
127	3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Metagenome	Rhizosphere
128	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
129	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
130	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
131	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
132	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
133	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
134	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
135	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
136	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
137	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
138	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
139	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
140	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
141	3300009765	Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule	Metagenome	Nodule
142	3300009766	Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule	Metagenome	Nodule
143	3300009986	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG	Metagenome	Rhizosphere
144	3300009987	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG	Metagenome	Rhizosphere
145	3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Metagenome	Rhizosphere
146	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
147	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
148	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
149	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
150	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
151	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
152	3300013249	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06	Metagenome	Rhizosphere
153	3300013250	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05	Metagenome	Rhizosphere
154	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
155	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
156	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
157	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
158	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
159	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
160	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
161	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
162	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
163	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
164	3300015690	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05	Metagenome	Rhizosphere
165	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
166	3300021320	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3	Metagenome	Nodule
167	3300021321	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1	Metagenome	Nodule
168	3300021327	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2	Metagenome	Nodule
169	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
170	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
171	3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Metagenome	Unclassified
172	3300022739	Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules	Metagenome	Nodule
173	3300022740	Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules	Metagenome	Nodule
174	3300025206	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2)	Metagenome	Unclassified
175	3300025208	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
176	3300025226	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
177	3300025229	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
178	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
179	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
180	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
181	3300025246	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2)	Metagenome	Unclassified
182	3300025250	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2)	Metagenome	Unclassified
183	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
184	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
185	3300025256	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2)	Metagenome	Unclassified
186	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
187	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
188	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
189	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
190	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
191	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
192	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
193	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
194	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
195	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
196	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
197	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
198	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
199	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
200	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
201	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
202	3300025711	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
203	3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
204	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
205	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
206	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
207	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
208	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
209	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
210	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
211	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
212	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
213	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
214	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
215	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
216	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
217	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
218	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
219	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
220	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
221	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
222	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
223	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
224	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
225	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
226	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
227	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
228	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
229	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
230	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
231	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
232	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
233	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
234	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
235	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
236	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
237	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
238	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
239	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
240	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
241	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
242	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
243	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
244	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
245	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
246	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
247	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
248	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
249	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
250	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
251	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
252	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
253	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
254	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
255	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
256	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
257	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
258	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
259	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
260	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
261	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
262	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
263	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
264	3300027312	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2)	Metagenome	Rhizosphere
265	3300027360	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2)	Metagenome	Rhizosphere
266	3300027378	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2)	Metagenome	Rhizosphere
267	3300027395	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2)	Metagenome	Rhizosphere
268	3300027462	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2)	Metagenome	Rhizosphere
269	3300027617	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
270	3300027666	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2)	Metagenome	Nodule
271	3300027682	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
272	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
273	3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
274	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
275	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
276	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
277	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
278	3300028558	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG	Metagenome	Rhizosphere
279	3300028577	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG	Metagenome	Rhizosphere
280	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
281	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
282	3300029957	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG	Metagenome	Rhizosphere
283	3300030083	Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1	Metagenome	Unclassified
284	3300030500	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3)	Metagenome	Rhizosphere
285	3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Metagenome	Unclassified
286	3300031090	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
287	3300031235	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG	Metagenome	Rhizosphere
288	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
289	3300031239	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG	Metagenome	Rhizosphere
290	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
291	3300031242	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG	Metagenome	Rhizosphere
292	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
293	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
294	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
295	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
296	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
297	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
298	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
299	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
300	3300031665	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3	Metagenome	Rhizosphere
301	3300031691	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA	Metagenome	Rhizosphere
302	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
303	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
304	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
305	3300031728	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC	Metagenome	Rhizosphere
306	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
307	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
308	3300031733	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1	Metagenome	Rhizosphere
309	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
310	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
311	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
312	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
313	3300031967	Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules	Metagenome	Nodule
314	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
315	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
316	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
317	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
318	3300032133	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA	Metagenome	Rhizosphere
319	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
320	3300033430	Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules	Metagenome	Nodule
321	3300033464	Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules	Metagenome	Nodule
322	3300033527	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
323	3300033541	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
324	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
325	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
326	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
327	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
328	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
329	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
330	3300035120	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5	Metagenome	Rhizosphere
331	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
332	3300035241	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4	Metagenome	Rhizosphere
333	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
334	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
335	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
336	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
337	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
338	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
339	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
340	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
341	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
342	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
343	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
344	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
345	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
346	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
347	3300037588	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA	Metagenome	Rhizosphere
348	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
349	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
350	3300038705	Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1	Metagenome	Unclassified
351	3300038725	Seagrass microbial communities from Seahorse Key, FL, USA - HV0818	Metagenome	Unclassified
352	3300038726	Seagrass microbial communities from Seahorse Key, FL, USA - TH0319	Metagenome	Unclassified
353	3300039062	Seagrass microbial communities from Seahorse Key, FL, USA - HH0818	Metagenome	Unclassified
354	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
355	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
356	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
357	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
358	3300041404	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272	Metagenome	Rhizosphere
359	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
360	3300041511	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG	Metagenome	Unclassified
361	3300042001	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542	Metagenome	Rhizosphere
362	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
363	3300042133	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134	Metagenome	Rhizosphere
364	3300042156	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593	Metagenome	Rhizosphere
365	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
366	3300042436	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520	Metagenome	Rhizosphere
367	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
368	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
369	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
370	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
371	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
372	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
373	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
374	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
375	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
376	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
377	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
378	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
379	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
380	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
381	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
382	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
383	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
384	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
385	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
386	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
387	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
388	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
389	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
390	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
391	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
392	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
393	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
394	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
395	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
396	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
397	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
398	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
399	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
400	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
401	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
402	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
403	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
404	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
405	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
406	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
407	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
408	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
409	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
410	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
411	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
412	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
413	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
414	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
415	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
416	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
417	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
418	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
419	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
420	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
421	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
422	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
423	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
424	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
425	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
426	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
427	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
428	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
429	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
430	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
431	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
432	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
433	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
434	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
435	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
436	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
437	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
438	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
439	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
440	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
441	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
442	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
443	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
444	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
445	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
446	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
447	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
448	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
449	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
450	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
451	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
452	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
453	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
454	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
455	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
456	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
457	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
458	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
459	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
460	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
461	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
462	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
463	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
464	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
465	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
466	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
467	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
468	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
469	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
470	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
471	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
472	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
473	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
474	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
475	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
476	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
477	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
478	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
479	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
480	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
481	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
482	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
483	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
484	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
485	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
486	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
487	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
488	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
489	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
490	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
491	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
492	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
493	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
494	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
495	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
496	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
497	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
498	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
499	3300049766	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought	Metagenome	Rhizosphere
500	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
501	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
502	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
503	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
504	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
505	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
506	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
507	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
508	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
509	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
510	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
511	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
512	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
513	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
514	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
515	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
516	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
517	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
518	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
519	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
520	3300053079	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere	Metagenome	Endosphere
521	3300053083	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere	Metagenome	Rhizosphere
522	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
523	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
524	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
525	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
526	3300053103	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere	Metagenome	Endosphere
527	3300053104	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere	Metagenome	Endosphere
528	3300053108	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere	Metagenome	Endosphere
529	3300053109	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere	Metagenome	Endosphere
530	3300053118	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere	Metagenome	Endosphere
531	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
532	3300053122	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere	Metagenome	Endosphere
533	3300053125	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere	Metagenome	Endosphere
534	3300053130	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere	Metagenome	Endosphere
535	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
536	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
537	3300053151	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere	Metagenome	Endosphere
538	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
539	3300053155	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere	Metagenome	Endosphere
540	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
541	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
542	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
543	3300053731	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere	Metagenome	Endosphere
544	3300053735	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere	Metagenome	Endosphere
545	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
546	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
547	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
548	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere
549	2503198000	Mesorhizobium opportunistum WSM2075	Isolate	Nodule
550	2508501122	Ensifer yinggardensis WSM1721	Isolate	Nodule
551	2508501123	Mesorhizobium sp. WSM3626	Isolate	Nodule
552	2508501127	Mesorhizobium sp. WSM2561	Isolate	Nodule
553	2509276018	Mesorhizobium ciceri CMG6	Isolate	Nodule
554	2509276019	Ensifer aridi TW10	Isolate	Nodule
555	2509276021	Rhizobium leguminosarum bv. trifolii WSM597	Isolate	Nodule
556	2509276022	Mesorhizobium australicum WSM2073	Isolate	Nodule
557	2509276033	Rhizobium leguminosarum bv. trifolii WSM2012	Isolate	Nodule
558	2510065019	Rhizobium leguminosarum bv. trifolii WSM1689	Isolate	Nodule
559	2510065057	Sinorhizobium meliloti WSM1022	Isolate	Nodule
560	2510065059	Mesorhizobium ciceri WSM4083	Isolate	Nodule
561	2510461069	Rhizobium sp. PDO1-076	Isolate	Rhizosphere
562	2510461076	Rhizobium leguminosarum bv. trifolii TA1	Isolate	Nodule
563	2510917022	Rhizobium sp. AP16	Isolate	Rhizosphere
564	2510917026	Rhizobium sp. CF80	Isolate	Rhizosphere
565	2510917028	Rhizobium sp. CF122	Isolate	Rhizosphere
566	2510917030	Rhizobium sp. CF142	Isolate	Rhizosphere
567	2511231027	Phyllobacterium sp. YR531	Isolate	Rhizosphere
568	2511231052	Sinorhizobium meliloti AK58	Isolate	Nodule
569	2512047086	Sinorhizobium arboris LMG 14919	Isolate	Nodule
570	2512875016	Mesorhizobium japonicum R7A	Isolate	Nodule
571	2512875024
572	2512875026	Sinorhizobium medicae WSM1115	Isolate	Nodule
573	2513237084	Rhizobium leguminosarum bv. viciae UPM1131	Isolate	Nodule
574	2513237085	Rhizobium leguminosarum bv. viciae UPM1137	Isolate	Nodule
575	2513237086	Sinorhizobium meliloti MVII-I	Isolate	Nodule
576	2513237087	Azorhizobium doebereinerae UFLA1-100	Isolate	Nodule
577	2513237088	Rhizobium mesoamericanum STM6155	Isolate	Nodule
578	2513237089	Sinorhizobium medicae DI28	Isolate	Nodule
579	2513237090	Mesorhizobium sp. WSM3224	Isolate	Nodule
580	2513237091	Sinorhizobium meliloti RRI128	Isolate	Nodule
581	2513237093	Rhizobium leguminosarum bv. phaseoli FA23	Isolate	Nodule
582	2513237103	Rhizobium leguminosarum bv. viciae VF39	Isolate	Nodule
583	2513237138	Rhizobium favelukesii OR191	Isolate	Nodule
584	2513237140	Sinorhizobium meliloti GVPV12	Isolate	Nodule
585	2513237143	Sinorhizobium meliloti Mlalz-1	Isolate	Nodule
586	2513237144	Rhizobium sullae WSM1592	Isolate	Nodule
587	2513237146	Rhizobium mongolense USDA 1844 (Illumina)	Isolate	Nodule
588	2513237156	Sinorhizobium medicae WSM1369	Isolate	Nodule
589	2513237159	Rhizobium giardinii bv. giardinii H152	Isolate	Nodule
590	2513237160	Sinorhizobium medicae WSM244	Isolate	Nodule
591	2513237162	Rhizobium ruizarguesonis GB30	Isolate	Nodule
592	2513237164	Mesorhizobium loti CJ3sym	Isolate	Nodule
593	2513237305	Mesorhizobium amorphae CCNWGS0123	Isolate	Nodule
594	2513237351	Mesorhizobium alhagi CCNWXJ12-2	Isolate	Nodule
595	2515075009	Rhizobium leguminosarum bv. viciae 248	Isolate	Nodule
596	2515154107	Sinorhizobium meliloti 4H41	Isolate	Nodule
597	2515154113	Rhizobium ruizarguesonis Vc2	Isolate	Nodule
598	2515154114	Rhizobium ruizarguesonis Vh3	Isolate	Nodule
599	2515154116	Rhizobium ruizarguesonis Ps8	Isolate	Nodule
600	2515154134	Rhizobium gallicum bv. gallicum R602sp	Isolate	Nodule
601	2516143018	Ensifer sp. BR816	Isolate	Nodule
602	2516653046	Sinorhizobium meliloti BO21CC	Isolate	Nodule
603	2516653077	Rhizobium acaciae WSM1481	Isolate	Nodule
604	2516653085	Rhizobium leguminosarum bv. phaseoli 4292	Isolate	Nodule
605	2517093000	Rhizobium leguminosarum bv. trifolii SRDI943	Isolate	Nodule
606	2517287029	Rhizobium leguminosarum bv. trifolii SRDI565	Isolate	Nodule
607	2517487022	Sinorhizobium medicae WSM4191	Isolate	Nodule
608	2519899620	Rhizobium sp. Pop5	Isolate	Nodule
609	2523231067	Pleomorphomonas oryzae DSM 16300	Isolate	Unclassified
610	2524023207	Ensifer sp. USDA 6670	Isolate	Nodule
611	2524023209	Rhizobium leucaenae USDA 9039	Isolate	Nodule
612	2529292951	Rhizobium sp. CCGE 510	Isolate	Nodule
613	2534681796	Rhizobium grahamii CCGE 502	Isolate	Nodule
614	2545555834	Methylobacterium sp. WSM2598	Isolate	Nodule
615	2551306084	Sinorhizobium meliloti 5A14	Isolate	Nodule
616	2551306085	Sinorhizobium meliloti AE608H	Isolate	Nodule
617	2551306086	Sinorhizobium meliloti AK11	Isolate	Nodule
618	2551306087	Sinorhizobium meliloti A0643DD	Isolate	Nodule
619	2551306089	Sinorhizobium meliloti 1A42	Isolate	Nodule
620	2551306090	Sinorhizobium meliloti A0641M	Isolate	Nodule
621	2551306091	Sinorhizobium meliloti C0431A	Isolate	Nodule
622	2551306092	Sinorhizobium meliloti AK75	Isolate	Nodule
623	2551306093	Sinorhizobium meliloti C0438LL	Isolate	Nodule
624	2551306519	Bacillus sp. WBUNB004	Isolate	Rhizosphere
625	2558860100	Sinorhizobium sp. PC2	Isolate	Nodule
626	2582581283	Rhizobium sp. OK665	Isolate	Rhizosphere
627	2582581294	Rhizobium sp. CF394	Isolate	Rhizosphere
628	2582581298	Rhizobium alamii YR540	Isolate	Rhizosphere
629	2582581299	Rhizobium leguminosarum OV483	Isolate	Rhizosphere
630	2582581304	Rhizobium sp. YR519	Isolate	Rhizosphere
631	2582581306	Rhizobium sp. YR295	Isolate	Rhizosphere
632	2582581307	Rhizobium sp. YR060	Isolate	Rhizosphere
633	2582581308	Rhizobium sp. OK494	Isolate	Rhizosphere
634	2582581315	Agrobacterium rhizogenes YR147	Isolate	Rhizosphere
635	2582581316	Agrobacterium rhizogenes OK036	Isolate	Rhizosphere
636	2582581865	Rhizobium sp. CF258	Isolate	Rhizosphere
637	2582581866	Rhizobium sp. CF097	Isolate	Rhizosphere
638	2582581867	Rhizobium sp. OV201	Isolate	Rhizosphere
639	2585427526	Rhizobium leguminosarum OV152	Isolate	Rhizosphere
640	2585427527	Rhizobium lusitanum YR374	Isolate	Rhizosphere
641	2585427528	Rhizobium leguminosarum CF307	Isolate	Rhizosphere
642	2585427529	Rhizobium alamii YR584	Isolate	Rhizosphere
643	2585427530	Rhizobium tropici YR635	Isolate	Rhizosphere
644	2585427531	Agrobacterium rhizogenes YR530	Isolate	Rhizosphere
645	2585427590	Rhizobium sp. CF048	Isolate	Rhizosphere
646	2585427593	Rhizobium tropici CF286	Isolate	Rhizosphere
647	2585427594	Rhizobium sp. YR528	Isolate	Rhizosphere
648	2585427608	Agrobacterium rhizogenes OV677	Isolate	Rhizosphere
649	2585427609	Agrobacterium rhizogenes CF263	Isolate	Rhizosphere
650	2585427633	Neorhizobium galegae bv. officinalis HAMBI 1141	Isolate	Nodule
651	2585427634	Neorhizobium galegae bv. orientalis HAMBI 540	Isolate	Nodule
652	2585428125	Agrobacterium rhizogenes CF262	Isolate	Rhizosphere
653	2593339131	Bacillus sp. UNCCL81	Isolate	Unclassified
654	2597489875	Mesorhizobium ciceri ca181	Isolate	Unclassified
655	2599185170	Rhizobium mongolense USDA 1844 (PacBio)	Isolate	Nodule
656	2599185236	Rhizobium sp. NFR07	Isolate	Rhizoplane
657	2599185301	Mesorhizobium sp. NFR06	Isolate	Rhizoplane
658	2599185352	Sinorhizobium sp. NFACC03	Isolate	Rhizoplane
659	2600254933	Rhizobium sp. NFR12	Isolate	Rhizoplane
660	2615840624	Rhizobium aethiopicum HBR26	Isolate	Nodule
661	2615840626	Rhizobium lusitanum P1-7	Isolate	Nodule
662	2615840698	Rhizobium multihospitium HAMBI 2975	Isolate	Nodule
663	2617270742	Rhizobium miluonense HAMBI 2971	Isolate	Nodule
664	2643221547	Pseudolabrys sp. Root1462	Isolate	Unclassified
665	2643221551	Mesorhizobium sp. Root1471	Isolate	Unclassified
666	2643221555	Mesorhizobium sp. Root554	Isolate	Unclassified
667	2643221557	Ensifer sp. Root558	Isolate	Unclassified
668	2643221558	Rhizobium sp. Root149	Isolate	Unclassified
669	2643221575	Microbacterium sp. Root61	Isolate	Unclassified
670	2643221588	Altererythrobacter sp. Root672	Isolate	Unclassified
671	2643221599	Rhizobium sp. Root708	Isolate	Unclassified
672	2643221607	Rhizobium sp. Root73	Isolate	Unclassified
673	2643221610	Ensifer sp. Root74	Isolate	Unclassified
674	2643221618	Ensifer sp. Root231	Isolate	Unclassified
675	2643221626	Ensifer sp. Root31	Isolate	Unclassified
676	2643221627	Mesorhizobium sp. Root102	Isolate	Unclassified
677	2643221634	Rhizobium sp. Root1203	Isolate	Unclassified
678	2643221636	Rhizobium sp. Root1204	Isolate	Unclassified
679	2643221637	Rhizobium sp. Root1212	Isolate	Unclassified
680	2643221643	Rhizobium sp. Root1220	Isolate	Unclassified
681	2643221653	Rhizobium sp. Root1240	Isolate	Unclassified
682	2643221655	Ensifer sp. Root1252	Isolate	Unclassified
683	2643221659	Ensifer sp. Root127	Isolate	Unclassified
684	2643221660	Methylibium sp. Root1272	Isolate	Unclassified
685	2643221668	Ensifer sp. Root423	Isolate	Unclassified
686	2643221675	Ensifer sp. Root1298	Isolate	Unclassified
687	2643221680	Ensifer sp. Root1312	Isolate	Unclassified
688	2643221686	Rhizobium sp. Root1334	Isolate	Unclassified
689	2643221688	Rhizobium sp. Root482	Isolate	Unclassified
690	2643221689	Rhizobium sp. Root483D2	Isolate	Unclassified
691	2643221698	Ensifer sp. Root142	Isolate	Unclassified
692	2643221712	Ensifer sp. Root258	Isolate	Unclassified
693	2643221718	Rhizobium sp. Root268	Isolate	Unclassified
694	2643221719	Rhizobium sp. Root274	Isolate	Unclassified
695	2643221723	Ensifer sp. Root278	Isolate	Unclassified
696	2643221726	Ensifer sp. Root954	Isolate	Unclassified
697	2643221729	Bacillus sp. Root11	Isolate	Unclassified
698	2643221730	Bacillus sp. Root131	Isolate	Unclassified
699	2643221731	Bacillus sp. Root147	Isolate	Unclassified
700	2643221732	Bacillus sp. Root239	Isolate	Unclassified
701	2643221733	Bosea sp. Root381	Isolate	Unclassified
702	2643221734	Bosea sp. Root670	Isolate	Unclassified
703	2657244999	Sinorhizobium sojae CCBAU 05684	Isolate	Unclassified
704	2667528174	Rhizobium sp. NFR17	Isolate	Rhizoplane
705	2671180139	Chelativorans sp. A52C2	Isolate	Unclassified
706	2684622632	Bacillus cereus 905	Isolate	Unclassified
707	2687453392	Mesorhizobium ciceri biserrulae WSM1284	Isolate	Unclassified
708	2690316117	Sinorhizobium fredii CCBAU 45436	Isolate	Unclassified
709	2693429783	Mesorhizobium sp. LCM 4577	Isolate	Rhizosphere
710	2693429784	Mesorhizobium sp. LCM 4576	Isolate	Rhizosphere
711	2695420987	Bacillus thuringiensis KNU-07	Isolate	Unclassified
712	2703719227	Bacillus mycoides GOE6	Isolate	Rhizosphere
713	2713897090	Paracoccus sphaerophysae HAMBI 3106	Isolate	Nodule
714	2718217882	Rhizobium sp. N741	Isolate	Nodule
715	2718217927	Rhizobium sp. N324	Isolate	Nodule
716	2718217997	Rhizobium phaseoli sv. phaseoli R723	Isolate	Nodule
717	2718218009	Rhizobium sp. N561	Isolate	Nodule
718	2718218199	Rhizobium phaseoli sv. phaseoli N261	Isolate	Nodule
719	2718218232	Rhizobium phaseoli sv. phaseoli N161	Isolate	Nodule
720	2718218233	Rhizobium phaseoli sv. phaseoli R744	Isolate	Nodule
721	2718218235	Rhizobium phaseoli sv. phaseoli R620	Isolate	Nodule
722	2718218269	Rhizobium phaseoli sv. phaseoli N671	Isolate	Nodule
723	2718218363	Rhizobium sp. N113	Isolate	Nodule
724	2718218365	Rhizobium sp. N731	Isolate	Nodule
725	2718218366	Rhizobium sp. N621	Isolate	Nodule
726	2718218423	Rhizobium sp. N941	Isolate	Nodule
727	2718218445	Bacillus sp. B25(2016b)	Isolate	Rhizosphere
728	2721755514	Rhizobium sp. N6212	Isolate	Nodule
729	2721755556	Rhizobium phaseoli sv. phaseoli N931	Isolate	Nodule
730	2721755684	Rhizobium phaseoli sv. phaseoli N841	Isolate	Nodule
731	2721755685	Rhizobium phaseoli sv. phaseoli R611	Isolate	Nodule
732	2721755686	Mesorhizobium amorphae CCNWGS0123	Isolate	Nodule
733	2721755809	Rhizobium sp. N541	Isolate	Nodule
734	2721755810	Rhizobium sp. N871	Isolate	Nodule
735	2721755819	Rhizobium phaseoli sv. phaseoli N771	Isolate	Nodule
736	2721755822	Rhizobium phaseoli sv. phaseoli R650	Isolate	Nodule
737	2721755823	Rhizobium phaseoli sv. phaseoli R630	Isolate	Nodule
738	2724679232	Rhizobium leguminosarum Vaf12	Isolate	Unclassified
739	2728369352	Rhizobium phaseoli sv. phaseoli N831	Isolate	Nodule
740	2728369365	Rhizobium sp. N1341	Isolate	Nodule
741	2728369397	Rhizobium sp. N1314	Isolate	Nodule
742	2738541281	Methylobacterium sp. GV094	Isolate	Unclassified
743	2738541293	Rhizobium sp. GV031	Isolate	Unclassified
744	2738541295	Bacillus sp. OK085	Isolate	Unclassified
745	2738541317	Rhizobium halophytocola DSM 21600	Isolate	Unclassified
746	2738541333	Rhizobium sophoriradicis CCBAU 03470	Isolate	Unclassified
747	2738541358	Bacillus sp. OV752	Isolate	Unclassified
748	2738543006	Bacillus sp. OK077	Isolate	Unclassified
749	2738543031	Pleomorphomonas sp. CF100	Isolate	Unclassified
750	2738543032	Methylobacterium sp. GV104	Isolate	Unclassified
751	2751185821	Ensifer shofinae CCBAU 251167	Isolate	Unclassified
752	2756170246	Mesorhizobium loti DSM 2626	Isolate	Nodule
753	2765235802	Phyllobacterium bourgognense 31-25a	Isolate	Rhizoplane
754	2765235942	Rhizobium sp. WYCCWR10014	Isolate	Nodule
755	2767802442	Phyllobacterium brassicacearum 29-15	Isolate	Rhizoplane
756	2775506902	Phyllobacterium zundukense Tri-48	Isolate	Unclassified
757	2775506904	Phyllobacterium zundukense Tri-38	Isolate	Unclassified
758	2775507049	Rhizobium sp. ACO-34A	Isolate	Unclassified
759	2775507177	Bacillus sp. AFS055030	Isolate	Unclassified
760	2775507192	Bacillus sp. AFS041924	Isolate	Unclassified
761	2775507266	Rhizobium tropici PRF 81	Isolate	Nodule
762	2791355082	Ensifer alkalisoli YIC4027	Isolate	Nodule
763	2791355091	Sinorhizobium sp. FG01	Isolate	Nodule
764	2791355092	Sinorhizobium sp. NG07B	Isolate	Nodule
765	2791355094	Sinorhizobium sp. BJ1	Isolate	Nodule
766	2791355123	Mesorhizobium sophorae ICMP 19535	Isolate	Unclassified
767	2791355256	Rhizobium sp. M10	Isolate	Nodule
768	2791355259	Rhizobium hidalgonense FH14	Isolate	Nodule
769	2791355260	Rhizobium sp. L9	Isolate	Nodule
770	2791355261	Rhizobium sp. J15	Isolate	Nodule
771	2791355262	Rhizobium sp. M1	Isolate	Nodule
772	2791355263	Rhizobium chutanense C5	Isolate	Nodule
773	2791355264	Rhizobium sp. S9	Isolate	Nodule
774	2791355265	Rhizobium sp. H4	Isolate	Nodule
775	2791355266	Rhizobium sp. L43	Isolate	Nodule
776	2791355267	Rhizobium sp. L18	Isolate	Nodule
777	2802428858	Sinorhizobium medicae M14-1	Isolate	Nodule
778	2802428859	Sinorhizobium medicae SF3.41	Isolate	Nodule
779	2802428860	Sinorhizobium medicae M19-1	Isolate	Nodule
780	2802428861	Sinorhizobium medicae USDA1037	Isolate	Nodule
781	2802428862	Sinorhizobium medicae M7-4	Isolate	Nodule
782	2802428863	Sinorhizobium medicae M26-2	Isolate	Nodule
783	2802429268	Sinorhizobium sojae CCBAU 05684	Isolate	Unclassified
784	2802429605	Rhizobium sophoriradicis L101	Isolate	Nodule
785	2802429606	Rhizobium sophoriradicis JJW1	Isolate	Nodule
786	2802429633	Rhizobium anhuiense J3	Isolate	Nodule
787	2802429634	Rhizobium anhuiense S10	Isolate	Nodule
788	2802429635	Rhizobium anhuiense Y27	Isolate	Nodule
789	2802429636	Rhizobium anhuiense JX3	Isolate	Nodule
790	2802429637	Rhizobium anhuiense C15	Isolate	Nodule
791	2818991272	Rhizobium sp. SLBN-4	Isolate	Unclassified
792	2818991441	Niallia circulans 3243	Isolate	Rhizosphere
793	2818991443	Bacillus thuringiensis 1230	Isolate	Unclassified
794	2818991448	Rhizobium miluonense 1234	Isolate	Unclassified
795	2818991453	Rhizobium lusitanum 1158	Isolate	Unclassified
796	2818991461	Neorhizobium alkalisoli 1225	Isolate	Unclassified
797	2818991465	Priestia megaterium 3291	Isolate	Rhizosphere
798	2818991467	Bosea vestrisii 3192	Isolate	Unclassified
799	2821123053	Rhizobium cellulosilyticum 1193	Isolate	Unclassified
800	2821443989	Inquilinus ginsengisoli 584	Isolate	Unclassified
801	2828305725	Xanthobacter tagetidis DSM 11105	Isolate	Unclassified
802	2829745981	Methylorubrum rhodinum DSM 2163	Isolate	Rhizosphere
803	2837651117	Pseudohoeflea suaedae YC6898	Isolate	Unclassified
804	2837678835	Jiella endophytica CBS5Q-3	Isolate	Unclassified
805	2838016132	Rhizobium phaseoli SEMIA 4071	Isolate	Nodule
806	2838022645	Rhizobium aethiopicum SEMIA 4074	Isolate	Nodule
807	2838029111	Rhizobium tropici SEMIA 4079	Isolate	Nodule
808	2838035591	Rhizobium mongolense SEMIA 4087	Isolate	Nodule
809	2838042994	Rhizobium esperanzae SEMIA 4089	Isolate	Nodule
810	2838048938	Rhizobium pisi 27/80	Isolate	Nodule
811	2838061910	Rhizobium phaseoli L15	Isolate	Nodule
812	2838068647	Rhizobium esperanzae VC28	Isolate	Nodule
813	2838074704	Sinorhizobium terangae SEMIA 6460	Isolate	Unclassified
814	2838661181	Rhizobium mongolense SEMIA 402	Isolate	Nodule
815	2838668709	Rhizobium sophoriradicis SEMIA 403	Isolate	Nodule
816	2838680041	Rhizobium leguminosarum SEMIA 415	Isolate	Nodule
817	2838686498	Rhizobium leguminosarum SEMIA 416	Isolate	Nodule
818	2838694306	Rhizobium leguminosarum SEMIA 421	Isolate	Nodule
819	2838701080	Rhizobium aethiopicum SEMIA 428	Isolate	Nodule
820	2838707686	Rhizobium leguminosarum SEMIA 430	Isolate	Nodule
821	2838729681	Rhizobium leguminosarum SEMIA 445	Isolate	Nodule
822	2838736955	Rhizobium cellulosilyticum SEMIA 448	Isolate	Nodule
823	2838742623	Rhizobium leguminosarum SEMIA 449	Isolate	Nodule
824	2839993093	Phyllobacterium endophyticum PEPV15	Isolate	Unclassified
825	2840764183	Phyllobacterium sophorae CCBAU 03422	Isolate	Unclassified
826	2840878972	Albibacillus kandeliae J95	Isolate	Rhizosphere
827	2841734538	Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1	Isolate	Nodule
828	2841840854	Rhizobium cellulosilyticum SEMIA 444	Isolate	Nodule
829	2841851746	Rhizobium leguminosarum SEMIA 498	Isolate	Nodule
830	2841864319	Rhizobium leguminosarum SEMIA 4052	Isolate	Nodule
831	2841911363	Bosea caraganae RCAM04685	Isolate	Nodule
832	2841917233	Bosea caraganae RCAM04680	Isolate	Nodule
833	2842077413	Rhizobium leguminosarum SEMIA 422	Isolate	Nodule
834	2842110456	Rhizobium esperanzae SEMIA 414	Isolate	Nodule
835	2842118031	Rhizobium esperanzae SEMIA 420	Isolate	Nodule
836	2842140634	Rhizobium cellulosilyticum SEMIA 452	Isolate	Nodule
837	2842146304	Rhizobium sophoriradicis SEMIA 454	Isolate	Nodule
838	2842156927	Rhizobium leguminosarum SEMIA 459	Isolate	Nodule
839	2842163707	Rhizobium leguminosarum SEMIA 460	Isolate	Nodule
840	2842192696	Rhizobium esperanzae SEMIA 468	Isolate	Nodule
841	2842198810	Rhizobium aethiopicum SEMIA 470	Isolate	Nodule
842	2842205361	Rhizobium etli SEMIA 471	Isolate	Nodule
843	2842217011	Rhizobium leguminosarum SEMIA 475	Isolate	Nodule
844	2842229732	Rhizobium leguminosarum SEMIA 481	Isolate	Nodule
845	2842237096	Rhizobium leguminosarum SEMIA 482	Isolate	Nodule
846	2842243621	Rhizobium leguminosarum SEMIA 483	Isolate	Nodule
847	2842250916	Rhizobium etli SEMIA 484	Isolate	Nodule
848	2842257432	Rhizobium leguminosarum SEMIA 485	Isolate	Nodule
849	2842264693	Rhizobium phaseoli SEMIA 487	Isolate	Nodule
850	2842271015	Rhizobium leguminosarum SEMIA 488	Isolate	Nodule
851	2842278818	Rhizobium etli SEMIA 489	Isolate	Nodule
852	2842285085	Rhizobium lentis SEMIA 490	Isolate	Nodule
853	2842291075	Rhizobium leguminosarum SEMIA 491	Isolate	Nodule
854	2842298080	Rhizobium leucaenae SEMIA 492	Isolate	Nodule
855	2842304105	Rhizobium leguminosarum SEMIA 499	Isolate	Nodule
856	2842311132	Rhizobium phaseoli SEMIA 4002	Isolate	Nodule
857	2842317721	Rhizobium etli SEMIA 4004	Isolate	Nodule
858	2842341865	Rhizobium leguminosarum SEMIA 4011	Isolate	Nodule
859	2842357229	Rhizobium leucaenae SEMIA 4015	Isolate	Nodule
860	2842363717	Rhizobium leguminosarum SEMIA 4016	Isolate	Nodule
861	2842370503	Rhizobium leguminosarum SEMIA 4022	Isolate	Nodule
862	2842377471	Rhizobium leguminosarum SEMIA 4024	Isolate	Nodule
863	2842384541	Rhizobium leguminosarum SEMIA 4025	Isolate	Nodule
864	2842395702	Rhizobium ecuadorense SEMIA 4029	Isolate	Nodule
865	2842402390	Rhizobium lentis SEMIA 4033	Isolate	Nodule
866	2842409023	Rhizobium lentis SEMIA 4034	Isolate	Nodule
867	2842415677	Rhizobium lentis SEMIA 4036	Isolate	Nodule
868	2842422224	Rhizobium esperanzae SEMIA 4042	Isolate	Nodule
869	2842428310	Rhizobium phaseoli SEMIA 4050	Isolate	Nodule
870	2842434925	Rhizobium esperanzae SEMIA 4051	Isolate	Nodule
871	2842441272	Rhizobium esperanzae SEMIA 4053	Isolate	Nodule
872	2842447887	Rhizobium esperanzae SEMIA 4055	Isolate	Nodule
873	2842462802	Rhizobium phaseoli SEMIA 4057	Isolate	Nodule
874	2842469257	Rhizobium phaseoli SEMIA 4058	Isolate	Nodule
875	2842475841	Rhizobium tropici SEMIA 4059	Isolate	Nodule
876	2842482326	Rhizobium lusitanum SEMIA 4060	Isolate	Nodule
877	2842489311	Rhizobium sophoriradicis SEMIA 4061	Isolate	Nodule
878	2842495871	Rhizobium etli SEMIA 4062	Isolate	Nodule
879	2842502639	Rhizobium tropici SEMIA 4063	Isolate	Nodule
880	2842509118	Rhizobium paranaense SEMIA 4064	Isolate	Nodule
881	2842521101	Rhizobium giardinii SEMIA 4084	Isolate	Nodule
882	2842694124	Methylopila sp. R-72369	Isolate	Unclassified
883	2842698319	Methylobacterium sp. R-72139	Isolate	Unclassified
884	2842775625	Roseomonas sp. R-71825	Isolate	Unclassified
885	2842871566	Phyllobacterium sp. R-73111	Isolate	Unclassified
886	2842882022	Bacillus sp. R-71893	Isolate	Unclassified
887	2844002411	Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1	Isolate	Nodule
888	2844009547	Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1	Isolate	Nodule
889	2844104063	Bosea sp. Tri-39	Isolate	Nodule
890	2844163670	Ensifer sp. 1H6	Isolate	Unclassified
891	2844454524	Rhizobium leguminosarum bv. viciae BIHB 1217	Isolate	Nodule
892	2844533157	Inquilinus sp. R-72501 v. 2	Isolate	Unclassified
893	2847417321	Sinorhizobium fredii CCBAU 45436	Isolate	Unclassified
894	2847670302	Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1	Isolate	Nodule
895	2847686936	Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1	Isolate	Nodule
896	2848297114	Croceibacterium ferulae EGI 63111	Isolate	Unclassified
897	2848992105	Sinorhizobium fredii CCBAU 25509	Isolate	Unclassified
898	2851246043	Bosea sp. Tri-54	Isolate	Nodule
899	2852387548	Rhizobium jaguaris CCGE525	Isolate	Unclassified
900	2854681122	Luteovulum sphaeroides SCJ	Isolate	Unclassified
901	2854896431	Neorhizobium alkalisoli DSM 21826	Isolate	Unclassified
902	2854916844	Neorhizobium huautlense DSM 21817	Isolate	Unclassified
903	2855825444	Sinorhizobium meliloti CXM1-105	Isolate	Nodule
904	2855839649	Sinorhizobium meliloti AK555	Isolate	Unclassified
905	2855872281	Sinorhizobium fredii PCH1	Isolate	Nodule
906	2856320880	Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1	Isolate	Nodule
907	2856328259	Mesorhizobium sp. Primo-B	Isolate	Nodule
908	2856334872	Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1	Isolate	Nodule
909	2856342000	Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1	Isolate	Nodule
910	2856349417	Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1	Isolate	Nodule
911	2856364286	Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1	Isolate	Nodule
912	2857349434	Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1	Isolate	Nodule
913	2857367948	Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1	Isolate	Nodule
914	2857516855	Rhizobium sp. R-72456	Isolate	Unclassified
915	2857531043	Neorhizobium sp. R-72160	Isolate	Unclassified
916	2857586860	Bacillus sp. R-71935	Isolate	Unclassified
917	2858800743	Sinorhizobium meliloti AK170	Isolate	Unclassified
918	2861691609	Methylorubrum thiocyanatum DSM 11490	Isolate	Rhizosphere
919	2869162929	Mesorhizobium sanjuanii BSA136	Isolate	Nodule
920	2869169390	Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1	Isolate	Nodule
921	2869234852	Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1	Isolate	Nodule
922	2869242130	Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1	Isolate	Nodule
923	2869249662	Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1	Isolate	Nodule
924	2869256925	Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0	Isolate	Nodule
925	2869264136	Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1	Isolate	Nodule
926	2869271264	Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1	Isolate	Nodule
927	2869278585	Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1	Isolate	Nodule
928	2869285874	Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1	Isolate	Nodule
929	2871429161	Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1	Isolate	Nodule
930	2871435913	Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0	Isolate	Nodule
931	2871451962	Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1	Isolate	Nodule
932	2871466892	Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1	Isolate	Nodule
933	2871474448	Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1	Isolate	Nodule
934	2871488783	Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1	Isolate	Nodule
935	2874102143	Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1	Isolate	Nodule
936	2874109183	Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1	Isolate	Nodule
937	2874116593	Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1	Isolate	Nodule
938	2874123672	Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1	Isolate	Nodule
939	2874139085	Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1	Isolate	Nodule
940	2874146452	Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1	Isolate	Nodule
941	2874155637	Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1	Isolate	Nodule
942	2874162495	Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1	Isolate	Nodule
943	2874168670	Mesorhizobium kowhaii Ach-343	Isolate	Nodule
944	2876363079	Mesorhizobium loti R7ANS::ICEMlSym2042	Isolate	Nodule
945	2876369609	Mesorhizobium sp. USDA-HM6	Isolate	Unclassified
946	2876377896	Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1	Isolate	Nodule
947	2876386047	Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1	Isolate	Nodule
948	2876399893	Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1	Isolate	Nodule
949	2876406927	Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1	Isolate	Nodule
950	2876413966	Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1	Isolate	Nodule
951	2876420981	Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1	Isolate	Nodule
952	2878730984	Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1	Isolate	Nodule
953	2878738818	Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1	Isolate	Nodule
954	2878745973	Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1	Isolate	Nodule
955	2878753008	Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1	Isolate	Nodule
956	2878774303	Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1	Isolate	Nodule
957	2878781027	Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1	Isolate	Nodule
958	2878788777	Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1	Isolate	Nodule
959	2881147464	Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1	Isolate	Nodule
960	2881155292	Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1	Isolate	Nodule
961	2881161766	Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1	Isolate	Nodule
962	2881845957	Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1	Isolate	Nodule
963	2881853255	Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1	Isolate	Nodule
964	2881861095	Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2	Isolate	Nodule
965	2882632389	Mesorhizobium waimense ICMP19557	Isolate	Unclassified
966	2882912400	Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1	Isolate	Nodule
967	2883291878	Hypericibacter terrae R5913	Isolate	Rhizosphere
968	2883354860	Hypericibacter adhaerens R5959	Isolate	Rhizosphere
969	2885305155	Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1	Isolate	Nodule
970	2885312484	Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2	Isolate	Nodule
971	2885318864	Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1	Isolate	Nodule
972	2885326080	Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1	Isolate	Nodule
973	2885342637	Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1	Isolate	Nodule
974	2885350715	Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1	Isolate	Nodule
975	2888337043	Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1	Isolate	Nodule
976	2888343758	Mesorhizobium sp. AA22	Isolate	Unclassified
977	2888350351	Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1	Isolate	Nodule
978	2889010040	Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1	Isolate	Nodule
979	2889016732	Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1	Isolate	Nodule
980	2889790730	Chelativorans xinjiangense lm93	Isolate	Rhizosphere
981	2889914905	Chelativorans alearense UJN715	Isolate	Rhizosphere
982	2891088606	Methylosinus sp. 3S-1	Isolate	Rhizosphere
983	2891373044	Shinella sp. AETb1-6	Isolate	Rhizosphere
984	2894652903	Phyllobacterium sp. SYP-B3895	Isolate	Rhizosphere
985	2894817345	Aureimonas psammosilenae YIM DR1026	Isolate	Unclassified
986	2896253425	Aurantiacibacter rhizosphaerae GH3-10	Isolate	Rhizosphere
987	2896384573	Ensifer sp. MPMI2T	Isolate	Unclassified
988	2898795034	Rhodobacter sp. SGA-6-6	Isolate	Rhizosphere
989	2899275550	Paracoccus hibiscisoli CCTCC AB2016182	Isolate	Rhizosphere
990	2899803654	Agrobacterium sp. a22-2	Isolate	Unclassified
991	2902330777	Methylobacterium sp. 2A	Isolate	Unclassified
992	2902405164	Methylobacterium sp. P1-11	Isolate	Unclassified
993	2903448605	Mesorhizobium japonicum Opo-235	Isolate	Nodule
994	2903492973	Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1	Isolate	Nodule
995	2903513507	Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2	Isolate	Nodule
996	2903521522	Mesorhizobium loti R7ANS::ICEMlSym2014	Isolate	Nodule
997	2903528002	Mesorhizobium loti R7ANS::ICEMlSym2037	Isolate	Nodule
998	2904524088	Priestia megaterium 1428	Isolate	Rhizosphere
999	2904578770	Phyllobacterium sp. 586	Isolate	Unclassified
1000	2906308376	Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1	Isolate	Nodule
1001	2906321335	Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1	Isolate	Nodule
1002	2906328253	Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1	Isolate	Nodule
1003	2906354277	Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1	Isolate	Nodule
1004	2906363423	Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1	Isolate	Nodule
1005	2906370794	Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1	Isolate	Nodule
1006	2906393657	Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1	Isolate	Nodule
1007	2906401398	Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1	Isolate	Nodule
1008	2906408224	Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1	Isolate	Nodule
1009	2906414383	Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1	Isolate	Nodule
1010	2913295892	Sinorhizobium kostiensis DSM 13372	Isolate	Nodule
1011	2913308742	Rhizobium halophytocola DSM 21600	Isolate	Unclassified
1012	2915980308	Sinorhizobium medicae USDA1149	Isolate	Nodule
1013	2915986958	Sinorhizobium meliloti USDA1659	Isolate	Nodule
1014	2915993759	Sinorhizobium meliloti USDA1336	Isolate	Nodule
1015	2916000859	Sinorhizobium meliloti USDA1562	Isolate	Nodule
1016	2916007675	Sinorhizobium meliloti USDA1289	Isolate	Nodule
1017	2916014648	Sinorhizobium meliloti USDA1583	Isolate	Nodule
1018	2916021584	Sinorhizobium meliloti USDA1550	Isolate	Nodule
1019	2916028427	Sinorhizobium meliloti USDA1613	Isolate	Nodule
1020	2916035215	Sinorhizobium meliloti 3011	Isolate	Nodule
1021	2916041962	Sinorhizobium meliloti USDA1795	Isolate	Nodule
1022	2916048683	Sinorhizobium meliloti USDA1796	Isolate	Nodule
1023	2916055098	Sinorhizobium meliloti USDA1770	Isolate	Nodule
1024	2916061851	Sinorhizobium medicae USDA1638	Isolate	Nodule
1025	2916076590	Sinorhizobium meliloti USDA1661	Isolate	Nodule
1026	2917554339	Chthonobacter rhizosphaerae yh7-1	Isolate	Rhizosphere
1027	2917699015	Bosea sp. F3-2	Isolate	Rhizosphere
1028	2919051321	Sinomonas atrocyanea 1003	Isolate	Rhizosphere
1029	2919059106	Arthrobacter sp. 1088	Isolate	Rhizosphere
1030	2919100787	Rhizobium sp. 1399	Isolate	Rhizosphere
1031	2919119836	Phyllobacterium sp. 1468	Isolate	Rhizosphere
1032	2919143609	Priestia megaterium 1751	Isolate	Rhizosphere
1033	2919171160	Neorhizobium sp. 2083	Isolate	Unclassified
1034	2919408235	Rhizobium miluonense 3199	Isolate	Unclassified
1035	2919450847	Ancylobacter sp. 3268	Isolate	Rhizosphere
1036	2919517244	Priestia aryabhattai 3820	Isolate	Unclassified
1037	2919679072	Pseudotabrizicola sp. 4114	Isolate	Unclassified
1038	2919720352	Priestia megaterium 4340	Isolate	Unclassified
1039	2920107658	Aquisphaera insulae JC669	Isolate	Rhizosphere
1040	2920760137	Ensifer psoraleae CCBAU 65732	Isolate	Unclassified
1041	2920822456	Ensifer sesbaniae CCBAU 65729	Isolate	Unclassified
1042	2921201388	Sinorhizobium meliloti USDA1692	Isolate	Nodule
1043	2921208531	Sinorhizobium meliloti USDA1660	Isolate	Nodule
1044	2921237296	Sinorhizobium meliloti USDA1508	Isolate	Nodule
1045	2921244191	Sinorhizobium meliloti 2119	Isolate	Nodule
1046	2921250672	Sinorhizobium medicae USDA1169	Isolate	Nodule
1047	2921257292	Sinorhizobium meliloti USDA1320	Isolate	Nodule
1048	2921263974	Sinorhizobium meliloti USDA1107	Isolate	Nodule
1049	2921282425	Sinorhizobium meliloti USDA1203	Isolate	Nodule
1050	2921289301	Sinorhizobium meliloti USDA1730	Isolate	Nodule
1051	2921296804	Sinorhizobium meliloti USDA1200	Isolate	Nodule
1052	2922130491	Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1	Isolate	Nodule
1053	2922151315	Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1	Isolate	Nodule
1054	2922158528	Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1	Isolate	Nodule
1055	2922172374	Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1	Isolate	Nodule
1056	2922178524	Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1	Isolate	Nodule
1057	2922185730	Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1	Isolate	Nodule
1058	2923556063	Rhizobium tibeticum 3740	Isolate	Unclassified
1059	2924144063	Sinorhizobium meliloti USDA1022	Isolate	Nodule
1060	2924150972	Sinorhizobium meliloti USDA1700	Isolate	Nodule
1061	2924158325	Sinorhizobium meliloti USDA1146	Isolate	Nodule
1062	2924165586	Sinorhizobium meliloti USDA1264	Isolate	Nodule
1063	2924172951	Sinorhizobium meliloti USDA1626	Isolate	Nodule
1064	2924179722	Sinorhizobium meliloti USDA1280	Isolate	Nodule
1065	2924186466	Sinorhizobium meliloti USDA1389	Isolate	Nodule
1066	2924193448	Sinorhizobium meliloti USDA1158	Isolate	Nodule
1067	2924200457	Sinorhizobium meliloti USDA1007	Isolate	Nodule
1068	2924207177	Sinorhizobium meliloti USDA1589	Isolate	Nodule
1069	2924214083	Sinorhizobium meliloti USDA1702	Isolate	Nodule
1070	2924221636	Sinorhizobium meliloti USDA1416	Isolate	Nodule
1071	2924228884	Sinorhizobium meliloti USDA1581	Isolate	Nodule
1072	2924726620	Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1	Isolate	Nodule
1073	2924733363	Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1	Isolate	Nodule
1074	2924748358	Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2	Isolate	Nodule
1075	2924754689	Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1	Isolate	Nodule
1076	2924762789	Mesorhizobium sp. WSM4303	Isolate	Unclassified
1077	2924776078	Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1	Isolate	Nodule
1078	2924784321	Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1	Isolate	Nodule
1079	2928093941	Priestia aryabhattai 1389	Isolate	Rhizosphere
1080	2928521798	Phyllobacterium ifriqiyense 1451	Isolate	Rhizosphere
1081	2929004312	Priestia megaterium 1104	Isolate	Unclassified
1082	2929233124	Bacillus sp. R-74298 Hybrid assembly	Isolate	Unclassified
1083	2929297113	Heliophilum fasciatum MTM	Isolate	Rhizosphere
1084	2932426870	Paenarthrobacter sp. 4246	Isolate	Rhizosphere
1085	2933016740	Rhizobium sp. SEMIA 4085	Isolate	Nodule
1086	2933418574	Jeotgalibacillus campisalis 4120	Isolate	Rhizosphere
1087	2933570622	Rhizobium leguminosarum SEMIA 409	Isolate	Nodule
1088	2933586486	Rhizobium leguminosarum SEMIA 4039	Isolate	Nodule
1089	2933599457	Rhizobium phaseoli M3	Isolate	Nodule
1090	2935894831	Rhizobium leguminosarum SEMIA 419	Isolate	Nodule
1091	2935901341	Rhizobium leguminosarum SEMIA 4082	Isolate	Nodule
1092	2936361878	Neobacillus endophyticus BRMEA1	Isolate	Unclassified
1093	2936367885	Rhizobium changzhiense WYCCWR 11290	Isolate	Nodule
1094	2936375103	Rhizobium changzhiense WYCCWR 11317	Isolate	Nodule
1095	2936381700	Rhizobium chutanense C16	Isolate	Unclassified
1096	2936996657	Sinorhizobium meliloti USDA1025	Isolate	Nodule
1097	2937002841	Sinorhizobium meliloti USDA1006	Isolate	Nodule
1098	2937009748	Sinorhizobium meliloti USDA1162	Isolate	Nodule
1099	2937016420	Sinorhizobium meliloti USDA1027	Isolate	Nodule
1100	2937023124	Sinorhizobium meliloti USDA1335	Isolate	Nodule
1101	2937029754	Sinorhizobium medicae USDA1624	Isolate	Nodule
1102	2937036028	Sinorhizobium medicae USDA1608	Isolate	Nodule
1103	2937042894	Sinorhizobium meliloti USDA1687	Isolate	Nodule
1104	2937049772	Sinorhizobium meliloti USDA1691	Isolate	Nodule
1105	2937056579	Sinorhizobium meliloti USDA1357	Isolate	Nodule
1106	2937063883	Sinorhizobium meliloti USDA1808	Isolate	Nodule
1107	2937071275	Sinorhizobium meliloti USDA1623	Isolate	Nodule
1108	2937078374	Sinorhizobium medicae USDA1004	Isolate	Nodule
1109	2937084907	Sinorhizobium medicae USDA1664	Isolate	Nodule
1110	2937091812	Sinorhizobium meliloti USDA1221	Isolate	Nodule
1111	2937098957	Sinorhizobium meliloti USDA1519	Isolate	Nodule
1112	2937106411	Sinorhizobium meliloti USDA1214	Isolate	Nodule
1113	2937113482	Sinorhizobium meliloti USDA1180	Isolate	Nodule
1114	2937119839	Sinorhizobium meliloti USDA1790	Isolate	Nodule
1115	2937126314	Sinorhizobium meliloti USDA1612	Isolate	Nodule
1116	2937813078	Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1	Isolate	Nodule
1117	2937822353	Mesorhizobium neociceri CCANP35	Isolate	Nodule
1118	2937836603	Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1	Isolate	Nodule
1119	2937843397	Mesorhizobium xinjiangense lm94	Isolate	Rhizosphere
1120	2937848649	Mesorhizobium sp. WSM4310	Isolate	Unclassified
1121	2937861824	Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1	Isolate	Nodule
1122	2937868953	Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1	Isolate	Nodule
1123	2937877337	Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1	Isolate	Nodule
1124	2937891427	Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1	Isolate	Nodule
1125	2937972304	Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1	Isolate	Nodule
1126	2938014810	Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1	Isolate	Nodule
1127	2938917290	Bacillus sp. CR71	Isolate	Unclassified
1128	2939615513	Lactococcus lactis 1925	Isolate	Rhizosphere
1129	2939674588	Arthrobacter bambusae 3552	Isolate	Rhizosphere
1130	2941499720	Ensifer sp. 4252	Isolate	Rhizosphere
1131	2946787523	Sphingomonas faeni W4I17	Isolate	Rhizosphere
1132	2947426588	Bacillus sp. RZ2MS9	Isolate	Rhizosphere
1133	2954011201	Phyllobacterium ifrigiyense W4I11	Isolate	Rhizosphere
1134	2957375807	Sinorhizobium medicae USDA1632	Isolate	Nodule
1135	2957382221	Sinorhizobium meliloti USDA1919	Isolate	Nodule
1136	2957388812	Sinorhizobium meliloti USDA1195	Isolate	Nodule
1137	2957395598	Sinorhizobium meliloti USDA1237	Isolate	Nodule
1138	2957402308	Sinorhizobium meliloti USDA1794	Isolate	Nodule
1139	2957408893	Sinorhizobium meliloti USDA1163	Isolate	Nodule
1140	2957415311	Sinorhizobium meliloti USDA1724	Isolate	Nodule
1141	2957422303	Sinorhizobium meliloti USDA1497	Isolate	Nodule
1142	2957430029	Sinorhizobium meliloti USDA1590	Isolate	Nodule
1143	2957437181	Sinorhizobium medicae USDA1694	Isolate	Nodule
1144	2957443900	Sinorhizobium meliloti USDA1734	Isolate	Nodule
1145	2957450854	Sinorhizobium meliloti USDA1655	Isolate	Nodule
1146	2957457609	Sinorhizobium meliloti USDA1751	Isolate	Nodule
1147	2957464669	Sinorhizobium meliloti USDA1520	Isolate	Nodule
1148	2957471148	Sinorhizobium meliloti USDA1204	Isolate	Nodule
1149	2957478035	Sinorhizobium meliloti USDA1171	Isolate	Nodule
1150	2957484790	Sinorhizobium meliloti USDA1464	Isolate	Nodule
1151	2957491536	Sinorhizobium meliloti USDA1804	Isolate	Nodule
1152	2957498199	Sinorhizobium meliloti USDA1561	Isolate	Nodule
1153	2957505466	Sinorhizobium meliloti USDA1696	Isolate	Nodule
1154	2958034702	Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1	Isolate	Nodule
1155	2958041894	Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1	Isolate	Nodule
1156	2958064165	Mesorhizobium sp. SARCC-RB16n	Isolate	Unclassified
1157	2958071322	Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1	Isolate	Nodule
1158	2958084443	Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1	Isolate	Nodule
1159	2958100919	Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1	Isolate	Nodule
1160	2958108152	Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1	Isolate	Nodule
1161	2958115193	Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1	Isolate	Nodule
1162	2958122699	Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1	Isolate	Nodule
1163	2958130278	Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1	Isolate	Nodule
1164	2958137437	Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1	Isolate	Nodule
1165	2958158011	Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1	Isolate	Nodule
1166	2958172287	Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1	Isolate	Nodule
1167	2958179912	Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1	Isolate	Nodule
1168	2960319331	Priestia megaterium AFS057444	Isolate	Unclassified
1169	2960375949	Priestia megaterium AFS067084	Isolate	Unclassified
1170	2960584000	Sinorhizobium meliloti USDA1530	Isolate	Nodule
1171	2960591022	Sinorhizobium medicae USDA1066	Isolate	Nodule
1172	2960597568	Sinorhizobium meliloti 3085	Isolate	Nodule
1173	2960603979	Sinorhizobium meliloti USDA1580	Isolate	Nodule
1174	2960610863	Sinorhizobium meliloti USDA1792	Isolate	Nodule
1175	2960617483	Sinorhizobium meliloti USDA1719	Isolate	Nodule
1176	2960624210	Sinorhizobium meliloti USDA1415	Isolate	Nodule
1177	2960631154	Sinorhizobium medicae USDA1629	Isolate	Nodule
1178	2960637947	Sinorhizobium meliloti USDA1202	Isolate	Nodule
1179	2960645483	Sinorhizobium meliloti USDA1703	Isolate	Nodule
1180	2960652885	Sinorhizobium meliloti USDA1199	Isolate	Nodule
1181	2960660292	Sinorhizobium meliloti USDA1883	Isolate	Nodule
1182	2960667422	Sinorhizobium meliloti USDA1170	Isolate	Nodule
1183	2960674078	Sinorhizobium meliloti USDA1666	Isolate	Nodule
1184	2960680706	Sinorhizobium medicae USDA1150	Isolate	Nodule
1185	2960687367	Sinorhizobium meliloti USDA1462	Isolate	Nodule
1186	2961077736	Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1	Isolate	Nodule
1187	2961127735	Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1	Isolate	Nodule
1188	2961136820	Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1	Isolate	Nodule
1189	2961170736	Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1	Isolate	Nodule
1190	2961183825	Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1	Isolate	Nodule
1191	2963644680	Mesorhizobium japonicum R7A	Isolate	Nodule
1192	2964607997	Sinorhizobium meliloti USDA1212	Isolate	Nodule
1193	2964615318	Sinorhizobium meliloti USDA1248	Isolate	Nodule
1194	2964621998	Sinorhizobium meliloti USDA1235	Isolate	Nodule
1195	2964628898	Sinorhizobium meliloti USDA1191	Isolate	Nodule
1196	2964636051	Sinorhizobium meliloti USDA1594	Isolate	Nodule
1197	2964643177	Sinorhizobium meliloti USDA1760	Isolate	Nodule
1198	2964649959	Sinorhizobium meliloti USDA1591	Isolate	Nodule
1199	2964656573	Sinorhizobium meliloti USDA1308	Isolate	Nodule
1200	2964663802	Sinorhizobium meliloti USDA1688	Isolate	Nodule
1201	2964670856	Sinorhizobium meliloti USDA1211	Isolate	Nodule
1202	2964678106	Sinorhizobium meliloti USDA1210	Isolate	Nodule
1203	2964685014	Sinorhizobium meliloti USDA1232	Isolate	Nodule
1204	2964691889	Sinorhizobium meliloti USDA1379	Isolate	Nodule
1205	2964698721	Sinorhizobium meliloti USDA1656	Isolate	Nodule
1206	2964705432	Sinorhizobium meliloti USDA1614	Isolate	Nodule
1207	2964712639	Sinorhizobium meliloti USDA1616	Isolate	Nodule
1208	2964719344	Sinorhizobium meliloti USDA1456	Isolate	Nodule
1209	2965025482	Mesorhizobium sp. Primo-A	Isolate	Nodule
1210	2965032056	Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1	Isolate	Nodule
1211	2965040258	Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1	Isolate	Nodule
1212	2965047637	Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1	Isolate	Nodule
1213	2965062239	Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1	Isolate	Nodule
1214	2965089291	Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1	Isolate	Nodule
1215	2965110997	Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1	Isolate	Nodule
1216	2965119406	Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1	Isolate	Nodule
1217	2965761152	Bacillus sp. COPE52	Isolate	Unclassified
1218	2967664464	Sinorhizobium meliloti USDA1208	Isolate	Nodule
1219	2967671571	Sinorhizobium meliloti USDA1496	Isolate	Nodule
1220	2967678726	Sinorhizobium meliloti USDA1467	Isolate	Nodule
1221	2967686174	Sinorhizobium medicae USDA1641	Isolate	Nodule
1222	2967693043	Sinorhizobium meliloti USDA1183	Isolate	Nodule
1223	2967699805	Sinorhizobium meliloti USDA1695	Isolate	Nodule
1224	2967706974	Sinorhizobium meliloti USDA1206	Isolate	Nodule
1225	2967714385	Sinorhizobium meliloti USDA1023	Isolate	Nodule
1226	2967721400	Sinorhizobium meliloti USDA1742	Isolate	Nodule
1227	2967728569	Sinorhizobium medicae USDA1607	Isolate	Nodule
1228	2967735183	Sinorhizobium meliloti USDA1710	Isolate	Nodule
1229	2967742019	Sinorhizobium meliloti USDA1676	Isolate	Nodule
1230	2967748971	Sinorhizobium meliloti USDA1024A	Isolate	Nodule
1231	2967755722	Sinorhizobium meliloti USDA1302	Isolate	Nodule
1232	2967762386	Sinorhizobium meliloti USDA1397	Isolate	Nodule
1233	2967769361	Sinorhizobium meliloti USDA1005	Isolate	Nodule
1234	2967775926	Sinorhizobium meliloti USDA1678	Isolate	Nodule
1235	2967996073	Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1	Isolate	Nodule
1236	2968003550	Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1	Isolate	Nodule
1237	2968016561	Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1	Isolate	Nodule
1238	2968083720	Mesorhizobium erdmanii Opo-242	Isolate	Unclassified
1239	2968091066	Mesorhizobium sp. AA23	Isolate	Unclassified
1240	2968097103	Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1	Isolate	Nodule
1241	2968117919	Mesorhizobium atlanticum CNPSo 3140	Isolate	Unclassified
1242	2968128360	Mesorhizobium sp. WSM3873	Isolate	Unclassified
1243	2968138860	Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1	Isolate	Nodule
1244	2970019648	Sinorhizobium meliloti USDA1603	Isolate	Nodule
1245	2970026789	Sinorhizobium medicae USDA1611	Isolate	Nodule
1246	2970033650	Sinorhizobium meliloti USDA1565	Isolate	Nodule
1247	2970040964	Sinorhizobium meliloti USDA1501	Isolate	Nodule
1248	2970047711	Sinorhizobium meliloti USDA1793	Isolate	Nodule
1249	2970054988	Sinorhizobium meliloti USDA1031	Isolate	Nodule
1250	2970061556	Sinorhizobium meliloti USDA1810	Isolate	Nodule
1251	2970068827	Sinorhizobium meliloti USDA1227	Isolate	Nodule
1252	2970076120	Sinorhizobium meliloti USDA1706	Isolate	Nodule
1253	2970082768	Sinorhizobium meliloti USDA1803	Isolate	Nodule
1254	2970088815	Sinorhizobium meliloti USDA1819	Isolate	Nodule
1255	2970095765	Sinorhizobium meliloti USDA1225	Isolate	Nodule
1256	2970102677	Sinorhizobium meliloti USDA1325	Isolate	Nodule
1257	2970109326	Sinorhizobium meliloti USDA1186	Isolate	Nodule
1258	2970116247	Sinorhizobium meliloti USDA1566	Isolate	Nodule
1259	2970122695	Sinorhizobium medicae 3082	Isolate	Nodule
1260	2970129317	Sinorhizobium meliloti USDA1008	Isolate	Nodule
1261	2970136068	Sinorhizobium meliloti USDA1699	Isolate	Nodule
1262	2970143518	Sinorhizobium medicae USDA1652	Isolate	Nodule
1263	2970149975	Sinorhizobium meliloti USDA1215	Isolate	Nodule
1264	2970156795	Sinorhizobium meliloti USDA1491	Isolate	Nodule
1265	2970164137	Sinorhizobium meliloti USDA1018	Isolate	Nodule
1266	2970170962	Sinorhizobium meliloti USDA1571	Isolate	Nodule
1267	2970177841	Sinorhizobium meliloti USDA1533	Isolate	Nodule
1268	2970184632	Sinorhizobium meliloti USDA1593	Isolate	Nodule
1269	2970191845	Sinorhizobium meliloti USDA1187	Isolate	Nodule
1270	2970469710	Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1	Isolate	Nodule
1271	2970489779	Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1	Isolate	Nodule
1272	2970503327	Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1	Isolate	Nodule
1273	2970510686	Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0	Isolate	Nodule
1274	2970524798	Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1	Isolate	Nodule
1275	2970532167	Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1	Isolate	Nodule
1276	2970540015	Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1	Isolate	Nodule
1277	2970547951	Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1	Isolate	Nodule
1278	2970593180	Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1	Isolate	Nodule
1279	2970619444	Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1	Isolate	Nodule
1280	2970627176	Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1	Isolate	Nodule
1281	2977254563	Bacillus sp. SORGH_AS 510	Isolate	Unclassified
1282	2977516862	Sinorhizobium meliloti USDA1791	Isolate	Nodule
1283	2977523885	Sinorhizobium meliloti USDA1777	Isolate	Nodule
1284	2977530762	Sinorhizobium medicae USDA1606	Isolate	Nodule
1285	2977537788	Sinorhizobium meliloti USDA1184	Isolate	Nodule
1286	2977544691	Sinorhizobium medicae USDA1631	Isolate	Nodule
1287	2977551784	Sinorhizobium meliloti USDA1035	Isolate	Nodule
1288	2977558990	Sinorhizobium meliloti USDA1222	Isolate	Nodule
1289	2977565890	Sinorhizobium meliloti USDA1617	Isolate	Nodule
1290	2977572785	Sinorhizobium meliloti USDA1767	Isolate	Nodule
1291	2977579622	Sinorhizobium meliloti USDA1161	Isolate	Nodule
1292	2977821940	Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1	Isolate	Nodule
1293	2977828996	Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1	Isolate	Nodule
1294	2977843712	Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1	Isolate	Nodule
1295	2977851361	Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1	Isolate	Nodule
1296	2977872689	Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1	Isolate	Nodule
1297	2977898635	Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1	Isolate	Nodule
1298	2977922695	Mesorhizobium sp. WSM4305	Isolate	Unclassified
1299	2977935797	Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1	Isolate	Nodule
1300	2977942078	Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1	Isolate	Nodule
1301	2977950692	Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1	Isolate	Nodule
1302	2977957713	Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1	Isolate	Nodule
1303	2977986579	Mesorhizobium intechi BD68	Isolate	Unclassified
1304	2979083700	Bacillus toyonensis SORGH_AS 407	Isolate	Unclassified
1305	2979710463	Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1	Isolate	Nodule
1306	2979742915	Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1	Isolate	Nodule
1307	2979772303	Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1	Isolate	Nodule
1308	2979779861	Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1	Isolate	Nodule
1309	2979808191	Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1	Isolate	Nodule
1310	2987636660	Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1	Isolate	Nodule
1311	2987645492	Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1	Isolate	Nodule
1312	2987652177	Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1	Isolate	Nodule
1313	2987666974	Mesorhizobium sp. WSM4306	Isolate	Unclassified
1314	2987673487	Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1	Isolate	Nodule
1315	2989349275	Shinella kummerowiae CCBAU 25048	Isolate	Unclassified
1316	2989771324	Rhizobium rhizolycopersici DBTS2	Isolate	Rhizosphere
1317	2989776772	Rhizobium glycinendophyticum CL12	Isolate	Unclassified
1318	2996336353	Mesorhizobium sp. YM1C-6-2	Isolate	Unclassified
1319	2996341866	Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1	Isolate	Nodule
1320	2996348954	Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1	Isolate	Nodule
1321	2996386984	Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0	Isolate	Nodule
1322	2996887358	Rhizobium sp. R711	Isolate	Nodule
1323	2996893221	Rhizobium sp. R635	Isolate	Nodule
1324	3000135777	Unclassified bacterium M00.F.Ca.ET.205.01.1.1	Isolate	Unclassified
1325	3000376612	Enterobacteriaceae bacterium 4M9	Isolate	Rhizosphere
1326	3001892409	Neobacillus rhizophilus FJAT-49825	Isolate	Rhizosphere
1327	3002141150	Phyllobacterium sp. 628	Isolate	Unclassified
1328	3003665799	Methylobacterium aquaticum BG2	Isolate	Unclassified
1329	3003930520	Sinorhizobium sp. BG8	Isolate	Unclassified
1330	3004167301	Mesorhizobium loti 582	Isolate	Unclassified
1331	3004195979	Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1	Isolate	Nodule
1332	3004203850	Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1	Isolate	Nodule
1333	3004211236	Mesorhizobium sp. WSM4307	Isolate	Unclassified
1334	3004218560	Mesorhizobium sp. WSM4315	Isolate	Unclassified
1335	3004232784	Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1	Isolate	Nodule
1336	3004248173	Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1	Isolate	Nodule
1337	3004268573	Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1	Isolate	Nodule
1338	3004275668	Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1	Isolate	Nodule
1339	3004289098	Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1	Isolate	Nodule
1340	3004334049	Mesorhizobium huakuii 583	Isolate	Unclassified
1341	3005409236	Rhizobium sp. P32RR-XVIII	Isolate	Rhizosphere
1342	3005416602	Rhizobium sp. P40RR-XXII	Isolate	Rhizosphere
1343	3005445848	Rhizobium sp. WYJ-E13	Isolate	Unclassified
1344	3005452660	Rhizobium grahamii BG7	Isolate	Unclassified
1345	3006978542	Bacillus sp. FJAT-49705	Isolate	Rhizosphere
1346	637000159	Mesorhizobium japonicum MAFF 303099	Isolate	Unclassified
1347	639633055	Rhizobium leguminosarum bv. viciae 3841	Isolate	Unclassified
1348	641522639	Methylobacterium sp. 4-46	Isolate	Nodule
1349	643348564	Methylobacterium nodulans ORS 2060	Isolate	Nodule
1350	643692032	Sinorhizobium fredii NGR234	Isolate	Nodule
1351	648276728	Sinorhizobium meliloti BL225C	Isolate	Nodule
1352	649633066	Mesorhizobium ciceri bv. biserrulae WSM1271	Isolate	Nodule
1353	8001845381	Ancylobacter sonchi VKM B-3145	Isolate	Unclassified
1354	8002060224	Methylocystis sp. Sn-Cys	Isolate	Unclassified
1355	8002285264	Aminobacter anthyllidis LMG 26462	Isolate	Nodule
1356	8003992118	Sinorhizobium meliloti RRI128	Isolate	Nodule
1357	8003999396	Sinorhizobium medicae WSM1115	Isolate	Nodule
1358	8004300914	Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1	Isolate	Nodule
1359	8004312739	Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0	Isolate	Nodule
1360	8004361976	Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1	Isolate	Nodule
1361	8004374579	Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1	Isolate	Nodule
1362	8004387939	Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1	Isolate	Nodule
1363	8004445564	Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1	Isolate	Nodule
1364	8004633249	Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1	Isolate	Nodule
1365	8004640170	Mesorhizobium sp. GbtcB19	Isolate	Unclassified
1366	8004695233	Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1	Isolate	Nodule
1367	8004703790	Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1	Isolate	Nodule
1368	8004714634	Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1	Isolate	Nodule
1369	8004727605	Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1	Isolate	Nodule
1370	8005246636	Rhizobium wuzhouense W44	Isolate	Rhizosphere
1371	8005258706	Rhizobium sp. R693	Isolate	Nodule
1372	8005275841	Rhizobium sp. N4311	Isolate	Nodule
1373	8005282627	Rhizobium phaseoli NC1	Isolate	Nodule
1374	8005289223	Rhizobium bangladeshense 1002	Isolate	Nodule
1375	8005301065	Rhizobium bangladeshense 1017	Isolate	Nodule
1376	8005307578	Rhizobium leguminosarum bv. phaseoli LCS0306	Isolate	Unclassified
1377	8005314921	Rhizobium sp. P28RR-XV	Isolate	Rhizosphere
1378	8005321885	Rhizobium sp. R72	Isolate	Nodule
1379	8005376324	Rhizobium changzhiense WYCCWR 11279	Isolate	Nodule
1380	8005382845	Rhizobium sp. R634	Isolate	Nodule
1381	8005395548	Rhizobium sp. R339	Isolate	Nodule
1382	8005430974	Rhizobium phaseoli Y20	Isolate	Nodule
1383	8005460587	Rhizobium leguminosarum bv. viciae 248	Isolate	Nodule
1384	8005484373	Rhizobium tropici SARCC-755	Isolate	Nodule
1385	8005497431	Rhizobium phaseoli CCGM8	Isolate	Unclassified
1386	8005542996	Rhizobium grahamii CCGM3	Isolate	Unclassified
1387	8005556819	Rhizobium sp. WYCCWR 11128	Isolate	Nodule
1388	8005563573	Rhizobium sp. WYCCWR 11152	Isolate	Nodule
1389	8005570704	Rhizobium anhuiense bv. trifolii WYCCWR10015	Isolate	Nodule
1390	8005619151	Rhizobium phaseoli CCGM2	Isolate	Unclassified
1391	8005626139	Rhizobium phaseoli Y18	Isolate	Nodule
1392	8005645114	Rhizobium tropici IGFRI Rhizo-19	Isolate	Rhizosphere
1393	8005658619	Rhizobium terrae CC-HIH110	Isolate	Unclassified
1394	8005668836	Rhizobium phaseoli CCGM9	Isolate	Unclassified
1395	8005682033	Rhizobium dioscoreae S-93	Isolate	Unclassified
1396	8005695170	Rhizobium sp. RMa-01	Isolate	Unclassified
1397	8007375930	Clostridium sp. YIM B02565	Isolate	Unclassified
1398	8018127388	Rhizobium aegyptiacum 950	Isolate	Nodule
1399	8018150411	Rhizobium straminoryzae SM12	Isolate	Rhizosphere
1400	8018163183	Rhizobium sp. WYCCWR 11146	Isolate	Nodule
1401	8018176218	Rhizobium sp. N122	Isolate	Nodule
1402	8022621104	Bacillus sp. PIC28	Isolate	Rhizosphere
1403	8022792930	Bacillus sp. Xin	Isolate	Rhizosphere
1404	8022893055	Bacillus aryabhattai AFS007213	Isolate	Unclassified
1405	8022914991	Bacillus aryabhattai SQU-R12	Isolate	Unclassified
1406	8023438354	Bacillus sp. BH2	Isolate	Unclassified
1407	8023444577	Bacillus sp. BH32	Isolate	Unclassified
1408	8023680758	Rhizobium leguminosarum SARCC-132	Isolate	Nodule
1409	8024479707	Rhizobium leguminosarum Tri-43	Isolate	Nodule
1410	8024486573	Rhizobium tubonense CCBAU 85046	Isolate	Nodule
1411	8024501048	Rhizobium sp. H4	Isolate	Nodule
1412	8045864390	Aurantimonas endophytica KCTC 52296	Isolate	Unclassified
1413	8046767195	Rhizobium calliandrae CCGE524	Isolate	Unclassified
1414	8054558443	Rhizobium alarense TRM95111	Isolate	Nodule
1415	8055431914	Allorhizobium sonneratiae BGMRC 0089	Isolate	Unclassified
1416	8055617313	Mesorhizobium onobrychidis OM4	Isolate	Nodule
1417	8056375014	Rhizobium redzepovicii 18T	Isolate	Nodule
1418	8056382006	Rhizobium croatiense 13T	Isolate	Nodule
1419	8056875544	Rhizobium halophilum TRM95001	Isolate	Rhizosphere
1420	8057132660	Paracoccus rhizosphaerae LMG 21293	Isolate	Rhizosphere
1421	8057529695	Bosea vestrisii A18/4-2	Isolate	Nodule
1422	8057575449	Rhizobium mayense CCGE526	Isolate	Nodule
1423	8057582654	Bacillus arachidis YX15	Isolate	Rhizosphere
1424	8057632132	Cytobacillus kochii RZ2	Isolate	Rhizosphere
1425	8057874678	Rhizobium acaciae 1AS12	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	66.16
Metatranscriptomes	0.19
Isolates	33.65

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	9.69
Nodule	24.14
Rhizoplane	3.17
Rhizosphere	51.75
Stem	0
Stem Tuber	0
Unclassified	0

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	nmdc:mga00v17_824_c1	3300050491	Bacteria	16830
2	JGI24741J21665_1004337	3300001915	Bacteria	3170
3	JGI24740J21852_10000169	3300001979	Bacteria	26125
4	JGI24740J21852_10018224	3300001979	Bacteria	2497
5	JGI24740J21852_10027380	3300001979	Bacteria	1897
6	JGI24739J22299_10004500	3300001989	Bacteria	5331
7	JGI24737J22298_10015909	3300001990	Bacteria	2431
8	JGI25155J39150_1000014	3300002704	Bacteria	196159
9	JGI25156J39149_1000037	3300002705	Bacteria	109690
10	JGI25156J39149_1000079	3300002705	Bacteria	73408
11	JGI25162J39368_1000217	3300002737	Bacteria	59945
12	JGI25162J39368_1000497	3300002737	Bacteria	29860
13	JGI25154J39366_1000052	3300002738	Bacteria	120209
14	JGI25158J39367_1000036	3300002739	Bacteria	30333
15	JGI25157J39369_1000040	3300002741	Bacteria	126165
16	JGI25157J39369_1000368	3300002741	Bacteria	30978
17	JGI25152J39213_1000731	3300002773	Bacteria	16830
18	JGI25152J39213_1003020	3300002773	Bacteria	5942
19	JGI25150J39212_1000417	3300002774	Bacteria	19610
20	JGI25159J45721_1000004	3300002987	Bacteria	215789
21	JGI25159J45721_1000401	3300002987	Bacteria	20230
22	JGI25159J45721_1002154	3300002987	Bacteria	7671
23	JGI25159J45721_1010682	3300002987	Bacteria	2315
24	JGI25151J46595_10000019	3300003187	Bacteria	236340
25	JGI25151J46595_10000039	3300003187	Bacteria	180051
26	JGI25151J46595_10000146	3300003187	Bacteria	93373
27	JGI25151J46595_10000215	3300003187	Bacteria	69771
28	JGI25151J46595_10000501	3300003187	Bacteria	36729
29	JGI25151J46595_10001550	3300003187	Bacteria	15339
30	JGI25151J46595_10004129	3300003187	Bacteria	7766
31	JGI25151J46595_10010875	3300003187	Bacteria	4210
32	JGI25151J46595_10014334	3300003187	Bacteria	3534
33	JGI25165J46597_1000006	3300003214	Bacteria	529784
34	JGI25165J46597_1000032	3300003214	Bacteria	294371
35	JGI25165J46597_1000371	3300003214	Bacteria	50062
36	JGI25165J46597_1000387	3300003214	Bacteria	47369
37	JGI25165J46597_1000462	3300003214	Bacteria	40205
38	JGI25153J46596_10000006	3300003215	Bacteria	447760
39	JGI25153J46596_10000012	3300003215	Bacteria	308056
40	JGI25153J46596_10000878	3300003215	Bacteria	18292
41	JGI25153J46596_10001917	3300003215	Bacteria	12342
42	JGI25153J46596_10004407	3300003215	Bacteria	7598
43	rootL2_10057297	3300003322	Bacteria	9528
44	JGI25160J50197_1000001	3300003354	Bacteria	782301
45	JGI25160J50197_1000021	3300003354	Bacteria	215789
46	JGI25160J50197_1001207	3300003354	Bacteria	13131
47	JGI25161J50226_1000001	3300003374	Bacteria	655036
48	JGI25161J50226_1000283	3300003374	Bacteria	28981
49	JGI25161J50226_1000307	3300003374	Bacteria	27289
50	Ga0006562J51391_1004549	3300003578	Bacteria	7460
51	Ga0006562J51391_1009927	3300003578	Bacteria	2081
52	Ga0055525_1000040	3300003759	Bacteria	286933
53	Ga0055542_1000046	3300003762	Bacteria	201922
54	Ga0055542_1000404	3300003762	Bacteria	42343
55	Ga0055529_1000007	3300003763	Bacteria	403604
56	Ga0055526_1000164	3300003771	Bacteria	58943
57	Ga0055526_1000204	3300003771	Bacteria	51135
58	Ga0055526_1001084	3300003771	Bacteria	19838
59	Ga0055526_1001319	3300003771	Bacteria	17763
60	Ga0055526_1002445	3300003771	Bacteria	12565
61	Ga0055526_1019273	3300003771	Bacteria	2493
62	Ga0055524_1000086	3300003775	Bacteria	116519
63	Ga0055524_1000779	3300003775	Bacteria	21386
64	Ga0055524_1001143	3300003775	Bacteria	15984
65	Ga0055524_1002014	3300003775	Bacteria	10853
66	Ga0055524_1003187	3300003775	Bacteria	8053
67	Ga0055524_1008396	3300003775	Bacteria	4294
68	Ga0055536_1004791	3300003781	Bacteria	6784
69	Ga0055528_1000549	3300003790	Bacteria	28640
70	Ga0055528_1001077	3300003790	Bacteria	17996
71	Ga0055528_1001745	3300003790	Bacteria	12549
72	Ga0055528_1001936	3300003790	Bacteria	11743
73	Ga0055528_1007831	3300003790	Bacteria	4666
74	Ga0055528_1018908	3300003790	Bacteria	2312
75	Ga0055540_1000766	3300003792	Bacteria	21853
76	Ga0055540_1004389	3300003792	Bacteria	6385
77	Ga0055540_1006397	3300003792	Bacteria	4685
78	Ga0055531_10009734	3300003794	Bacteria	4878
79	Ga0055531_10009754	3300003794	Bacteria	4871
80	Ga0055543_1000060	3300004625	Bacteria	98330
81	Ga0055543_1000102	3300004625	Bacteria	73861
82	Ga0055543_1000282	3300004625	Bacteria	37267
83	Ga0055543_1000311	3300004625	Bacteria	33798
84	Ga0065165_1000008	3300005262	Bacteria	334429
85	Ga0065165_1000033	3300005262	Bacteria	215827
86	Ga0065165_1006300	3300005262	Bacteria	6283
87	Ga0065165_1009739	3300005262	Bacteria	4255
88	Ga0070658_10007368	3300005327	Bacteria	8888
89	Ga0070658_10007750	3300005327	Bacteria	8653
90	Ga0070658_10028445	3300005327	Bacteria	4488
91	Ga0070683_100060161	3300005329	Bacteria	3530
92	Ga0070683_100100577	3300005329	Bacteria	2722
93	Ga0070690_100002870	3300005330	Bacteria	9295
94	Ga0070670_100005632	3300005331	Bacteria	10572
95	Ga0070670_100006793	3300005331	Bacteria	9687
96	Ga0070670_100015246	3300005331	Bacteria	6597
97	Ga0070670_100153528	3300005331	Bacteria	1993
98	Ga0070677_10033672	3300005333	Bacteria	1975
99	Ga0068869_100002008	3300005334	Bacteria	12224
100	Ga0068869_100002698	3300005334	Bacteria	10735
101	Ga0068869_100002883	3300005334	Bacteria	10445
102	Ga0068869_100100726	3300005334	Bacteria	2184
103	Ga0070666_10002996	3300005335	Bacteria	10238
104	Ga0070666_10004102	3300005335	Bacteria	8845
105	Ga0070666_10088160	3300005335	Bacteria	2128
106	Ga0070680_100000084	3300005336	Bacteria	51930
107	Ga0070680_100003680	3300005336	Bacteria	11448
108	Ga0070680_100025322	3300005336	Bacteria	4742
109	Ga0070682_100009136	3300005337	Bacteria	5603
110	Ga0068868_100000774	3300005338	Bacteria	21630
111	Ga0068868_100003486	3300005338	Bacteria	10947
112	Ga0070660_100011017	3300005339	Bacteria	6408
113	Ga0070660_100015858	3300005339	Bacteria	5454
114	Ga0070689_100004258	3300005340	Bacteria	9643
115	Ga0070689_100117127	3300005340	Bacteria	2124
116	Ga0070687_100000018	3300005343	Bacteria	53672
117	Ga0070661_100001999	3300005344	Bacteria	14104
118	Ga0070661_100004005	3300005344	Bacteria	10134
119	Ga0070661_100048093	3300005344	Bacteria	3122
120	Ga0070661_100098304	3300005344	Bacteria	2174
121	Ga0070661_100105014	3300005344	Bacteria	2105
122	Ga0070692_10032711	3300005345	Bacteria	2617
123	Ga0070668_100000041	3300005347	Bacteria	78742
124	Ga0070668_100001385	3300005347	Bacteria	17406
125	Ga0070668_100020824	3300005347	Bacteria	4953
126	Ga0070668_100055137	3300005347	Bacteria	3068
127	Ga0070669_100000032	3300005353	Bacteria	153549
128	Ga0070669_100017917	3300005353	Bacteria	5057
129	Ga0070669_100025975	3300005353	Bacteria	4212
130	Ga0070669_100035642	3300005353	Bacteria	3605
131	Ga0070675_100000054	3300005354	Bacteria	69739
132	Ga0070675_100001478	3300005354	Bacteria	17338
133	Ga0070675_100031607	3300005354	Bacteria	4281
134	Ga0070675_100086342	3300005354	Bacteria	2622
135	Ga0070671_100004813	3300005355	Bacteria	10734
136	Ga0070671_100008514	3300005355	Bacteria	8222
137	Ga0070671_100053399	3300005355	Bacteria	3359
138	Ga0070671_100118028	3300005355	Bacteria	2231
139	Ga0070674_100003852	3300005356	Bacteria	8490
140	Ga0070674_100010167	3300005356	Bacteria	5670
141	Ga0070674_100059896	3300005356	Bacteria	2652
142	Ga0070688_100010440	3300005365	Bacteria	5120
143	Ga0070688_100022793	3300005365	Bacteria	3675
144	Ga0070659_100031728	3300005366	Bacteria	4093
145	Ga0070667_100000053	3300005367	Bacteria	151974
146	Ga0070667_100000058	3300005367	Bacteria	148071
147	Ga0070667_100000108	3300005367	Bacteria	105301
148	Ga0070667_100005200	3300005367	Bacteria	10877
149	Ga0070667_100045300	3300005367	Bacteria	3697
150	Ga0070667_100129010	3300005367	Bacteria	2206
151	Ga0070714_100009765	3300005435	Bacteria	7561
152	Ga0070714_100045385	3300005435	Bacteria	3725
153	Ga0070713_100022240	3300005436	Bacteria	4897
154	Ga0070701_10001221	3300005438	Bacteria	9422
155	Ga0070701_10001334	3300005438	Bacteria	9093
156	Ga0070711_100055977	3300005439	Bacteria	2726
157	Ga0070711_100057097	3300005439	Bacteria	2702
158	Ga0070705_100000263	3300005440	Bacteria	31507
159	Ga0070705_100027605	3300005440	Bacteria	3101
160	Ga0070700_100000577	3300005441	Bacteria	18363
161	Ga0070700_100008932	3300005441	Bacteria	5482
162	Ga0070694_100000229	3300005444	Bacteria	29512
163	Ga0070694_100002810	3300005444	Bacteria	10332
164	Ga0070694_100006487	3300005444	Bacteria	7109
165	Ga0070694_100023100	3300005444	Bacteria	3994
166	Ga0070694_100036728	3300005444	Bacteria	3246
167	Ga0070708_100035094	3300005445	Bacteria	4367
168	Ga0070708_100068868	3300005445	Bacteria	3181
169	Ga0070663_100000169	3300005455	Bacteria	32809
170	Ga0070663_100002573	3300005455	Bacteria	10240
171	Ga0070663_100010679	3300005455	Bacteria	5730
172	Ga0070663_100031771	3300005455	Bacteria	3632
173	Ga0070663_100094489	3300005455	Bacteria	2220
174	Ga0070678_100002176	3300005456	Bacteria	10649
175	Ga0070678_100123372	3300005456	Bacteria	2046
176	Ga0070662_100013078	3300005457	Bacteria	5516
177	Ga0070681_10000001	3300005458	Bacteria	946857
178	Ga0070681_10002486	3300005458	Bacteria	16877
179	Ga0070681_10005353	3300005458	Bacteria	12389
180	Ga0070681_10007048	3300005458	Bacteria	10945
181	Ga0070681_10030716	3300005458	Bacteria	5391
182	Ga0068867_100000577	3300005459	Bacteria	24298
183	Ga0068867_100002175	3300005459	Bacteria	13763
184	Ga0068867_100005366	3300005459	Bacteria	9061
185	Ga0068867_100074784	3300005459	Bacteria	2540
186	Ga0068867_100084403	3300005459	Bacteria	2399
187	Ga0070685_10027586	3300005466	Bacteria	3140
188	Ga0070706_100019202	3300005467	Bacteria	6307
189	Ga0070706_100025740	3300005467	Bacteria	5414
190	Ga0070706_100095575	3300005467	Bacteria	2758
191	Ga0070707_100028242	3300005468	Bacteria	5337
192	Ga0070698_100006884	3300005471	Bacteria	12316
193	Ga0070698_100047840	3300005471	Bacteria	4372
194	Ga0070698_100109477	3300005471	Bacteria	2729
195	Ga0070699_100006254	3300005518	Bacteria	10386
196	Ga0070699_100020017	3300005518	Bacteria	5766
197	Ga0070699_100080984	3300005518	Bacteria	2830
198	Ga0070679_100000577	3300005530	Bacteria	31104
199	Ga0070679_100006374	3300005530	Bacteria	10987
200	Ga0070679_100007172	3300005530	Bacteria	10407
201	Ga0070679_100047963	3300005530	Bacteria	4256
202	Ga0070679_100109802	3300005530	Bacteria	2744
203	Ga0070679_100150800	3300005530	Bacteria	2301
204	Ga0070679_100162442	3300005530	Bacteria	2208
205	Ga0070679_100237169	3300005530	Bacteria	1782
206	Ga0070697_100055759	3300005536	Bacteria	3214
207	Ga0068853_100001658	3300005539	Bacteria	16301
208	Ga0068853_100008372	3300005539	Bacteria	8305
209	Ga0068853_100021853	3300005539	Bacteria	5337
210	Ga0070672_100000897	3300005543	Bacteria	17894
211	Ga0070672_100003833	3300005543	Bacteria	9791
212	Ga0070672_100011324	3300005543	Bacteria	6222
213	Ga0070686_100000592	3300005544	Bacteria	21409
214	Ga0070686_100001036	3300005544	Bacteria	15994
215	Ga0070686_100008122	3300005544	Bacteria	5869
216	Ga0070695_100001133	3300005545	Bacteria	14617
217	Ga0070695_100001572	3300005545	Bacteria	12736
218	Ga0070695_100006940	3300005545	Bacteria	6708
219	Ga0070695_100036857	3300005545	Bacteria	3079
220	Ga0070696_100000363	3300005546	Bacteria	27710
221	Ga0070696_100004042	3300005546	Bacteria	9781
222	Ga0070696_100004348	3300005546	Bacteria	9441
223	Ga0070696_100004389	3300005546	Bacteria	9407
224	Ga0070696_100009153	3300005546	Bacteria	6630
225	Ga0070693_100000136	3300005547	Bacteria	33252
226	Ga0070693_100005331	3300005547	Bacteria	6165
227	Ga0070665_100000075	3300005548	Bacteria	189496
228	Ga0070665_100000458	3300005548	Bacteria	59389
229	Ga0070665_100000502	3300005548	Bacteria	55985
230	Ga0070665_100006857	3300005548	Bacteria	11581
231	Ga0070665_100011037	3300005548	Bacteria	9131
232	Ga0070665_100020647	3300005548	Bacteria	6618
233	Ga0070665_100033253	3300005548	Bacteria	5189
234	Ga0070665_100061692	3300005548	Bacteria	3759
235	Ga0070704_100001675	3300005549	Bacteria	12033
236	Ga0070704_100002022	3300005549	Bacteria	11239
237	Ga0070704_100002896	3300005549	Bacteria	9741
238	Ga0070704_100002930	3300005549	Bacteria	9696
239	Ga0070704_100030042	3300005549	Bacteria	3637
240	Ga0070704_100062866	3300005549	Bacteria	2662
241	Ga0070704_100081892	3300005549	Bacteria	2379
242	Ga0068855_100000307	3300005563	Bacteria	60715
243	Ga0068855_100001415	3300005563	Bacteria	29792
244	Ga0068855_100018221	3300005563	Bacteria	8435
245	Ga0068855_100023979	3300005563	Bacteria	7304
246	Ga0068855_100172277	3300005563	Bacteria	2450
247	Ga0068855_100188765	3300005563	Bacteria	2326
248	Ga0070664_100004970	3300005564	Bacteria	10652
249	Ga0070664_100019138	3300005564	Bacteria	5630
250	Ga0070664_100126389	3300005564	Bacteria	2243
251	Ga0070664_100133413	3300005564	Bacteria	2182
252	Ga0068857_100002388	3300005577	Bacteria	15318
253	Ga0068857_100059149	3300005577	Bacteria	3403
254	Ga0068854_100017706	3300005578	Bacteria	4772
255	Ga0068854_100028483	3300005578	Bacteria	3860
256	Ga0068856_100002249	3300005614	Bacteria	19936
257	Ga0068856_100053069	3300005614	Bacteria	3998
258	Ga0068856_100069798	3300005614	Bacteria	3475
259	Ga0070702_100000129	3300005615	Bacteria	23189
260	Ga0068852_100152317	3300005616	Bacteria	2151
261	Ga0068859_100002526	3300005617	Bacteria	18567
262	Ga0068859_100004713	3300005617	Bacteria	13857
263	Ga0068859_100004921	3300005617	Bacteria	13585
264	Ga0068859_100014988	3300005617	Bacteria	7781
265	Ga0068859_100016819	3300005617	Bacteria	7343
266	Ga0068859_100069459	3300005617	Bacteria	3558
267	Ga0068859_100215893	3300005617	Bacteria	2005
268	Ga0068864_100005549	3300005618	Bacteria	10345
269	Ga0068864_100012136	3300005618	Bacteria	7118
270	Ga0068864_100018681	3300005618	Bacteria	5793
271	Ga0068864_100020992	3300005618	Bacteria	5469
272	Ga0068864_100055206	3300005618	Bacteria	3429
273	Ga0068864_100078032	3300005618	Bacteria	2898
274	Ga0068864_100167658	3300005618	Bacteria	2000
275	Ga0068866_10003524	3300005718	Bacteria	6406
276	Ga0068866_10014998	3300005718	Bacteria	3435
277	Ga0068861_100001533	3300005719	Bacteria	14640
278	Ga0068861_100001869	3300005719	Bacteria	13561
279	Ga0068861_100023146	3300005719	Bacteria	4479
280	Ga0068861_100096873	3300005719	Bacteria	2339
281	Ga0068870_10007192	3300005840	Bacteria	4956
282	Ga0068863_100000031	3300005841	Bacteria	175602
283	Ga0068863_100001022	3300005841	Bacteria	28022
284	Ga0068863_100002326	3300005841	Bacteria	18892
285	Ga0068863_100002425	3300005841	Bacteria	18513
286	Ga0068863_100005869	3300005841	Bacteria	12030
287	Ga0068863_100011046	3300005841	Bacteria	8759
288	Ga0068858_100001230	3300005842	Bacteria	26467
289	Ga0068858_100004632	3300005842	Bacteria	13465
290	Ga0068858_100012799	3300005842	Bacteria	7909
291	Ga0068858_100030409	3300005842	Bacteria	5014
292	Ga0068858_100048624	3300005842	Bacteria	3928
293	Ga0068860_100000344	3300005843	Bacteria	62777
294	Ga0068860_100002991	3300005843	Bacteria	17457
295	Ga0068860_100003052	3300005843	Bacteria	17292
296	Ga0068860_100007739	3300005843	Bacteria	10735
297	Ga0068860_100013337	3300005843	Bacteria	8058
298	Ga0068860_100187132	3300005843	Bacteria	2002
299	Ga0068860_100200048	3300005843	Bacteria	1936
300	Ga0068862_100000625	3300005844	Bacteria	36732
301	Ga0068862_100001654	3300005844	Bacteria	20281
302	Ga0081455_10000087	3300005937	Bacteria	99627
303	Ga0081455_10001698	3300005937	Bacteria	26658
304	Ga0081455_10035516	3300005937	Bacteria	4452
305	Ga0081455_10122078	3300005937	Bacteria	2051
306	Ga0081538_10000854	3300005981	Bacteria	32885
307	Ga0081538_10011679	3300005981	Bacteria	7097
308	Ga0081540_1042341	3300005983	Bacteria	2349
309	Ga0081539_10000005	3300005985	Bacteria	549026
310	Ga0081539_10002162	3300005985	Bacteria	28939
311	Ga0081539_10005604	3300005985	Bacteria	12647
312	Ga0081539_10012479	3300005985	Bacteria	6546
313	Ga0070717_10004736	3300006028	Bacteria	9890
314	Ga0075365_10000291	3300006038	Bacteria	17391
315	Ga0075365_10000739	3300006038	Bacteria	13238
316	Ga0075365_10018420	3300006038	Bacteria	4293
317	Ga0075365_10073650	3300006038	Bacteria	2302
318	Ga0075368_10012992	3300006042	Bacteria	3053
319	Ga0075363_100000715	3300006048	Bacteria	11263
320	Ga0075363_100003581	3300006048	Bacteria	6645
321	Ga0075364_10002108	3300006051	Bacteria	11108
322	Ga0075364_10005590	3300006051	Bacteria	7325
323	Ga0075364_10018842	3300006051	Bacteria	4328
324	Ga0075364_10022087	3300006051	Bacteria	4015
325	Ga0070712_100006664	3300006175	Bacteria	7180
326	Ga0070712_100047579	3300006175	Bacteria	2969
327	Ga0075362_10000935	3300006177	Bacteria	8910
328	Ga0075362_10041727	3300006177	Bacteria	2025
329	Ga0075367_10003877	3300006178	Bacteria	7209
330	Ga0075367_10011751	3300006178	Bacteria	4647
331	Ga0075367_10027339	3300006178	Bacteria	3244
332	Ga0075367_10074314	3300006178	Bacteria	2049
333	Ga0075366_10001188	3300006195	Bacteria	12913
334	Ga0075366_10003066	3300006195	Bacteria	8724
335	Ga0075366_10014617	3300006195	Bacteria	4485
336	Ga0097621_100000387	3300006237	Bacteria	30657
337	Ga0097621_100003771	3300006237	Bacteria	10502
338	Ga0097621_100007813	3300006237	Bacteria	7674
339	Ga0097621_100094517	3300006237	Bacteria	2506
340	Ga0075370_10005109	3300006353	Bacteria	6469
341	Ga0075370_10044873	3300006353	Bacteria	2499
342	Ga0068871_100000344	3300006358	Bacteria	32279
343	Ga0068871_100003921	3300006358	Bacteria	10261
344	Ga0068871_100008852	3300006358	Bacteria	7254
345	Ga0068871_100013758	3300006358	Bacteria	6016
346	Ga0068871_100023471	3300006358	Bacteria	4773
347	Ga0068871_100027151	3300006358	Bacteria	4474
348	Ga0068871_100033003	3300006358	Bacteria	4094
349	Ga0068871_100066808	3300006358	Bacteria	2948
350	Ga0075428_100000505	3300006844	Bacteria	39638
351	Ga0075428_100002222	3300006844	Bacteria	21034
352	Ga0075428_100014479	3300006844	Bacteria	8759
353	Ga0075428_100042239	3300006844	Bacteria	5014
354	Ga0075428_100058560	3300006844	Bacteria	4217
355	Ga0075428_100113497	3300006844	Bacteria	2952
356	Ga0075428_100212105	3300006844	Bacteria	2092
357	Ga0075430_100008653	3300006846	Bacteria	8585
358	Ga0075430_100039205	3300006846	Bacteria	4011
359	Ga0075430_100169820	3300006846	Bacteria	1814
360	Ga0075431_100002462	3300006847	Bacteria	17833
361	Ga0075431_100004461	3300006847	Bacteria	13732
362	Ga0075431_100005986	3300006847	Bacteria	12049
363	Ga0075431_100009834	3300006847	Bacteria	9604
364	Ga0075431_100023126	3300006847	Bacteria	6354
365	Ga0075431_100084822	3300006847	Bacteria	3270
366	Ga0075431_100122440	3300006847	Bacteria	2684
367	Ga0075433_10001729	3300006852	Bacteria	16290
368	Ga0075433_10002744	3300006852	Bacteria	13464
369	Ga0075433_10004833	3300006852	Bacteria	10530
370	Ga0075433_10043433	3300006852	Bacteria	3901
371	Ga0075434_100000066	3300006871	Bacteria	54004
372	Ga0075434_100001877	3300006871	Bacteria	18186
373	Ga0075434_100004698	3300006871	Bacteria	12344
374	Ga0075434_100009542	3300006871	Bacteria	9056
375	Ga0075434_100014143	3300006871	Bacteria	7623
376	Ga0075434_100024547	3300006871	Bacteria	5894
377	Ga0075429_100000783	3300006880	Bacteria	25072
378	Ga0075429_100000863	3300006880	Bacteria	23895
379	Ga0075429_100010927	3300006880	Bacteria	7854
380	Ga0075429_100012976	3300006880	Bacteria	7229
381	Ga0075429_100014131	3300006880	Bacteria	6919
382	Ga0075429_100027941	3300006880	Bacteria	4897
383	Ga0075429_100078189	3300006880	Bacteria	2883
384	Ga0075429_100091483	3300006880	Bacteria	2654
385	Ga0075429_100122222	3300006880	Bacteria	2276
386	Ga0068865_100000159	3300006881	Bacteria	36900
387	Ga0075436_100000232	3300006914	Bacteria	34912
388	Ga0075436_100014043	3300006914	Bacteria	5481
389	Ga0075436_100038319	3300006914	Bacteria	3308
390	Ga0097620_100002526	3300006931	Bacteria	18567
391	Ga0097620_100004713	3300006931	Bacteria	13857
392	Ga0097620_100004921	3300006931	Bacteria	13585
393	Ga0097620_100014989	3300006931	Bacteria	7781
394	Ga0097620_100016819	3300006931	Bacteria	7343
395	Ga0097620_100069457	3300006931	Bacteria	3558
396	Ga0097620_100215898	3300006931	Bacteria	2005
397	Ga0079104_1000884	3300006946	Bacteria	24591
398	Ga0079104_1001599	3300006946	Bacteria	14765
399	Ga0075435_100000893	3300007076	Bacteria	18765
400	Ga0075435_100001417	3300007076	Bacteria	15465
401	Ga0075435_100012612	3300007076	Bacteria	6260
402	Ga0099795_10008606	3300007788	Bacteria	2919
403	Ga0105250_10026344	3300009092	Bacteria	2341
404	Ga0105240_10000014	3300009093	Bacteria	482033
405	Ga0105240_10000641	3300009093	Bacteria	64500
406	Ga0105240_10012540	3300009093	Bacteria	11693
407	Ga0105240_10017036	3300009093	Bacteria	9815
408	Ga0105240_10089912	3300009093	Bacteria	3754
409	Ga0105240_10159774	3300009093	Bacteria	2678
410	Ga0111539_10000445	3300009094	Bacteria	52233
411	Ga0111539_10000539	3300009094	Bacteria	48163
412	Ga0111539_10001392	3300009094	Bacteria	32179
413	Ga0111539_10009712	3300009094	Bacteria	12144
414	Ga0111539_10017313	3300009094	Bacteria	8918
415	Ga0111539_10030018	3300009094	Bacteria	6614
416	Ga0111539_10030597	3300009094	Bacteria	6543
417	Ga0111539_10057599	3300009094	Bacteria	4614
418	Ga0111539_10076476	3300009094	Bacteria	3941
419	Ga0111539_10152273	3300009094	Bacteria	2707
420	Ga0105245_10019259	3300009098	Bacteria	5975
421	Ga0105245_10150039	3300009098	Bacteria	2203
422	Ga0105247_10000811	3300009101	Bacteria	23812
423	Ga0105247_10014507	3300009101	Bacteria	4726
424	Ga0105247_10067782	3300009101	Bacteria	2224
425	Ga0114129_10000018	3300009147	Bacteria	125757
426	Ga0114129_10000341	3300009147	Bacteria	54331
427	Ga0114129_10000823	3300009147	Bacteria	40012
428	Ga0114129_10026093	3300009147	Bacteria	8275
429	Ga0114129_10068819	3300009147	Bacteria	4935
430	Ga0114129_10094786	3300009147	Bacteria	4134
431	Ga0114129_10337580	3300009147	Bacteria	1999
432	Ga0105243_10000346	3300009148	Bacteria	49790
433	Ga0105243_10000744	3300009148	Bacteria	31197
434	Ga0105243_10042059	3300009148	Bacteria	3576
435	Ga0105243_10046828	3300009148	Bacteria	3403
436	Ga0105243_10047691	3300009148	Bacteria	3374
437	Ga0105243_10102687	3300009148	Bacteria	2376
438	Ga0105241_10002600	3300009174	Bacteria	13537
439	Ga0105241_10003120	3300009174	Bacteria	12329
440	Ga0105241_10047927	3300009174	Bacteria	3250
441	Ga0105242_10000310	3300009176	Bacteria	39046
442	Ga0105242_10003033	3300009176	Bacteria	13123
443	Ga0105242_10025002	3300009176	Bacteria	4721
444	Ga0105242_10120038	3300009176	Bacteria	2254
445	Ga0105248_10000001	3300009177	Bacteria	1881304
446	Ga0105248_10000848	3300009177	Bacteria	34381
447	Ga0105248_10003110	3300009177	Bacteria	18377
448	Ga0105248_10003938	3300009177	Bacteria	16417
449	Ga0105248_10030060	3300009177	Bacteria	6063
450	Ga0105248_10038225	3300009177	Bacteria	5371
451	Ga0105248_10054710	3300009177	Bacteria	4476
452	Ga0105248_10196871	3300009177	Bacteria	2271
453	Ga0105237_10005664	3300009545	Bacteria	14056
454	Ga0105237_10019642	3300009545	Bacteria	6977
455	Ga0105237_10049141	3300009545	Bacteria	4241
456	Ga0105237_10050991	3300009545	Bacteria	4158
457	Ga0105238_10026848	3300009551	Bacteria	5869
458	Ga0105238_10027979	3300009551	Bacteria	5745
459	Ga0105238_10045965	3300009551	Bacteria	4409
460	Ga0105249_10000161	3300009553	Bacteria	80491
461	Ga0105249_10011567	3300009553	Bacteria	7754
462	Ga0105249_10040878	3300009553	Bacteria	4213
463	Ga0105249_10068612	3300009553	Bacteria	3270
464	Ga0123341_1000112	3300009765	Bacteria	36073
465	Ga0123342_1014760	3300009766	Bacteria	7346
466	Ga0123342_1019719	3300009766	Bacteria	5077
467	Ga0105033_100688	3300009986	Bacteria	2624
468	Ga0105030_100141	3300009987	Bacteria	5760
469	Ga0099796_10003558	3300010159	Bacteria	3636
470	Ga0105239_10008952	3300010375	Bacteria	11328
471	Ga0105239_10010585	3300010375	Bacteria	10312
472	Ga0105239_10012397	3300010375	Bacteria	9492
473	Ga0105239_10063665	3300010375	Bacteria	4049
474	Ga0105239_10072525	3300010375	Bacteria	3785
475	Ga0105246_10000505	3300011119	Bacteria	21244
476	Ga0105246_10009004	3300011119	Bacteria	6147
477	Ga0105246_10074180	3300011119	Bacteria	2404
478	Ga0157373_10060717	3300013100	Bacteria	2678
479	Ga0157371_10000097	3300013102	Bacteria	134150
480	Ga0157370_10000327	3300013104	Bacteria	59705
481	Ga0157370_10035178	3300013104	Bacteria	4871
482	Ga0157370_10037328	3300013104	Bacteria	4710
483	Ga0157369_10024316	3300013105	Bacteria	6742
484	Ga0157369_10072169	3300013105	Bacteria	3705
485	Ga0171463_1007	3300013249	Bacteria	301198
486	Ga0171462_1008	3300013250	Bacteria	384318
487	Ga0157374_10000346	3300013296	Bacteria	42858
488	Ga0157374_10000626	3300013296	Bacteria	31114
489	Ga0157374_10001326	3300013296	Bacteria	21038
490	Ga0157374_10005883	3300013296	Bacteria	10361
491	Ga0157374_10014633	3300013296	Bacteria	6866
492	Ga0157378_10002094	3300013297	Bacteria	17820
493	Ga0157378_10004595	3300013297	Bacteria	12112
494	Ga0163162_10009461	3300013306	Bacteria	9476
495	Ga0163162_10012493	3300013306	Bacteria	8296
496	Ga0163162_10042675	3300013306	Bacteria	4541
497	Ga0163162_10069833	3300013306	Bacteria	3564
498	Ga0163162_10077454	3300013306	Bacteria	3389
499	Ga0157372_10134584	3300013307	Bacteria	2845
500	Ga0157375_10000084	3300013308	Bacteria	94026
501	Ga0157375_10035912	3300013308	Bacteria	4735
502	Ga0157375_10043865	3300013308	Bacteria	4340
503	Ga0157375_10046934	3300013308	Bacteria	4214
504	Ga0157375_10054910	3300013308	Bacteria	3925
505	Ga0157375_10097234	3300013308	Bacteria	3018
506	Ga0157375_10099371	3300013308	Bacteria	2989
507	Ga0163163_10021117	3300014325	Bacteria	6142
508	Ga0157380_10008981	3300014326	Bacteria	7140
509	Ga0157380_10024448	3300014326	Bacteria	4573
510	Ga0157380_10027501	3300014326	Bacteria	4326
511	Ga0157380_10073451	3300014326	Bacteria	2773
512	Ga0157380_10135885	3300014326	Bacteria	2104
513	Ga0157380_10187486	3300014326	Bacteria	1823
514	Ga0157379_10000296	3300014968	Bacteria	39507
515	Ga0157379_10004773	3300014968	Bacteria	11648
516	Ga0157379_10020958	3300014968	Bacteria	5784
517	Ga0157376_10016396	3300014969	Bacteria	5624
518	Ga0157376_10017972	3300014969	Bacteria	5408
519	Ga0157376_10034829	3300014969	Bacteria	4068
520	Ga0157376_10050973	3300014969	Bacteria	3436
521	Ga0157376_10113706	3300014969	Bacteria	2387
522	Ga0182007_10001651	3300015262	Bacteria	11809
523	Ga0183363_1049	3300015690	Bacteria	38978
524	Ga0163161_10027453	3300017792	Bacteria	4038
525	Ga0214544_1000110	3300021320	Bacteria	113143
526	Ga0214542_1000268	3300021321	Bacteria	87082
527	Ga0214543_1000022	3300021327	Bacteria	241930
528	Ga0214543_1000219	3300021327	Bacteria	87102
529	Ga0213872_10005745	3300021361	Bacteria	6315
530	Ga0213876_10000889	3300021384	Bacteria	19999
531	Ga0213876_10005226	3300021384	Bacteria	7155
532	Ga0213875_10000101	3300021388	Bacteria	96957
533	Ga0213875_10004529	3300021388	Bacteria	7603
534	Ga0228711_1000026	3300022739	Bacteria	101497
535	Ga0228710_1000005	3300022740	Bacteria	233531
536	Ga0209435_100027	3300025206	Bacteria	196217
537	Ga0209436_100061	3300025208	Bacteria	58629
538	Ga0209436_100422	3300025208	Bacteria	18988
539	Ga0209674_104464	3300025226	Bacteria	2272
540	Ga0209147_100014	3300025229	Bacteria	597841
541	Ga0209147_100413	3300025229	Bacteria	28449
542	Ga0209563_100019	3300025230	Bacteria	697828
543	Ga0209437_100051	3300025233	Bacteria	392523
544	Ga0209437_100060	3300025233	Bacteria	355034
545	Ga0209437_102802	3300025233	Bacteria	3271
546	Ga0207425_1000046	3300025245	Bacteria	189433
547	Ga0207425_1004595	3300025245	Bacteria	4097
548	Ga0209646_1000086	3300025246	Bacteria	196217
549	Ga0209646_1006961	3300025246	Bacteria	1873
550	Ga0209026_1000082	3300025250	Bacteria	196315
551	Ga0209026_1000089	3300025250	Bacteria	175907
552	Ga0209677_100273	3300025253	Bacteria	34599
553	Ga0209148_1000026	3300025254	Bacteria	629213
554	Ga0209148_1000315	3300025254	Bacteria	68127
555	Ga0209148_1000899	3300025254	Bacteria	20258
556	Ga0209759_1000040	3300025256	Bacteria	254501
557	Ga0209759_1000063	3300025256	Bacteria	196315
558	Ga0209129_1000171	3300025258	Bacteria	95724
559	Ga0209129_1000433	3300025258	Bacteria	31302
560	Ga0209129_1000636	3300025258	Bacteria	23480
561	Ga0209129_1000897	3300025258	Bacteria	18250
562	Ga0209129_1008375	3300025258	Bacteria	2888
563	Ga0209233_1000010	3300025261	Bacteria	1194329
564	Ga0209233_1000066	3300025261	Bacteria	381218
565	Ga0209233_1000095	3300025261	Bacteria	303783
566	Ga0209233_1000190	3300025261	Bacteria	130713
567	Ga0209233_1000228	3300025261	Bacteria	100100
568	Ga0209455_1000005	3300025272	Bacteria	1416756
569	Ga0209455_1000062	3300025272	Bacteria	335169
570	Ga0209455_1000999	3300025272	Bacteria	14262
571	Ga0209673_1000010	3300025273	Bacteria	596656
572	Ga0209673_1000025	3300025273	Bacteria	404572
573	Ga0209673_1000112	3300025273	Bacteria	179676
574	Ga0209673_1001725	3300025273	Bacteria	18400
575	Ga0209673_1002044	3300025273	Bacteria	15288
576	Ga0209673_1002631	3300025273	Bacteria	12049
577	Ga0209673_1004344	3300025273	Bacteria	7635
578	Ga0209130_1000003	3300025284	Bacteria	677988
579	Ga0209130_1000017	3300025284	Bacteria	388431
580	Ga0209130_1000020	3300025284	Bacteria	379297
581	Ga0209130_1000317	3300025284	Bacteria	56717
582	Ga0209130_1007207	3300025284	Bacteria	3475
583	Ga0209130_1015700	3300025284	Bacteria	1856
584	Ga0209675_1000798	3300025291	Bacteria	20825
585	Ga0209676_1004395	3300025292	Bacteria	7871
586	Ga0209676_1011719	3300025292	Bacteria	3507
587	Ga0209676_1014089	3300025292	Bacteria	3028
588	Ga0209025_1000008	3300025294	Bacteria	1130876
589	Ga0209025_1000091	3300025294	Bacteria	250401
590	Ga0209025_1000137	3300025294	Bacteria	190136
591	Ga0209025_1000152	3300025294	Bacteria	171558
592	Ga0209025_1000161	3300025294	Bacteria	166506
593	Ga0209025_1000171	3300025294	Bacteria	160478
594	Ga0209025_1000353	3300025294	Bacteria	99365
595	Ga0209025_1000927	3300025294	Bacteria	44856
596	Ga0209025_1002842	3300025294	Bacteria	17370
597	Ga0209025_1003402	3300025294	Bacteria	15125
598	Ga0209025_1004438	3300025294	Bacteria	12192
599	Ga0209025_1005632	3300025294	Bacteria	10109
600	Ga0209025_1013730	3300025294	Bacteria	5060
601	Ga0209025_1015020	3300025294	Bacteria	4706
602	Ga0209025_1015688	3300025294	Bacteria	4543
603	Ga0209564_1000013	3300025295	Bacteria	775755
604	Ga0209564_1000015	3300025295	Bacteria	615324
605	Ga0209564_1000041	3300025295	Bacteria	405199
606	Ga0209564_1000265	3300025295	Bacteria	110606
607	Ga0209564_1000607	3300025295	Bacteria	55712
608	Ga0209564_1001968	3300025295	Bacteria	18089
609	Ga0209564_1006166	3300025295	Bacteria	6568
610	Ga0209758_1000001	3300025297	Bacteria	1981790
611	Ga0209758_1000058	3300025297	Bacteria	331603
612	Ga0209758_1000059	3300025297	Bacteria	328458
613	Ga0209758_1000123	3300025297	Bacteria	190136
614	Ga0209758_1000671	3300025297	Bacteria	51169
615	Ga0209758_1003792	3300025297	Bacteria	13316
616	Ga0209758_1005424	3300025297	Bacteria	9832
617	Ga0209758_1008086	3300025297	Bacteria	6933
618	Ga0209758_1014210	3300025297	Bacteria	4257
619	Ga0209758_1016894	3300025297	Bacteria	3675
620	Ga0209758_1019336	3300025297	Bacteria	3288
621	Ga0209050_1003423	3300025298	Bacteria	11731
622	Ga0209050_1005846	3300025298	Bacteria	7538
623	Ga0209256_1000062	3300025299	Bacteria	253433
624	Ga0209256_1000153	3300025299	Bacteria	144736
625	Ga0209256_1000381	3300025299	Bacteria	70973
626	Ga0209256_1001831	3300025299	Bacteria	19881
627	Ga0209256_1002016	3300025299	Bacteria	18118
628	Ga0209256_1002074	3300025299	Bacteria	17621
629	Ga0209256_1002077	3300025299	Bacteria	17609
630	Ga0207426_1000006	3300025302	Bacteria	1025969
631	Ga0207426_1000008	3300025302	Bacteria	848730
632	Ga0207426_1000011	3300025302	Bacteria	791203
633	Ga0207426_1000344	3300025302	Bacteria	85912
634	Ga0207426_1001327	3300025302	Bacteria	21106
635	Ga0207426_1001616	3300025302	Bacteria	17829
636	Ga0209051_1000997	3300025303	Bacteria	27189
637	Ga0209051_1001157	3300025303	Bacteria	23986
638	Ga0209051_1002134	3300025303	Bacteria	14731
639	Ga0209257_1002221	3300025304	Bacteria	19965
640	Ga0209257_1002974	3300025304	Bacteria	15474
641	Ga0207697_10016850	3300025315	Bacteria	3007
642	Ga0207696_1001883	3300025711	Bacteria	10737
643	Ga0207713_1002429	3300025735	Bacteria	13591
644	Ga0207682_10008050	3300025893	Bacteria	4184
645	Ga0207682_10017513	3300025893	Bacteria	2799
646	Ga0207642_10006542	3300025899	Bacteria	3883
647	Ga0207642_10041589	3300025899	Bacteria	2014
648	Ga0207710_10008682	3300025900	Bacteria	4285
649	Ga0207688_10017552	3300025901	Bacteria	3890
650	Ga0207680_10002965	3300025903	Bacteria	7959
651	Ga0207680_10051025	3300025903	Bacteria	2472
652	Ga0207647_10044985	3300025904	Bacteria	2755
653	Ga0207645_10000431	3300025907	Bacteria	34728
654	Ga0207645_10021695	3300025907	Bacteria	4185
655	Ga0207645_10072644	3300025907	Bacteria	2202
656	Ga0207643_10007971	3300025908	Bacteria	5685
657	Ga0207643_10018026	3300025908	Bacteria	3867
658	Ga0207643_10046897	3300025908	Bacteria	2443
659	Ga0207705_10006608	3300025909	Bacteria	8580
660	Ga0207705_10031857	3300025909	Bacteria	3766
661	Ga0207684_10027584	3300025910	Bacteria	4837
662	Ga0207707_10000001	3300025912	Bacteria	1212482
663	Ga0207707_10008122	3300025912	Bacteria	9112
664	Ga0207707_10014098	3300025912	Bacteria	6967
665	Ga0207707_10022394	3300025912	Bacteria	5524
666	Ga0207707_10032911	3300025912	Bacteria	4537
667	Ga0207707_10066735	3300025912	Bacteria	3133
668	Ga0207695_10000018	3300025913	Bacteria	766611
669	Ga0207695_10000037	3300025913	Bacteria	476303
670	Ga0207695_10040350	3300025913	Bacteria	5007
671	Ga0207695_10082410	3300025913	Bacteria	3252
672	Ga0207671_10000271	3300025914	Bacteria	77228
673	Ga0207671_10002809	3300025914	Bacteria	18118
674	Ga0207671_10018107	3300025914	Bacteria	5412
675	Ga0207671_10048631	3300025914	Bacteria	3139
676	Ga0207671_10086294	3300025914	Bacteria	2359
677	Ga0207693_10000060	3300025915	Bacteria	93715
678	Ga0207693_10005142	3300025915	Bacteria	10960
679	Ga0207693_10028935	3300025915	Bacteria	4379
680	Ga0207693_10031032	3300025915	Bacteria	4222
681	Ga0207663_10033899	3300025916	Bacteria	3046
682	Ga0207663_10051757	3300025916	Bacteria	2559
683	Ga0207663_10071928	3300025916	Bacteria	2233
684	Ga0207663_10079320	3300025916	Bacteria	2143
685	Ga0207663_10081114	3300025916	Bacteria	2123
686	Ga0207660_10004926	3300025917	Bacteria	8699
687	Ga0207660_10006325	3300025917	Bacteria	7677
688	Ga0207662_10000347	3300025918	Bacteria	20979
689	Ga0207657_10008175	3300025919	Bacteria	10658
690	Ga0207657_10025489	3300025919	Bacteria	5453
691	Ga0207649_10003013	3300025920	Bacteria	9273
692	Ga0207649_10017688	3300025920	Bacteria	4040
693	Ga0207652_10000879	3300025921	Bacteria	28409
694	Ga0207652_10015283	3300025921	Bacteria	6232
695	Ga0207646_10030770	3300025922	Bacteria	4863
696	Ga0207681_10000243	3300025923	Bacteria	41819
697	Ga0207681_10013827	3300025923	Bacteria	5000
698	Ga0207681_10016711	3300025923	Bacteria	4597
699	Ga0207681_10027743	3300025923	Bacteria	3664
700	Ga0207681_10063658	3300025923	Bacteria	2544
701	Ga0207694_10000018	3300025924	Bacteria	331281
702	Ga0207694_10003084	3300025924	Bacteria	13339
703	Ga0207694_10135066	3300025924	Bacteria	1980
704	Ga0207694_10141387	3300025924	Bacteria	1935
705	Ga0207650_10001061	3300025925	Bacteria	20432
706	Ga0207650_10009998	3300025925	Bacteria	6495
707	Ga0207650_10140495	3300025925	Bacteria	1898
708	Ga0207659_10000345	3300025926	Bacteria	27854
709	Ga0207659_10004500	3300025926	Bacteria	8430
710	Ga0207659_10045117	3300025926	Bacteria	3105
711	Ga0207659_10064874	3300025926	Bacteria	2645
712	Ga0207687_10004204	3300025927	Bacteria	9630
713	Ga0207700_10097319	3300025928	Bacteria	2339
714	Ga0207664_10002029	3300025929	Bacteria	13326
715	Ga0207664_10059759	3300025929	Bacteria	3037
716	Ga0207644_10005507	3300025931	Bacteria	8246
717	Ga0207644_10022854	3300025931	Bacteria	4276
718	Ga0207690_10002289	3300025932	Bacteria	11683
719	Ga0207690_10002694	3300025932	Bacteria	10714
720	Ga0207706_10034933	3300025933	Bacteria	4472
721	Ga0207706_10082004	3300025933	Bacteria	2835
722	Ga0207686_10000948	3300025934	Bacteria	17305
723	Ga0207709_10000188	3300025935	Bacteria	82582
724	Ga0207709_10000485	3300025935	Bacteria	36221
725	Ga0207709_10024803	3300025935	Bacteria	3428
726	Ga0207709_10044638	3300025935	Bacteria	2679
727	Ga0207670_10001310	3300025936	Bacteria	13144
728	Ga0207670_10016223	3300025936	Bacteria	4471
729	Ga0207670_10031250	3300025936	Bacteria	3410
730	Ga0207670_10055178	3300025936	Bacteria	2684
731	Ga0207669_10000201	3300025937	Bacteria	27232
732	Ga0207669_10034548	3300025937	Bacteria	2866
733	Ga0207669_10098031	3300025937	Bacteria	1929
734	Ga0207665_10046678	3300025939	Bacteria	2902
735	Ga0207691_10001955	3300025940	Bacteria	20123
736	Ga0207691_10016546	3300025940	Bacteria	7003
737	Ga0207691_10022094	3300025940	Bacteria	6003
738	Ga0207711_10000002	3300025941	Bacteria	1228676
739	Ga0207711_10001015	3300025941	Bacteria	26915
740	Ga0207711_10003516	3300025941	Bacteria	13559
741	Ga0207711_10004268	3300025941	Bacteria	12213
742	Ga0207711_10006975	3300025941	Bacteria	9481
743	Ga0207711_10008863	3300025941	Bacteria	8411
744	Ga0207711_10052671	3300025941	Bacteria	3489
745	Ga0207711_10175214	3300025941	Bacteria	1948
746	Ga0207689_10000488	3300025942	Bacteria	37483
747	Ga0207689_10005639	3300025942	Bacteria	11152
748	Ga0207689_10006227	3300025942	Bacteria	10567
749	Ga0207689_10015037	3300025942	Bacteria	6562
750	Ga0207689_10016154	3300025942	Bacteria	6321
751	Ga0207661_10041931	3300025944	Bacteria	3606
752	Ga0207661_10159772	3300025944	Bacteria	1954
753	Ga0207679_10030871	3300025945	Bacteria	3746
754	Ga0207679_10071989	3300025945	Bacteria	2610
755	Ga0207679_10096853	3300025945	Bacteria	2297
756	Ga0207667_10000010	3300025949	Bacteria	477432
757	Ga0207667_10000052	3300025949	Bacteria	232415
758	Ga0207667_10001504	3300025949	Bacteria	29232
759	Ga0207667_10015843	3300025949	Bacteria	8544
760	Ga0207667_10023924	3300025949	Bacteria	6719
761	Ga0207651_10033239	3300025960	Bacteria	3324
762	Ga0207712_10000059	3300025961	Bacteria	137849
763	Ga0207712_10000343	3300025961	Bacteria	42053
764	Ga0207712_10077406	3300025961	Bacteria	2410
765	Ga0207668_10000038	3300025972	Bacteria	112486
766	Ga0207668_10015155	3300025972	Bacteria	4786
767	Ga0207668_10043754	3300025972	Bacteria	3041
768	Ga0207668_10096329	3300025972	Bacteria	2187
769	Ga0207640_10012223	3300025981	Bacteria	4885
770	Ga0207640_10022073	3300025981	Bacteria	3804
771	Ga0207658_10000037	3300025986	Bacteria	148087
772	Ga0207658_10000074	3300025986	Bacteria	110470
773	Ga0207658_10000093	3300025986	Bacteria	98928
774	Ga0207658_10010772	3300025986	Bacteria	6219
775	Ga0207658_10036570	3300025986	Bacteria	3521
776	Ga0207658_10039783	3300025986	Bacteria	3394
777	Ga0207658_10051707	3300025986	Bacteria	3029
778	Ga0207703_10012815	3300026035	Bacteria	6537
779	Ga0207703_10022788	3300026035	Bacteria	4919
780	Ga0207639_10002705	3300026041	Bacteria	11891
781	Ga0207639_10004623	3300026041	Bacteria	9266
782	Ga0207639_10008137	3300026041	Bacteria	7169
783	Ga0207639_10010160	3300026041	Bacteria	6514
784	Ga0207639_10043520	3300026041	Bacteria	3372
785	Ga0207639_10055402	3300026041	Bacteria	3035
786	Ga0207678_10000532	3300026067	Bacteria	34757
787	Ga0207678_10000567	3300026067	Bacteria	33823
788	Ga0207678_10006774	3300026067	Bacteria	10159
789	Ga0207678_10026474	3300026067	Bacteria	5058
790	Ga0207678_10048162	3300026067	Bacteria	3684
791	Ga0207708_10001062	3300026075	Bacteria	20593
792	Ga0207708_10015080	3300026075	Bacteria	5793
793	Ga0207708_10029622	3300026075	Bacteria	4149
794	Ga0207708_10033176	3300026075	Bacteria	3921
795	Ga0207708_10080212	3300026075	Bacteria	2508
796	Ga0207708_10112081	3300026075	Bacteria	2119
797	Ga0207702_10001740	3300026078	Bacteria	21419
798	Ga0207702_10031217	3300026078	Bacteria	4439
799	Ga0207702_10085685	3300026078	Bacteria	2746
800	Ga0207702_10139579	3300026078	Bacteria	2191
801	Ga0207641_10000050	3300026088	Bacteria	175954
802	Ga0207641_10001115	3300026088	Bacteria	27013
803	Ga0207641_10001172	3300026088	Bacteria	26323
804	Ga0207641_10003433	3300026088	Bacteria	14030
805	Ga0207641_10004693	3300026088	Bacteria	11776
806	Ga0207641_10061616	3300026088	Bacteria	3200
807	Ga0207648_10000306	3300026089	Bacteria	53612
808	Ga0207648_10000361	3300026089	Bacteria	50161
809	Ga0207648_10020688	3300026089	Bacteria	5923
810	Ga0207648_10037648	3300026089	Bacteria	4261
811	Ga0207648_10046204	3300026089	Bacteria	3818
812	Ga0207648_10087476	3300026089	Bacteria	2719
813	Ga0207648_10148902	3300026089	Bacteria	2065
814	Ga0207676_10001858	3300026095	Bacteria	15468
815	Ga0207676_10016181	3300026095	Bacteria	5399
816	Ga0207676_10031822	3300026095	Bacteria	3969
817	Ga0207676_10043773	3300026095	Bacteria	3449
818	Ga0207674_10009667	3300026116	Bacteria	10996
819	Ga0207674_10015783	3300026116	Bacteria	8284
820	Ga0207674_10049903	3300026116	Bacteria	4277
821	Ga0207674_10053935	3300026116	Bacteria	4095
822	Ga0207674_10072833	3300026116	Bacteria	3450
823	Ga0207674_10132363	3300026116	Bacteria	2456
824	Ga0207675_100000316	3300026118	Bacteria	46037
825	Ga0207675_100015099	3300026118	Bacteria	7205
826	Ga0207675_100020532	3300026118	Bacteria	6157
827	Ga0207675_100020580	3300026118	Bacteria	6149
828	Ga0207675_100027232	3300026118	Bacteria	5324
829	Ga0207675_100050563	3300026118	Bacteria	3878
830	Ga0207675_100060056	3300026118	Bacteria	3549
831	Ga0207683_10000010	3300026121	Bacteria	150106
832	Ga0207683_10000661	3300026121	Bacteria	31642
833	Ga0207683_10001718	3300026121	Bacteria	19588
834	Ga0207683_10014173	3300026121	Bacteria	6792
835	Ga0207683_10017122	3300026121	Bacteria	6169
836	Ga0207683_10062319	3300026121	Bacteria	3284
837	Ga0207683_10083120	3300026121	Bacteria	2845
838	Ga0207683_10209702	3300026121	Bacteria	1773
839	Ga0207698_10003706	3300026142	Bacteria	9237
840	Ga0207698_10006921	3300026142	Bacteria	7096
841	Ga0207698_10023183	3300026142	Bacteria	4331
842	Ga0209281_1000034	3300027111	Bacteria	382562
843	Ga0209281_1000082	3300027111	Bacteria	257684
844	Ga0209281_1002777	3300027111	Bacteria	6487
845	Ga0209371_1003106	3300027312	Bacteria	8469
846	Ga0209371_1004382	3300027312	Bacteria	6192
847	Ga0209969_1000234	3300027360	Bacteria	7466
848	Ga0209981_1002410	3300027378	Bacteria	2380
849	Ga0209996_1003650	3300027395	Bacteria	1943
850	Ga0210000_1000426	3300027462	Bacteria	5808
851	Ga0210002_1000484	3300027617	Bacteria	5412
852	Ga0209282_1000006	3300027666	Bacteria	276998
853	Ga0209971_1002689	3300027682	Bacteria	4250
854	Ga0209813_10019720	3300027866	Bacteria	1878
855	Ga0209974_10004955	3300027876	Bacteria	4710
856	Ga0209974_10004969	3300027876	Bacteria	4704
857	Ga0207428_10000242	3300027907	Bacteria	74839
858	Ga0207428_10000679	3300027907	Bacteria	39859
859	Ga0207428_10001263	3300027907	Bacteria	27090
860	Ga0207428_10001945	3300027907	Bacteria	20943
861	Ga0207428_10003387	3300027907	Bacteria	15493
862	Ga0207428_10007049	3300027907	Bacteria	10292
863	Ga0207428_10010601	3300027907	Bacteria	8224
864	Ga0207428_10081279	3300027907	Bacteria	2530
865	Ga0207428_10092409	3300027907	Bacteria	2348
866	Ga0207428_10144841	3300027907	Bacteria	1811
867	Ga0268266_10000002	3300028379	Bacteria	3059047
868	Ga0268266_10000379	3300028379	Bacteria	67802
869	Ga0268266_10000468	3300028379	Bacteria	58386
870	Ga0268266_10000494	3300028379	Bacteria	56395
871	Ga0268266_10006387	3300028379	Bacteria	10799
872	Ga0268266_10021042	3300028379	Bacteria	5559
873	Ga0268266_10023985	3300028379	Bacteria	5191
874	Ga0268266_10029215	3300028379	Bacteria	4687
875	Ga0268266_10034364	3300028379	Bacteria	4312
876	Ga0268266_10070246	3300028379	Bacteria	3034
877	Ga0268265_10000155	3300028380	Bacteria	83925
878	Ga0268265_10000552	3300028380	Bacteria	38141
879	Ga0268265_10002823	3300028380	Bacteria	12777
880	Ga0268265_10028138	3300028380	Bacteria	4021
881	Ga0268265_10154627	3300028380	Bacteria	1939
882	Ga0268265_10183394	3300028380	Bacteria	1800
883	Ga0268264_10000161	3300028381	Bacteria	150917
884	Ga0268264_10000868	3300028381	Bacteria	32016
885	Ga0268264_10002854	3300028381	Bacteria	15066
886	Ga0268264_10007460	3300028381	Bacteria	9127
887	Ga0268264_10008472	3300028381	Bacteria	8550
888	Ga0268264_10023327	3300028381	Bacteria	5048
889	Ga0268264_10035229	3300028381	Bacteria	4120
890	Ga0265326_10003259	3300028558	Bacteria	5351
891	Ga0265318_10000094	3300028577	Bacteria	82007
892	Ga0265318_10011250	3300028577	Bacteria	3860
893	Ga0307515_10000006	3300028794	Bacteria	725810
894	Ga0307515_10000017	3300028794	Bacteria	550465
895	Ga0307515_10000043	3300028794	Bacteria	304612
896	Ga0307515_10003053	3300028794	Bacteria	35461
897	Ga0307515_10007366	3300028794	Bacteria	21774
898	Ga0307515_10008674	3300028794	Bacteria	19781
899	Ga0307515_10082421	3300028794	Bacteria	4161
900	Ga0265338_10000005	3300028800	Bacteria	571137
901	Ga0265338_10005237	3300028800	Bacteria	17007
902	Ga0265338_10030658	3300028800	Bacteria	5291
903	Ga0265338_10086992	3300028800	Bacteria	2598
904	Ga0265338_10117041	3300028800	Bacteria	2133
905	Ga0265324_10000117	3300029957	Bacteria	62994
906	Ga0237817_10047	3300030083	Bacteria	41405
907	Ga0268256_1004121	3300030500	Bacteria	6192
908	Ga0307511_10010541	3300030521	Bacteria	9180
909	Ga0265760_10019663	3300031090	Bacteria	1946
910	Ga0265330_10008930	3300031235	Bacteria	4787
911	Ga0265330_10024421	3300031235	Bacteria	2742
912	Ga0265332_10002858	3300031238	Bacteria	8545
913	Ga0265328_10000002	3300031239	Bacteria	275819
914	Ga0265328_10000012	3300031239	Bacteria	157661
915	Ga0265325_10000005	3300031241	Bacteria	321343
916	Ga0265325_10002918	3300031241	Bacteria	11396
917	Ga0265329_10008569	3300031242	Bacteria	3869
918	Ga0265340_10000206	3300031247	Bacteria	29746
919	Ga0265340_10000632	3300031247	Bacteria	19680
920	Ga0265340_10007431	3300031247	Bacteria	5947
921	Ga0265340_10011312	3300031247	Bacteria	4746
922	Ga0265340_10020450	3300031247	Bacteria	3401
923	Ga0265340_10024535	3300031247	Bacteria	3061
924	Ga0265339_10001486	3300031249	Bacteria	17310
925	Ga0265331_10000017	3300031250	Bacteria	269978
926	Ga0265331_10000504	3300031250	Bacteria	36812
927	Ga0265331_10002961	3300031250	Bacteria	11179
928	Ga0265331_10004560	3300031250	Bacteria	8630
929	Ga0265331_10005758	3300031250	Bacteria	7423
930	Ga0265331_10007756	3300031250	Bacteria	6162
931	Ga0265331_10011174	3300031250	Bacteria	4925
932	Ga0265331_10016150	3300031250	Bacteria	3926
933	Ga0265327_10000135	3300031251	Bacteria	162683
934	Ga0265327_10000710	3300031251	Bacteria	52598
935	Ga0265327_10001697	3300031251	Bacteria	26322
936	Ga0265327_10001968	3300031251	Bacteria	23490
937	Ga0265327_10005958	3300031251	Bacteria	9935
938	Ga0265327_10006002	3300031251	Bacteria	9879
939	Ga0265327_10021678	3300031251	Bacteria	3869
940	Ga0265327_10024267	3300031251	Bacteria	3568
941	Ga0265316_10000429	3300031344	Bacteria	47829
942	Ga0265316_10004082	3300031344	Bacteria	14610
943	Ga0265316_10012424	3300031344	Bacteria	7636
944	Ga0265316_10118861	3300031344	Bacteria	1997
945	Ga0307513_10002173	3300031456	Bacteria	27419
946	Ga0307513_10024793	3300031456	Bacteria	6972
947	Ga0307513_10042125	3300031456	Bacteria	5031
948	Ga0307513_10065706	3300031456	Bacteria	3816
949	Ga0307513_10077740	3300031456	Bacteria	3435
950	Ga0307513_10078317	3300031456	Bacteria	3419
951	Ga0265313_10000298	3300031595	Bacteria	53738
952	Ga0265313_10005338	3300031595	Bacteria	9489
953	Ga0265313_10026530	3300031595	Bacteria	3050
954	Ga0307508_10140695	3300031616	Bacteria	2017
955	Ga0316575_10012884	3300031665	Bacteria	3118
956	Ga0316575_10014162	3300031665	Bacteria	2990
957	Ga0316575_10024005	3300031665	Bacteria	2358
958	Ga0316579_10001035	3300031691	Bacteria	9810
959	Ga0316579_10004706	3300031691	Bacteria	5444
960	Ga0265314_10010830	3300031711	Bacteria	7582
961	Ga0265314_10022315	3300031711	Bacteria	4850
962	Ga0265342_10000175	3300031712	Bacteria	71083
963	Ga0265342_10011310	3300031712	Bacteria	6118
964	Ga0265342_10011737	3300031712	Bacteria	5977
965	Ga0265342_10029020	3300031712	Bacteria	3438
966	Ga0316576_10003716	3300031727	Bacteria	9009
967	Ga0316576_10005030	3300031727	Bacteria	8010
968	Ga0316576_10010386	3300031727	Bacteria	6048
969	Ga0316576_10010808	3300031727	Bacteria	5947
970	Ga0316576_10012907	3300031727	Bacteria	5529
971	Ga0316576_10021976	3300031727	Bacteria	4422
972	Ga0316576_10030835	3300031727	Bacteria	3800
973	Ga0316576_10041481	3300031727	Bacteria	3313
974	Ga0316578_10042539	3300031728	Bacteria	2634
975	Ga0316578_10082182	3300031728	Bacteria	1917
976	Ga0307516_10000023	3300031730	Bacteria	190971
977	Ga0307516_10000208	3300031730	Bacteria	75300
978	Ga0307405_10019857	3300031731	Bacteria	3743
979	Ga0316577_10000403	3300031733	Bacteria	16625
980	Ga0316577_10013901	3300031733	Bacteria	4414
981	Ga0307413_10002413	3300031824	Bacteria	7588
982	Ga0307413_10033939	3300031824	Bacteria	2911
983	Ga0307413_10116387	3300031824	Bacteria	1801
984	Ga0307410_10070281	3300031852	Bacteria	2424
985	Ga0307407_10048154	3300031903	Bacteria	2424
986	Ga0307412_10002165	3300031911	Bacteria	10901
987	Ga0307412_10054891	3300031911	Bacteria	2647
988	Ga0315914_1000003	3300031967	Bacteria	314370
989	Ga0307416_100000215	3300032002	Bacteria	30330
990	Ga0307416_100026340	3300032002	Bacteria	4284
991	Ga0307414_10003258	3300032004	Bacteria	8651
992	Ga0307414_10067419	3300032004	Bacteria	2563
993	Ga0307411_10002323	3300032005	Bacteria	8354
994	Ga0307415_100000500	3300032126	Bacteria	17010
995	Ga0307415_100016717	3300032126	Bacteria	4380
996	Ga0316583_10000596	3300032133	Bacteria	10981
997	Ga0316583_10012153	3300032133	Bacteria	3106
998	Ga0316583_10023859	3300032133	Bacteria	2184
999	Ga0307510_10011314	3300033180	Bacteria	10600
1000	Ga0307510_10037705	3300033180	Bacteria	5359
1001	Ga0315913_1000001	3300033430	Bacteria	284459
1002	Ga0315915_1000008	3300033464	Bacteria	258517
1003	Ga0316586_1005828	3300033527	Bacteria	1749
1004	Ga0316596_1002153	3300033541	Bacteria	4166
1005	Ga0373934_0000199	3300035086	Bacteria	22129
1006	Ga0373934_0001186	3300035086	Bacteria	9472
1007	Ga0373923_0000319	3300035111	Bacteria	10771
1008	Ga0373936_0001528	3300035113	Bacteria	8425
1009	Ga0373953_0000509	3300035117	Bacteria	10806
1010	Ga0373953_0000725	3300035117	Bacteria	9108
1011	Ga0373954_0000616	3300035118	Bacteria	13589
1012	Ga0373954_0008132	3300035118	Bacteria	4597
1013	Ga0373954_0018136	3300035118	Bacteria	3166
1014	Ga0373956_0000034	3300035119	Bacteria	43936
1015	Ga0373956_0016163	3300035119	Bacteria	3132
1016	Ga0373957_0009190	3300035120	Bacteria	3227
1017	Ga0373960_0007483	3300035121	Bacteria	2590
1018	Ga0373961_0000355	3300035241	Bacteria	19806
1019	Ga0316574_0008223	3300035398	Bacteria	5781
1020	Ga0316574_0017979	3300035398	Bacteria	4146
1021	Ga0316574_0040997	3300035398	Bacteria	2852
1022	Ga0316574_0049115	3300035398	Bacteria	2623
1023	Ga0316574_0051781	3300035398	Bacteria	2559
1024	Ga0316574_0079292	3300035398	Bacteria	2082
1025	Ga0373924_0001035	3300035410	Bacteria	8835
1026	Ga0373931_0000320	3300035691	Bacteria	20211
1027	Ga0373931_0000339	3300035691	Bacteria	19365
1028	Ga0373931_0001364	3300035691	Bacteria	10440
1029	Ga0373935_0004965	3300035692	Bacteria	7824
1030	Ga0373935_0008750	3300035692	Bacteria	6066
1031	Ga0373935_0009826	3300035692	Bacteria	5729
1032	Ga0373927_0005507	3300035695	Bacteria	8721
1033	Ga0373927_0015638	3300035695	Bacteria	5012
1034	Ga0373933_0000691	3300035724	Bacteria	20777
1035	Ga0373947_0002220	3300035725	Bacteria	11758
1036	Ga0373937_0001711	3300036401	Bacteria	18445
1037	Ga0373937_0002608	3300036401	Bacteria	15018
1038	Ga0373937_0017770	3300036401	Bacteria	6344
1039	Ga0373937_0034699	3300036401	Bacteria	4588
1040	Ga0373937_0042783	3300036401	Bacteria	4133
1041	Ga0373937_0095210	3300036401	Bacteria	2761
1042	Ga0373937_0113613	3300036401	Bacteria	2520
1043	Ga0373937_0175105	3300036401	Bacteria	2014
1044	Ga0316582_0020164	3300036647	Bacteria	3916
1045	Ga0316582_0023087	3300036647	Bacteria	3703
1046	Ga0316582_0077107	3300036647	Bacteria	2168
1047	Ga0316582_0091253	3300036647	Bacteria	2005
1048	Ga0316584_0000036	3300036712	Bacteria	48276
1049	Ga0316584_0036923	3300036712	Bacteria	3627
1050	Ga0316584_0085340	3300036712	Bacteria	2364
1051	Ga0316584_0100252	3300036712	Bacteria	2168
1052	Ga0316584_0107913	3300036712	Bacteria	2083
1053	Ga0316584_0130096	3300036712	Bacteria	1880
1054	Ga0373925_0001295	3300037068	Bacteria	21971
1055	Ga0373925_0008505	3300037068	Bacteria	7480
1056	Ga0373925_0008996	3300037068	Bacteria	7276
1057	Ga0373925_0011200	3300037068	Bacteria	6505
1058	Ga0373925_0057882	3300037068	Bacteria	2905
1059	Ga0395900_0008923	3300037418	Bacteria	10285
1060	Ga0395900_0051320	3300037418	Bacteria	4249
1061	Ga0395900_0111836	3300037418	Bacteria	2805
1062	Ga0395900_0121646	3300037418	Bacteria	2678
1063	Ga0395900_0122132	3300037418	Bacteria	2672
1064	Ga0395898_0013285	3300037466	Bacteria	8481
1065	Ga0395898_0029567	3300037466	Bacteria	5487
1066	Ga0395898_0064048	3300037466	Bacteria	3566
1067	Ga0395898_0216607	3300037466	Bacteria	1826
1068	Ga0395905_0000247	3300037471	Bacteria	81281
1069	Ga0395905_0005902	3300037471	Bacteria	12420
1070	Ga0395905_0009806	3300037471	Bacteria	9333
1071	Ga0316581_0001331	3300037588	Bacteria	5487
1072	Ga0436364_0423999	3300037853	Bacteria	3009
1073	Ga0436364_0547155	3300037853	Bacteria	53932
1074	Ga0436364_0679392	3300037853	Bacteria	26409
1075	Ga0436364_0921801	3300037853	Bacteria	28337
1076	Ga0436364_1013963	3300037853	Bacteria	10622
1077	Ga0436364_1476473	3300037853	Bacteria	4927
1078	Ga0395901_0000093	3300038443	Bacteria	120300
1079	Ga0395901_0003578	3300038443	Bacteria	15677
1080	Ga0395901_0007515	3300038443	Bacteria	11004
1081	Ga0395901_0014480	3300038443	Bacteria	8023
1082	Ga0395901_0018103	3300038443	Bacteria	7189
1083	Ga0395901_0041185	3300038443	Bacteria	4786
1084	Ga0395901_0060743	3300038443	Bacteria	3933
1085	Ga0395901_0137250	3300038443	Bacteria	2570
1086	Ga0395901_0200827	3300038443	Bacteria	2090
1087	Ga0237819_00928	3300038705	Bacteria	9050
1088	Ga0400484_27574	3300038725	Bacteria	9605
1089	Ga0400490_03842	3300038726	Bacteria	27608
1090	Ga0400483_046359	3300039062	Bacteria	19124
1091	Ga0400483_106683	3300039062	Bacteria	21855
1092	Ga0400483_154876	3300039062	Bacteria	2131
1093	Ga0436365_1849791	3300039437	Bacteria	109940
1094	Ga0436360_0921776	3300039438	Bacteria	3058
1095	Ga0436360_1209995	3300039438	Bacteria	3150
1096	Ga0436361_0891949	3300039447	Bacteria	7628
1097	Ga0436361_0993322	3300039447	Bacteria	10670
1098	Ga0436361_1028602	3300039447	Bacteria	8752
1099	Ga0436363_0562538	3300039450	Bacteria	6163
1100	Ga0436363_0899192	3300039450	Bacteria	4956
1101	Ga0436363_1416780	3300039450	Bacteria	3795
1102	Ga0439436_0007632	3300041404	Bacteria	3330
1103	Ga0439436_0008737	3300041404	Bacteria	3113
1104	Ga0439465_0001911	3300041413	Bacteria	6825
1105	Ga0439465_0008539	3300041413	Bacteria	3231
1106	Ga0451855_0959896	3300041511	Bacteria	11889
1107	Ga0439441_000073	3300042001	Bacteria	7652
1108	Ga0439441_000169	3300042001	Bacteria	5796
1109	Ga0439449_0006907	3300042007	Bacteria	4328
1110	Ga0450896_000462	3300042133	Bacteria	4188
1111	Ga0439446_0000368	3300042156	Bacteria	8643
1112	Ga0439434_0000880	3300042435	Bacteria	8653
1113	Ga0439434_0003350	3300042435	Bacteria	4698
1114	Ga0439435_0000647	3300042436	Bacteria	5727
1115	Ga0439435_0001682	3300042436	Bacteria	4167
1116	Ga0439435_0002608	3300042436	Bacteria	3612
1117	Ga0451577_0000481	3300042876	Bacteria	67449
1118	Ga0451577_0003470	3300042876	Bacteria	17536
1119	Ga0451577_0042540	3300042876	Bacteria	4073
1120	Ga0451577_0064145	3300042876	Bacteria	3276
1121	Ga0451577_0076662	3300042876	Bacteria	2981
1122	Ga0453683_0006760	3300044673	Bacteria	7836
1123	Ga0466966_0001025	3300044684	Bacteria	17857
1124	Ga0466961_0003658	3300044693	Bacteria	9588
1125	Ga0466964_0001073	3300044706	Bacteria	9140
1126	Ga0453684_0001020	3300044712	Bacteria	89996
1127	Ga0453684_0001500	3300044712	Bacteria	65793
1128	Ga0453684_0008466	3300044712	Bacteria	18410
1129	Ga0453684_0054723	3300044712	Bacteria	5195
1130	Ga0466971_0000450	3300044719	Bacteria	16075
1131	Ga0466970_0001115	3300044765	Bacteria	13007
1132	Ga0466957_0004297	3300044842	Bacteria	7907
1133	Ga0466959_0001398	3300045049	Bacteria	14775
1134	Ga0466959_0016765	3300045049	Bacteria	5361
1135	Ga0451576_0000407	3300045051	Bacteria	100082
1136	Ga0451576_0000431	3300045051	Bacteria	96367
1137	Ga0451576_0000713	3300045051	Bacteria	67026
1138	Ga0451576_0003022	3300045051	Bacteria	23776
1139	Ga0451576_0033233	3300045051	Bacteria	5483
1140	Ga0466967_0000620	3300045976	Bacteria	17707
1141	Ga0466967_0004104	3300045976	Bacteria	9731
1142	Ga0495592_0000725	3300046454	Bacteria	23069
1143	Ga0495592_0001366	3300046454	Bacteria	16866
1144	Ga0495592_0112110	3300046454	Bacteria	1929
1145	Ga0495629_0007120	3300046459	Bacteria	8241
1146	Ga0495638_0000179	3300046460	Bacteria	97078
1147	Ga0495638_0001972	3300046460	Bacteria	17564
1148	Ga0495638_0012527	3300046460	Bacteria	5806
1149	Ga0495638_0020321	3300046460	Bacteria	4388
1150	Ga0495638_0038143	3300046460	Bacteria	3055
1151	Ga0495651_0000056	3300046462	Bacteria	83191
1152	Ga0495651_0004590	3300046462	Bacteria	10558
1153	Ga0495653_0002911	3300046463	Bacteria	13684
1154	Ga0495650_0000058	3300046471	Bacteria	302308
1155	Ga0495650_0009383	3300046471	Bacteria	5569
1156	Ga0495580_0009081	3300046472	Bacteria	7839
1157	Ga0495580_0032645	3300046472	Bacteria	3755
1158	Ga0495580_0076030	3300046472	Bacteria	2342
1159	Ga0495582_0007738	3300046473	Bacteria	5940
1160	Ga0495582_0019554	3300046473	Bacteria	3704
1161	Ga0495605_0001262	3300046474	Bacteria	16753
1162	Ga0495662_0045694	3300046476	Bacteria	2114
1163	Ga0495664_0035483	3300046477	Bacteria	2937
1164	Ga0495584_0044097	3300046491	Bacteria	2251
1165	Ga0495584_0079836	3300046491	Bacteria	1646
1166	Ga0495594_0006616	3300046499	Bacteria	5963
1167	Ga0495607_0053538	3300046501	Bacteria	2331
1168	Ga0495583_0001172	3300046506	Bacteria	28294
1169	Ga0495583_0006721	3300046506	Bacteria	7444
1170	Ga0495606_0000434	3300046507	Bacteria	69495
1171	Ga0495606_0004702	3300046507	Bacteria	13473
1172	Ga0495606_0047086	3300046507	Bacteria	2845
1173	Ga0495610_0001234	3300046512	Bacteria	22985
1174	Ga0495618_0032298	3300046514	Bacteria	3278
1175	Ga0495628_0012478	3300046516	Bacteria	7163
1176	Ga0495628_0076931	3300046516	Bacteria	2596
1177	Ga0495630_0005050	3300046517	Bacteria	9281
1178	Ga0495630_0053124	3300046517	Bacteria	3033
1179	Ga0495637_0025744	3300046520	Bacteria	2649
1180	Ga0495643_0001766	3300046522	Bacteria	18595
1181	Ga0495643_0002587	3300046522	Bacteria	14120
1182	Ga0495643_0011175	3300046522	Bacteria	5486
1183	Ga0495643_0016112	3300046522	Bacteria	4398
1184	Ga0495643_0020538	3300046522	Bacteria	3806
1185	Ga0495643_0027721	3300046522	Bacteria	3180
1186	Ga0495648_0000256	3300046524	Bacteria	60519
1187	Ga0495648_0024938	3300046524	Bacteria	4059
1188	Ga0495666_0001758	3300046526	Bacteria	10689
1189	Ga0495642_0042329	3300046528	Bacteria	1855
1190	Ga0495652_0016929	3300046529	Bacteria	6513
1191	Ga0495654_0001572	3300046530	Bacteria	15496
1192	Ga0495665_0004795	3300046531	Bacteria	7300
1193	Ga0495665_0037691	3300046531	Bacteria	2580
1194	Ga0495586_0003221	3300046535	Bacteria	8767
1195	Ga0495586_0004128	3300046535	Bacteria	7782
1196	Ga0495587_0036424	3300046536	Bacteria	2959
1197	Ga0495621_0033780	3300046539	Bacteria	1765
1198	Ga0495645_0001302	3300046543	Bacteria	16968
1199	Ga0495645_0015851	3300046543	Bacteria	5367
1200	Ga0495622_0005016	3300046557	Bacteria	6135
1201	Ga0495622_0016250	3300046557	Bacteria	3466
1202	Ga0495633_0001885	3300046558	Bacteria	15298
1203	Ga0495633_0045804	3300046558	Bacteria	2070
1204	Ga0495667_0024092	3300046559	Bacteria	4099
1205	Ga0495656_0015935	3300046615	Bacteria	2846
1206	Ga0495668_0000163	3300046616	Bacteria	99607
1207	Ga0495634_0005742	3300046642	Bacteria	9477
1208	Ga0495634_0070423	3300046642	Bacteria	2305
1209	Ga0495611_0006136	3300046648	Bacteria	5129
1210	Ga0495625_0000424	3300046660	Bacteria	63593
1211	Ga0495625_0002255	3300046660	Bacteria	21195
1212	Ga0495625_0005898	3300046660	Bacteria	11024
1213	Ga0495625_0012257	3300046660	Bacteria	6952
1214	Ga0495635_0053533	3300046663	Bacteria	2781
1215	Ga0495635_0083377	3300046663	Bacteria	2187
1216	Ga0495657_0003348	3300046675	Bacteria	13110
1217	Ga0495599_0002055	3300046678	Bacteria	11666
1218	Ga0495599_0013320	3300046678	Bacteria	5083
1219	Ga0495647_0000249	3300046681	Bacteria	14763
1220	Ga0495647_0002025	3300046681	Bacteria	6333
1221	Ga0495658_0001264	3300046683	Bacteria	13289
1222	Ga0495658_0007611	3300046683	Bacteria	5372
1223	Ga0495658_0088981	3300046683	Bacteria	1826
1224	Ga0495669_0000334	3300046684	Bacteria	25057
1225	Ga0495669_0001394	3300046684	Bacteria	9963
1226	Ga0495613_0054838	3300046689	Bacteria	2929
1227	Ga0495624_0012397	3300046690	Bacteria	5830
1228	Ga0495600_0027837	3300046809	Bacteria	3654
1229	Ga0495660_0075094	3300046810	Bacteria	1784
1230	Ga0495604_0006398	3300047317	Bacteria	9345
1231	Ga0495636_0000950	3300047318	Bacteria	10813
1232	Ga0495636_0003366	3300047318	Bacteria	6199
1233	Ga0495636_0004872	3300047318	Bacteria	5257
1234	Ga0495674_0004795	3300047319	Bacteria	13012
1235	Ga0495676_0063779	3300047321	Bacteria	2870
1236	Ga0495680_0013508	3300047322	Bacteria	7121
1237	Ga0495680_0083625	3300047322	Bacteria	2406
1238	Ga0495683_0001056	3300047323	Bacteria	19092
1239	Ga0495687_000557	3300047443	Bacteria	43965
1240	Ga0495687_000933	3300047443	Bacteria	30343
1241	Ga0495675_0003045	3300047444	Bacteria	10079
1242	Ga0495675_0095549	3300047444	Bacteria	1863
1243	Ga0495681_0009860	3300047470	Bacteria	5841
1244	Ga0495684_0008344	3300047471	Bacteria	8030
1245	Ga0495686_0000645	3300047472	Bacteria	48009
1246	Ga0495686_0001486	3300047472	Bacteria	25489
1247	Ga0495686_0002111	3300047472	Bacteria	19487
1248	Ga0495686_0005079	3300047472	Bacteria	10536
1249	Ga0495686_0040658	3300047472	Bacteria	2964
1250	Ga0495602_0019308	3300048088	Bacteria	6772
1251	Ga0496100_0010213	3300048903	Bacteria	5309
1252	Ga0496101_0000358	3300048904	Bacteria	30626
1253	Ga0496101_0047184	3300048904	Bacteria	3091
1254	Ga0496101_0098506	3300048904	Bacteria	2184
1255	Ga0496102_0001541	3300048905	Bacteria	20348
1256	Ga0496102_0004575	3300048905	Bacteria	11688
1257	Ga0496102_0007251	3300048905	Bacteria	9463
1258	Ga0496102_0007982	3300048905	Bacteria	9045
1259	Ga0496102_0024167	3300048905	Bacteria	5401
1260	Ga0496102_0056376	3300048905	Bacteria	3584
1261	Ga0496102_0076889	3300048905	Bacteria	3071
1262	Ga0496102_0087001	3300048905	Bacteria	2887
1263	Ga0496103_0000335	3300048906	Bacteria	42986
1264	Ga0496103_0003001	3300048906	Bacteria	10430
1265	Ga0496103_0004380	3300048906	Bacteria	8573
1266	Ga0496103_0025256	3300048906	Bacteria	3589
1267	Ga0496103_0030823	3300048906	Bacteria	3265
1268	Ga0496103_0038026	3300048906	Bacteria	2951
1269	Ga0496104_0002175	3300048907	Bacteria	17002
1270	Ga0496104_0003919	3300048907	Bacteria	12881
1271	Ga0496104_0029729	3300048907	Bacteria	5070
1272	Ga0496104_0048385	3300048907	Bacteria	4009
1273	Ga0496104_0077573	3300048907	Bacteria	3165
1274	Ga0496105_0000773	3300048908	Bacteria	21686
1275	Ga0496105_0001669	3300048908	Bacteria	15811
1276	Ga0496105_0004306	3300048908	Bacteria	10717
1277	Ga0496105_0020018	3300048908	Bacteria	5401
1278	Ga0496105_0032367	3300048908	Bacteria	4290
1279	Ga0496105_0087270	3300048908	Bacteria	2578
1280	Ga0496105_0176127	3300048908	Bacteria	1752
1281	Ga0496106_0000726	3300048909	Bacteria	23754
1282	Ga0496106_0002781	3300048909	Bacteria	12970
1283	Ga0496106_0004794	3300048909	Bacteria	10002
1284	Ga0496106_0008723	3300048909	Bacteria	7499
1285	Ga0496106_0020654	3300048909	Bacteria	4890
1286	Ga0496106_0046007	3300048909	Bacteria	3279
1287	Ga0496107_0000514	3300048910	Bacteria	21529
1288	Ga0496107_0000976	3300048910	Bacteria	16973
1289	Ga0496107_0006722	3300048910	Bacteria	7921
1290	Ga0496107_0010856	3300048910	Bacteria	6338
1291	Ga0496107_0017280	3300048910	Bacteria	5073
1292	Ga0496107_0029451	3300048910	Bacteria	3905
1293	Ga0496107_0058908	3300048910	Bacteria	2778
1294	Ga0496108_0001029	3300048911	Bacteria	21735
1295	Ga0496108_0021728	3300048911	Bacteria	5276
1296	Ga0496108_0023861	3300048911	Bacteria	5035
1297	Ga0496108_0032777	3300048911	Bacteria	4315
1298	Ga0496108_0119126	3300048911	Bacteria	2263
1299	Ga0496109_0007024	3300048912	Bacteria	9499
1300	Ga0496109_0012283	3300048912	Bacteria	7393
1301	Ga0496109_0015290	3300048912	Bacteria	6683
1302	Ga0496109_0031282	3300048912	Bacteria	4775
1303	Ga0496109_0034421	3300048912	Bacteria	4561
1304	Ga0496110_0000813	3300048913	Bacteria	21875
1305	Ga0496110_0005310	3300048913	Bacteria	10085
1306	Ga0496110_0005731	3300048913	Bacteria	9756
1307	Ga0496110_0010446	3300048913	Bacteria	7550
1308	Ga0496110_0026891	3300048913	Bacteria	4927
1309	Ga0496110_0165672	3300048913	Bacteria	2004
1310	Ga0496111_0003530	3300048914	Bacteria	9673
1311	Ga0496111_0007069	3300048914	Bacteria	7334
1312	Ga0496111_0008950	3300048914	Bacteria	6659
1313	Ga0496111_0035380	3300048914	Bacteria	3569
1314	Ga0496111_0131844	3300048914	Bacteria	1849
1315	Ga0496113_0005190	3300048916	Bacteria	8101
1316	Ga0496113_0009364	3300048916	Bacteria	6421
1317	Ga0496114_0000064	3300048917	Bacteria	83513
1318	Ga0496114_0010857	3300048917	Bacteria	7254
1319	Ga0496114_0015025	3300048917	Bacteria	6225
1320	Ga0496114_0018928	3300048917	Bacteria	5577
1321	Ga0496114_0036747	3300048917	Bacteria	4049
1322	Ga0496114_0040208	3300048917	Bacteria	3870
1323	Ga0496114_0147243	3300048917	Bacteria	2042
1324	Ga0496115_0000172	3300048918	Bacteria	59971
1325	Ga0496115_0002339	3300048918	Bacteria	13595
1326	Ga0496115_0002583	3300048918	Bacteria	12996
1327	Ga0496115_0165691	3300048918	Bacteria	1828
1328	Ga0496116_0003713	3300048919	Bacteria	14928
1329	Ga0496116_0004457	3300048919	Bacteria	13343
1330	Ga0496116_0024980	3300048919	Bacteria	4403
1331	Ga0496116_0054115	3300048919	Bacteria	2646
1332	Ga0496117_0000040	3300048920	Bacteria	318616
1333	Ga0496117_0000582	3300048920	Bacteria	60157
1334	Ga0496117_0006686	3300048920	Bacteria	11533
1335	Ga0496117_0007744	3300048920	Bacteria	10378
1336	Ga0496117_0013159	3300048920	Bacteria	7237
1337	Ga0496117_0025074	3300048920	Bacteria	4697
1338	Ga0496117_0033362	3300048920	Bacteria	3894
1339	Ga0496118_0001151	3300048921	Bacteria	40832
1340	Ga0496118_0002822	3300048921	Bacteria	22727
1341	Ga0496118_0011995	3300048921	Bacteria	8374
1342	Ga0496118_0017772	3300048921	Bacteria	6455
1343	Ga0496119_0001371	3300048922	Bacteria	29712
1344	Ga0496119_0002251	3300048922	Bacteria	21469
1345	Ga0496119_0002551	3300048922	Bacteria	19826
1346	Ga0496119_0005444	3300048922	Bacteria	12197
1347	Ga0496120_0001128	3300048923	Bacteria	34511
1348	Ga0496120_0001625	3300048923	Bacteria	26039
1349	Ga0496120_0028708	3300048923	Bacteria	3405
1350	Ga0496120_0042121	3300048923	Bacteria	2668
1351	Ga0496121_0000580	3300048924	Bacteria	68713
1352	Ga0496121_0001258	3300048924	Bacteria	43842
1353	Ga0496121_0006258	3300048924	Bacteria	14896
1354	Ga0496121_0010593	3300048924	Bacteria	10361
1355	Ga0496121_0013924	3300048924	Bacteria	8595
1356	Ga0496121_0020407	3300048924	Bacteria	6563
1357	Ga0496121_0068973	3300048924	Bacteria	2857
1358	Ga0496121_0081024	3300048924	Bacteria	2570
1359	Ga0496122_0000157	3300048925	Bacteria	159733
1360	Ga0496122_0000414	3300048925	Bacteria	90664
1361	Ga0496122_0001038	3300048925	Bacteria	48750
1362	Ga0496122_0010926	3300048925	Bacteria	9284
1363	Ga0496122_0011770	3300048925	Bacteria	8812
1364	Ga0496122_0016181	3300048925	Bacteria	7084
1365	Ga0496122_0028145	3300048925	Bacteria	4781
1366	Ga0496122_0035301	3300048925	Bacteria	4070
1367	Ga0496122_0037808	3300048925	Bacteria	3878
1368	Ga0496123_0000048	3300048926	Bacteria	244152
1369	Ga0496123_0000147	3300048926	Bacteria	143834
1370	Ga0496123_0000792	3300048926	Bacteria	51045
1371	Ga0496123_0000848	3300048926	Bacteria	48801
1372	Ga0496123_0006482	3300048926	Bacteria	11329
1373	Ga0496123_0023802	3300048926	Bacteria	4678
1374	Ga0496123_0025813	3300048926	Bacteria	4417
1375	Ga0496123_0051082	3300048926	Bacteria	2756
1376	Ga0496124_0000348	3300048927	Bacteria	84728
1377	Ga0496124_0000606	3300048927	Bacteria	60251
1378	Ga0496124_0002089	3300048927	Bacteria	26962
1379	Ga0496124_0006013	3300048927	Bacteria	13382
1380	Ga0496124_0015984	3300048927	Bacteria	7162
1381	Ga0496124_0072217	3300048927	Bacteria	2858
1382	Ga0496124_0076986	3300048927	Bacteria	2752
1383	Ga0496124_0102616	3300048927	Bacteria	2314
1384	Ga0496125_0000666	3300048928	Bacteria	57200
1385	Ga0496125_0000848	3300048928	Bacteria	49020
1386	Ga0496125_0005220	3300048928	Bacteria	14569
1387	Ga0496125_0013692	3300048928	Bacteria	7957
1388	Ga0496125_0015247	3300048928	Bacteria	7438
1389	Ga0496125_0038410	3300048928	Bacteria	4144
1390	Ga0496126_0001153	3300048929	Bacteria	43798
1391	Ga0496126_0003273	3300048929	Bacteria	20666
1392	Ga0496126_0025465	3300048929	Bacteria	5692
1393	Ga0496126_0042884	3300048929	Bacteria	4177
1394	Ga0496126_0043327	3300048929	Bacteria	4152
1395	Ga0495678_002029	3300049459	Bacteria	14513
1396	Ga0495682_0001243	3300049460	Bacteria	14414
1397	Ga0501031_0000274	3300049568	Bacteria	29130
1398	Ga0501031_0003711	3300049568	Bacteria	9825
1399	Ga0501032_0000024	3300049569	Bacteria	143876
1400	Ga0501032_0000597	3300049569	Bacteria	29147
1401	Ga0501032_0000951	3300049569	Bacteria	23376
1402	Ga0501032_0002365	3300049569	Bacteria	14771
1403	Ga0501032_0006007	3300049569	Bacteria	8954
1404	Ga0501033_0000189	3300049570	Bacteria	59012
1405	Ga0501033_0001349	3300049570	Bacteria	21856
1406	Ga0501033_0001767	3300049570	Bacteria	18899
1407	Ga0501033_0002145	3300049570	Bacteria	17068
1408	Ga0501033_0009793	3300049570	Bacteria	7360
1409	Ga0501033_0045267	3300049570	Bacteria	3275
1410	Ga0501034_0000205	3300049571	Bacteria	112180
1411	Ga0501034_0000317	3300049571	Bacteria	85341
1412	Ga0501034_0002140	3300049571	Bacteria	24535
1413	Ga0501034_0004533	3300049571	Bacteria	15441
1414	Ga0501034_0012803	3300049571	Bacteria	8653
1415	Ga0501034_0015236	3300049571	Bacteria	7901
1416	Ga0501034_0031725	3300049571	Bacteria	5367
1417	Ga0501034_0086275	3300049571	Bacteria	3140
1418	Ga0501034_0096743	3300049571	Bacteria	2948
1419	Ga0501034_0124058	3300049571	Bacteria	2568
1420	Ga0501036_0000396	3300049572	Bacteria	30676
1421	Ga0501036_0000460	3300049572	Bacteria	29152
1422	Ga0501036_0007368	3300049572	Bacteria	8964
1423	Ga0501036_0047412	3300049572	Bacteria	3639
1424	Ga0501036_0057491	3300049572	Bacteria	3294
1425	Ga0501036_0095538	3300049572	Bacteria	2512
1426	Ga0501037_0000186	3300049573	Bacteria	57745
1427	Ga0501037_0000363	3300049573	Bacteria	38033
1428	Ga0501037_0000934	3300049573	Bacteria	21711
1429	Ga0501037_0004086	3300049573	Bacteria	10578
1430	Ga0501037_0009077	3300049573	Bacteria	7288
1431	Ga0501037_0026795	3300049573	Bacteria	4258
1432	Ga0501037_0030774	3300049573	Bacteria	3964
1433	Ga0501037_0085458	3300049573	Bacteria	2284
1434	Ga0501037_0087696	3300049573	Bacteria	2252
1435	Ga0501038_0000022	3300049574	Bacteria	151623
1436	Ga0501038_0000064	3300049574	Bacteria	87975
1437	Ga0501038_0000730	3300049574	Bacteria	29345
1438	Ga0501038_0005305	3300049574	Bacteria	11972
1439	Ga0501038_0017575	3300049574	Bacteria	6465
1440	Ga0501038_0028576	3300049574	Bacteria	4953
1441	Ga0501039_0000017	3300049575	Bacteria	189412
1442	Ga0501039_0000030	3300049575	Bacteria	130049
1443	Ga0501039_0002397	3300049575	Bacteria	13940
1444	Ga0501039_0009336	3300049575	Bacteria	7474
1445	Ga0501039_0050145	3300049575	Bacteria	3229
1446	Ga0501039_0119994	3300049575	Bacteria	2060
1447	Ga0501039_0121714	3300049575	Bacteria	2045
1448	Ga0501040_0000675	3300049576	Bacteria	21084
1449	Ga0501040_0020171	3300049576	Bacteria	4440
1450	Ga0501041_0005649	3300049577	Bacteria	7308
1451	Ga0501041_0011840	3300049577	Bacteria	5162
1452	Ga0501041_0017837	3300049577	Bacteria	4224
1453	Ga0501041_0028358	3300049577	Bacteria	3377
1454	Ga0501042_0010804	3300049578	Bacteria	6138
1455	Ga0501042_0015348	3300049578	Bacteria	5244
1456	Ga0501043_0000050	3300049579	Bacteria	107465
1457	Ga0501043_0000265	3300049579	Bacteria	47653
1458	Ga0501043_0001343	3300049579	Bacteria	21530
1459	Ga0501043_0003031	3300049579	Bacteria	13961
1460	Ga0501043_0013937	3300049579	Bacteria	6291
1461	Ga0501043_0030262	3300049579	Bacteria	4254
1462	Ga0501043_0093835	3300049579	Bacteria	2359
1463	Ga0501043_0099390	3300049579	Bacteria	2287
1464	Ga0501043_0110644	3300049579	Bacteria	2157
1465	Ga0501046_0000035	3300049580	Bacteria	161495
1466	Ga0501046_0000858	3300049580	Bacteria	29578
1467	Ga0501046_0001830	3300049580	Bacteria	20277
1468	Ga0501046_0008673	3300049580	Bacteria	8837
1469	Ga0501046_0030007	3300049580	Bacteria	4417
1470	Ga0501046_0039757	3300049580	Bacteria	3764
1471	Ga0501046_0058649	3300049580	Bacteria	3017
1472	Ga0501046_0069028	3300049580	Bacteria	2751
1473	Ga0501046_0069710	3300049580	Bacteria	2735
1474	Ga0501046_0075415	3300049580	Bacteria	2615
1475	Ga0501047_0000172	3300049581	Bacteria	79334
1476	Ga0501047_0005550	3300049581	Bacteria	11872
1477	Ga0501047_0007715	3300049581	Bacteria	10133
1478	Ga0501047_0027350	3300049581	Bacteria	5494
1479	Ga0501047_0070703	3300049581	Bacteria	3360
1480	Ga0501047_0079466	3300049581	Bacteria	3153
1481	Ga0501047_0093199	3300049581	Bacteria	2891
1482	Ga0501048_0003101	3300049582	Bacteria	12682
1483	Ga0501048_0013328	3300049582	Bacteria	6099
1484	Ga0501048_0023676	3300049582	Bacteria	4486
1485	Ga0501048_0036075	3300049582	Bacteria	3555
1486	Ga0501048_0081445	3300049582	Bacteria	2284
1487	Ga0501048_0103622	3300049582	Bacteria	2008
1488	Ga0501048_0108457	3300049582	Bacteria	1960
1489	Ga0501067_0000662	3300049583	Bacteria	18505
1490	Ga0501067_0001038	3300049583	Bacteria	14923
1491	Ga0501067_0005495	3300049583	Bacteria	7029
1492	Ga0501067_0007855	3300049583	Bacteria	5929
1493	Ga0501067_0018230	3300049583	Bacteria	3888
1494	Ga0501068_0005329	3300049584	Bacteria	7027
1495	Ga0501068_0016120	3300049584	Bacteria	4304
1496	Ga0501068_0040402	3300049584	Bacteria	2801
1497	Ga0501069_0000066	3300049585	Bacteria	55164
1498	Ga0501069_0000088	3300049585	Bacteria	44197
1499	Ga0501070_0000819	3300049586	Bacteria	28242
1500	Ga0501070_0001479	3300049586	Bacteria	21034
1501	Ga0501070_0001512	3300049586	Bacteria	20735
1502	Ga0501070_0001911	3300049586	Bacteria	18392
1503	Ga0501070_0004201	3300049586	Bacteria	12382
1504	Ga0501070_0009613	3300049586	Bacteria	8169
1505	Ga0501070_0027007	3300049586	Bacteria	4815
1506	Ga0501070_0047096	3300049586	Bacteria	3584
1507	Ga0501070_0049372	3300049586	Bacteria	3494
1508	Ga0501070_0081743	3300049586	Bacteria	2673
1509	Ga0501071_0034536	3300049587	Bacteria	3600
1510	Ga0501071_0057183	3300049587	Bacteria	2818
1511	Ga0501072_0002550	3300049588	Bacteria	13648
1512	Ga0501072_0009328	3300049588	Bacteria	7459
1513	Ga0501072_0021330	3300049588	Bacteria	5025
1514	Ga0501072_0087514	3300049588	Bacteria	2472
1515	Ga0501072_0095434	3300049588	Bacteria	2363
1516	Ga0501072_0140557	3300049588	Bacteria	1925
1517	Ga0501073_0002593	3300049589	Bacteria	13522
1518	Ga0501073_0008662	3300049589	Bacteria	7537
1519	Ga0501073_0014214	3300049589	Bacteria	5782
1520	Ga0501073_0014602	3300049589	Bacteria	5706
1521	Ga0501073_0026081	3300049589	Bacteria	4187
1522	Ga0501073_0082516	3300049589	Bacteria	2236
1523	Ga0501074_0040144	3300049590	Bacteria	3390
1524	Ga0501075_0000134	3300049591	Bacteria	36642
1525	Ga0501075_0001338	3300049591	Bacteria	16001
1526	Ga0501075_0007984	3300049591	Bacteria	7353
1527	Ga0501075_0014713	3300049591	Bacteria	5607
1528	Ga0501075_0021413	3300049591	Bacteria	4713
1529	Ga0501075_0023949	3300049591	Bacteria	4472
1530	Ga0501075_0046356	3300049591	Bacteria	3265
1531	Ga0501075_0064473	3300049591	Bacteria	2763
1532	Ga0501076_0000029	3300049592	Bacteria	75907
1533	Ga0501076_0000211	3300049592	Bacteria	35233
1534	Ga0501076_0000506	3300049592	Bacteria	24711
1535	Ga0501076_0007335	3300049592	Bacteria	8025
1536	Ga0501076_0013096	3300049592	Bacteria	6210
1537	Ga0501076_0024845	3300049592	Bacteria	4634
1538	Ga0501076_0051085	3300049592	Bacteria	3272
1539	Ga0501077_0003810	3300049593	Bacteria	9084
1540	Ga0501077_0005857	3300049593	Bacteria	7491
1541	Ga0501077_0011373	3300049593	Bacteria	5558
1542	Ga0501077_0040392	3300049593	Bacteria	2972
1543	Ga0501077_0059393	3300049593	Bacteria	2427
1544	Ga0501077_0093066	3300049593	Bacteria	1910
1545	Ga0501079_0003857	3300049741	Bacteria	11062
1546	Ga0501079_0005090	3300049741	Bacteria	9764
1547	Ga0501079_0005381	3300049741	Bacteria	9531
1548	Ga0501079_0006445	3300049741	Bacteria	8814
1549	Ga0501079_0007352	3300049741	Bacteria	8327
1550	Ga0501079_0015495	3300049741	Bacteria	5818
1551	Ga0501079_0027634	3300049741	Bacteria	4352
1552	Ga0501079_0042822	3300049741	Bacteria	3496
1553	Ga0501079_0043317	3300049741	Bacteria	3474
1554	Ga0501080_0000032	3300049742	Bacteria	86373
1555	Ga0501080_0000354	3300049742	Bacteria	35302
1556	Ga0501080_0000871	3300049742	Bacteria	24729
1557	Ga0501080_0001591	3300049742	Bacteria	19269
1558	Ga0501080_0012119	3300049742	Bacteria	7898
1559	Ga0501080_0016479	3300049742	Bacteria	6825
1560	Ga0501080_0019684	3300049742	Bacteria	6251
1561	Ga0501080_0056531	3300049742	Bacteria	3654
1562	Ga0501080_0061216	3300049742	Bacteria	3505
1563	Ga0501080_0077850	3300049742	Bacteria	3084
1564	Ga0501081_0000636	3300049743	Bacteria	20058
1565	Ga0501081_0000844	3300049743	Bacteria	18134
1566	Ga0501081_0003374	3300049743	Bacteria	10163
1567	Ga0501081_0025584	3300049743	Bacteria	3971
1568	Ga0501081_0045965	3300049743	Bacteria	2999
1569	Ga0501081_0046392	3300049743	Bacteria	2987
1570	Ga0501081_0052936	3300049743	Bacteria	2802
1571	Ga0501081_0074314	3300049743	Bacteria	2371
1572	Ga0501083_0003938	3300049744	Bacteria	10435
1573	Ga0501083_0017805	3300049744	Bacteria	4956
1574	Ga0501083_0031768	3300049744	Bacteria	3624
1575	Ga0501083_0051159	3300049744	Bacteria	2778
1576	Ga0501083_0083139	3300049744	Bacteria	2121
1577	Ga0501269_001981	3300049766	Bacteria	2582
1578	Ga0501035_0000011	3300049822	Bacteria	305794
1579	Ga0501035_0000021	3300049822	Bacteria	209085
1580	Ga0501035_0000065	3300049822	Bacteria	129986
1581	Ga0501035_0001047	3300049822	Bacteria	28944
1582	Ga0501035_0002360	3300049822	Bacteria	18572
1583	Ga0501035_0003024	3300049822	Bacteria	16120
1584	Ga0501035_0007291	3300049822	Bacteria	10347
1585	Ga0501035_0008032	3300049822	Bacteria	9835
1586	Ga0501035_0015812	3300049822	Bacteria	6965
1587	Ga0501035_0062759	3300049822	Bacteria	3306
1588	Ga0501035_0085870	3300049822	Bacteria	2773
1589	Ga0501035_0137473	3300049822	Bacteria	2126
1590	Ga0501044_0000043	3300049823	Bacteria	151623
1591	Ga0501044_0000333	3300049823	Bacteria	59546
1592	Ga0501044_0014501	3300049823	Bacteria	8502
1593	Ga0501044_0016934	3300049823	Bacteria	7819
1594	Ga0501044_0023814	3300049823	Bacteria	6507
1595	Ga0501044_0060916	3300049823	Bacteria	3862
1596	Ga0501044_0072669	3300049823	Bacteria	3497
1597	Ga0501044_0134928	3300049823	Bacteria	2460
1598	Ga0501045_0000489	3300049824	Bacteria	24526
1599	Ga0501045_0007117	3300049824	Bacteria	7759
1600	Ga0501045_0011306	3300049824	Bacteria	6266
1601	Ga0501045_0020921	3300049824	Bacteria	4677
1602	Ga0501045_0029153	3300049824	Bacteria	3987
1603	Ga0501045_0031535	3300049824	Bacteria	3839
1604	Ga0501045_0038253	3300049824	Bacteria	3489
1605	Ga0501045_0143226	3300049824	Bacteria	1778
1606	nmdc:mga03683_1133_c1	3300050489	Bacteria	7833
1607	nmdc:mga03683_20197_c1	3300050489	Bacteria	2553
1608	nmdc:mga03683_23464_c1	3300050489	Bacteria	2403
1609	nmdc:mga03n38_132_c1	3300050490	Bacteria	16217
1610	nmdc:mga03n38_4444_c1	3300050490	Bacteria	4649
1611	nmdc:mga00v17_835_c1	3300050491	Bacteria	16694
1612	nmdc:mga0yw44_27189_c1	3300050492	Bacteria	3274
1613	nmdc:mga0yw44_29361_c1	3300050492	Bacteria	3174
1614	nmdc:mga0yw44_460_c1	3300050492	Bacteria	14436
1615	nmdc:mga0yw44_58547_c1	3300050492	Bacteria	2354
1616	nmdc:mga0k408_7739_c1	3300050493	Bacteria	5744
1617	nmdc:mga0k408_956_c1	3300050493	Bacteria	15857
1618	nmdc:mga06z11_2631_c1	3300050494	Bacteria	2199
1619	nmdc:mga06z11_269_c1	3300050494	Bacteria	8745
1620	nmdc:mga04h51_15631_c1	3300050495	Bacteria	2189
1621	nmdc:mga07m45_36315_c1	3300050496	Bacteria	2744
1622	nmdc:mga07m45_68161_c1	3300050496	Bacteria	2023
1623	nmdc:mga05p37_2617_c1	3300050507	Bacteria	20946
1624	nmdc:mga05p37_29279_c1	3300050507	Bacteria	6721
1625	nmdc:mga05p37_5315_c1	3300050507	Bacteria	15118
1626	nmdc:mga05p37_87972_c1	3300050507	Bacteria	3829
1627	nmdc:mga09592_10_c1	3300050508	Bacteria	106937
1628	nmdc:mga09592_1504_c1	3300050508	Bacteria	18770
1629	nmdc:mga09592_174377_c1	3300050508	Bacteria	1860
1630	nmdc:mga09592_301_c1	3300050508	Bacteria	35907
1631	nmdc:mga09592_34514_c1	3300050508	Bacteria	4229
1632	nmdc:mga09592_36761_c1	3300050508	Bacteria	4103
1633	nmdc:mga09592_42965_c1	3300050508	Bacteria	3802
1634	nmdc:mga09592_58628_c1	3300050508	Bacteria	3256
1635	nmdc:mga09592_87471_c1	3300050508	Bacteria	2660
1636	nmdc:mga09592_8936_c1	3300050508	Bacteria	8145
1637	nmdc:mga0qj67_20862_c1	3300050509	Bacteria	5020
1638	nmdc:mga0qj67_36027_c1	3300050509	Bacteria	3870
1639	nmdc:mga06r32_14284_c1	3300050510	Bacteria	7202
1640	nmdc:mga06r32_1660_c1	3300050510	Bacteria	20100
1641	nmdc:mga06r32_220165_c1	3300050510	Bacteria	1886
1642	nmdc:mga06r32_2813_c1	3300050510	Bacteria	15595
1643	nmdc:mga06r32_54662_c1	3300050510	Bacteria	3829
1644	nmdc:mga06r32_59081_c1	3300050510	Bacteria	3686
1645	nmdc:mga06r32_78398_c1	3300050510	Bacteria	3211
1646	nmdc:mga08y16_124661_c1	3300050511	Bacteria	2680
1647	nmdc:mga08y16_195813_c1	3300050511	Bacteria	2095
1648	nmdc:mga08y16_29351_c1	3300050511	Bacteria	5795
1649	nmdc:mga08y16_3090_c1	3300050511	Bacteria	17221
1650	nmdc:mga08y16_3339_c1	3300050511	Bacteria	16624
1651	nmdc:mga08y16_35970_c1	3300050511	Bacteria	5201
1652	nmdc:mga08y16_35_c1	3300050511	Bacteria	157578
1653	nmdc:mga08y16_5753_c1	3300050511	Bacteria	12979
1654	nmdc:mga08y16_89602_c1	3300050511	Bacteria	3206
1655	nmdc:mga08y16_91454_c1	3300050511	Bacteria	3171
1656	nmdc:mga0n895_12221_c1	3300050512	Bacteria	7694
1657	nmdc:mga0n895_147478_c1	3300050512	Bacteria	2382
1658	nmdc:mga0n895_23546_c1	3300050512	Bacteria	5789
1659	nmdc:mga0n895_24540_c1	3300050512	Bacteria	5683
1660	nmdc:mga0n895_30618_c1	3300050512	Bacteria	5145
1661	nmdc:mga0n895_31954_c1	3300050512	Bacteria	5047
1662	nmdc:mga0n895_46445_c1	3300050512	Bacteria	4243
1663	nmdc:mga0n895_48482_c1	3300050512	Bacteria	4158
1664	nmdc:mga0rr50_150_c1	3300050513	Bacteria	38355
1665	nmdc:mga0rr50_35859_c1	3300050513	Bacteria	3566
1666	nmdc:mga0rr50_5774_c1	3300050513	Bacteria	7428
1667	nmdc:mga08x19_391_c1	3300050514	Bacteria	30774
1668	nmdc:mga08x19_8847_c1	3300050514	Bacteria	6006
1669	nmdc:mga0a205_12364_c1	3300050515	Bacteria	7896
1670	nmdc:mga0a205_1525_c1	3300050515	Bacteria	19796
1671	nmdc:mga0a205_153_c2	3300050515	Bacteria	40564
1672	nmdc:mga0a205_34305_c1	3300050515	Bacteria	4870
1673	nmdc:mga0a205_34964_c1	3300050515	Bacteria	4824
1674	nmdc:mga0a205_41897_c1	3300050515	Bacteria	4411
1675	nmdc:mga0a205_461_c1	3300050515	Bacteria	31578
1676	Ga0495601_0024366	3300053077	Bacteria	3726
1677	Ga0500610_0000382	3300053079	Bacteria	13456
1678	Ga0495655_0001812	3300053083	Bacteria	3328
1679	Ga0495595_0000771	3300053084	Bacteria	12152
1680	Ga0495595_0007385	3300053084	Bacteria	4500
1681	Ga0495595_0010287	3300053084	Bacteria	3886
1682	Ga0495619_0018513	3300053085	Bacteria	4418
1683	Ga0495619_0021231	3300053085	Bacteria	4143
1684	Ga0500643_000001	3300053087	Bacteria	1440111
1685	Ga0500643_017144	3300053087	Bacteria	2433
1686	Ga0500641_0000230	3300053096	Bacteria	21018
1687	Ga0500641_0001163	3300053096	Bacteria	9379
1688	Ga0500641_0023346	3300053096	Bacteria	2377
1689	Ga0500555_005169	3300053103	Bacteria	3701
1690	Ga0500556_0000031	3300053104	Bacteria	156000
1691	Ga0500556_0000155	3300053104	Bacteria	57500
1692	Ga0500556_0000172	3300053104	Bacteria	52902
1693	Ga0500562_000093	3300053108	Bacteria	37199
1694	Ga0500562_002492	3300053108	Bacteria	4606
1695	Ga0500569_000487	3300053109	Bacteria	6572
1696	Ga0500594_0009361	3300053118	Bacteria	2254
1697	Ga0500595_000878	3300053119	Bacteria	17136
1698	Ga0500595_001503	3300053119	Bacteria	12385
1699	Ga0500595_002281	3300053119	Bacteria	9651
1700	Ga0500595_018059	3300053119	Bacteria	2587
1701	Ga0500608_028952	3300053122	Bacteria	2617
1702	Ga0500618_000849	3300053125	Bacteria	16428
1703	Ga0500618_001483	3300053125	Bacteria	10381
1704	Ga0500618_008664	3300053125	Bacteria	2823
1705	Ga0500642_0000003	3300053130	Bacteria	544899
1706	Ga0500642_0000647	3300053130	Bacteria	10382
1707	Ga0500658_0000206	3300053134	Bacteria	27878
1708	Ga0500658_0026427	3300053134	Bacteria	2236
1709	Ga0500568_0000054	3300053139	Bacteria	111105
1710	Ga0500568_0000905	3300053139	Bacteria	20463
1711	Ga0500568_0011234	3300053139	Bacteria	4168
1712	Ga0500604_0000004	3300053151	Bacteria	146374
1713	Ga0500616_0000309	3300053153	Bacteria	70113
1714	Ga0500616_0000393	3300053153	Bacteria	60542
1715	Ga0500616_0000576	3300053153	Bacteria	44650
1716	Ga0500616_0000893	3300053153	Bacteria	32769
1717	Ga0500616_0002050	3300053153	Bacteria	17716
1718	Ga0500616_0011950	3300053153	Bacteria	5102
1719	Ga0500616_0059115	3300053153	Bacteria	1992
1720	Ga0500620_000488	3300053155	Bacteria	6976
1721	Ga0500622_0000011	3300053156	Bacteria	386096
1722	Ga0500622_0000399	3300053156	Bacteria	41585
1723	Ga0500622_0012800	3300053156	Bacteria	4533
1724	Ga0500636_0003395	3300053177	Bacteria	8953
1725	Ga0500645_000170	3300053730	Bacteria	51134
1726	Ga0500645_002762	3300053730	Bacteria	7604
1727	Ga0500645_009971	3300053730	Bacteria	3165
1728	Ga0500609_000260	3300053731	Bacteria	7673
1729	Ga0500596_000115	3300053735	Bacteria	11301
1730	Ga0501084_0000016	3300054114	Bacteria	155919
1731	Ga0501084_0001167	3300054114	Bacteria	20494
1732	Ga0501084_0001884	3300054114	Bacteria	16721
1733	Ga0501084_0002245	3300054114	Bacteria	15503
1734	Ga0501084_0028853	3300054114	Bacteria	4639
1735	Ga0501084_0033867	3300054114	Bacteria	4273
1736	Ga0501084_0038230	3300054114	Bacteria	4012
1737	Ga0501084_0044216	3300054114	Bacteria	3728
1738	Ga0501084_0060030	3300054114	Bacteria	3184
1739	Ga0501082_0000215	3300060353	Bacteria	50556
1740	Ga0501082_0000816	3300060353	Bacteria	27385
1741	Ga0501082_0002657	3300060353	Bacteria	15631
1742	Ga0501082_0006245	3300060353	Bacteria	10342
1743	Ga0501082_0006353	3300060353	Bacteria	10254
1744	Ga0501082_0006638	3300060353	Bacteria	10012
1745	Ga0501082_0012805	3300060353	Bacteria	7209
1746	Ga0501082_0015842	3300060353	Bacteria	6483
1747	Ga0501082_0035239	3300060353	Bacteria	4314
1748	Ga0501082_0075753	3300060353	Bacteria	2899
1749	Ga0501082_0086463	3300060353	Bacteria	2704
1750	Ga0501082_0089121	3300060353	Bacteria	2663
1751	Ga0501082_0105664	3300060353	Bacteria	2436
1752	Ga0501082_0118442	3300060353	Bacteria	2294
1753	Ga0466962_0001888	3300061719	Bacteria	9864
1754	Ga0530510_0000284	3300061734	Bacteria	32207
1755	Ga0530510_0006743	3300061734	Bacteria	8005
1756	Ga0530510_0009217	3300061734	Bacteria	6918
1757	Ga0530510_0038433	3300061734	Bacteria	3455
1758	Ga0530510_0047506	3300061734	Bacteria	3101
1759	Ga0530510_0083392	3300061734	Bacteria	2328
1760	2503200258	2503198000	Bacteria	6884444
1761	2509108151	2508501122	Bacteria	6292184
1762	2509115104	2508501123	Bacteria	6283661
1763	2509139494	2508501127	Bacteria	7037543
1764	2509372206	2509276018	Bacteria	6910194
1765	2509376674	2509276019	Bacteria	6802256
1766	2509391808	2509276021	Bacteria	7634384
1767	2509395073	2509276022	Bacteria	6200534
1768	2509447337	2509276033	Bacteria	7180565
1769	2510134175	2510065019	Bacteria	6903379
1770	2510305325	2510065057	Bacteria	6649661
1771	2510314195	2510065059	Bacteria	6847884
1772	2510841352	2510461069	Bacteria	5505000
1773	2510895612	2510461076	Bacteria	8618824
1774	2511133222	2510917022	Bacteria	6504556
1775	2511172233	2510917026	Bacteria	7046020
1776	2511182473	2510917028	Bacteria	6185411
1777	2511199250	2510917030	Bacteria	7460662
1778	2511390160	2511231027	Bacteria	5013807
1779	2511502461	2511231052	Bacteria	6974333
1780	2512533839	2512047086	Bacteria	6850303
1781	2512932374	2512875016	Bacteria	6529530
1782	2512960378	2512875024	Bacteria	7195110
1783	2512970412	2512875026	Bacteria	6861065
1784	2513567744	2513237084	Bacteria	7231967
1785	2513577174	2513237085	Bacteria	7695351
1786	2513585006	2513237086	Bacteria	7265287
1787	2513593664	2513237087	Bacteria	5817514
1788	2513597672	2513237088	Bacteria	6927906
1789	2513601476	2513237089	Bacteria	6553624
1790	2513608500	2513237090	Bacteria	7096802
1791	2513618155	2513237091	Bacteria	6900273
1792	2513633158	2513237093	Bacteria	7545552
1793	2513707846	2513237103	Bacteria	7647401
1794	2513865923	2513237138	Bacteria	7368160
1795	2513884470	2513237140	Bacteria	7076289
1796	2513904488	2513237143	Bacteria	6664116
1797	2513908546	2513237144	Bacteria	7530820
1798	2513925185	2513237146	Bacteria	7166346
1799	2513983673	2513237156	Bacteria	6402557
1800	2513997686	2513237159	Bacteria	6810126
1801	2514003078	2513237160	Bacteria	6650282
1802	2514018077	2513237162	Bacteria	7468464
1803	2514034516	2513237164	Bacteria	7563725
1804	2514420341	2513237305	Bacteria	7293571
1805	2514587679	2513237351	Bacteria	6968952
1806	2515113341	2515075009	Bacteria	7288508
1807	2515609256	2515154107	Bacteria	6795637
1808	2515636767	2515154113	Bacteria	7807172
1809	2515646367	2515154114	Bacteria	7848616
1810	2515655117	2515154116	Bacteria	7552979
1811	2515739709	2515154134	Bacteria	7220242
1812	2516206191	2516143018	Bacteria	6951533
1813	2516893837	2516653046	Bacteria	6989037
1814	2517036945	2516653077	Bacteria	7555578
1815	2517077305	2516653085	Bacteria	7346596
1816	2517096061	2517093000	Bacteria	7412387
1817	2517407679	2517287029	Bacteria	6905599
1818	2517570550	2517487022	Bacteria	7227575
1819	2520377035	2519899620	Bacteria	6499161
1820	2523466225	2523231067	Bacteria	5230452
1821	2524448341	2524023207	Bacteria	6813453
1822	2524458853	2524023209	Bacteria	6679728
1823	2530646578	2529292951	Bacteria	6916614
1824	2535517102	2534681796	Bacteria	7146037
1825	2545678198	2545555834	Bacteria	8130841
1826	2551675956	2551306084	Bacteria	8942552
1827	2551688290	2551306085	Bacteria	7347181
1828	2551690914	2551306086	Bacteria	6843938
1829	2551703457	2551306087	Bacteria	7351905
1830	2551715295	2551306089	Bacteria	7162724
1831	2551723715	2551306090	Bacteria	7953713
1832	2551726891	2551306091	Bacteria	7086830
1833	2551736717	2551306092	Bacteria	6992595
1834	2551742964	2551306093	Bacteria	7064773
1835	2553396316	2551306519	Bacteria	5465154
1836	2558863964	2558860100	Bacteria	8458965
1837	2585167440	2582581283	Bacteria	6030556
1838	2585201997	2582581294	Bacteria	6626667
1839	2585223079	2582581298	Bacteria	7315509
1840	2585228515	2582581299	Bacteria	6518058
1841	2585258270	2582581304	Bacteria	5831370
1842	2585265664	2582581306	Bacteria	6450535
1843	2585271347	2582581307	Bacteria	6597605
1844	2585279289	2582581308	Bacteria	7413247
1845	2585323107	2582581315	Bacteria	7318924
1846	2585331220	2582581316	Bacteria	7774528
1847	2585388869	2582581865	Bacteria	6644329
1848	2585395431	2582581866	Bacteria	6859583
1849	2585400954	2582581867	Bacteria	7184437
1850	2585524733	2585427526	Bacteria	7258840
1851	2585531227	2585427527	Bacteria	7273426
1852	2585538416	2585427528	Bacteria	6842387
1853	2585545662	2585427529	Bacteria	7395659
1854	2585552850	2585427530	Bacteria	7383882
1855	2585559090	2585427531	Bacteria	6992870
1856	2585822143	2585427590	Bacteria	6824633
1857	2585836369	2585427593	Bacteria	7141551
1858	2585843470	2585427594	Bacteria	6180594
1859	2585898472	2585427608	Bacteria	6544331
1860	2585903964	2585427609	Bacteria	6667127
1861	2585996674	2585427633	Bacteria	6413184
1862	2586001199	2585427634	Bacteria	6455027
1863	2587980918	2585428125	Bacteria	6662905
1864	2595087830	2593339131	Bacteria	5116855
1865	2597812260	2597489875	Bacteria	7010078
1866	2599417092	2599185170	Bacteria	7295545
1867	2599721602	2599185236	Bacteria	6875203
1868	2599936263	2599185301	Bacteria	6161860
1869	2600194847	2599185352	Bacteria	7228948
1870	2600374113	2600254933	Bacteria	4750527
1871	2616293141	2615840624	Bacteria	6557588
1872	2616311030	2615840626	Bacteria	7921970
1873	2616554467	2615840698	Bacteria	7319877
1874	2617384830	2617270742	Bacteria	6808054
1875	2643757739	2643221547	Bacteria	4740017
1876	2643776451	2643221551	Bacteria	3750538
1877	2643794898	2643221555	Bacteria	3749717
1878	2643804199	2643221557	Bacteria	7184309
1879	2643811313	2643221558	Bacteria	5460675
1880	2643887383	2643221575	Bacteria	4022601
1881	2643949838	2643221588	Bacteria	3692460
1882	2644007043	2643221599	Bacteria	6292121
1883	2644050237	2643221607	Bacteria	6314006
1884	2644065027	2643221610	Bacteria	7480339
1885	2644105262	2643221618	Bacteria	7717186
1886	2644145662	2643221626	Bacteria	8069654
1887	2644156451	2643221627	Bacteria	6761570
1888	2644158351	2643221627	Bacteria	6761570
1889	2644191822	2643221634	Bacteria	6705461
1890	2644204701	2643221636	Bacteria	6583769
1891	2644208791	2643221637	Bacteria	5345260
1892	2644242560	2643221643	Bacteria	5749658
1893	2644298902	2643221653	Bacteria	4569637
1894	2644309675	2643221655	Bacteria	7722067
1895	2644331157	2643221659	Bacteria	7890716
1896	2644338530	2643221660	Bacteria	4208257
1897	2644376564	2643221668	Bacteria	7306521
1898	2644416700	2643221675	Bacteria	7473456
1899	2644449740	2643221680	Bacteria	7473610
1900	2644483157	2643221686	Bacteria	6310811
1901	2644494313	2643221688	Bacteria	5260751
1902	2644497804	2643221689	Bacteria	6042950
1903	2644543404	2643221698	Bacteria	7756764
1904	2644616199	2643221712	Bacteria	7729434
1905	2644652321	2643221718	Bacteria	5345506
1906	2644657131	2643221719	Bacteria	4568197
1907	2644675822	2643221723	Bacteria	7095460
1908	2644689872	2643221726	Bacteria	7455827
1909	2644704557	2643221729	Bacteria	6621700
1910	2644709251	2643221730	Bacteria	6523787
1911	2644718354	2643221731	Bacteria	5623886
1912	2644725233	2643221732	Bacteria	5756404
1913	2644728490	2643221733	Bacteria	5690728
1914	2644736889	2643221734	Bacteria	5365412
1915	2657681728	2657244999	Bacteria	5946535
1916	2671111213	2667528174	Bacteria	6435400
1917	2671692433	2671180139	Bacteria	4196045
1918	2685149982	2684622632	Bacteria	5380049
1919	2688597437	2687453392	Bacteria	6880454
1920	2692315286	2690316117	Bacteria	6800650
1921	2694628533	2693429783	Bacteria	7019804
1922	2694637554	2693429784	Bacteria	7241525
1923	2698323217	2695420987	Bacteria	6152737
1924	2705994023	2703719227	Bacteria	5631989
1925	2715499134	2713897090	Bacteria	3353799
1926	2719182015	2718217882	Bacteria	6556348
1927	2719386627	2718217927	Bacteria	6972593
1928	2719666376	2718217997	Bacteria	6740740
1929	2719732731	2718218009	Bacteria	6478651
1930	2720492796	2718218199	Bacteria	6740745
1931	2720614263	2718218232	Bacteria	6720332
1932	2720621032	2718218233	Bacteria	6662049
1933	2720632355	2718218235	Bacteria	6630699
1934	2720776083	2718218269	Bacteria	6906114
1935	2721148106	2718218363	Bacteria	6524337
1936	2721159558	2718218365	Bacteria	6274507
1937	2721164942	2718218366	Bacteria	6425255
1938	2721400331	2718218423	Bacteria	6438183
1939	2721505347	2718218445	Bacteria	5113413
1940	2722841112	2721755514	Bacteria	6424414
1941	2723027682	2721755556	Bacteria	6745503
1942	2723561310	2721755684	Bacteria	6859907
1943	2723567933	2721755685	Bacteria	6704835
1944	2723574654	2721755686	Bacteria	7343952
1945	2724039144	2721755809	Bacteria	6438790
1946	2724045487	2721755810	Bacteria	6479005
1947	2724090690	2721755819	Bacteria	6906405
1948	2724105198	2721755822	Bacteria	6726041
1949	2724111026	2721755823	Bacteria	6752556
1950	2725951378	2724679232	Bacteria	7646494
1951	2730108618	2728369352	Bacteria	6745171
1952	2730165250	2728369365	Bacteria	6555560
1953	2730299190	2728369397	Bacteria	6274511
1954	2738744967	2738541281	Bacteria	5112672
1955	2738800319	2738541293	Bacteria	7065685
1956	2738814184	2738541295	Bacteria	5730091
1957	2738944067	2738541317	Bacteria	5340176
1958	2739033057	2738541333	Bacteria	7106503
1959	2739159267	2738541358	Bacteria	5932299
1960	2739211927	2738543006	Bacteria	5904091
1961	2739347053	2738543031	Bacteria	5769731
1962	2739354197	2738543032	Bacteria	5115625
1963	2753462357	2751185821	Bacteria	6189929
1964	2756671722	2756170246	Bacteria	7451806
1965	2765466515	2765235802	Bacteria	5618596
1966	2766066100	2765235942	Bacteria	7445910
1967	2770196968	2767802442	Bacteria	5747986
1968	2776270424	2775506902	Bacteria	6208009
1969	2776281657	2775506904	Bacteria	5954060
1970	2776914183	2775507049	Bacteria	6284736
1971	2777763091	2775507177	Bacteria	4384303
1972	2777839662	2775507192	Bacteria	4622234
1973	2778175650	2775507266	Bacteria	7392367
1974	2792581440	2791355082	Bacteria	5973319
1975	2792620581	2791355091	Bacteria	6135441
1976	2792625940	2791355092	Bacteria	6248105
1977	2792638879	2791355094	Bacteria	7011481
1978	2792751927	2791355123	Bacteria	8049106
1979	2793294215	2791355256	Bacteria	6798008
1980	2793315870	2791355259	Bacteria	7254731
1981	2793319396	2791355260	Bacteria	6598818
1982	2793328482	2791355261	Bacteria	6661293
1983	2793335441	2791355262	Bacteria	6774204
1984	2793339492	2791355263	Bacteria	6872478
1985	2793347031	2791355264	Bacteria	6429314
1986	2793351623	2791355265	Bacteria	6539969
1987	2793361919	2791355266	Bacteria	7116587
1988	2793367675	2791355267	Bacteria	7222458
1989	2802716768	2802428858	Bacteria	6636079
1990	2802725580	2802428859	Bacteria	6667919
1991	2802730329	2802428860	Bacteria	6525526
1992	2802737700	2802428861	Bacteria	6534206
1993	2802742911	2802428862	Bacteria	6633353
1994	2802750335	2802428863	Bacteria	6410669
1995	2804752914	2802429268	Bacteria	6094027
1996	2805926853	2802429605	Bacteria	6875453
1997	2805932767	2802429606	Bacteria	6346811
1998	2806045196	2802429633	Bacteria	7341974
1999	2806050009	2802429634	Bacteria	7083200
2000	2806056847	2802429635	Bacteria	7650140
2001	2806064228	2802429636	Bacteria	7597525
2002	2806071496	2802429637	Bacteria	7067217
2003	2819241091	2818991272	Bacteria	4622173
2004	2819569511	2818991441	Bacteria	5062707
2005	2819578869	2818991443	Bacteria	6598732
2006	2819609357	2818991448	Bacteria	6772224
2007	2819641331	2818991453	Bacteria	7181617
2008	2819685154	2818991461	Bacteria	7026071
2009	2819707491	2818991465	Bacteria	5388835
2010	2819719773	2818991467	Bacteria	5893227
2011	2821125731	2821123053	Bacteria	7836056
2012	2821448288	2821443989	Bacteria	7658172
2013	2828308095	2828305725	Bacteria	4916900
2014	2829747706	2829745981	Bacteria	5406054
2015	2837654657	2837651117	Bacteria	3772164
2016	2837679176	2837678835	Bacteria	5252418
2017	2837679679	2837678835	Bacteria	5252418
2018	2838021675	2838016132	Bacteria	6577831
2019	2838023634	2838022645	Bacteria	6494267
2020	2838033383	2838029111	Bacteria	6603031
2021	2838038702	2838035591	Bacteria	7166484
2022	2838045188	2838042994	Bacteria	6046894
2023	2838053331	2838048938	Bacteria	6044578
2024	2838065450	2838061910	Bacteria	6794874
2025	2838069930	2838068647	Bacteria	6208656
2026	2838079789	2838074704	Bacteria	6785777
2027	2838661376	2838661181	Bacteria	7385261
2028	2838670581	2838668709	Bacteria	6671819
2029	2838683227	2838680041	Bacteria	6545511
2030	2838686821	2838686498	Bacteria	7807632
2031	2838697829	2838694306	Bacteria	6853137
2032	2838702952	2838701080	Bacteria	6669771
2033	2838710944	2838707686	Bacteria	6619912
2034	2838730221	2838729681	Bacteria	7400765
2035	2838737817	2838736955	Bacteria	5760694
2036	2838742764	2838742623	Bacteria	7396178
2037	2839997506	2839993093	Bacteria	5512535
2038	2840768980	2840764183	Bacteria	6358399
2039	2840882236	2840878972	Bacteria	5483153
2040	2841738267	2841734538	Bacteria	6784580
2041	2841841814	2841840854	Bacteria	5761912
2042	2841854649	2841851746	Bacteria	7532261
2043	2841867177	2841864319	Bacteria	6742987
2044	2841914023	2841911363	Bacteria	6173697
2045	2841921493	2841917233	Bacteria	6173500
2046	2842079118	2842077413	Bacteria	6508645
2047	2842113037	2842110456	Bacteria	7656360
2048	2842118372	2842118031	Bacteria	7033875
2049	2842141592	2842140634	Bacteria	5759631
2050	2842147790	2842146304	Bacteria	5957337
2051	2842158331	2842156927	Bacteria	6894975
2052	2842168566	2842163707	Bacteria	6916235
2053	2842195837	2842192696	Bacteria	6147454
2054	2842199148	2842198810	Bacteria	6608673
2055	2842209595	2842205361	Bacteria	6340321
2056	2842218171	2842217011	Bacteria	7497767
2057	2842230054	2842229732	Bacteria	7475766
2058	2842240284	2842237096	Bacteria	6620661
2059	2842243943	2842243621	Bacteria	7421798
2060	2842252856	2842250916	Bacteria	6579627
2061	2842257972	2842257432	Bacteria	7401195
2062	2842269505	2842264693	Bacteria	6472963
2063	2842271641	2842271015	Bacteria	7807131
2064	2842283049	2842278818	Bacteria	6340002
2065	2842285385	2842285085	Bacteria	6011953
2066	2842292780	2842291075	Bacteria	7076806
2067	2842298203	2842298080	Bacteria	6123127
2068	2842305272	2842304105	Bacteria	7023636
2069	2842314000	2842311132	Bacteria	6616990
2070	2842319760	2842317721	Bacteria	6793725
2071	2842348464	2842341865	Bacteria	7003929
2072	2842360197	2842357229	Bacteria	6485165
2073	2842368313	2842363717	Bacteria	6844742
2074	2842373858	2842370503	Bacteria	7038661
2075	2842379177	2842377471	Bacteria	7140707
2076	2842384882	2842384541	Bacteria	7057858
2077	2842400123	2842395702	Bacteria	6780583
2078	2842402745	2842402390	Bacteria	6681310
2079	2842409884	2842409023	Bacteria	6687331
2080	2842416532	2842415677	Bacteria	6596907
2081	2842423544	2842422224	Bacteria	6239196
2082	2842430493	2842428310	Bacteria	6767288
2083	2842436695	2842434925	Bacteria	6502746
2084	2842443463	2842441272	Bacteria	6769273
2085	2842449332	2842447887	Bacteria	6754142
2086	2842466747	2842462802	Bacteria	6588055
2087	2842471435	2842469257	Bacteria	6752936
2088	2842479951	2842475841	Bacteria	6603183
2089	2842483850	2842482326	Bacteria	7212537
2090	2842492289	2842489311	Bacteria	6620893
2091	2842497850	2842495871	Bacteria	6820686
2092	2842505264	2842502639	Bacteria	6604161
2093	2842514273	2842509118	Bacteria	6850950
2094	2842522070	2842521101	Bacteria	6569494
2095	2842697363	2842694124	Bacteria	4063419
2096	2842699669	2842698319	Bacteria	5190321
2097	2842779971	2842775625	Bacteria	5587290
2098	2842872151	2842871566	Bacteria	4827117
2099	2842882187	2842882022	Bacteria	6158489
2100	2844008343	2844002411	Bacteria	7168230
2101	2844012814	2844009547	Bacteria	6728125
2102	2844106279	2844104063	Bacteria	6440972
2103	2844164021	2844163670	Bacteria	7266046
2104	2844458118	2844454524	Bacteria	7952546
2105	2844534953	2844533157	Bacteria	7517899
2106	2847419656	2847417321	Bacteria	6913799
2107	2847674906	2847670302	Bacteria	6165597
2108	2847675161	2847670302	Bacteria	6165597
2109	2847691337	2847686936	Bacteria	6278406
2110	2848298458	2848297114	Bacteria	3608511
2111	2848994658	2848992105	Bacteria	6810864
2112	2851246635	2851246043	Bacteria	6439203
2113	2852390480	2852387548	Bacteria	8025568
2114	2854682575	2854681122	Bacteria	4548679
2115	2854901342	2854896431	Bacteria	5869725
2116	2854919031	2854916844	Bacteria	5725939
2117	2855826563	2855825444	Bacteria	6785811
2118	2855841952	2855839649	Bacteria	7135830
2119	2855877173	2855872281	Bacteria	6964271
2120	2856322093	2856320880	Bacteria	7263508
2121	2856323340	2856320880	Bacteria	7263508
2122	2856329353	2856328259	Bacteria	6528202
2123	2856336461	2856334872	Bacteria	7037011
2124	2856347253	2856342000	Bacteria	7176905
2125	2856352927	2856349417	Bacteria	6230045
2126	2856368217	2856364286	Bacteria	6939991
2127	2857351592	2857349434	Bacteria	7926032
2128	2857370380	2857367948	Bacteria	6965560
2129	2857517195	2857516855	Bacteria	7787325
2130	2857532292	2857531043	Bacteria	6754041
2131	2857587304	2857586860	Bacteria	4354574
2132	2858803756	2858800743	Bacteria	6603254
2133	2861696029	2861691609	Bacteria	5628931
2134	2869164043	2869162929	Bacteria	6399702
2135	2869174653	2869169390	Bacteria	6659796
2136	2869239105	2869234852	Bacteria	6654993
2137	2869246801	2869242130	Bacteria	6609239
2138	2869249991	2869249662	Bacteria	6868783
2139	2869263881	2869256925	Bacteria	6981691
2140	2869269968	2869264136	Bacteria	6880765
2141	2869277372	2869271264	Bacteria	6908218
2142	2869282819	2869278585	Bacteria	7077053
2143	2869290164	2869285874	Bacteria	6901219
2144	2871432448	2871429161	Bacteria	6547891
2145	2871437942	2871435913	Bacteria	6880295
2146	2871453152	2871451962	Bacteria	7336357
2147	2871470964	2871466892	Bacteria	6923287
2148	2871474689	2871474448	Bacteria	6806570
2149	2871493069	2871488783	Bacteria	6929816
2150	2874108757	2874102143	Bacteria	6342645
2151	2874111547	2874109183	Bacteria	6517025
2152	2874117450	2874116593	Bacteria	6674494
2153	2874126956	2874123672	Bacteria	7238285
2154	2874139611	2874139085	Bacteria	7021506
2155	2874142479	2874139085	Bacteria	7021506
2156	2874152414	2874146452	Bacteria	7533118
2157	2874159815	2874155637	Bacteria	6724144
2158	2874162781	2874162495	Bacteria	6174670
2159	2874168864	2874168670	Bacteria	8062617
2160	2876367594	2876363079	Bacteria	6544991
2161	2876372404	2876369609	Bacteria	6807521
2162	2876383158	2876377896	Bacteria	6565995
2163	2876392809	2876386047	Bacteria	6698674
2164	2876405137	2876399893	Bacteria	6927900
2165	2876413522	2876406927	Bacteria	6191900
2166	2876418331	2876413966	Bacteria	6831344
2167	2876422273	2876420981	Bacteria	6687741
2168	2878736240	2878730984	Bacteria	6380721
2169	2878744337	2878738818	Bacteria	7136951
2170	2878750062	2878745973	Bacteria	6867388
2171	2878757114	2878753008	Bacteria	6922523
2172	2878778781	2878774303	Bacteria	6108671
2173	2878787130	2878781027	Bacteria	6834456
2174	2878795535	2878788777	Bacteria	6567085
2175	2881150160	2881147464	Bacteria	7779814
2176	2881161269	2881155292	Bacteria	6461656
2177	2881163458	2881161766	Bacteria	7127907
2178	2881166994	2881161766	Bacteria	7127907
2179	2881848199	2881845957	Bacteria	6611900
2180	2881859432	2881853255	Bacteria	6698367
2181	2881861754	2881861095	Bacteria	7128710
2182	2882640772	2882632389	Bacteria	8154593
2183	2882918473	2882912400	Bacteria	6801539
2184	2883294923	2883291878	Bacteria	5894118
2185	2883356591	2883354860	Bacteria	5865246
2186	2885305769	2885305155	Bacteria	7348390
2187	2885308513	2885305155	Bacteria	7348390
2188	2885312703	2885312484	Bacteria	6415165
2189	2885320478	2885318864	Bacteria	6729568
2190	2885327732	2885326080	Bacteria	7134805
2191	2885343162	2885342637	Bacteria	7011821
2192	2885353732	2885350715	Bacteria	6787678
2193	2888338502	2888337043	Bacteria	6629336
2194	2888346003	2888343758	Bacteria	6611049
2195	2888355313	2888350351	Bacteria	7372807
2196	2889010292	2889010040	Bacteria	6749192
2197	2889018042	2889016732	Bacteria	6700763
2198	2889796104	2889790730	Bacteria	5689708
2199	2889919912	2889914905	Bacteria	5702301
2200	2891090533	2891088606	Bacteria	4762464
2201	2891373580	2891373044	Bacteria	5202277
2202	2894655723	2894652903	Bacteria	4587256
2203	2894820510	2894817345	Bacteria	4892941
2204	2896254908	2896253425	Bacteria	3418029
2205	2896391097	2896384573	Bacteria	7700774
2206	2898796482	2898795034	Bacteria	4294459
2207	2899276442	2899275550	Bacteria	3958688
2208	2899806241	2899803654	Bacteria	5577784
2209	2902331756	2902330777	Bacteria	6395352
2210	2902408892	2902405164	Bacteria	6784948
2211	2903450372	2903448605	Bacteria	7357801
2212	2903500841	2903492973	Bacteria	13473544
2213	2903518644	2903513507	Bacteria	6344008
2214	2903521889	2903521522	Bacteria	6525694
2215	2903528266	2903528002	Bacteria	6586099
2216	2904527153	2904524088	Bacteria	5887454
2217	2904582088	2904578770	Bacteria	5302906
2218	2906312420	2906308376	Bacteria	6841989
2219	2906325129	2906321335	Bacteria	6579571
2220	2906330476	2906328253	Bacteria	6585166
2221	2906357965	2906354277	Bacteria	6991324
2222	2906365230	2906363423	Bacteria	6856682
2223	2906377752	2906370794	Bacteria	6881062
2224	2906397918	2906393657	Bacteria	6790866
2225	2906406942	2906401398	Bacteria	6693206
2226	2906408744	2906408224	Bacteria	6162342
2227	2906419673	2906414383	Bacteria	6580790
2228	2913296109	2913295892	Bacteria	6333755
2229	2913313577	2913308742	Bacteria	5350706
2230	2915982880	2915980308	Bacteria	6624279
2231	2915989479	2915986958	Bacteria	6739310
2232	2915994984	2915993759	Bacteria	7016183
2233	2916003094	2916000859	Bacteria	6865702
2234	2916009201	2916007675	Bacteria	6898660
2235	2916020069	2916014648	Bacteria	6946486
2236	2916023726	2916021584	Bacteria	6854472
2237	2916034409	2916028427	Bacteria	6748433
2238	2916041958	2916035215	Bacteria	6755766
2239	2916044332	2916041962	Bacteria	6820487
2240	2916050381	2916048683	Bacteria	6543552
2241	2916058066	2916055098	Bacteria	6758838
2242	2916065464	2916061851	Bacteria	6737736
2243	2916078324	2916076590	Bacteria	6596108
2244	2917558427	2917554339	Bacteria	4987857
2245	2917704321	2917699015	Bacteria	7043791
2246	2919054445	2919051321	Bacteria	4210889
2247	2919059621	2919059106	Bacteria	4991624
2248	2919106234	2919100787	Bacteria	7710546
2249	2919123134	2919119836	Bacteria	5208557
2250	2919144255	2919143609	Bacteria	6219228
2251	2919172966	2919171160	Bacteria	6499771
2252	2919410219	2919408235	Bacteria	6149349
2253	2919451190	2919450847	Bacteria	5631160
2254	2919519452	2919517244	Bacteria	5858162
2255	2919679547	2919679072	Bacteria	4629602
2256	2919720577	2919720352	Bacteria	5986006
2257	2920112846	2920107658	Bacteria	10042636
2258	2920761312	2920760137	Bacteria	7427611
2259	2920825485	2920822456	Bacteria	6897201
2260	2921205100	2921201388	Bacteria	6926299
2261	2921215153	2921208531	Bacteria	6745326
2262	2921238957	2921237296	Bacteria	6876710
2263	2921244842	2921244191	Bacteria	6568419
2264	2921253728	2921250672	Bacteria	6677771
2265	2921261935	2921257292	Bacteria	6808382
2266	2921266927	2921263974	Bacteria	6864552
2267	2921283939	2921282425	Bacteria	6826397
2268	2921290776	2921289301	Bacteria	7316391
2269	2921297905	2921296804	Bacteria	7176999
2270	2922135436	2922130491	Bacteria	7173936
2271	2922152398	2922151315	Bacteria	6902399
2272	2922163460	2922158528	Bacteria	6573167
2273	2922175442	2922172374	Bacteria	6167644
2274	2922180859	2922178524	Bacteria	6025201
2275	2922190605	2922185730	Bacteria	7113964
2276	2923561093	2923556063	Bacteria	6793593
2277	2924150878	2924144063	Bacteria	6883928
2278	2924156781	2924150972	Bacteria	7169444
2279	2924160855	2924158325	Bacteria	7188855
2280	2924167310	2924165586	Bacteria	7260590
2281	2924175447	2924172951	Bacteria	6749356
2282	2924182545	2924179722	Bacteria	6843264
2283	2924189237	2924186466	Bacteria	6876637
2284	2924196970	2924193448	Bacteria	6955718
2285	2924207066	2924200457	Bacteria	6757188
2286	2924212340	2924207177	Bacteria	6917007
2287	2924219151	2924214083	Bacteria	7080103
2288	2924224651	2924221636	Bacteria	7113495
2289	2924235427	2924228884	Bacteria	6633132
2290	2924728166	2924726620	Bacteria	6271473
2291	2924737687	2924733363	Bacteria	7574837
2292	2924749452	2924748358	Bacteria	6154725
2293	2924762212	2924754689	Bacteria	6774424
2294	2924765559	2924762789	Bacteria	6561353
2295	2924766248	2924762789	Bacteria	6561353
2296	2924782367	2924776078	Bacteria	7492003
2297	2924786417	2924784321	Bacteria	7416538
2298	2928095662	2928093941	Bacteria	5965005
2299	2928524082	2928521798	Bacteria	4960112
2300	2929008087	2929004312	Bacteria	5678476
2301	2929235248	2929233124	Bacteria	5948380
2302	2929297602	2929297113	Bacteria	3141306
2303	2932426956	2932426870	Bacteria	4547726
2304	2933023532	2933016740	Bacteria	6355406
2305	2933419590	2933418574	Bacteria	4476724
2306	2933571079	2933570622	Bacteria	7023390
2307	2933588906	2933586486	Bacteria	7667493
2308	2933600736	2933599457	Bacteria	5858799
2309	2935896786	2935894831	Bacteria	6620579
2310	2935901727	2935901341	Bacteria	7341747
2311	2936367107	2936361878	Bacteria	5632809
2312	2936371815	2936367885	Bacteria	7324495
2313	2936379650	2936375103	Bacteria	6652732
2314	2936387819	2936381700	Bacteria	7006523
2315	2937002719	2936996657	Bacteria	6298727
2316	2937005734	2937002841	Bacteria	6934057
2317	2937012211	2937009748	Bacteria	6746052
2318	2937019206	2937016420	Bacteria	6782579
2319	2937027291	2937023124	Bacteria	6815156
2320	2937033386	2937029754	Bacteria	6424026
2321	2937038436	2937036028	Bacteria	6846469
2322	2937044523	2937042894	Bacteria	6741576
2323	2937054495	2937049772	Bacteria	6757901
2324	2937057914	2937056579	Bacteria	7107896
2325	2937065262	2937063883	Bacteria	7199456
2326	2937074623	2937071275	Bacteria	6984483
2327	2937080644	2937078374	Bacteria	6610289
2328	2937091296	2937084907	Bacteria	6618516
2329	2937095054	2937091812	Bacteria	6979387
2330	2937100413	2937098957	Bacteria	7249374
2331	2937107816	2937106411	Bacteria	6947143
2332	2937117726	2937113482	Bacteria	6505872
2333	2937122911	2937119839	Bacteria	6597547
2334	2937130729	2937126314	Bacteria	6771275
2335	2937819436	2937813078	Bacteria	7783518
2336	2937825189	2937822353	Bacteria	7290551
2337	2937842478	2937836603	Bacteria	6811263
2338	2937845272	2937843397	Bacteria	5256375
2339	2937851019	2937848649	Bacteria	6983481
2340	2937862024	2937861824	Bacteria	6660327
2341	2937874224	2937868953	Bacteria	6639878
2342	2937880908	2937877337	Bacteria	7246526
2343	2937897632	2937891427	Bacteria	6357007
2344	2937976372	2937972304	Bacteria	7532020
2345	2937977102	2937972304	Bacteria	7532020
2346	2938016583	2938014810	Bacteria	6700592
2347	2938919429	2938917290	Bacteria	5914775
2348	2939616806	2939615513	Bacteria	2384962
2349	2939677464	2939674588	Bacteria	4844420
2350	2941504733	2941499720	Bacteria	7599444
2351	2946788987	2946787523	Bacteria	4366789
2352	2947428790	2947426588	Bacteria	5357194
2353	2954013028	2954011201	Bacteria	4762601
2354	2957380743	2957375807	Bacteria	6425588
2355	2957388532	2957382221	Bacteria	6737050
2356	2957394713	2957388812	Bacteria	6778072
2357	2957397208	2957395598	Bacteria	6822399
2358	2957405798	2957402308	Bacteria	6741770
2359	2957415005	2957408893	Bacteria	6558585
2360	2957418997	2957415311	Bacteria	6991633
2361	2957429606	2957422303	Bacteria	7172205
2362	2957430696	2957430029	Bacteria	7022557
2363	2957439504	2957437181	Bacteria	6568994
2364	2957445562	2957443900	Bacteria	6869977
2365	2957455783	2957450854	Bacteria	6765715
2366	2957458731	2957457609	Bacteria	6967680
2367	2957465072	2957464669	Bacteria	6568877
2368	2957473144	2957471148	Bacteria	6797643
2369	2957484649	2957478035	Bacteria	6756658
2370	2957485931	2957484790	Bacteria	6703082
2371	2957493008	2957491536	Bacteria	6695180
2372	2957500054	2957498199	Bacteria	7126688
2373	2957511362	2957505466	Bacteria	7253085
2374	2958038687	2958034702	Bacteria	6989922
2375	2958039602	2958034702	Bacteria	6989922
2376	2958052769	2958041894	Bacteria	13082850
2377	2958065136	2958064165	Bacteria	7158582
2378	2958071804	2958071322	Bacteria	6815895
2379	2958088536	2958084443	Bacteria	7312792
2380	2958105897	2958100919	Bacteria	6800575
2381	2958110491	2958108152	Bacteria	6681128
2382	2958116509	2958115193	Bacteria	6923548
2383	2958127087	2958122699	Bacteria	7280457
2384	2958134552	2958130278	Bacteria	6897202
2385	2958140280	2958137437	Bacteria	6050276
2386	2958158654	2958158011	Bacteria	6058449
2387	2958174783	2958172287	Bacteria	6716688
2388	2958181033	2958179912	Bacteria	6874908
2389	2960322838	2960319331	Bacteria	5502575
2390	2960377848	2960375949	Bacteria	5361395
2391	2960586065	2960584000	Bacteria	6864594
2392	2960594067	2960591022	Bacteria	6622873
2393	2960603828	2960597568	Bacteria	6550735
2394	2960606318	2960603979	Bacteria	6898737
2395	2960613149	2960610863	Bacteria	6691244
2396	2960619830	2960617483	Bacteria	6727748
2397	2960625684	2960624210	Bacteria	6875384
2398	2960635580	2960631154	Bacteria	6732508
2399	2960639523	2960637947	Bacteria	7296468
2400	2960646987	2960645483	Bacteria	7211087
2401	2960656163	2960652885	Bacteria	7083688
2402	2960663043	2960660292	Bacteria	7041660
2403	2960674066	2960667422	Bacteria	6763020
2404	2960675205	2960674078	Bacteria	6609048
2405	2960680859	2960680706	Bacteria	6624464
2406	2960688155	2960687367	Bacteria	6535474
2407	2961078869	2961077736	Bacteria	7079850
2408	2961133360	2961127735	Bacteria	7196641
2409	2961139595	2961136820	Bacteria	6775228
2410	2961175557	2961170736	Bacteria	7072258
2411	2961186682	2961183825	Bacteria	6688536
2412	2963646831	2963644680	Bacteria	6530403
2413	2964608780	2964607997	Bacteria	7101408
2414	2964618128	2964615318	Bacteria	6809089
2415	2964623674	2964621998	Bacteria	6834995
2416	2964629972	2964628898	Bacteria	7083044
2417	2964637195	2964636051	Bacteria	7091832
2418	2964649895	2964643177	Bacteria	6820887
2419	2964652434	2964649959	Bacteria	6675118
2420	2964659876	2964656573	Bacteria	7100150
2421	2964669299	2964663802	Bacteria	7019362
2422	2964673506	2964670856	Bacteria	6851364
2423	2964679622	2964678106	Bacteria	6792020
2424	2964686288	2964685014	Bacteria	6839111
2425	2964697447	2964691889	Bacteria	6802758
2426	2964700145	2964698721	Bacteria	6765331
2427	2964707884	2964705432	Bacteria	7114648
2428	2964717659	2964712639	Bacteria	6695970
2429	2964721492	2964719344	Bacteria	7286602
2430	2965029676	2965025482	Bacteria	6532201
2431	2965034604	2965032056	Bacteria	6887443
2432	2965046108	2965040258	Bacteria	6855979
2433	2965052121	2965047637	Bacteria	6623551
2434	2965063079	2965062239	Bacteria	7412989
2435	2965091411	2965089291	Bacteria	6866420
2436	2965116100	2965110997	Bacteria	6693150
2437	2965122517	2965119406	Bacteria	6956431
2438	2965763293	2965761152	Bacteria	5806513
2439	2967667300	2967664464	Bacteria	6948836
2440	2967673932	2967671571	Bacteria	7021409
2441	2967680360	2967678726	Bacteria	7264382
2442	2967689278	2967686174	Bacteria	6678622
2443	2967699523	2967693043	Bacteria	6804451
2444	2967706022	2967699805	Bacteria	6854538
2445	2967713129	2967706974	Bacteria	7186053
2446	2967721115	2967714385	Bacteria	7000047
2447	2967725447	2967721400	Bacteria	7073753
2448	2967729445	2967728569	Bacteria	6641507
2449	2967741961	2967735183	Bacteria	6827012
2450	2967743680	2967742019	Bacteria	6794534
2451	2967755426	2967748971	Bacteria	6733771
2452	2967759700	2967755722	Bacteria	6814706
2453	2967764970	2967762386	Bacteria	6923502
2454	2967775648	2967769361	Bacteria	6587838
2455	2967779449	2967775926	Bacteria	6738189
2456	2967999387	2967996073	Bacteria	6787468
2457	2968007799	2968003550	Bacteria	6929263
2458	2968020930	2968016561	Bacteria	7022047
2459	2968023711	2968016561	Bacteria	7022047
2460	2968088368	2968083720	Bacteria	7351627
2461	2968094978	2968091066	Bacteria	6052692
2462	2968102016	2968097103	Bacteria	6107094
2463	2968119543	2968117919	Bacteria	6536078
2464	2968130537	2968128360	Bacteria	6270294
2465	2968142503	2968138860	Bacteria	6605449
2466	2970025612	2970019648	Bacteria	7072033
2467	2970028064	2970026789	Bacteria	6785236
2468	2970036254	2970033650	Bacteria	7118744
2469	2970042125	2970040964	Bacteria	6731123
2470	2970053667	2970047711	Bacteria	7088379
2471	2970060031	2970054988	Bacteria	6611507
2472	2970066819	2970061556	Bacteria	7099761
2473	2970073592	2970068827	Bacteria	7123112
2474	2970078517	2970076120	Bacteria	6697332
2475	2970087444	2970082768	Bacteria	6183754
2476	2970090611	2970088815	Bacteria	6933825
2477	2970098459	2970095765	Bacteria	6936963
2478	2970104017	2970102677	Bacteria	6812532
2479	2970111678	2970109326	Bacteria	6863976
2480	2970122627	2970116247	Bacteria	6501857
2481	2970126095	2970122695	Bacteria	6625855
2482	2970132051	2970129317	Bacteria	6806560
2483	2970137653	2970136068	Bacteria	7207982
2484	2970147260	2970143518	Bacteria	6446480
2485	2970152337	2970149975	Bacteria	6779706
2486	2970158657	2970156795	Bacteria	7168044
2487	2970164418	2970164137	Bacteria	6861252
2488	2970177742	2970170962	Bacteria	6876229
2489	2970181156	2970177841	Bacteria	6768001
2490	2970190828	2970184632	Bacteria	7054431
2491	2970194788	2970191845	Bacteria	7032787
2492	2970469752	2970469710	Bacteria	6969209
2493	2970474227	2970469710	Bacteria	6969209
2494	2970494953	2970489779	Bacteria	6517260
2495	2970508145	2970503327	Bacteria	7099517
2496	2970511526	2970510686	Bacteria	7006402
2497	2970527535	2970524798	Bacteria	6840927
2498	2970537955	2970532167	Bacteria	6553173
2499	2970545966	2970540015	Bacteria	6977556
2500	2970554246	2970547951	Bacteria	6931819
2501	2970597428	2970593180	Bacteria	7073582
2502	2970625925	2970619444	Bacteria	6986144
2503	2970628757	2970627176	Bacteria	6680862
2504	2977256900	2977254563	Bacteria	4828420
2505	2977523201	2977516862	Bacteria	6940108
2506	2977524740	2977523885	Bacteria	6960446
2507	2977536448	2977530762	Bacteria	6951399
2508	2977541196	2977537788	Bacteria	6929320
2509	2977550539	2977544691	Bacteria	6875412
2510	2977553772	2977551784	Bacteria	7125765
2511	2977560158	2977558990	Bacteria	6863948
2512	2977572723	2977565890	Bacteria	6901543
2513	2977578364	2977572785	Bacteria	6763888
2514	2977584769	2977579622	Bacteria	6772100
2515	2977826273	2977821940	Bacteria	6906439
2516	2977832624	2977828996	Bacteria	7007971
2517	2977848208	2977843712	Bacteria	6753583
2518	2977852725	2977851361	Bacteria	6694324
2519	2977874018	2977872689	Bacteria	7270173
2520	2977903371	2977898635	Bacteria	6675551
2521	2977927430	2977922695	Bacteria	6956781
2522	2977936466	2977935797	Bacteria	6252826
2523	2977944575	2977942078	Bacteria	7570577
2524	2977955654	2977950692	Bacteria	6893264
2525	2977958516	2977957713	Bacteria	6877875
2526	2977990921	2977986579	Bacteria	6581278
2527	2979085745	2979083700	Bacteria	5894929
2528	2979717462	2979710463	Bacteria	6785254
2529	2979749014	2979742915	Bacteria	7301278
2530	2979773422	2979772303	Bacteria	6618277
2531	2979784215	2979779861	Bacteria	6219781
2532	2979813329	2979808191	Bacteria	7179355
2533	2987638776	2987636660	Bacteria	8088555
2534	2987647217	2987645492	Bacteria	6117018
2535	2987658806	2987652177	Bacteria	6969023
2536	2987670827	2987666974	Bacteria	6509233
2537	2987674213	2987673487	Bacteria	6884027
2538	2989350054	2989349275	Bacteria	6349068
2539	2989776004	2989771324	Bacteria	5605128
2540	2989779463	2989776772	Bacteria	4843317
2541	2996339835	2996336353	Bacteria	5511628
2542	2996342296	2996341866	Bacteria	6643098
2543	2996352439	2996348954	Bacteria	7239054
2544	2996355179	2996348954	Bacteria	7239054
2545	2996390223	2996386984	Bacteria	6978667
2546	2996892816	2996887358	Bacteria	5795980
2547	2996894921	2996893221	Bacteria	5823108
2548	3000139799	3000135777	Bacteria	6891109
2549	3000376816	3000376612	Bacteria	4705565
2550	3001898091	3001892409	Bacteria	6328293
2551	3002144974	3002141150	Bacteria	5254435
2552	3003666571	3003665799	Bacteria	7279786
2553	3003934468	3003930520	Bacteria	5667563
2554	3004167864	3004167301	Bacteria	8330599
2555	3004203572	3004195979	Bacteria	6776956
2556	3004204981	3004203850	Bacteria	7307914
2557	3004215240	3004211236	Bacteria	7417683
2558	3004220718	3004218560	Bacteria	7421728
2559	3004233331	3004232784	Bacteria	6662140
2560	3004254644	3004248173	Bacteria	6563236
2561	3004275475	3004268573	Bacteria	7043476
2562	3004279121	3004275668	Bacteria	7114440
2563	3004281713	3004275668	Bacteria	7114440
2564	3004295619	3004289098	Bacteria	6135450
2565	3004335507	3004334049	Bacteria	8449246
2566	3005414340	3005409236	Bacteria	7188837
2567	3005418960	3005416602	Bacteria	7064308
2568	3005448673	3005445848	Bacteria	6906074
2569	3005454910	3005452660	Bacteria	5889319
2570	3006981453	3006978542	Bacteria	5328100
2571	637075472	637000159	Bacteria	7596297
2572	639649400	639633055	Bacteria	7751309
2573	641643423	641522639	Bacteria	7737025
2574	643602105	643348564	Bacteria	8839022
2575	643826552	643692032	Bacteria	6891900
2576	648741952	648276728	Bacteria	6968865
2577	649871987	649633066	Bacteria	6690028
2578	8001848654	8001845381	Bacteria	5804942
2579	8002063230	8002060224	Bacteria	4026565
2580	8002288433	8002285264	Bacteria	6717907
2581	8002289392	8002285264	Bacteria	6717907
2582	8003994389	8003992118	Bacteria	7266902
2583	8004002088	8003999396	Bacteria	7063185
2584	8004303276	8004300914	Bacteria	6132239
2585	8004314116	8004312739	Bacteria	7444653
2586	8004366793	8004361976	Bacteria	6858373
2587	8004378689	8004374579	Bacteria	6898112
2588	8004392370	8004387939	Bacteria	7049250
2589	8004451437	8004445564	Bacteria	6322258
2590	8004637384	8004633249	Bacteria	6723080
2591	8004644899	8004640170	Bacteria	6723001
2592	8004696407	8004695233	Bacteria	6731676
2593	8004705442	8004703790	Bacteria	8006957
2594	8004718679	8004714634	Bacteria	6776161
2595	8004731716	8004727605	Bacteria	6643904
2596	8005249929	8005246636	Bacteria	4933972
2597	8005259417	8005258706	Bacteria	6184835
2598	8005281435	8005275841	Bacteria	6929066
2599	8005284596	8005282627	Bacteria	6675747
2600	8005295736	8005289223	Bacteria	6634003
2601	8005303347	8005301065	Bacteria	6614431
2602	8005309620	8005307578	Bacteria	7395396
2603	8005318148	8005314921	Bacteria	7072929
2604	8005327343	8005321885	Bacteria	5795980
2605	8005381153	8005376324	Bacteria	6590079
2606	8005388894	8005382845	Bacteria	6732062
2607	8005395878	8005395548	Bacteria	6806915
2608	8005437503	8005430974	Bacteria	6689030
2609	8005464024	8005460587	Bacteria	7157962
2610	8005488975	8005484373	Bacteria	6297373
2611	8005501116	8005497431	Bacteria	6477605
2612	8005545917	8005542996	Bacteria	7077758
2613	8005561444	8005556819	Bacteria	6908598
2614	8005568222	8005563573	Bacteria	7153261
2615	8005573239	8005570704	Bacteria	6957481
2616	8005622484	8005619151	Bacteria	7030230
2617	8005629985	8005626139	Bacteria	6534237
2618	8005646056	8005645114	Bacteria	6950293
2619	8005658846	8005658619	Bacteria	4500593
2620	8005672534	8005668836	Bacteria	6953162
2621	8005682667	8005682033	Bacteria	6726518
2622	8005697632	8005695170	Bacteria	6912330
2623	8007376164	8007375930	Bacteria	4080554
2624	8018127981	8018127388	Bacteria	7351159
2625	8018151335	8018150411	Bacteria	5549903
2626	8018164346	8018163183	Bacteria	7277977
2627	8018176831	8018176218	Bacteria	6896178
2628	8022625751	8022621104	Bacteria	5241040
2629	8022797478	8022792930	Bacteria	5693794
2630	8022896908	8022893055	Bacteria	5300455
2631	8022915080	8022914991	Bacteria	5584517
2632	8023444209	8023438354	Bacteria	5779374
2633	8023449628	8023444577	Bacteria	5661597
2634	8023682940	8023680758	Bacteria	7729763
2635	8024482639	8024479707	Bacteria	6954785
2636	8024488261	8024486573	Bacteria	6540512
2637	8024504655	8024501048	Bacteria	6427847
2638	8045864455	8045864390	Bacteria	5043873
2639	8046771723	8046767195	Bacteria	7547379
2640	8054562183	8054558443	Bacteria	5204801
2641	8055432388	8055431914	Bacteria	4551896
2642	8055619734	8055617313	Bacteria	7548464
2643	8056377619	8056375014	Bacteria	7006639
2644	8056386267	8056382006	Bacteria	6408074
2645	8056875770	8056875544	Bacteria	4355797
2646	8057136209	8057132660	Bacteria	4061191
2647	8057531171	8057529695	Bacteria	6306553
2648	8057575476	8057575449	Bacteria	7367519
2649	8057584746	8057582654	Bacteria	5218944
2650	8057635075	8057632132	Bacteria	4726859
2651	8057879882	8057874678	Bacteria	7494653
2652	nmdc:mga00v17_824_c1
2653	JGI24741J21665_1004337
2654	JGI24740J21852_10000169
2655	JGI24740J21852_10018224
2656	JGI24740J21852_10027380
2657	JGI24739J22299_10004500
2658	JGI24737J22298_10015909
2659	JGI25155J39150_1000014
2660	JGI25156J39149_1000037
2661	JGI25156J39149_1000079
2662	JGI25162J39368_1000217
2663	JGI25162J39368_1000497
2664	JGI25154J39366_1000052
2665	JGI25158J39367_1000036
2666	JGI25157J39369_1000040
2667	JGI25157J39369_1000368
2668	JGI25152J39213_1000731
2669	JGI25152J39213_1003020
2670	JGI25150J39212_1000417
2671	JGI25159J45721_1000004
2672	JGI25159J45721_1000401
2673	JGI25159J45721_1002154
2674	JGI25159J45721_1010682
2675	JGI25151J46595_10000019
2676	JGI25151J46595_10000039
2677	JGI25151J46595_10000146
2678	JGI25151J46595_10000215
2679	JGI25151J46595_10000501
2680	JGI25151J46595_10001550
2681	JGI25151J46595_10004129
2682	JGI25151J46595_10010875
2683	JGI25151J46595_10014334
2684	JGI25165J46597_1000006
2685	JGI25165J46597_1000032
2686	JGI25165J46597_1000371
2687	JGI25165J46597_1000387
2688	JGI25165J46597_1000462
2689	JGI25153J46596_10000006
2690	JGI25153J46596_10000012
2691	JGI25153J46596_10000878
2692	JGI25153J46596_10001917
2693	JGI25153J46596_10004407
2694	rootL2_10057297
2695	JGI25160J50197_1000001
2696	JGI25160J50197_1000021
2697	JGI25160J50197_1001207
2698	JGI25161J50226_1000001
2699	JGI25161J50226_1000283
2700	JGI25161J50226_1000307
2701	Ga0006562J51391_1004549
2702	Ga0006562J51391_1009927
2703	Ga0055525_1000040
2704	Ga0055542_1000046
2705	Ga0055542_1000404
2706	Ga0055529_1000007
2707	Ga0055526_1000164
2708	Ga0055526_1000204
2709	Ga0055526_1001084
2710	Ga0055526_1001319
2711	Ga0055526_1002445
2712	Ga0055526_1019273
2713	Ga0055524_1000086
2714	Ga0055524_1000779
2715	Ga0055524_1001143
2716	Ga0055524_1002014
2717	Ga0055524_1003187
2718	Ga0055524_1008396
2719	Ga0055536_1004791
2720	Ga0055528_1000549
2721	Ga0055528_1001077
2722	Ga0055528_1001745
2723	Ga0055528_1001936
2724	Ga0055528_1007831
2725	Ga0055528_1018908
2726	Ga0055540_1000766
2727	Ga0055540_1004389
2728	Ga0055540_1006397
2729	Ga0055531_10009734
2730	Ga0055531_10009754
2731	Ga0055543_1000060
2732	Ga0055543_1000102
2733	Ga0055543_1000282
2734	Ga0055543_1000311
2735	Ga0065165_1000008
2736	Ga0065165_1000033
2737	Ga0065165_1006300
2738	Ga0065165_1009739
2739	Ga0070658_10007368
2740	Ga0070658_10007750
2741	Ga0070658_10028445
2742	Ga0070683_100060161
2743	Ga0070683_100100577
2744	Ga0070690_100002870
2745	Ga0070670_100005632
2746	Ga0070670_100006793
2747	Ga0070670_100015246
2748	Ga0070670_100153528
2749	Ga0070677_10033672
2750	Ga0068869_100002008
2751	Ga0068869_100002698
2752	Ga0068869_100002883
2753	Ga0068869_100100726
2754	Ga0070666_10002996
2755	Ga0070666_10004102
2756	Ga0070666_10088160
2757	Ga0070680_100000084
2758	Ga0070680_100003680
2759	Ga0070680_100025322
2760	Ga0070682_100009136
2761	Ga0068868_100000774
2762	Ga0068868_100003486
2763	Ga0070660_100011017
2764	Ga0070660_100015858
2765	Ga0070689_100004258
2766	Ga0070689_100117127
2767	Ga0070687_100000018
2768	Ga0070661_100001999
2769	Ga0070661_100004005
2770	Ga0070661_100048093
2771	Ga0070661_100098304
2772	Ga0070661_100105014
2773	Ga0070692_10032711
2774	Ga0070668_100000041
2775	Ga0070668_100001385
2776	Ga0070668_100020824
2777	Ga0070668_100055137
2778	Ga0070669_100000032
2779	Ga0070669_100017917
2780	Ga0070669_100025975
2781	Ga0070669_100035642
2782	Ga0070675_100000054
2783	Ga0070675_100001478
2784	Ga0070675_100031607
2785	Ga0070675_100086342
2786	Ga0070671_100004813
2787	Ga0070671_100008514
2788	Ga0070671_100053399
2789	Ga0070671_100118028
2790	Ga0070674_100003852
2791	Ga0070674_100010167
2792	Ga0070674_100059896
2793	Ga0070688_100010440
2794	Ga0070688_100022793
2795	Ga0070659_100031728
2796	Ga0070667_100000053
2797	Ga0070667_100000058
2798	Ga0070667_100000108
2799	Ga0070667_100005200
2800	Ga0070667_100045300
2801	Ga0070667_100129010
2802	Ga0070714_100009765
2803	Ga0070714_100045385
2804	Ga0070713_100022240
2805	Ga0070701_10001221
2806	Ga0070701_10001334
2807	Ga0070711_100055977
2808	Ga0070711_100057097
2809	Ga0070705_100000263
2810	Ga0070705_100027605
2811	Ga0070700_100000577
2812	Ga0070700_100008932
2813	Ga0070694_100000229
2814	Ga0070694_100002810
2815	Ga0070694_100006487
2816	Ga0070694_100023100
2817	Ga0070694_100036728
2818	Ga0070708_100035094
2819	Ga0070708_100068868
2820	Ga0070663_100000169
2821	Ga0070663_100002573
2822	Ga0070663_100010679
2823	Ga0070663_100031771
2824	Ga0070663_100094489
2825	Ga0070678_100002176
2826	Ga0070678_100123372
2827	Ga0070662_100013078
2828	Ga0070681_10000001
2829	Ga0070681_10002486
2830	Ga0070681_10005353
2831	Ga0070681_10007048
2832	Ga0070681_10030716
2833	Ga0068867_100000577
2834	Ga0068867_100002175
2835	Ga0068867_100005366
2836	Ga0068867_100074784
2837	Ga0068867_100084403
2838	Ga0070685_10027586
2839	Ga0070706_100019202
2840	Ga0070706_100025740
2841	Ga0070706_100095575
2842	Ga0070707_100028242
2843	Ga0070698_100006884
2844	Ga0070698_100047840
2845	Ga0070698_100109477
2846	Ga0070699_100006254
2847	Ga0070699_100020017
2848	Ga0070699_100080984
2849	Ga0070679_100000577
2850	Ga0070679_100006374
2851	Ga0070679_100007172
2852	Ga0070679_100047963
2853	Ga0070679_100109802
2854	Ga0070679_100150800
2855	Ga0070679_100162442
2856	Ga0070679_100237169
2857	Ga0070697_100055759
2858	Ga0068853_100001658
2859	Ga0068853_100008372
2860	Ga0068853_100021853
2861	Ga0070672_100000897
2862	Ga0070672_100003833
2863	Ga0070672_100011324
2864	Ga0070686_100000592
2865	Ga0070686_100001036
2866	Ga0070686_100008122
2867	Ga0070695_100001133
2868	Ga0070695_100001572
2869	Ga0070695_100006940
2870	Ga0070695_100036857
2871	Ga0070696_100000363
2872	Ga0070696_100004042
2873	Ga0070696_100004348
2874	Ga0070696_100004389
2875	Ga0070696_100009153
2876	Ga0070693_100000136
2877	Ga0070693_100005331
2878	Ga0070665_100000075
2879	Ga0070665_100000458
2880	Ga0070665_100000502
2881	Ga0070665_100006857
2882	Ga0070665_100011037
2883	Ga0070665_100020647
2884	Ga0070665_100033253
2885	Ga0070665_100061692
2886	Ga0070704_100001675
2887	Ga0070704_100002022
2888	Ga0070704_100002896
2889	Ga0070704_100002930
2890	Ga0070704_100030042
2891	Ga0070704_100062866
2892	Ga0070704_100081892
2893	Ga0068855_100000307
2894	Ga0068855_100001415
2895	Ga0068855_100018221
2896	Ga0068855_100023979
2897	Ga0068855_100172277
2898	Ga0068855_100188765
2899	Ga0070664_100004970
2900	Ga0070664_100019138
2901	Ga0070664_100126389
2902	Ga0070664_100133413
2903	Ga0068857_100002388
2904	Ga0068857_100059149
2905	Ga0068854_100017706
2906	Ga0068854_100028483
2907	Ga0068856_100002249
2908	Ga0068856_100053069
2909	Ga0068856_100069798
2910	Ga0070702_100000129
2911	Ga0068852_100152317
2912	Ga0068859_100002526
2913	Ga0068859_100004713
2914	Ga0068859_100004921
2915	Ga0068859_100014988
2916	Ga0068859_100016819
2917	Ga0068859_100069459
2918	Ga0068859_100215893
2919	Ga0068864_100005549
2920	Ga0068864_100012136
2921	Ga0068864_100018681
2922	Ga0068864_100020992
2923	Ga0068864_100055206
2924	Ga0068864_100078032
2925	Ga0068864_100167658
2926	Ga0068866_10003524
2927	Ga0068866_10014998
2928	Ga0068861_100001533
2929	Ga0068861_100001869
2930	Ga0068861_100023146
2931	Ga0068861_100096873
2932	Ga0068870_10007192
2933	Ga0068863_100000031
2934	Ga0068863_100001022
2935	Ga0068863_100002326
2936	Ga0068863_100002425
2937	Ga0068863_100005869
2938	Ga0068863_100011046
2939	Ga0068858_100001230
2940	Ga0068858_100004632
2941	Ga0068858_100012799
2942	Ga0068858_100030409
2943	Ga0068858_100048624
2944	Ga0068860_100000344
2945	Ga0068860_100002991
2946	Ga0068860_100003052
2947	Ga0068860_100007739
2948	Ga0068860_100013337
2949	Ga0068860_100187132
2950	Ga0068860_100200048
2951	Ga0068862_100000625
2952	Ga0068862_100001654
2953	Ga0081455_10000087
2954	Ga0081455_10001698
2955	Ga0081455_10035516
2956	Ga0081455_10122078
2957	Ga0081538_10000854
2958	Ga0081538_10011679
2959	Ga0081540_1042341
2960	Ga0081539_10000005
2961	Ga0081539_10002162
2962	Ga0081539_10005604
2963	Ga0081539_10012479
2964	Ga0070717_10004736
2965	Ga0075365_10000291
2966	Ga0075365_10000739
2967	Ga0075365_10018420
2968	Ga0075365_10073650
2969	Ga0075368_10012992
2970	Ga0075363_100000715
2971	Ga0075363_100003581
2972	Ga0075364_10002108
2973	Ga0075364_10005590
2974	Ga0075364_10018842
2975	Ga0075364_10022087
2976	Ga0070712_100006664
2977	Ga0070712_100047579
2978	Ga0075362_10000935
2979	Ga0075362_10041727
2980	Ga0075367_10003877
2981	Ga0075367_10011751
2982	Ga0075367_10027339
2983	Ga0075367_10074314
2984	Ga0075366_10001188
2985	Ga0075366_10003066
2986	Ga0075366_10014617
2987	Ga0097621_100000387
2988	Ga0097621_100003771
2989	Ga0097621_100007813
2990	Ga0097621_100094517
2991	Ga0075370_10005109
2992	Ga0075370_10044873
2993	Ga0068871_100000344
2994	Ga0068871_100003921
2995	Ga0068871_100008852
2996	Ga0068871_100013758
2997	Ga0068871_100023471
2998	Ga0068871_100027151
2999	Ga0068871_100033003
3000	Ga0068871_100066808
3001	Ga0075428_100000505
3002	Ga0075428_100002222
3003	Ga0075428_100014479
3004	Ga0075428_100042239
3005	Ga0075428_100058560
3006	Ga0075428_100113497
3007	Ga0075428_100212105
3008	Ga0075430_100008653
3009	Ga0075430_100039205
3010	Ga0075430_100169820
3011	Ga0075431_100002462
3012	Ga0075431_100004461
3013	Ga0075431_100005986
3014	Ga0075431_100009834
3015	Ga0075431_100023126
3016	Ga0075431_100084822
3017	Ga0075431_100122440
3018	Ga0075433_10001729
3019	Ga0075433_10002744
3020	Ga0075433_10004833
3021	Ga0075433_10043433
3022	Ga0075434_100000066
3023	Ga0075434_100001877
3024	Ga0075434_100004698
3025	Ga0075434_100009542
3026	Ga0075434_100014143
3027	Ga0075434_100024547
3028	Ga0075429_100000783
3029	Ga0075429_100000863
3030	Ga0075429_100010927
3031	Ga0075429_100012976
3032	Ga0075429_100014131
3033	Ga0075429_100027941
3034	Ga0075429_100078189
3035	Ga0075429_100091483
3036	Ga0075429_100122222
3037	Ga0068865_100000159
3038	Ga0075436_100000232
3039	Ga0075436_100014043
3040	Ga0075436_100038319
3041	Ga0097620_100002526
3042	Ga0097620_100004713
3043	Ga0097620_100004921
3044	Ga0097620_100014989
3045	Ga0097620_100016819
3046	Ga0097620_100069457
3047	Ga0097620_100215898
3048	Ga0079104_1000884
3049	Ga0079104_1001599
3050	Ga0075435_100000893
3051	Ga0075435_100001417
3052	Ga0075435_100012612
3053	Ga0099795_10008606
3054	Ga0105250_10026344
3055	Ga0105240_10000014
3056	Ga0105240_10000641
3057	Ga0105240_10012540
3058	Ga0105240_10017036
3059	Ga0105240_10089912
3060	Ga0105240_10159774
3061	Ga0111539_10000445
3062	Ga0111539_10000539
3063	Ga0111539_10001392
3064	Ga0111539_10009712
3065	Ga0111539_10017313
3066	Ga0111539_10030018
3067	Ga0111539_10030597
3068	Ga0111539_10057599
3069	Ga0111539_10076476
3070	Ga0111539_10152273
3071	Ga0105245_10019259
3072	Ga0105245_10150039
3073	Ga0105247_10000811
3074	Ga0105247_10014507
3075	Ga0105247_10067782
3076	Ga0114129_10000018
3077	Ga0114129_10000341
3078	Ga0114129_10000823
3079	Ga0114129_10026093
3080	Ga0114129_10068819
3081	Ga0114129_10094786
3082	Ga0114129_10337580
3083	Ga0105243_10000346
3084	Ga0105243_10000744
3085	Ga0105243_10042059
3086	Ga0105243_10046828
3087	Ga0105243_10047691
3088	Ga0105243_10102687
3089	Ga0105241_10002600
3090	Ga0105241_10003120
3091	Ga0105241_10047927
3092	Ga0105242_10000310
3093	Ga0105242_10003033
3094	Ga0105242_10025002
3095	Ga0105242_10120038
3096	Ga0105248_10000001
3097	Ga0105248_10000848
3098	Ga0105248_10003110
3099	Ga0105248_10003938
3100	Ga0105248_10030060
3101	Ga0105248_10038225
3102	Ga0105248_10054710
3103	Ga0105248_10196871
3104	Ga0105237_10005664
3105	Ga0105237_10019642
3106	Ga0105237_10049141
3107	Ga0105237_10050991
3108	Ga0105238_10026848
3109	Ga0105238_10027979
3110	Ga0105238_10045965
3111	Ga0105249_10000161
3112	Ga0105249_10011567
3113	Ga0105249_10040878
3114	Ga0105249_10068612
3115	Ga0123341_1000112
3116	Ga0123342_1014760
3117	Ga0123342_1019719
3118	Ga0105033_100688
3119	Ga0105030_100141
3120	Ga0099796_10003558
3121	Ga0105239_10008952
3122	Ga0105239_10010585
3123	Ga0105239_10012397
3124	Ga0105239_10063665
3125	Ga0105239_10072525
3126	Ga0105246_10000505
3127	Ga0105246_10009004
3128	Ga0105246_10074180
3129	Ga0157373_10060717
3130	Ga0157371_10000097
3131	Ga0157370_10000327
3132	Ga0157370_10035178
3133	Ga0157370_10037328
3134	Ga0157369_10024316
3135	Ga0157369_10072169
3136	Ga0171463_1007
3137	Ga0171462_1008
3138	Ga0157374_10000346
3139	Ga0157374_10000626
3140	Ga0157374_10001326
3141	Ga0157374_10005883
3142	Ga0157374_10014633
3143	Ga0157378_10002094
3144	Ga0157378_10004595
3145	Ga0163162_10009461
3146	Ga0163162_10012493
3147	Ga0163162_10042675
3148	Ga0163162_10069833
3149	Ga0163162_10077454
3150	Ga0157372_10134584
3151	Ga0157375_10000084
3152	Ga0157375_10035912
3153	Ga0157375_10043865
3154	Ga0157375_10046934
3155	Ga0157375_10054910
3156	Ga0157375_10097234
3157	Ga0157375_10099371
3158	Ga0163163_10021117
3159	Ga0157380_10008981
3160	Ga0157380_10024448
3161	Ga0157380_10027501
3162	Ga0157380_10073451
3163	Ga0157380_10135885
3164	Ga0157380_10187486
3165	Ga0157379_10000296
3166	Ga0157379_10004773
3167	Ga0157379_10020958
3168	Ga0157376_10016396
3169	Ga0157376_10017972
3170	Ga0157376_10034829
3171	Ga0157376_10050973
3172	Ga0157376_10113706
3173	Ga0182007_10001651
3174	Ga0183363_1049
3175	Ga0163161_10027453
3176	Ga0214544_1000110
3177	Ga0214542_1000268
3178	Ga0214543_1000022
3179	Ga0214543_1000219
3180	Ga0213872_10005745
3181	Ga0213876_10000889
3182	Ga0213876_10005226
3183	Ga0213875_10000101
3184	Ga0213875_10004529
3185	Ga0228711_1000026
3186	Ga0228710_1000005
3187	Ga0209435_100027
3188	Ga0209436_100061
3189	Ga0209436_100422
3190	Ga0209674_104464
3191	Ga0209147_100014
3192	Ga0209147_100413
3193	Ga0209563_100019
3194	Ga0209437_100051
3195	Ga0209437_100060
3196	Ga0209437_102802
3197	Ga0207425_1000046
3198	Ga0207425_1004595
3199	Ga0209646_1000086
3200	Ga0209646_1006961
3201	Ga0209026_1000082
3202	Ga0209026_1000089
3203	Ga0209677_100273
3204	Ga0209148_1000026
3205	Ga0209148_1000315
3206	Ga0209148_1000899
3207	Ga0209759_1000040
3208	Ga0209759_1000063
3209	Ga0209129_1000171
3210	Ga0209129_1000433
3211	Ga0209129_1000636
3212	Ga0209129_1000897
3213	Ga0209129_1008375
3214	Ga0209233_1000010
3215	Ga0209233_1000066
3216	Ga0209233_1000095
3217	Ga0209233_1000190
3218	Ga0209233_1000228
3219	Ga0209455_1000005
3220	Ga0209455_1000062
3221	Ga0209455_1000999
3222	Ga0209673_1000010
3223	Ga0209673_1000025
3224	Ga0209673_1000112
3225	Ga0209673_1001725
3226	Ga0209673_1002044
3227	Ga0209673_1002631
3228	Ga0209673_1004344
3229	Ga0209130_1000003
3230	Ga0209130_1000017
3231	Ga0209130_1000020
3232	Ga0209130_1000317
3233	Ga0209130_1007207
3234	Ga0209130_1015700
3235	Ga0209675_1000798
3236	Ga0209676_1004395
3237	Ga0209676_1011719
3238	Ga0209676_1014089
3239	Ga0209025_1000008
3240	Ga0209025_1000091
3241	Ga0209025_1000137
3242	Ga0209025_1000152
3243	Ga0209025_1000161
3244	Ga0209025_1000171
3245	Ga0209025_1000353
3246	Ga0209025_1000927
3247	Ga0209025_1002842
3248	Ga0209025_1003402
3249	Ga0209025_1004438
3250	Ga0209025_1005632
3251	Ga0209025_1013730
3252	Ga0209025_1015020
3253	Ga0209025_1015688
3254	Ga0209564_1000013
3255	Ga0209564_1000015
3256	Ga0209564_1000041
3257	Ga0209564_1000265
3258	Ga0209564_1000607
3259	Ga0209564_1001968
3260	Ga0209564_1006166
3261	Ga0209758_1000001
3262	Ga0209758_1000058
3263	Ga0209758_1000059
3264	Ga0209758_1000123
3265	Ga0209758_1000671
3266	Ga0209758_1003792
3267	Ga0209758_1005424
3268	Ga0209758_1008086
3269	Ga0209758_1014210
3270	Ga0209758_1016894
3271	Ga0209758_1019336
3272	Ga0209050_1003423
3273	Ga0209050_1005846
3274	Ga0209256_1000062
3275	Ga0209256_1000153
3276	Ga0209256_1000381
3277	Ga0209256_1001831
3278	Ga0209256_1002016
3279	Ga0209256_1002074
3280	Ga0209256_1002077
3281	Ga0207426_1000006
3282	Ga0207426_1000008
3283	Ga0207426_1000011
3284	Ga0207426_1000344
3285	Ga0207426_1001327
3286	Ga0207426_1001616
3287	Ga0209051_1000997
3288	Ga0209051_1001157
3289	Ga0209051_1002134
3290	Ga0209257_1002221
3291	Ga0209257_1002974
3292	Ga0207697_10016850
3293	Ga0207696_1001883
3294	Ga0207713_1002429
3295	Ga0207682_10008050
3296	Ga0207682_10017513
3297	Ga0207642_10006542
3298	Ga0207642_10041589
3299	Ga0207710_10008682
3300	Ga0207688_10017552
3301	Ga0207680_10002965
3302	Ga0207680_10051025
3303	Ga0207647_10044985
3304	Ga0207645_10000431
3305	Ga0207645_10021695
3306	Ga0207645_10072644
3307	Ga0207643_10007971
3308	Ga0207643_10018026
3309	Ga0207643_10046897
3310	Ga0207705_10006608
3311	Ga0207705_10031857
3312	Ga0207684_10027584
3313	Ga0207707_10000001
3314	Ga0207707_10008122
3315	Ga0207707_10014098
3316	Ga0207707_10022394
3317	Ga0207707_10032911
3318	Ga0207707_10066735
3319	Ga0207695_10000018
3320	Ga0207695_10000037
3321	Ga0207695_10040350
3322	Ga0207695_10082410
3323	Ga0207671_10000271
3324	Ga0207671_10002809
3325	Ga0207671_10018107
3326	Ga0207671_10048631
3327	Ga0207671_10086294
3328	Ga0207693_10000060
3329	Ga0207693_10005142
3330	Ga0207693_10028935
3331	Ga0207693_10031032
3332	Ga0207663_10033899
3333	Ga0207663_10051757
3334	Ga0207663_10071928
3335	Ga0207663_10079320
3336	Ga0207663_10081114
3337	Ga0207660_10004926
3338	Ga0207660_10006325
3339	Ga0207662_10000347
3340	Ga0207657_10008175
3341	Ga0207657_10025489
3342	Ga0207649_10003013
3343	Ga0207649_10017688
3344	Ga0207652_10000879
3345	Ga0207652_10015283
3346	Ga0207646_10030770
3347	Ga0207681_10000243
3348	Ga0207681_10013827
3349	Ga0207681_10016711
3350	Ga0207681_10027743
3351	Ga0207681_10063658
3352	Ga0207694_10000018
3353	Ga0207694_10003084
3354	Ga0207694_10135066
3355	Ga0207694_10141387
3356	Ga0207650_10001061
3357	Ga0207650_10009998
3358	Ga0207650_10140495
3359	Ga0207659_10000345
3360	Ga0207659_10004500
3361	Ga0207659_10045117
3362	Ga0207659_10064874
3363	Ga0207687_10004204
3364	Ga0207700_10097319
3365	Ga0207664_10002029
3366	Ga0207664_10059759
3367	Ga0207644_10005507
3368	Ga0207644_10022854
3369	Ga0207690_10002289
3370	Ga0207690_10002694
3371	Ga0207706_10034933
3372	Ga0207706_10082004
3373	Ga0207686_10000948
3374	Ga0207709_10000188
3375	Ga0207709_10000485
3376	Ga0207709_10024803
3377	Ga0207709_10044638
3378	Ga0207670_10001310
3379	Ga0207670_10016223
3380	Ga0207670_10031250
3381	Ga0207670_10055178
3382	Ga0207669_10000201
3383	Ga0207669_10034548
3384	Ga0207669_10098031
3385	Ga0207665_10046678
3386	Ga0207691_10001955
3387	Ga0207691_10016546
3388	Ga0207691_10022094
3389	Ga0207711_10000002
3390	Ga0207711_10001015
3391	Ga0207711_10003516
3392	Ga0207711_10004268
3393	Ga0207711_10006975
3394	Ga0207711_10008863
3395	Ga0207711_10052671
3396	Ga0207711_10175214
3397	Ga0207689_10000488
3398	Ga0207689_10005639
3399	Ga0207689_10006227
3400	Ga0207689_10015037
3401	Ga0207689_10016154
3402	Ga0207661_10041931
3403	Ga0207661_10159772
3404	Ga0207679_10030871
3405	Ga0207679_10071989
3406	Ga0207679_10096853
3407	Ga0207667_10000010
3408	Ga0207667_10000052
3409	Ga0207667_10001504
3410	Ga0207667_10015843
3411	Ga0207667_10023924
3412	Ga0207651_10033239
3413	Ga0207712_10000059
3414	Ga0207712_10000343
3415	Ga0207712_10077406
3416	Ga0207668_10000038
3417	Ga0207668_10015155
3418	Ga0207668_10043754
3419	Ga0207668_10096329
3420	Ga0207640_10012223
3421	Ga0207640_10022073
3422	Ga0207658_10000037
3423	Ga0207658_10000074
3424	Ga0207658_10000093
3425	Ga0207658_10010772
3426	Ga0207658_10036570
3427	Ga0207658_10039783
3428	Ga0207658_10051707
3429	Ga0207703_10012815
3430	Ga0207703_10022788
3431	Ga0207639_10002705
3432	Ga0207639_10004623
3433	Ga0207639_10008137
3434	Ga0207639_10010160
3435	Ga0207639_10043520
3436	Ga0207639_10055402
3437	Ga0207678_10000532
3438	Ga0207678_10000567
3439	Ga0207678_10006774
3440	Ga0207678_10026474
3441	Ga0207678_10048162
3442	Ga0207708_10001062
3443	Ga0207708_10015080
3444	Ga0207708_10029622
3445	Ga0207708_10033176
3446	Ga0207708_10080212
3447	Ga0207708_10112081
3448	Ga0207702_10001740
3449	Ga0207702_10031217
3450	Ga0207702_10085685
3451	Ga0207702_10139579
3452	Ga0207641_10000050
3453	Ga0207641_10001115
3454	Ga0207641_10001172
3455	Ga0207641_10003433
3456	Ga0207641_10004693
3457	Ga0207641_10061616
3458	Ga0207648_10000306
3459	Ga0207648_10000361
3460	Ga0207648_10020688
3461	Ga0207648_10037648
3462	Ga0207648_10046204
3463	Ga0207648_10087476
3464	Ga0207648_10148902
3465	Ga0207676_10001858
3466	Ga0207676_10016181
3467	Ga0207676_10031822
3468	Ga0207676_10043773
3469	Ga0207674_10009667
3470	Ga0207674_10015783
3471	Ga0207674_10049903
3472	Ga0207674_10053935
3473	Ga0207674_10072833
3474	Ga0207674_10132363
3475	Ga0207675_100000316
3476	Ga0207675_100015099
3477	Ga0207675_100020532
3478	Ga0207675_100020580
3479	Ga0207675_100027232
3480	Ga0207675_100050563
3481	Ga0207675_100060056
3482	Ga0207683_10000010
3483	Ga0207683_10000661
3484	Ga0207683_10001718
3485	Ga0207683_10014173
3486	Ga0207683_10017122
3487	Ga0207683_10062319
3488	Ga0207683_10083120
3489	Ga0207683_10209702
3490	Ga0207698_10003706
3491	Ga0207698_10006921
3492	Ga0207698_10023183
3493	Ga0209281_1000034
3494	Ga0209281_1000082
3495	Ga0209281_1002777
3496	Ga0209371_1003106
3497	Ga0209371_1004382
3498	Ga0209969_1000234
3499	Ga0209981_1002410
3500	Ga0209996_1003650
3501	Ga0210000_1000426
3502	Ga0210002_1000484
3503	Ga0209282_1000006
3504	Ga0209971_1002689
3505	Ga0209813_10019720
3506	Ga0209974_10004955
3507	Ga0209974_10004969
3508	Ga0207428_10000242
3509	Ga0207428_10000679
3510	Ga0207428_10001263
3511	Ga0207428_10001945
3512	Ga0207428_10003387
3513	Ga0207428_10007049
3514	Ga0207428_10010601
3515	Ga0207428_10081279
3516	Ga0207428_10092409
3517	Ga0207428_10144841
3518	Ga0268266_10000002
3519	Ga0268266_10000379
3520	Ga0268266_10000468
3521	Ga0268266_10000494
3522	Ga0268266_10006387
3523	Ga0268266_10021042
3524	Ga0268266_10023985
3525	Ga0268266_10029215
3526	Ga0268266_10034364
3527	Ga0268266_10070246
3528	Ga0268265_10000155
3529	Ga0268265_10000552
3530	Ga0268265_10002823
3531	Ga0268265_10028138
3532	Ga0268265_10154627
3533	Ga0268265_10183394
3534	Ga0268264_10000161
3535	Ga0268264_10000868
3536	Ga0268264_10002854
3537	Ga0268264_10007460
3538	Ga0268264_10008472
3539	Ga0268264_10023327
3540	Ga0268264_10035229
3541	Ga0265326_10003259
3542	Ga0265318_10000094
3543	Ga0265318_10011250
3544	Ga0307515_10000006
3545	Ga0307515_10000017
3546	Ga0307515_10000043
3547	Ga0307515_10003053
3548	Ga0307515_10007366
3549	Ga0307515_10008674
3550	Ga0307515_10082421
3551	Ga0265338_10000005
3552	Ga0265338_10005237
3553	Ga0265338_10030658
3554	Ga0265338_10086992
3555	Ga0265338_10117041
3556	Ga0265324_10000117
3557	Ga0237817_10047
3558	Ga0268256_1004121
3559	Ga0307511_10010541
3560	Ga0265760_10019663
3561	Ga0265330_10008930
3562	Ga0265330_10024421
3563	Ga0265332_10002858
3564	Ga0265328_10000002
3565	Ga0265328_10000012
3566	Ga0265325_10000005
3567	Ga0265325_10002918
3568	Ga0265329_10008569
3569	Ga0265340_10000206
3570	Ga0265340_10000632
3571	Ga0265340_10007431
3572	Ga0265340_10011312
3573	Ga0265340_10020450
3574	Ga0265340_10024535
3575	Ga0265339_10001486
3576	Ga0265331_10000017
3577	Ga0265331_10000504
3578	Ga0265331_10002961
3579	Ga0265331_10004560
3580	Ga0265331_10005758
3581	Ga0265331_10007756
3582	Ga0265331_10011174
3583	Ga0265331_10016150
3584	Ga0265327_10000135
3585	Ga0265327_10000710
3586	Ga0265327_10001697
3587	Ga0265327_10001968
3588	Ga0265327_10005958
3589	Ga0265327_10006002
3590	Ga0265327_10021678
3591	Ga0265327_10024267
3592	Ga0265316_10000429
3593	Ga0265316_10004082
3594	Ga0265316_10012424
3595	Ga0265316_10118861
3596	Ga0307513_10002173
3597	Ga0307513_10024793
3598	Ga0307513_10042125
3599	Ga0307513_10065706
3600	Ga0307513_10077740
3601	Ga0307513_10078317
3602	Ga0265313_10000298
3603	Ga0265313_10005338
3604	Ga0265313_10026530
3605	Ga0307508_10140695
3606	Ga0316575_10012884
3607	Ga0316575_10014162
3608	Ga0316575_10024005
3609	Ga0316579_10001035
3610	Ga0316579_10004706
3611	Ga0265314_10010830
3612	Ga0265314_10022315
3613	Ga0265342_10000175
3614	Ga0265342_10011310
3615	Ga0265342_10011737
3616	Ga0265342_10029020
3617	Ga0316576_10003716
3618	Ga0316576_10005030
3619	Ga0316576_10010386
3620	Ga0316576_10010808
3621	Ga0316576_10012907
3622	Ga0316576_10021976
3623	Ga0316576_10030835
3624	Ga0316576_10041481
3625	Ga0316578_10042539
3626	Ga0316578_10082182
3627	Ga0307516_10000023
3628	Ga0307516_10000208
3629	Ga0307405_10019857
3630	Ga0316577_10000403
3631	Ga0316577_10013901
3632	Ga0307413_10002413
3633	Ga0307413_10033939
3634	Ga0307413_10116387
3635	Ga0307410_10070281
3636	Ga0307407_10048154
3637	Ga0307412_10002165
3638	Ga0307412_10054891
3639	Ga0315914_1000003
3640	Ga0307416_100000215
3641	Ga0307416_100026340
3642	Ga0307414_10003258
3643	Ga0307414_10067419
3644	Ga0307411_10002323
3645	Ga0307415_100000500
3646	Ga0307415_100016717
3647	Ga0316583_10000596
3648	Ga0316583_10012153
3649	Ga0316583_10023859
3650	Ga0307510_10011314
3651	Ga0307510_10037705
3652	Ga0315913_1000001
3653	Ga0315915_1000008
3654	Ga0316586_1005828
3655	Ga0316596_1002153
3656	Ga0373934_0000199
3657	Ga0373934_0001186
3658	Ga0373923_0000319
3659	Ga0373936_0001528
3660	Ga0373953_0000509
3661	Ga0373953_0000725
3662	Ga0373954_0000616
3663	Ga0373954_0008132
3664	Ga0373954_0018136
3665	Ga0373956_0000034
3666	Ga0373956_0016163
3667	Ga0373957_0009190
3668	Ga0373960_0007483
3669	Ga0373961_0000355
3670	Ga0316574_0008223
3671	Ga0316574_0017979
3672	Ga0316574_0040997
3673	Ga0316574_0049115
3674	Ga0316574_0051781
3675	Ga0316574_0079292
3676	Ga0373924_0001035
3677	Ga0373931_0000320
3678	Ga0373931_0000339
3679	Ga0373931_0001364
3680	Ga0373935_0004965
3681	Ga0373935_0008750
3682	Ga0373935_0009826
3683	Ga0373927_0005507
3684	Ga0373927_0015638
3685	Ga0373933_0000691
3686	Ga0373947_0002220
3687	Ga0373937_0001711
3688	Ga0373937_0002608
3689	Ga0373937_0017770
3690	Ga0373937_0034699
3691	Ga0373937_0042783
3692	Ga0373937_0095210
3693	Ga0373937_0113613
3694	Ga0373937_0175105
3695	Ga0316582_0020164
3696	Ga0316582_0023087
3697	Ga0316582_0077107
3698	Ga0316582_0091253
3699	Ga0316584_0000036
3700	Ga0316584_0036923
3701	Ga0316584_0085340
3702	Ga0316584_0100252
3703	Ga0316584_0107913
3704	Ga0316584_0130096
3705	Ga0373925_0001295
3706	Ga0373925_0008505
3707	Ga0373925_0008996
3708	Ga0373925_0011200
3709	Ga0373925_0057882
3710	Ga0395900_0008923
3711	Ga0395900_0051320
3712	Ga0395900_0111836
3713	Ga0395900_0121646
3714	Ga0395900_0122132
3715	Ga0395898_0013285
3716	Ga0395898_0029567
3717	Ga0395898_0064048
3718	Ga0395898_0216607
3719	Ga0395905_0000247
3720	Ga0395905_0005902
3721	Ga0395905_0009806
3722	Ga0316581_0001331
3723	Ga0436364_0423999
3724	Ga0436364_0547155
3725	Ga0436364_0679392
3726	Ga0436364_0921801
3727	Ga0436364_1013963
3728	Ga0436364_1476473
3729	Ga0395901_0000093
3730	Ga0395901_0003578
3731	Ga0395901_0007515
3732	Ga0395901_0014480
3733	Ga0395901_0018103
3734	Ga0395901_0041185
3735	Ga0395901_0060743
3736	Ga0395901_0137250
3737	Ga0395901_0200827
3738	Ga0237819_00928
3739	Ga0400484_27574
3740	Ga0400490_03842
3741	Ga0400483_046359
3742	Ga0400483_106683
3743	Ga0400483_154876
3744	Ga0436365_1849791
3745	Ga0436360_0921776
3746	Ga0436360_1209995
3747	Ga0436361_0891949
3748	Ga0436361_0993322
3749	Ga0436361_1028602
3750	Ga0436363_0562538
3751	Ga0436363_0899192
3752	Ga0436363_1416780
3753	Ga0439436_0007632
3754	Ga0439436_0008737
3755	Ga0439465_0001911
3756	Ga0439465_0008539
3757	Ga0451855_0959896
3758	Ga0439441_000073
3759	Ga0439441_000169
3760	Ga0439449_0006907
3761	Ga0450896_000462
3762	Ga0439446_0000368
3763	Ga0439434_0000880
3764	Ga0439434_0003350
3765	Ga0439435_0000647
3766	Ga0439435_0001682
3767	Ga0439435_0002608
3768	Ga0451577_0000481
3769	Ga0451577_0003470
3770	Ga0451577_0042540
3771	Ga0451577_0064145
3772	Ga0451577_0076662
3773	Ga0453683_0006760
3774	Ga0466966_0001025
3775	Ga0466961_0003658
3776	Ga0466964_0001073
3777	Ga0453684_0001020
3778	Ga0453684_0001500
3779	Ga0453684_0008466
3780	Ga0453684_0054723
3781	Ga0466971_0000450
3782	Ga0466970_0001115
3783	Ga0466957_0004297
3784	Ga0466959_0001398
3785	Ga0466959_0016765
3786	Ga0451576_0000407
3787	Ga0451576_0000431
3788	Ga0451576_0000713
3789	Ga0451576_0003022
3790	Ga0451576_0033233
3791	Ga0466967_0000620
3792	Ga0466967_0004104
3793	Ga0495592_0000725
3794	Ga0495592_0001366
3795	Ga0495592_0112110
3796	Ga0495629_0007120
3797	Ga0495638_0000179
3798	Ga0495638_0001972
3799	Ga0495638_0012527
3800	Ga0495638_0020321
3801	Ga0495638_0038143
3802	Ga0495651_0000056
3803	Ga0495651_0004590
3804	Ga0495653_0002911
3805	Ga0495650_0000058
3806	Ga0495650_0009383
3807	Ga0495580_0009081
3808	Ga0495580_0032645
3809	Ga0495580_0076030
3810	Ga0495582_0007738
3811	Ga0495582_0019554
3812	Ga0495605_0001262
3813	Ga0495662_0045694
3814	Ga0495664_0035483
3815	Ga0495584_0044097
3816	Ga0495584_0079836
3817	Ga0495594_0006616
3818	Ga0495607_0053538
3819	Ga0495583_0001172
3820	Ga0495583_0006721
3821	Ga0495606_0000434
3822	Ga0495606_0004702
3823	Ga0495606_0047086
3824	Ga0495610_0001234
3825	Ga0495618_0032298
3826	Ga0495628_0012478
3827	Ga0495628_0076931
3828	Ga0495630_0005050
3829	Ga0495630_0053124
3830	Ga0495637_0025744
3831	Ga0495643_0001766
3832	Ga0495643_0002587
3833	Ga0495643_0011175
3834	Ga0495643_0016112
3835	Ga0495643_0020538
3836	Ga0495643_0027721
3837	Ga0495648_0000256
3838	Ga0495648_0024938
3839	Ga0495666_0001758
3840	Ga0495642_0042329
3841	Ga0495652_0016929
3842	Ga0495654_0001572
3843	Ga0495665_0004795
3844	Ga0495665_0037691
3845	Ga0495586_0003221
3846	Ga0495586_0004128
3847	Ga0495587_0036424
3848	Ga0495621_0033780
3849	Ga0495645_0001302
3850	Ga0495645_0015851
3851	Ga0495622_0005016
3852	Ga0495622_0016250
3853	Ga0495633_0001885
3854	Ga0495633_0045804
3855	Ga0495667_0024092
3856	Ga0495656_0015935
3857	Ga0495668_0000163
3858	Ga0495634_0005742
3859	Ga0495634_0070423
3860	Ga0495611_0006136
3861	Ga0495625_0000424
3862	Ga0495625_0002255
3863	Ga0495625_0005898
3864	Ga0495625_0012257
3865	Ga0495635_0053533
3866	Ga0495635_0083377
3867	Ga0495657_0003348
3868	Ga0495599_0002055
3869	Ga0495599_0013320
3870	Ga0495647_0000249
3871	Ga0495647_0002025
3872	Ga0495658_0001264
3873	Ga0495658_0007611
3874	Ga0495658_0088981
3875	Ga0495669_0000334
3876	Ga0495669_0001394
3877	Ga0495613_0054838
3878	Ga0495624_0012397
3879	Ga0495600_0027837
3880	Ga0495660_0075094
3881	Ga0495604_0006398
3882	Ga0495636_0000950
3883	Ga0495636_0003366
3884	Ga0495636_0004872
3885	Ga0495674_0004795
3886	Ga0495676_0063779
3887	Ga0495680_0013508
3888	Ga0495680_0083625
3889	Ga0495683_0001056
3890	Ga0495687_000557
3891	Ga0495687_000933
3892	Ga0495675_0003045
3893	Ga0495675_0095549
3894	Ga0495681_0009860
3895	Ga0495684_0008344
3896	Ga0495686_0000645
3897	Ga0495686_0001486
3898	Ga0495686_0002111
3899	Ga0495686_0005079
3900	Ga0495686_0040658
3901	Ga0495602_0019308
3902	Ga0496100_0010213
3903	Ga0496101_0000358
3904	Ga0496101_0047184
3905	Ga0496101_0098506
3906	Ga0496102_0001541
3907	Ga0496102_0004575
3908	Ga0496102_0007251
3909	Ga0496102_0007982
3910	Ga0496102_0024167
3911	Ga0496102_0056376
3912	Ga0496102_0076889
3913	Ga0496102_0087001
3914	Ga0496103_0000335
3915	Ga0496103_0003001
3916	Ga0496103_0004380
3917	Ga0496103_0025256
3918	Ga0496103_0030823
3919	Ga0496103_0038026
3920	Ga0496104_0002175
3921	Ga0496104_0003919
3922	Ga0496104_0029729
3923	Ga0496104_0048385
3924	Ga0496104_0077573
3925	Ga0496105_0000773
3926	Ga0496105_0001669
3927	Ga0496105_0004306
3928	Ga0496105_0020018
3929	Ga0496105_0032367
3930	Ga0496105_0087270
3931	Ga0496105_0176127
3932	Ga0496106_0000726
3933	Ga0496106_0002781
3934	Ga0496106_0004794
3935	Ga0496106_0008723
3936	Ga0496106_0020654
3937	Ga0496106_0046007
3938	Ga0496107_0000514
3939	Ga0496107_0000976
3940	Ga0496107_0006722
3941	Ga0496107_0010856
3942	Ga0496107_0017280
3943	Ga0496107_0029451
3944	Ga0496107_0058908
3945	Ga0496108_0001029
3946	Ga0496108_0021728
3947	Ga0496108_0023861
3948	Ga0496108_0032777
3949	Ga0496108_0119126
3950	Ga0496109_0007024
3951	Ga0496109_0012283
3952	Ga0496109_0015290
3953	Ga0496109_0031282
3954	Ga0496109_0034421
3955	Ga0496110_0000813
3956	Ga0496110_0005310
3957	Ga0496110_0005731
3958	Ga0496110_0010446
3959	Ga0496110_0026891
3960	Ga0496110_0165672
3961	Ga0496111_0003530
3962	Ga0496111_0007069
3963	Ga0496111_0008950
3964	Ga0496111_0035380
3965	Ga0496111_0131844
3966	Ga0496113_0005190
3967	Ga0496113_0009364
3968	Ga0496114_0000064
3969	Ga0496114_0010857
3970	Ga0496114_0015025
3971	Ga0496114_0018928
3972	Ga0496114_0036747
3973	Ga0496114_0040208
3974	Ga0496114_0147243
3975	Ga0496115_0000172
3976	Ga0496115_0002339
3977	Ga0496115_0002583
3978	Ga0496115_0165691
3979	Ga0496116_0003713
3980	Ga0496116_0004457
3981	Ga0496116_0024980
3982	Ga0496116_0054115
3983	Ga0496117_0000040
3984	Ga0496117_0000582
3985	Ga0496117_0006686
3986	Ga0496117_0007744
3987	Ga0496117_0013159
3988	Ga0496117_0025074
3989	Ga0496117_0033362
3990	Ga0496118_0001151
3991	Ga0496118_0002822
3992	Ga0496118_0011995
3993	Ga0496118_0017772
3994	Ga0496119_0001371
3995	Ga0496119_0002251
3996	Ga0496119_0002551
3997	Ga0496119_0005444
3998	Ga0496120_0001128
3999	Ga0496120_0001625
4000	Ga0496120_0028708
4001	Ga0496120_0042121
4002	Ga0496121_0000580
4003	Ga0496121_0001258
4004	Ga0496121_0006258
4005	Ga0496121_0010593
4006	Ga0496121_0013924
4007	Ga0496121_0020407
4008	Ga0496121_0068973
4009	Ga0496121_0081024
4010	Ga0496122_0000157
4011	Ga0496122_0000414
4012	Ga0496122_0001038
4013	Ga0496122_0010926
4014	Ga0496122_0011770
4015	Ga0496122_0016181
4016	Ga0496122_0028145
4017	Ga0496122_0035301
4018	Ga0496122_0037808
4019	Ga0496123_0000048
4020	Ga0496123_0000147
4021	Ga0496123_0000792
4022	Ga0496123_0000848
4023	Ga0496123_0006482
4024	Ga0496123_0023802
4025	Ga0496123_0025813
4026	Ga0496123_0051082
4027	Ga0496124_0000348
4028	Ga0496124_0000606
4029	Ga0496124_0002089
4030	Ga0496124_0006013
4031	Ga0496124_0015984
4032	Ga0496124_0072217
4033	Ga0496124_0076986
4034	Ga0496124_0102616
4035	Ga0496125_0000666
4036	Ga0496125_0000848
4037	Ga0496125_0005220
4038	Ga0496125_0013692
4039	Ga0496125_0015247
4040	Ga0496125_0038410
4041	Ga0496126_0001153
4042	Ga0496126_0003273
4043	Ga0496126_0025465
4044	Ga0496126_0042884
4045	Ga0496126_0043327
4046	Ga0495678_002029
4047	Ga0495682_0001243
4048	Ga0501031_0000274
4049	Ga0501031_0003711
4050	Ga0501032_0000024
4051	Ga0501032_0000597
4052	Ga0501032_0000951
4053	Ga0501032_0002365
4054	Ga0501032_0006007
4055	Ga0501033_0000189
4056	Ga0501033_0001349
4057	Ga0501033_0001767
4058	Ga0501033_0002145
4059	Ga0501033_0009793
4060	Ga0501033_0045267
4061	Ga0501034_0000205
4062	Ga0501034_0000317
4063	Ga0501034_0002140
4064	Ga0501034_0004533
4065	Ga0501034_0012803
4066	Ga0501034_0015236
4067	Ga0501034_0031725
4068	Ga0501034_0086275
4069	Ga0501034_0096743
4070	Ga0501034_0124058
4071	Ga0501036_0000396
4072	Ga0501036_0000460
4073	Ga0501036_0007368
4074	Ga0501036_0047412
4075	Ga0501036_0057491
4076	Ga0501036_0095538
4077	Ga0501037_0000186
4078	Ga0501037_0000363
4079	Ga0501037_0000934
4080	Ga0501037_0004086
4081	Ga0501037_0009077
4082	Ga0501037_0026795
4083	Ga0501037_0030774
4084	Ga0501037_0085458
4085	Ga0501037_0087696
4086	Ga0501038_0000022
4087	Ga0501038_0000064
4088	Ga0501038_0000730
4089	Ga0501038_0005305
4090	Ga0501038_0017575
4091	Ga0501038_0028576
4092	Ga0501039_0000017
4093	Ga0501039_0000030
4094	Ga0501039_0002397
4095	Ga0501039_0009336
4096	Ga0501039_0050145
4097	Ga0501039_0119994
4098	Ga0501039_0121714
4099	Ga0501040_0000675
4100	Ga0501040_0020171
4101	Ga0501041_0005649
4102	Ga0501041_0011840
4103	Ga0501041_0017837
4104	Ga0501041_0028358
4105	Ga0501042_0010804
4106	Ga0501042_0015348
4107	Ga0501043_0000050
4108	Ga0501043_0000265
4109	Ga0501043_0001343
4110	Ga0501043_0003031
4111	Ga0501043_0013937
4112	Ga0501043_0030262
4113	Ga0501043_0093835
4114	Ga0501043_0099390
4115	Ga0501043_0110644
4116	Ga0501046_0000035
4117	Ga0501046_0000858
4118	Ga0501046_0001830
4119	Ga0501046_0008673
4120	Ga0501046_0030007
4121	Ga0501046_0039757
4122	Ga0501046_0058649
4123	Ga0501046_0069028
4124	Ga0501046_0069710
4125	Ga0501046_0075415
4126	Ga0501047_0000172
4127	Ga0501047_0005550
4128	Ga0501047_0007715
4129	Ga0501047_0027350
4130	Ga0501047_0070703
4131	Ga0501047_0079466
4132	Ga0501047_0093199
4133	Ga0501048_0003101
4134	Ga0501048_0013328
4135	Ga0501048_0023676
4136	Ga0501048_0036075
4137	Ga0501048_0081445
4138	Ga0501048_0103622
4139	Ga0501048_0108457
4140	Ga0501067_0000662
4141	Ga0501067_0001038
4142	Ga0501067_0005495
4143	Ga0501067_0007855
4144	Ga0501067_0018230
4145	Ga0501068_0005329
4146	Ga0501068_0016120
4147	Ga0501068_0040402
4148	Ga0501069_0000066
4149	Ga0501069_0000088
4150	Ga0501070_0000819
4151	Ga0501070_0001479
4152	Ga0501070_0001512
4153	Ga0501070_0001911
4154	Ga0501070_0004201
4155	Ga0501070_0009613
4156	Ga0501070_0027007
4157	Ga0501070_0047096
4158	Ga0501070_0049372
4159	Ga0501070_0081743
4160	Ga0501071_0034536
4161	Ga0501071_0057183
4162	Ga0501072_0002550
4163	Ga0501072_0009328
4164	Ga0501072_0021330
4165	Ga0501072_0087514
4166	Ga0501072_0095434
4167	Ga0501072_0140557
4168	Ga0501073_0002593
4169	Ga0501073_0008662
4170	Ga0501073_0014214
4171	Ga0501073_0014602
4172	Ga0501073_0026081
4173	Ga0501073_0082516
4174	Ga0501074_0040144
4175	Ga0501075_0000134
4176	Ga0501075_0001338
4177	Ga0501075_0007984
4178	Ga0501075_0014713
4179	Ga0501075_0021413
4180	Ga0501075_0023949
4181	Ga0501075_0046356
4182	Ga0501075_0064473
4183	Ga0501076_0000029
4184	Ga0501076_0000211
4185	Ga0501076_0000506
4186	Ga0501076_0007335
4187	Ga0501076_0013096
4188	Ga0501076_0024845
4189	Ga0501076_0051085
4190	Ga0501077_0003810
4191	Ga0501077_0005857
4192	Ga0501077_0011373
4193	Ga0501077_0040392
4194	Ga0501077_0059393
4195	Ga0501077_0093066
4196	Ga0501079_0003857
4197	Ga0501079_0005090
4198	Ga0501079_0005381
4199	Ga0501079_0006445
4200	Ga0501079_0007352
4201	Ga0501079_0015495
4202	Ga0501079_0027634
4203	Ga0501079_0042822
4204	Ga0501079_0043317
4205	Ga0501080_0000032
4206	Ga0501080_0000354
4207	Ga0501080_0000871
4208	Ga0501080_0001591
4209	Ga0501080_0012119
4210	Ga0501080_0016479
4211	Ga0501080_0019684
4212	Ga0501080_0056531
4213	Ga0501080_0061216
4214	Ga0501080_0077850
4215	Ga0501081_0000636
4216	Ga0501081_0000844
4217	Ga0501081_0003374
4218	Ga0501081_0025584
4219	Ga0501081_0045965
4220	Ga0501081_0046392
4221	Ga0501081_0052936
4222	Ga0501081_0074314
4223	Ga0501083_0003938
4224	Ga0501083_0017805
4225	Ga0501083_0031768
4226	Ga0501083_0051159
4227	Ga0501083_0083139
4228	Ga0501269_001981
4229	Ga0501035_0000011
4230	Ga0501035_0000021
4231	Ga0501035_0000065
4232	Ga0501035_0001047
4233	Ga0501035_0002360
4234	Ga0501035_0003024
4235	Ga0501035_0007291
4236	Ga0501035_0008032
4237	Ga0501035_0015812
4238	Ga0501035_0062759
4239	Ga0501035_0085870
4240	Ga0501035_0137473
4241	Ga0501044_0000043
4242	Ga0501044_0000333
4243	Ga0501044_0014501
4244	Ga0501044_0016934
4245	Ga0501044_0023814
4246	Ga0501044_0060916
4247	Ga0501044_0072669
4248	Ga0501044_0134928
4249	Ga0501045_0000489
4250	Ga0501045_0007117
4251	Ga0501045_0011306
4252	Ga0501045_0020921
4253	Ga0501045_0029153
4254	Ga0501045_0031535
4255	Ga0501045_0038253
4256	Ga0501045_0143226
4257	nmdc:mga03683_1133_c1
4258	nmdc:mga03683_20197_c1
4259	nmdc:mga03683_23464_c1
4260	nmdc:mga03n38_132_c1
4261	nmdc:mga03n38_4444_c1
4262	nmdc:mga00v17_835_c1
4263	nmdc:mga0yw44_27189_c1
4264	nmdc:mga0yw44_29361_c1
4265	nmdc:mga0yw44_460_c1
4266	nmdc:mga0yw44_58547_c1
4267	nmdc:mga0k408_7739_c1
4268	nmdc:mga0k408_956_c1
4269	nmdc:mga06z11_2631_c1
4270	nmdc:mga06z11_269_c1
4271	nmdc:mga04h51_15631_c1
4272	nmdc:mga07m45_36315_c1
4273	nmdc:mga07m45_68161_c1
4274	nmdc:mga05p37_2617_c1
4275	nmdc:mga05p37_29279_c1
4276	nmdc:mga05p37_5315_c1
4277	nmdc:mga05p37_87972_c1
4278	nmdc:mga09592_10_c1
4279	nmdc:mga09592_1504_c1
4280	nmdc:mga09592_174377_c1
4281	nmdc:mga09592_301_c1
4282	nmdc:mga09592_34514_c1
4283	nmdc:mga09592_36761_c1
4284	nmdc:mga09592_42965_c1
4285	nmdc:mga09592_58628_c1
4286	nmdc:mga09592_87471_c1
4287	nmdc:mga09592_8936_c1
4288	nmdc:mga0qj67_20862_c1
4289	nmdc:mga0qj67_36027_c1
4290	nmdc:mga06r32_14284_c1
4291	nmdc:mga06r32_1660_c1
4292	nmdc:mga06r32_220165_c1
4293	nmdc:mga06r32_2813_c1
4294	nmdc:mga06r32_54662_c1
4295	nmdc:mga06r32_59081_c1
4296	nmdc:mga06r32_78398_c1
4297	nmdc:mga08y16_124661_c1
4298	nmdc:mga08y16_195813_c1
4299	nmdc:mga08y16_29351_c1
4300	nmdc:mga08y16_3090_c1
4301	nmdc:mga08y16_3339_c1
4302	nmdc:mga08y16_35970_c1
4303	nmdc:mga08y16_35_c1
4304	nmdc:mga08y16_5753_c1
4305	nmdc:mga08y16_89602_c1
4306	nmdc:mga08y16_91454_c1
4307	nmdc:mga0n895_12221_c1
4308	nmdc:mga0n895_147478_c1
4309	nmdc:mga0n895_23546_c1
4310	nmdc:mga0n895_24540_c1
4311	nmdc:mga0n895_30618_c1
4312	nmdc:mga0n895_31954_c1
4313	nmdc:mga0n895_46445_c1
4314	nmdc:mga0n895_48482_c1
4315	nmdc:mga0rr50_150_c1
4316	nmdc:mga0rr50_35859_c1
4317	nmdc:mga0rr50_5774_c1
4318	nmdc:mga08x19_391_c1
4319	nmdc:mga08x19_8847_c1
4320	nmdc:mga0a205_12364_c1
4321	nmdc:mga0a205_1525_c1
4322	nmdc:mga0a205_153_c2
4323	nmdc:mga0a205_34305_c1
4324	nmdc:mga0a205_34964_c1
4325	nmdc:mga0a205_41897_c1
4326	nmdc:mga0a205_461_c1
4327	Ga0495601_0024366
4328	Ga0500610_0000382
4329	Ga0495655_0001812
4330	Ga0495595_0000771
4331	Ga0495595_0007385
4332	Ga0495595_0010287
4333	Ga0495619_0018513
4334	Ga0495619_0021231
4335	Ga0500643_000001
4336	Ga0500643_017144
4337	Ga0500641_0000230
4338	Ga0500641_0001163
4339	Ga0500641_0023346
4340	Ga0500555_005169
4341	Ga0500556_0000031
4342	Ga0500556_0000155
4343	Ga0500556_0000172
4344	Ga0500562_000093
4345	Ga0500562_002492
4346	Ga0500569_000487
4347	Ga0500594_0009361
4348	Ga0500595_000878
4349	Ga0500595_001503
4350	Ga0500595_002281
4351	Ga0500595_018059
4352	Ga0500608_028952
4353	Ga0500618_000849
4354	Ga0500618_001483
4355	Ga0500618_008664
4356	Ga0500642_0000003
4357	Ga0500642_0000647
4358	Ga0500658_0000206
4359	Ga0500658_0026427
4360	Ga0500568_0000054
4361	Ga0500568_0000905
4362	Ga0500568_0011234
4363	Ga0500604_0000004
4364	Ga0500616_0000309
4365	Ga0500616_0000393
4366	Ga0500616_0000576
4367	Ga0500616_0000893
4368	Ga0500616_0002050
4369	Ga0500616_0011950
4370	Ga0500616_0059115
4371	Ga0500620_000488
4372	Ga0500622_0000011
4373	Ga0500622_0000399
4374	Ga0500622_0012800
4375	Ga0500636_0003395
4376	Ga0500645_000170
4377	Ga0500645_002762
4378	Ga0500645_009971
4379	Ga0500609_000260
4380	Ga0500596_000115
4381	Ga0501084_0000016
4382	Ga0501084_0001167
4383	Ga0501084_0001884
4384	Ga0501084_0002245
4385	Ga0501084_0028853
4386	Ga0501084_0033867
4387	Ga0501084_0038230
4388	Ga0501084_0044216
4389	Ga0501084_0060030
4390	Ga0501082_0000215
4391	Ga0501082_0000816
4392	Ga0501082_0002657
4393	Ga0501082_0006245
4394	Ga0501082_0006353
4395	Ga0501082_0006638
4396	Ga0501082_0012805
4397	Ga0501082_0015842
4398	Ga0501082_0035239
4399	Ga0501082_0075753
4400	Ga0501082_0086463
4401	Ga0501082_0089121
4402	Ga0501082_0105664
4403	Ga0501082_0118442
4404	Ga0466962_0001888
4405	Ga0530510_0000284
4406	Ga0530510_0006743
4407	Ga0530510_0009217
4408	Ga0530510_0038433
4409	Ga0530510_0047506
4410	Ga0530510_0083392
4411	2503200258
4412	2509108151
4413	2509115104
4414	2509139494
4415	2509372206
4416	2509376674
4417	2509391808
4418	2509395073
4419	2509447337
4420	2510134175
4421	2510305325
4422	2510314195
4423	2510841352
4424	2510895612
4425	2511133222
4426	2511172233
4427	2511182473
4428	2511199250
4429	2511390160
4430	2511502461
4431	2512533839
4432	2512932374
4433	2512960378
4434	2512970412
4435	2513567744
4436	2513577174
4437	2513585006
4438	2513593664
4439	2513597672
4440	2513601476
4441	2513608500
4442	2513618155
4443	2513633158
4444	2513707846
4445	2513865923
4446	2513884470
4447	2513904488
4448	2513908546
4449	2513925185
4450	2513983673
4451	2513997686
4452	2514003078
4453	2514018077
4454	2514034516
4455	2514420341
4456	2514587679
4457	2515113341
4458	2515609256
4459	2515636767
4460	2515646367
4461	2515655117
4462	2515739709
4463	2516206191
4464	2516893837
4465	2517036945
4466	2517077305
4467	2517096061
4468	2517407679
4469	2517570550
4470	2520377035
4471	2523466225
4472	2524448341
4473	2524458853
4474	2530646578
4475	2535517102
4476	2545678198
4477	2551675956
4478	2551688290
4479	2551690914
4480	2551703457
4481	2551715295
4482	2551723715
4483	2551726891
4484	2551736717
4485	2551742964
4486	2553396316
4487	2558863964
4488	2585167440
4489	2585201997
4490	2585223079
4491	2585228515
4492	2585258270
4493	2585265664
4494	2585271347
4495	2585279289
4496	2585323107
4497	2585331220
4498	2585388869
4499	2585395431
4500	2585400954
4501	2585524733
4502	2585531227
4503	2585538416
4504	2585545662
4505	2585552850
4506	2585559090
4507	2585822143
4508	2585836369
4509	2585843470
4510	2585898472
4511	2585903964
4512	2585996674
4513	2586001199
4514	2587980918
4515	2595087830
4516	2597812260
4517	2599417092
4518	2599721602
4519	2599936263
4520	2600194847
4521	2600374113
4522	2616293141
4523	2616311030
4524	2616554467
4525	2617384830
4526	2643757739
4527	2643776451
4528	2643794898
4529	2643804199
4530	2643811313
4531	2643887383
4532	2643949838
4533	2644007043
4534	2644050237
4535	2644065027
4536	2644105262
4537	2644145662
4538	2644156451
4539	2644158351
4540	2644191822
4541	2644204701
4542	2644208791
4543	2644242560
4544	2644298902
4545	2644309675
4546	2644331157
4547	2644338530
4548	2644376564
4549	2644416700
4550	2644449740
4551	2644483157
4552	2644494313
4553	2644497804
4554	2644543404
4555	2644616199
4556	2644652321
4557	2644657131
4558	2644675822
4559	2644689872
4560	2644704557
4561	2644709251
4562	2644718354
4563	2644725233
4564	2644728490
4565	2644736889
4566	2657681728
4567	2671111213
4568	2671692433
4569	2685149982
4570	2688597437
4571	2692315286
4572	2694628533
4573	2694637554
4574	2698323217
4575	2705994023
4576	2715499134
4577	2719182015
4578	2719386627
4579	2719666376
4580	2719732731
4581	2720492796
4582	2720614263
4583	2720621032
4584	2720632355
4585	2720776083
4586	2721148106
4587	2721159558
4588	2721164942
4589	2721400331
4590	2721505347
4591	2722841112
4592	2723027682
4593	2723561310
4594	2723567933
4595	2723574654
4596	2724039144
4597	2724045487
4598	2724090690
4599	2724105198
4600	2724111026
4601	2725951378
4602	2730108618
4603	2730165250
4604	2730299190
4605	2738744967
4606	2738800319
4607	2738814184
4608	2738944067
4609	2739033057
4610	2739159267
4611	2739211927
4612	2739347053
4613	2739354197
4614	2753462357
4615	2756671722
4616	2765466515
4617	2766066100
4618	2770196968
4619	2776270424
4620	2776281657
4621	2776914183
4622	2777763091
4623	2777839662
4624	2778175650
4625	2792581440
4626	2792620581
4627	2792625940
4628	2792638879
4629	2792751927
4630	2793294215
4631	2793315870
4632	2793319396
4633	2793328482
4634	2793335441
4635	2793339492
4636	2793347031
4637	2793351623
4638	2793361919
4639	2793367675
4640	2802716768
4641	2802725580
4642	2802730329
4643	2802737700
4644	2802742911
4645	2802750335
4646	2804752914
4647	2805926853
4648	2805932767
4649	2806045196
4650	2806050009
4651	2806056847
4652	2806064228
4653	2806071496
4654	2819241091
4655	2819569511
4656	2819578869
4657	2819609357
4658	2819641331
4659	2819685154
4660	2819707491
4661	2819719773
4662	2821125731
4663	2821448288
4664	2828308095
4665	2829747706
4666	2837654657
4667	2837679176
4668	2837679679
4669	2838021675
4670	2838023634
4671	2838033383
4672	2838038702
4673	2838045188
4674	2838053331
4675	2838065450
4676	2838069930
4677	2838079789
4678	2838661376
4679	2838670581
4680	2838683227
4681	2838686821
4682	2838697829
4683	2838702952
4684	2838710944
4685	2838730221
4686	2838737817
4687	2838742764
4688	2839997506
4689	2840768980
4690	2840882236
4691	2841738267
4692	2841841814
4693	2841854649
4694	2841867177
4695	2841914023
4696	2841921493
4697	2842079118
4698	2842113037
4699	2842118372
4700	2842141592
4701	2842147790
4702	2842158331
4703	2842168566
4704	2842195837
4705	2842199148
4706	2842209595
4707	2842218171
4708	2842230054
4709	2842240284
4710	2842243943
4711	2842252856
4712	2842257972
4713	2842269505
4714	2842271641
4715	2842283049
4716	2842285385
4717	2842292780
4718	2842298203
4719	2842305272
4720	2842314000
4721	2842319760
4722	2842348464
4723	2842360197
4724	2842368313
4725	2842373858
4726	2842379177
4727	2842384882
4728	2842400123
4729	2842402745
4730	2842409884
4731	2842416532
4732	2842423544
4733	2842430493
4734	2842436695
4735	2842443463
4736	2842449332
4737	2842466747
4738	2842471435
4739	2842479951
4740	2842483850
4741	2842492289
4742	2842497850
4743	2842505264
4744	2842514273
4745	2842522070
4746	2842697363
4747	2842699669
4748	2842779971
4749	2842872151
4750	2842882187
4751	2844008343
4752	2844012814
4753	2844106279
4754	2844164021
4755	2844458118
4756	2844534953
4757	2847419656
4758	2847674906
4759	2847675161
4760	2847691337
4761	2848298458
4762	2848994658
4763	2851246635
4764	2852390480
4765	2854682575
4766	2854901342
4767	2854919031
4768	2855826563
4769	2855841952
4770	2855877173
4771	2856322093
4772	2856323340
4773	2856329353
4774	2856336461
4775	2856347253
4776	2856352927
4777	2856368217
4778	2857351592
4779	2857370380
4780	2857517195
4781	2857532292
4782	2857587304
4783	2858803756
4784	2861696029
4785	2869164043
4786	2869174653
4787	2869239105
4788	2869246801
4789	2869249991
4790	2869263881
4791	2869269968
4792	2869277372
4793	2869282819
4794	2869290164
4795	2871432448
4796	2871437942
4797	2871453152
4798	2871470964
4799	2871474689
4800	2871493069
4801	2874108757
4802	2874111547
4803	2874117450
4804	2874126956
4805	2874139611
4806	2874142479
4807	2874152414
4808	2874159815
4809	2874162781
4810	2874168864
4811	2876367594
4812	2876372404
4813	2876383158
4814	2876392809
4815	2876405137
4816	2876413522
4817	2876418331
4818	2876422273
4819	2878736240
4820	2878744337
4821	2878750062
4822	2878757114
4823	2878778781
4824	2878787130
4825	2878795535
4826	2881150160
4827	2881161269
4828	2881163458
4829	2881166994
4830	2881848199
4831	2881859432
4832	2881861754
4833	2882640772
4834	2882918473
4835	2883294923
4836	2883356591
4837	2885305769
4838	2885308513
4839	2885312703
4840	2885320478
4841	2885327732
4842	2885343162
4843	2885353732
4844	2888338502
4845	2888346003
4846	2888355313
4847	2889010292
4848	2889018042
4849	2889796104
4850	2889919912
4851	2891090533
4852	2891373580
4853	2894655723
4854	2894820510
4855	2896254908
4856	2896391097
4857	2898796482
4858	2899276442
4859	2899806241
4860	2902331756
4861	2902408892
4862	2903450372
4863	2903500841
4864	2903518644
4865	2903521889
4866	2903528266
4867	2904527153
4868	2904582088
4869	2906312420
4870	2906325129
4871	2906330476
4872	2906357965
4873	2906365230
4874	2906377752
4875	2906397918
4876	2906406942
4877	2906408744
4878	2906419673
4879	2913296109
4880	2913313577
4881	2915982880
4882	2915989479
4883	2915994984
4884	2916003094
4885	2916009201
4886	2916020069
4887	2916023726
4888	2916034409
4889	2916041958
4890	2916044332
4891	2916050381
4892	2916058066
4893	2916065464
4894	2916078324
4895	2917558427
4896	2917704321
4897	2919054445
4898	2919059621
4899	2919106234
4900	2919123134
4901	2919144255
4902	2919172966
4903	2919410219
4904	2919451190
4905	2919519452
4906	2919679547
4907	2919720577
4908	2920112846
4909	2920761312
4910	2920825485
4911	2921205100
4912	2921215153
4913	2921238957
4914	2921244842
4915	2921253728
4916	2921261935
4917	2921266927
4918	2921283939
4919	2921290776
4920	2921297905
4921	2922135436
4922	2922152398
4923	2922163460
4924	2922175442
4925	2922180859
4926	2922190605
4927	2923561093
4928	2924150878
4929	2924156781
4930	2924160855
4931	2924167310
4932	2924175447
4933	2924182545
4934	2924189237
4935	2924196970
4936	2924207066
4937	2924212340
4938	2924219151
4939	2924224651
4940	2924235427
4941	2924728166
4942	2924737687
4943	2924749452
4944	2924762212
4945	2924765559
4946	2924766248
4947	2924782367
4948	2924786417
4949	2928095662
4950	2928524082
4951	2929008087
4952	2929235248
4953	2929297602
4954	2932426956
4955	2933023532
4956	2933419590
4957	2933571079
4958	2933588906
4959	2933600736
4960	2935896786
4961	2935901727
4962	2936367107
4963	2936371815
4964	2936379650
4965	2936387819
4966	2937002719
4967	2937005734
4968	2937012211
4969	2937019206
4970	2937027291
4971	2937033386
4972	2937038436
4973	2937044523
4974	2937054495
4975	2937057914
4976	2937065262
4977	2937074623
4978	2937080644
4979	2937091296
4980	2937095054
4981	2937100413
4982	2937107816
4983	2937117726
4984	2937122911
4985	2937130729
4986	2937819436
4987	2937825189
4988	2937842478
4989	2937845272
4990	2937851019
4991	2937862024
4992	2937874224
4993	2937880908
4994	2937897632
4995	2937976372
4996	2937977102
4997	2938016583
4998	2938919429
4999	2939616806
5000	2939677464
5001	2941504733
5002	2946788987
5003	2947428790
5004	2954013028
5005	2957380743
5006	2957388532
5007	2957394713
5008	2957397208
5009	2957405798
5010	2957415005
5011	2957418997
5012	2957429606
5013	2957430696
5014	2957439504
5015	2957445562
5016	2957455783
5017	2957458731
5018	2957465072
5019	2957473144
5020	2957484649
5021	2957485931
5022	2957493008
5023	2957500054
5024	2957511362
5025	2958038687
5026	2958039602
5027	2958052769
5028	2958065136
5029	2958071804
5030	2958088536
5031	2958105897
5032	2958110491
5033	2958116509
5034	2958127087
5035	2958134552
5036	2958140280
5037	2958158654
5038	2958174783
5039	2958181033
5040	2960322838
5041	2960377848
5042	2960586065
5043	2960594067
5044	2960603828
5045	2960606318
5046	2960613149
5047	2960619830
5048	2960625684
5049	2960635580
5050	2960639523
5051	2960646987
5052	2960656163
5053	2960663043
5054	2960674066
5055	2960675205
5056	2960680859
5057	2960688155
5058	2961078869
5059	2961133360
5060	2961139595
5061	2961175557
5062	2961186682
5063	2963646831
5064	2964608780
5065	2964618128
5066	2964623674
5067	2964629972
5068	2964637195
5069	2964649895
5070	2964652434
5071	2964659876
5072	2964669299
5073	2964673506
5074	2964679622
5075	2964686288
5076	2964697447
5077	2964700145
5078	2964707884
5079	2964717659
5080	2964721492
5081	2965029676
5082	2965034604
5083	2965046108
5084	2965052121
5085	2965063079
5086	2965091411
5087	2965116100
5088	2965122517
5089	2965763293
5090	2967667300
5091	2967673932
5092	2967680360
5093	2967689278
5094	2967699523
5095	2967706022
5096	2967713129
5097	2967721115
5098	2967725447
5099	2967729445
5100	2967741961
5101	2967743680
5102	2967755426
5103	2967759700
5104	2967764970
5105	2967775648
5106	2967779449
5107	2967999387
5108	2968007799
5109	2968020930
5110	2968023711
5111	2968088368
5112	2968094978
5113	2968102016
5114	2968119543
5115	2968130537
5116	2968142503
5117	2970025612
5118	2970028064
5119	2970036254
5120	2970042125
5121	2970053667
5122	2970060031
5123	2970066819
5124	2970073592
5125	2970078517
5126	2970087444
5127	2970090611
5128	2970098459
5129	2970104017
5130	2970111678
5131	2970122627
5132	2970126095
5133	2970132051
5134	2970137653
5135	2970147260
5136	2970152337
5137	2970158657
5138	2970164418
5139	2970177742
5140	2970181156
5141	2970190828
5142	2970194788
5143	2970469752
5144	2970474227
5145	2970494953
5146	2970508145
5147	2970511526
5148	2970527535
5149	2970537955
5150	2970545966
5151	2970554246
5152	2970597428
5153	2970625925
5154	2970628757
5155	2977256900
5156	2977523201
5157	2977524740
5158	2977536448
5159	2977541196
5160	2977550539
5161	2977553772
5162	2977560158
5163	2977572723
5164	2977578364
5165	2977584769
5166	2977826273
5167	2977832624
5168	2977848208
5169	2977852725
5170	2977874018
5171	2977903371
5172	2977927430
5173	2977936466
5174	2977944575
5175	2977955654
5176	2977958516
5177	2977990921
5178	2979085745
5179	2979717462
5180	2979749014
5181	2979773422
5182	2979784215
5183	2979813329
5184	2987638776
5185	2987647217
5186	2987658806
5187	2987670827
5188	2987674213
5189	2989350054
5190	2989776004
5191	2989779463
5192	2996339835
5193	2996342296
5194	2996352439
5195	2996355179
5196	2996390223
5197	2996892816
5198	2996894921
5199	3000139799
5200	3000376816
5201	3001898091
5202	3002144974
5203	3003666571
5204	3003934468
5205	3004167864
5206	3004203572
5207	3004204981
5208	3004215240
5209	3004220718
5210	3004233331
5211	3004254644
5212	3004275475
5213	3004279121
5214	3004281713
5215	3004295619
5216	3004335507
5217	3005414340
5218	3005418960
5219	3005448673
5220	3005454910
5221	3006981453
5222	637075472
5223	639649400
5224	641643423
5225	643602105
5226	643826552
5227	648741952
5228	649871987
5229	8001848654
5230	8002063230
5231	8002288433
5232	8002289392
5233	8003994389
5234	8004002088
5235	8004303276
5236	8004314116
5237	8004366793
5238	8004378689
5239	8004392370
5240	8004451437
5241	8004637384
5242	8004644899
5243	8004696407
5244	8004705442
5245	8004718679
5246	8004731716
5247	8005249929
5248	8005259417
5249	8005281435
5250	8005284596
5251	8005295736
5252	8005303347
5253	8005309620
5254	8005318148
5255	8005327343
5256	8005381153
5257	8005388894
5258	8005395878
5259	8005437503
5260	8005464024
5261	8005488975
5262	8005501116
5263	8005545917
5264	8005561444
5265	8005568222
5266	8005573239
5267	8005622484
5268	8005629985
5269	8005646056
5270	8005658846
5271	8005672534
5272	8005682667
5273	8005697632
5274	8007376164
5275	8018127981
5276	8018151335
5277	8018164346
5278	8018176831
5279	8022625751
5280	8022797478
5281	8022896908
5282	8022915080
5283	8023444209
5284	8023449628
5285	8023682940
5286	8024482639
5287	8024488261
5288	8024504655
5289	8045864455
5290	8046771723
5291	8054562183
5292	8055432388
5293	8055619734
5294	8056377619
5295	8056386267
5296	8056875770
5297	8057136209
5298	8057531171
5299	8057575476
5300	8057584746
5301	8057635075
5302	8057879882

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01268

FTHFS

Formate--tetrahydrofolate ligase

113

667

0.99 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
7c11-assembly1.cif.gz_C	formate--tetrahydrofolate ligase from methylobacterium extorquens cm4 strain	0.9649	2	554
5a5g-assembly1.cif.gz_A	crystal structure of fthfs2 from t.acetoxydans re1	0.9634	2	554
5a5g-assembly1.cif.gz_A	crystal structure of fthfs2 from t.acetoxydans re1	0.9617	2	554
7c11-assembly1.cif.gz_C	formate--tetrahydrofolate ligase from methylobacterium extorquens cm4 strain	0.9615	2	554
4ioj-assembly1.cif.gz_A	n10-formyltetrahydrofolate synthetase from moorella thermoacetica with sulfate	0.9598	2	554

ID	Description	Score	Start	End	Superfamily
af_A4I5T5_508_597_3.10.410.10	Alpha Beta;Roll;Formyltetrahydrofolate synthetase; domain 3;Formyltetrahydrofolate synthetase, domain 3	0.9695	442	530	3.10.410.10
af_O96553_855_943_3.10.410.10	Alpha Beta;Roll;Formyltetrahydrofolate synthetase; domain 3;Formyltetrahydrofolate synthetase, domain 3	0.9642	442	530	3.10.410.10
5a5gA03	Alpha Beta;Roll;Formyltetrahydrofolate synthetase; domain 3;Formyltetrahydrofolate synthetase, domain 3	0.9543	443	530	3.10.410.10
af_O96553_855_943_3.10.410.10	Alpha Beta;Roll;Formyltetrahydrofolate synthetase; domain 3;Formyltetrahydrofolate synthetase, domain 3	0.9538	442	530	3.10.410.10
af_P37655_1_231_3.40.50.300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases	0.953	66	90	3.40.50.300

ID	Description	Score	Start	End	GO Terms
AF-A0A440DNV0-F1-model_v4	deleted	1.003	441	525
AF-A0A3S3F8Z1-F1-model_v4	formate--tetrahydrofolate ligase (EC 6.3.4.3)	0.9977	322	521	GO:0004329 GO:0005524 GO:0035999
AF-A0A529LPK5-F1-model_v4	Formate--tetrahydrofolate ligase	0.9962	356	504	GO:0004329 GO:0005524 GO:0006730
AF-A0A434QUD7-F1-model_v4	Formate--tetrahydrofolate ligase	0.9961	333	508	GO:0004329 GO:0005524 GO:0006730
AF-F4N9M7-F1-model_v4	formate--tetrahydrofolate ligase (EC 6.3.4.3)	0.9948	277	481	GO:0004329 GO:0005524 GO:0035999

F496979

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF01268

FTHFS

Formate--tetrahydrofolate ligase

113

667

0.99

Structural Annotation

Top 5 Hits

Map