F497007
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 2700 | 764 | 5400 | 120 |
Family's Representative Sequence
| Representative Sequence | 3300048905|Ga0496102_0835597|Ga0496102_0835597_75_485 |
| Length | 136 |
| Sequence | MPAIRRFGNLGKHSEYCNMARVKRGVTTRAKHKNILEQAKGYRGRRKNTIRVARQAVEKAGQYAYRDRKVKKRTFRALWIQRINAAVREAGLTYSQFIHGAKLAGIELDRKAMADLAMNEGAVFASVISQAKAALG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 2 | 2010549000 | Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes | Metagenome | Endosphere |
| 3 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 4 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 5 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 6 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 7 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 8 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 9 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 10 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 11 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 12 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 13 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 14 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 15 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 16 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 17 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 18 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 19 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 20 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 21 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 22 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 23 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 24 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 25 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 26 | 3300003371 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM | Metagenome | Rhizosphere |
| 27 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 28 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 29 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 30 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 31 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 32 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 33 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 34 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 35 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 36 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 37 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 38 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 39 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 40 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 41 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 42 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 43 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 44 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 45 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 49 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 51 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 55 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 57 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 68 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 85 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 86 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 87 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 88 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 89 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 90 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 91 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 92 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 94 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 95 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 99 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 100 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 102 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 103 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 104 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 106 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 107 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 108 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 109 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 110 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 111 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 112 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 113 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 114 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 115 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 116 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 117 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 118 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 119 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 120 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 121 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 122 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 123 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 124 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 125 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 126 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 127 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 128 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 129 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 130 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 131 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 132 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 133 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 135 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 136 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 137 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 138 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 139 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 140 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 141 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 142 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 143 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 144 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 146 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 147 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 148 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 154 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 156 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 157 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 158 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 159 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 160 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 161 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 162 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 163 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 164 | 3300012490 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 | Metagenome | Rhizosphere |
| 165 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 166 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 167 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 168 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 172 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 173 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 174 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 175 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 176 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 177 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 178 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 179 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 180 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 181 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 182 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 183 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 184 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 185 | 3300019182 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE1 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 186 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 187 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 188 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 189 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 190 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 191 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 192 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 193 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 194 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 195 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 196 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 197 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 198 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 199 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 200 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 201 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 202 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 203 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 204 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 205 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 206 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 207 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 209 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 210 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 211 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 212 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 213 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 214 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 215 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 216 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 217 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 287 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 295 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 297 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 299 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 303 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 304 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 305 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 306 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 307 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 308 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 309 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 310 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 311 | 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 312 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 313 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 314 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 315 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 316 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 317 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 318 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 319 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 320 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 321 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 322 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 323 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 324 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 325 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 326 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 327 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 328 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 329 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 330 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 331 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 332 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 333 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 334 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 335 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 336 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 337 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 338 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 339 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 340 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 341 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 342 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 343 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 344 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 345 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 346 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 347 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 348 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 349 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 350 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 351 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 352 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 353 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 354 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 355 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 356 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 357 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 358 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 359 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 360 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 361 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 362 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 363 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 364 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 365 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 366 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 367 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 368 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 369 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 370 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 371 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 372 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 373 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 374 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 375 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 376 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 377 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 378 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 379 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 380 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 381 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 382 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 383 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 384 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 385 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 386 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 387 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 388 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 389 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 390 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 391 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 392 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 393 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 394 | 3300041444 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT | Metatranscriptome | Rhizoplane |
| 395 | 3300041445 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaT | Metatranscriptome | Rhizoplane |
| 396 | 3300041446 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT | Metatranscriptome | Rhizoplane |
| 397 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 398 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 399 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 400 | 3300041455 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaT | Metatranscriptome | Rhizoplane |
| 401 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 402 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 403 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 404 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 405 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 406 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 407 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 408 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 409 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 410 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 411 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 412 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 413 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 414 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 415 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 416 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 417 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 418 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 419 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 420 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 421 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 422 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 423 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 424 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 425 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 426 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 427 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 428 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 429 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 430 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 431 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 432 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 433 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 434 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 435 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 436 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 437 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 438 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 439 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 440 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 441 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 442 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 443 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 444 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 445 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 446 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 447 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 448 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 449 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 489 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 491 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 492 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 493 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 494 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 495 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 498 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 499 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 500 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 501 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 502 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 503 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 504 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 505 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 506 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 507 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 508 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 509 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 510 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 511 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 512 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 513 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 514 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 515 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 516 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 517 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 518 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 519 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 520 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 521 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 522 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 523 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 524 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 525 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 526 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 527 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 528 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 529 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 530 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 531 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 532 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 533 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 534 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 535 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 536 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 537 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 538 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 539 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 540 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 541 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 542 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 543 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 544 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 545 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 546 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 547 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 548 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 549 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 550 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 551 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 552 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 553 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 554 | 3300049550 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 555 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 556 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 557 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 558 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 559 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 560 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 561 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 562 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 563 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 564 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 565 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 566 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 567 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 568 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 569 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 570 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 571 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 572 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 573 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 574 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 575 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 576 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 577 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 578 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 579 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 580 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 581 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 582 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 583 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 584 | 3300049678 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought | Metagenome | Rhizosphere |
| 585 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 586 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 587 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 588 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 589 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 590 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 591 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 592 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 593 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 594 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 595 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 596 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 597 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 598 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 599 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 600 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 601 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 602 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 603 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 604 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 605 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 606 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 607 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 608 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 609 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 610 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 611 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 612 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 613 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 614 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 615 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 616 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 617 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 618 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 619 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 620 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 621 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 622 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 623 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 624 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 625 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 626 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 627 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 628 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 629 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 630 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 631 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 632 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 633 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 634 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 635 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 636 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 637 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 638 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 639 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 640 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 641 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 642 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 643 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 644 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 645 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 646 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 647 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 648 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 649 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 650 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 651 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 652 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 653 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 654 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 655 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 656 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 657 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 658 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 659 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 660 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 661 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 662 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 663 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 664 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 665 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 666 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 667 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 668 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 669 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 670 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 671 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 672 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 673 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 674 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 675 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 676 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 677 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 678 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 679 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 680 | 3300059607 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 681 | 3300059608 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 682 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 683 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 684 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 685 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 686 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 687 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 688 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 689 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 690 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 691 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 692 | 3300059648 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 693 | 3300059650 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 694 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 695 | 3300059653 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 696 | 3300059654 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 697 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 698 | 3300059658 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 699 | 3300059660 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 700 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 701 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 702 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 703 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 704 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 705 | 2510917021 | Novosphingobium sp. AP12 | Isolate | Rhizosphere |
| 706 | 2512564014 | Sphingobium sp. AP49 | Isolate | Rhizosphere |
| 707 | 2523231067 | Pleomorphomonas oryzae DSM 16300 | Isolate | Unclassified |
| 708 | 2534681786 | Brucella suis 92/29 | Isolate | Unclassified |
| 709 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 710 | 2643221560 | Sphingopyxis sp. Root1497 | Isolate | Unclassified |
| 711 | 2643221563 | Sphingopyxis sp. Root154 | Isolate | Unclassified |
| 712 | 2643221588 | Altererythrobacter sp. Root672 | Isolate | Unclassified |
| 713 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 714 | 2643221608 | Sphingopyxis sp. Root214 | Isolate | Unclassified |
| 715 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 716 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 717 | 2738541275 | Novosphingobium sp. GV027 | Isolate | Unclassified |
| 718 | 2738541301 | Novosphingobium sp. GV079 | Isolate | Unclassified |
| 719 | 2738541304 | Novosphingobium sp. GV061 | Isolate | Unclassified |
| 720 | 2738543022 | Novosphingobium sp. GV055 | Isolate | Unclassified |
| 721 | 2738543031 | Pleomorphomonas sp. CF100 | Isolate | Unclassified |
| 722 | 2738543033 | Novosphingobium sp. GV064 | Isolate | Unclassified |
| 723 | 2739367664 | Novosphingobium sp. GV002 | Isolate | Unclassified |
| 724 | 2739367865 | Novosphingobium sp. GV013 | Isolate | Unclassified |
| 725 | 2751185800 | Brucella pituitosa AA2 | Isolate | Unclassified |
| 726 | 2758568016 | [Ochrobactrum] quorumnocens A44 | Isolate | Rhizosphere |
| 727 | 2775507255 | Sphingobium indicum B90A | Isolate | Rhizosphere |
| 728 | 2808606401 | Sphingobium sp. AEW010 | Isolate | Rhizosphere |
| 729 | 2808606404 | Sphingobium sp. AEW013 | Isolate | Rhizosphere |
| 730 | 2808606405 | Sphingobium sp. AEW001 | Isolate | Rhizosphere |
| 731 | 2818991438 | Novosphingobium barchaimii 1192 | Isolate | Unclassified |
| 732 | 2830075706 | Sphingomonas jinjuensis DSM 21457 | Isolate | Rhizosphere |
| 733 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 734 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 735 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 736 | 2842694124 | Methylopila sp. R-72369 | Isolate | Unclassified |
| 737 | 2848297114 | Croceibacterium ferulae EGI 63111 | Isolate | Unclassified |
| 738 | 2852653556 | Sphingopyxis sp. JAI108 | Isolate | Rhizosphere |
| 739 | 2852680915 | Sphingopyxis sp. JAI128 | Isolate | Rhizosphere |
| 740 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 741 | 2880518877 | Sphingobium sp. JAI105 | Isolate | Rhizosphere |
| 742 | 2882806704 | Pelagerythrobacter rhizovicinus AY-3R | Isolate | Rhizosphere |
| 743 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 744 | 2896184354 | Aurantiacibacter suaedae GH3-15 | Isolate | Rhizosphere |
| 745 | 2896253425 | Aurantiacibacter rhizosphaerae GH3-10 | Isolate | Rhizosphere |
| 746 | 2917554339 | Chthonobacter rhizosphaerae yh7-1 | Isolate | Rhizosphere |
| 747 | 2919138771 | Novosphingobium sp. 1748 | Isolate | Rhizosphere |
| 748 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 749 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
| 750 | 2928027323 | Sphingomonas sp. 1185 | Isolate | Unclassified |
| 751 | 2928100450 | Novosphingobium sp. 1529 | Isolate | Rhizosphere |
| 752 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 753 | 2928959182 | Novosphingobium capsulatum 1057 | Isolate | Unclassified |
| 754 | 2929199973 | Roseomonas sp. R-73070 Hybrid assembly | Isolate | Unclassified |
| 755 | 2946787523 | Sphingomonas faeni W4I17 | Isolate | Rhizosphere |
| 756 | 2984555340 | Sphingomonas sp. SORGH_AS789 | Isolate | Aerial Root |
| 757 | 2984564862 | Sphingomonas sp. SORGH_AS870 | Isolate | Aerial Root |
| 758 | 2990265787 | Sphingomonas sp. SORGH_AS802 | Isolate | Aerial Root |
| 759 | 2993356040 | Sphingomonas sp. SORGH_AS742 | Isolate | Aerial Root |
| 760 | 2993693658 | Sphingomonas sp. SORGH_AS438 | Isolate | Aerial Root |
| 761 | 8045864390 | Aurantimonas endophytica KCTC 52296 | Isolate | Unclassified |
| 762 | 8054302542 | Novosphingobium kaempferiae Sx8-5 | Isolate | Rhizosphere |
| 763 | 8055909800 | Plastoroseomonas hellenica LMG 31523 | Isolate | Unclassified |
| 764 | 8057101203 | Sphingomonas lycopersici MMSM20 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93 |
| Metatranscriptomes | 4.78 |
| Isolates | 2.22 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.19 |
| Bulb | 0 |
| Endosphere | 11.04 |
| Nodule | 0.37 |
| Rhizoplane | 4.96 |
| Rhizosphere | 77.33 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.22 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0496102_0835597 | 3300048905 | Bacteria | 843 |
| 2 | RicEn_FSXC48362_g1 | 2010549000 | Bacteria | 781 |
| 3 | SwRhRL2b_contig_1023452 | 2162886007 | Bacteria | 3999 |
| 4 | SwRhRL2b_contig_1878598 | 2162886007 | Bacteria | 25068 |
| 5 | SwRhRL2b_contig_2614068 | 2162886007 | Bacteria | 5430 |
| 6 | SwRhRL2b_contig_2761788 | 2162886007 | Bacteria | 890 |
| 7 | ARcpr5oldR_c006461 | 3300000041 | Bacteria | 1001 |
| 8 | ARcpr5yngRDRAFT_c006253 | 3300000043 | Bacteria | 1078 |
| 9 | ARCol0yngRDRAFT_1004808 | 3300000652 | Bacteria | 977 |
| 10 | JGI24736J21556_1000036 | 3300001904 | Bacteria | 22294 |
| 11 | JGI24736J21556_1000841 | 3300001904 | Bacteria | 5661 |
| 12 | JGI24736J21556_1012983 | 3300001904 | Bacteria | 1346 |
| 13 | JGI24741J21665_1000048 | 3300001915 | Bacteria | 29528 |
| 14 | JGI24741J21665_1003961 | 3300001915 | Bacteria | 3389 |
| 15 | JGI24752J21851_1010676 | 3300001976 | Bacteria | 1198 |
| 16 | JGI24740J21852_10029072 | 3300001979 | Bacteria | 1819 |
| 17 | JGI24740J21852_10042206 | 3300001979 | Bacteria | 1368 |
| 18 | JGI24740J21852_10054054 | 3300001979 | Bacteria | 1136 |
| 19 | JGI24740J21852_10113049 | 3300001979 | Bacteria | 684 |
| 20 | JGI24740J21852_10169404 | 3300001979 | Bacteria | 542 |
| 21 | JGI24739J22299_10005112 | 3300001989 | Bacteria | 4995 |
| 22 | JGI24739J22299_10017766 | 3300001989 | Bacteria | 2563 |
| 23 | JGI24739J22299_10042319 | 3300001989 | Bacteria | 1511 |
| 24 | JGI24739J22299_10092022 | 3300001989 | Bacteria | 922 |
| 25 | JGI24739J22299_10218492 | 3300001989 | Bacteria | 558 |
| 26 | JGI24737J22298_10010158 | 3300001990 | Bacteria | 3115 |
| 27 | JGI24737J22298_10013520 | 3300001990 | Bacteria | 2656 |
| 28 | JGI24737J22298_10016354 | 3300001990 | Bacteria | 2395 |
| 29 | JGI24737J22298_10028620 | 3300001990 | Bacteria | 1750 |
| 30 | JGI24737J22298_10257098 | 3300001990 | Bacteria | 516 |
| 31 | JGI24743J22301_10031593 | 3300001991 | Bacteria | 1043 |
| 32 | JGI24750J21931_1005276 | 3300002070 | Bacteria | 1587 |
| 33 | JGI24748J21848_1020079 | 3300002074 | Bacteria | 804 |
| 34 | JGI24738J21930_10007334 | 3300002075 | Bacteria | 2549 |
| 35 | JGI24738J21930_10025901 | 3300002075 | Bacteria | 1205 |
| 36 | JGI24738J21930_10051879 | 3300002075 | Bacteria | 837 |
| 37 | JGI24744J21845_10038391 | 3300002077 | Bacteria | 901 |
| 38 | JGI24035J26624_1007994 | 3300002126 | Bacteria | 1033 |
| 39 | JGI24034J26672_10005335 | 3300002239 | Bacteria | 1840 |
| 40 | JGI24034J26672_10034443 | 3300002239 | Bacteria | 835 |
| 41 | JGI24751J29686_10000476 | 3300002459 | Bacteria | 11948 |
| 42 | JGI24751J29686_10014858 | 3300002459 | Bacteria | 1606 |
| 43 | JGI24751J29686_10094936 | 3300002459 | Bacteria | 621 |
| 44 | JGI25157J39369_1022777 | 3300002741 | Bacteria | 739 |
| 45 | JGI25150J39212_1000067 | 3300002774 | Bacteria | 63491 |
| 46 | JGI25150J39212_1034377 | 3300002774 | Bacteria | 682 |
| 47 | JGI25151J46595_10024018 | 3300003187 | Bacteria | 2500 |
| 48 | JGI25153J46596_10000073 | 3300003215 | Bacteria | 115166 |
| 49 | JGI25153J46596_10000417 | 3300003215 | Bacteria | 27933 |
| 50 | JGI25153J46596_10010562 | 3300003215 | Bacteria | 4164 |
| 51 | rootH2_10089335 | 3300003320 | Bacteria | 3876 |
| 52 | JGI26145J50221_1008080 | 3300003371 | Bacteria | 900 |
| 53 | Ga0055525_1000119 | 3300003759 | Bacteria | 120272 |
| 54 | Ga0055542_1000142 | 3300003762 | Bacteria | 89813 |
| 55 | Ga0055542_1000783 | 3300003762 | Bacteria | 23812 |
| 56 | Ga0055529_1000167 | 3300003763 | Bacteria | 90966 |
| 57 | Ga0055537_1003859 | 3300003773 | Bacteria | 4479 |
| 58 | Ga0055537_1007040 | 3300003773 | Bacteria | 2768 |
| 59 | Ga0055524_1000154 | 3300003775 | Bacteria | 80540 |
| 60 | Ga0055536_1009288 | 3300003781 | Bacteria | 4088 |
| 61 | Ga0055536_1010360 | 3300003781 | Bacteria | 3713 |
| 62 | Ga0055536_1014285 | 3300003781 | Bacteria | 2802 |
| 63 | Ga0055536_1016129 | 3300003781 | Bacteria | 2515 |
| 64 | Ga0055536_1056849 | 3300003781 | Bacteria | 828 |
| 65 | Ga0055534_1040661 | 3300003784 | Bacteria | 685 |
| 66 | Ga0055530_10000278 | 3300003791 | Bacteria | 46428 |
| 67 | Ga0055530_10000919 | 3300003791 | Bacteria | 24154 |
| 68 | Ga0055530_10008924 | 3300003791 | Bacteria | 3931 |
| 69 | Ga0055530_10017727 | 3300003791 | Bacteria | 2218 |
| 70 | Ga0055530_10098501 | 3300003791 | Bacteria | 590 |
| 71 | Ga0055540_1004222 | 3300003792 | Bacteria | 6599 |
| 72 | Ga0055531_10000094 | 3300003794 | Bacteria | 96266 |
| 73 | Ga0055531_10000576 | 3300003794 | Bacteria | 32018 |
| 74 | Ga0055531_10002471 | 3300003794 | Bacteria | 12332 |
| 75 | Ga0055531_10019986 | 3300003794 | Bacteria | 2674 |
| 76 | Ga0055531_10079625 | 3300003794 | Bacteria | 726 |
| 77 | Ga0055531_10108249 | 3300003794 | Bacteria | 559 |
| 78 | Ga0055543_1028437 | 3300004625 | Bacteria | 985 |
| 79 | Ga0058859_11630952 | 3300004798 | Bacteria | 876 |
| 80 | Ga0065165_1077226 | 3300005262 | Bacteria | 872 |
| 81 | Ga0065165_1148841 | 3300005262 | Bacteria | 548 |
| 82 | Ga0065714_10445013 | 3300005288 | Bacteria | 555 |
| 83 | Ga0065704_10003962 | 3300005289 | Bacteria | 4806 |
| 84 | Ga0065704_10070408 | 3300005289 | Bacteria | 26306 |
| 85 | Ga0065704_10074213 | 3300005289 | Bacteria | 6443 |
| 86 | Ga0065704_10075787 | 3300005289 | Bacteria | 5418 |
| 87 | Ga0065704_10123182 | 3300005289 | Bacteria | 1738 |
| 88 | Ga0065704_10337028 | 3300005289 | Bacteria | 829 |
| 89 | Ga0065704_10404655 | 3300005289 | Bacteria | 748 |
| 90 | Ga0065712_10077425 | 3300005290 | Bacteria | 3486 |
| 91 | Ga0065715_10043060 | 3300005293 | Bacteria | 1216 |
| 92 | Ga0065707_10089502 | 3300005295 | Bacteria | 4353 |
| 93 | Ga0065707_10795077 | 3300005295 | Bacteria | 601 |
| 94 | Ga0070658_10001088 | 3300005327 | Bacteria | 23167 |
| 95 | Ga0070658_10001818 | 3300005327 | Bacteria | 17955 |
| 96 | Ga0070658_10004556 | 3300005327 | Bacteria | 11266 |
| 97 | Ga0070658_10121705 | 3300005327 | Bacteria | 2168 |
| 98 | Ga0070658_10132051 | 3300005327 | Bacteria | 2081 |
| 99 | Ga0070658_10157951 | 3300005327 | Bacteria | 1901 |
| 100 | Ga0070658_10226029 | 3300005327 | Bacteria | 1584 |
| 101 | Ga0070658_10345800 | 3300005327 | Bacteria | 1272 |
| 102 | Ga0070658_10363440 | 3300005327 | Bacteria | 1240 |
| 103 | Ga0070658_10441636 | 3300005327 | Bacteria | 1120 |
| 104 | Ga0070658_10753753 | 3300005327 | Bacteria | 845 |
| 105 | Ga0070658_10891125 | 3300005327 | Bacteria | 773 |
| 106 | Ga0070676_10001859 | 3300005328 | Bacteria | 10744 |
| 107 | Ga0070676_10186173 | 3300005328 | Bacteria | 1353 |
| 108 | Ga0070676_10220314 | 3300005328 | Bacteria | 1253 |
| 109 | Ga0070676_10320630 | 3300005328 | Bacteria | 1057 |
| 110 | Ga0070676_10777837 | 3300005328 | Bacteria | 705 |
| 111 | Ga0070683_100026014 | 3300005329 | Bacteria | 5263 |
| 112 | Ga0070683_100027795 | 3300005329 | Bacteria | 5105 |
| 113 | Ga0070683_100036618 | 3300005329 | Bacteria | 4490 |
| 114 | Ga0070683_100915020 | 3300005329 | Bacteria | 841 |
| 115 | Ga0070683_101024501 | 3300005329 | Bacteria | 793 |
| 116 | Ga0070683_101072531 | 3300005329 | Unclassified | 774 |
| 117 | Ga0070683_101298110 | 3300005329 | Bacteria | 699 |
| 118 | Ga0070683_101876743 | 3300005329 | Bacteria | 576 |
| 119 | Ga0070690_100001067 | 3300005330 | Bacteria | 14061 |
| 120 | Ga0070690_100230956 | 3300005330 | Bacteria | 1301 |
| 121 | Ga0070690_100634766 | 3300005330 | Bacteria | 814 |
| 122 | Ga0070670_100001783 | 3300005331 | Bacteria | 17520 |
| 123 | Ga0070670_100003330 | 3300005331 | Bacteria | 13297 |
| 124 | Ga0070670_100034735 | 3300005331 | Bacteria | 4339 |
| 125 | Ga0070670_100130100 | 3300005331 | Bacteria | 2173 |
| 126 | Ga0070670_100191020 | 3300005331 | Bacteria | 1779 |
| 127 | Ga0070670_100317880 | 3300005331 | Bacteria | 1364 |
| 128 | Ga0070670_100595825 | 3300005331 | Bacteria | 989 |
| 129 | Ga0070670_101389547 | 3300005331 | Bacteria | 644 |
| 130 | Ga0068869_100047300 | 3300005334 | Bacteria | 3106 |
| 131 | Ga0068869_100961881 | 3300005334 | Bacteria | 742 |
| 132 | Ga0070666_10000476 | 3300005335 | Bacteria | 24221 |
| 133 | Ga0070666_10002290 | 3300005335 | Bacteria | 11574 |
| 134 | Ga0070666_10008159 | 3300005335 | Bacteria | 6488 |
| 135 | Ga0070666_10112794 | 3300005335 | Bacteria | 1881 |
| 136 | Ga0070666_10351601 | 3300005335 | Bacteria | 1055 |
| 137 | Ga0070666_10921308 | 3300005335 | Bacteria | 646 |
| 138 | Ga0070666_11289571 | 3300005335 | Bacteria | 545 |
| 139 | Ga0070680_100015107 | 3300005336 | Bacteria | 6046 |
| 140 | Ga0070680_100018879 | 3300005336 | Bacteria | 5453 |
| 141 | Ga0070680_100714063 | 3300005336 | Bacteria | 863 |
| 142 | Ga0070682_100003964 | 3300005337 | Bacteria | 8220 |
| 143 | Ga0070682_100229299 | 3300005337 | Bacteria | 1327 |
| 144 | Ga0070682_100246443 | 3300005337 | Bacteria | 1286 |
| 145 | Ga0070682_100573061 | 3300005337 | Bacteria | 887 |
| 146 | Ga0068868_100000006 | 3300005338 | Bacteria | 123358 |
| 147 | Ga0068868_100002615 | 3300005338 | Bacteria | 12490 |
| 148 | Ga0068868_100257110 | 3300005338 | Bacteria | 1472 |
| 149 | Ga0070660_100000584 | 3300005339 | Bacteria | 24459 |
| 150 | Ga0070660_100004220 | 3300005339 | Bacteria | 9921 |
| 151 | Ga0070660_100095160 | 3300005339 | Bacteria | 2354 |
| 152 | Ga0070660_100124465 | 3300005339 | Bacteria | 2059 |
| 153 | Ga0070660_100242779 | 3300005339 | Bacteria | 1467 |
| 154 | Ga0070660_100292811 | 3300005339 | Bacteria | 1333 |
| 155 | Ga0070660_100404291 | 3300005339 | Bacteria | 1129 |
| 156 | Ga0070660_100511463 | 3300005339 | Bacteria | 999 |
| 157 | Ga0070660_100562380 | 3300005339 | Bacteria | 952 |
| 158 | Ga0070660_100644777 | 3300005339 | Bacteria | 887 |
| 159 | Ga0070689_100005611 | 3300005340 | Bacteria | 8587 |
| 160 | Ga0070689_100060369 | 3300005340 | Bacteria | 2948 |
| 161 | Ga0070689_100190728 | 3300005340 | Bacteria | 1669 |
| 162 | Ga0070689_100698428 | 3300005340 | Bacteria | 886 |
| 163 | Ga0070691_10000302 | 3300005341 | Bacteria | 17332 |
| 164 | Ga0070691_10004772 | 3300005341 | Bacteria | 6168 |
| 165 | Ga0070691_10305346 | 3300005341 | Bacteria | 870 |
| 166 | Ga0070687_100000686 | 3300005343 | Bacteria | 11295 |
| 167 | Ga0070687_100486630 | 3300005343 | Bacteria | 828 |
| 168 | Ga0070661_100000507 | 3300005344 | Bacteria | 29896 |
| 169 | Ga0070661_100000976 | 3300005344 | Bacteria | 20365 |
| 170 | Ga0070661_100039616 | 3300005344 | Bacteria | 3434 |
| 171 | Ga0070661_100078488 | 3300005344 | Bacteria | 2435 |
| 172 | Ga0070661_100206559 | 3300005344 | Bacteria | 1502 |
| 173 | Ga0070661_100244966 | 3300005344 | Bacteria | 1381 |
| 174 | Ga0070661_100281820 | 3300005344 | Bacteria | 1289 |
| 175 | Ga0070661_100384803 | 3300005344 | Bacteria | 1106 |
| 176 | Ga0070661_100635173 | 3300005344 | Bacteria | 866 |
| 177 | Ga0070661_101536523 | 3300005344 | Bacteria | 562 |
| 178 | Ga0070692_10000534 | 3300005345 | Bacteria | 11810 |
| 179 | Ga0070692_10152416 | 3300005345 | Bacteria | 1317 |
| 180 | Ga0070668_100005413 | 3300005347 | Bacteria | 9476 |
| 181 | Ga0070668_100010434 | 3300005347 | Bacteria | 6903 |
| 182 | Ga0070668_100024692 | 3300005347 | Bacteria | 4555 |
| 183 | Ga0070668_100042071 | 3300005347 | Bacteria | 3501 |
| 184 | Ga0070668_100050967 | 3300005347 | Bacteria | 3188 |
| 185 | Ga0070668_100131066 | 3300005347 | Bacteria | 2012 |
| 186 | Ga0070668_100345243 | 3300005347 | Bacteria | 1258 |
| 187 | Ga0070668_100699953 | 3300005347 | Bacteria | 894 |
| 188 | Ga0070668_100834014 | 3300005347 | Bacteria | 821 |
| 189 | Ga0070668_101004698 | 3300005347 | Bacteria | 750 |
| 190 | Ga0070669_100000052 | 3300005353 | Bacteria | 114467 |
| 191 | Ga0070669_100000074 | 3300005353 | Bacteria | 99054 |
| 192 | Ga0070669_100000096 | 3300005353 | Bacteria | 86930 |
| 193 | Ga0070669_100001148 | 3300005353 | Bacteria | 19338 |
| 194 | Ga0070669_100001940 | 3300005353 | Bacteria | 14931 |
| 195 | Ga0070669_100029003 | 3300005353 | Bacteria | 3988 |
| 196 | Ga0070669_100043147 | 3300005353 | Bacteria | 3283 |
| 197 | Ga0070669_100216629 | 3300005353 | Bacteria | 1513 |
| 198 | Ga0070669_100331168 | 3300005353 | Bacteria | 1232 |
| 199 | Ga0070669_100361280 | 3300005353 | Bacteria | 1181 |
| 200 | Ga0070675_100001202 | 3300005354 | Bacteria | 18818 |
| 201 | Ga0070675_100101930 | 3300005354 | Bacteria | 2418 |
| 202 | Ga0070675_100214407 | 3300005354 | Bacteria | 1675 |
| 203 | Ga0070675_100424323 | 3300005354 | Bacteria | 1189 |
| 204 | Ga0070675_100568381 | 3300005354 | Bacteria | 1026 |
| 205 | Ga0070675_100975029 | 3300005354 | Bacteria | 778 |
| 206 | Ga0070671_100000005 | 3300005355 | Bacteria | 256547 |
| 207 | Ga0070671_100000045 | 3300005355 | Bacteria | 85779 |
| 208 | Ga0070671_100001052 | 3300005355 | Bacteria | 20342 |
| 209 | Ga0070671_100001262 | 3300005355 | Bacteria | 18969 |
| 210 | Ga0070671_100002546 | 3300005355 | Bacteria | 14125 |
| 211 | Ga0070671_100361216 | 3300005355 | Bacteria | 1240 |
| 212 | Ga0070671_101495182 | 3300005355 | Bacteria | 597 |
| 213 | Ga0070674_100002525 | 3300005356 | Bacteria | 10131 |
| 214 | Ga0070674_100016076 | 3300005356 | Bacteria | 4687 |
| 215 | Ga0070674_100182352 | 3300005356 | Bacteria | 1609 |
| 216 | Ga0070674_100624080 | 3300005356 | Bacteria | 913 |
| 217 | Ga0070674_101329822 | 3300005356 | Bacteria | 641 |
| 218 | Ga0070674_101386922 | 3300005356 | Bacteria | 629 |
| 219 | Ga0070674_102221935 | 3300005356 | Bacteria | 501 |
| 220 | Ga0070673_100000673 | 3300005364 | Bacteria | 18823 |
| 221 | Ga0070673_100169382 | 3300005364 | Bacteria | 1863 |
| 222 | Ga0070673_100212447 | 3300005364 | Bacteria | 1671 |
| 223 | Ga0070673_100521796 | 3300005364 | Bacteria | 1076 |
| 224 | Ga0070673_101275468 | 3300005364 | Bacteria | 689 |
| 225 | Ga0070688_100004077 | 3300005365 | Bacteria | 7580 |
| 226 | Ga0070688_100027433 | 3300005365 | Bacteria | 3393 |
| 227 | Ga0070688_100102443 | 3300005365 | Bacteria | 1890 |
| 228 | Ga0070688_100269781 | 3300005365 | Bacteria | 1219 |
| 229 | Ga0070688_101374121 | 3300005365 | Bacteria | 572 |
| 230 | Ga0070659_100000005 | 3300005366 | Bacteria | 259902 |
| 231 | Ga0070659_100005781 | 3300005366 | Bacteria | 8905 |
| 232 | Ga0070659_100006377 | 3300005366 | Bacteria | 8520 |
| 233 | Ga0070659_100026584 | 3300005366 | Bacteria | 4454 |
| 234 | Ga0070659_100163068 | 3300005366 | Bacteria | 1823 |
| 235 | Ga0070659_100550632 | 3300005366 | Bacteria | 987 |
| 236 | Ga0070659_101456372 | 3300005366 | Bacteria | 609 |
| 237 | Ga0070667_100000126 | 3300005367 | Bacteria | 96729 |
| 238 | Ga0070667_100000696 | 3300005367 | Bacteria | 32392 |
| 239 | Ga0070667_100001801 | 3300005367 | Bacteria | 19071 |
| 240 | Ga0070667_100045751 | 3300005367 | Bacteria | 3680 |
| 241 | Ga0070667_100054770 | 3300005367 | Bacteria | 3368 |
| 242 | Ga0070667_100092193 | 3300005367 | Bacteria | 2606 |
| 243 | Ga0070667_100196352 | 3300005367 | Bacteria | 1789 |
| 244 | Ga0070667_100210872 | 3300005367 | Bacteria | 1726 |
| 245 | Ga0070667_100255166 | 3300005367 | Bacteria | 1569 |
| 246 | Ga0070667_100279150 | 3300005367 | Bacteria | 1500 |
| 247 | Ga0070667_100406367 | 3300005367 | Bacteria | 1240 |
| 248 | Ga0070703_10017825 | 3300005406 | Bacteria | 2048 |
| 249 | Ga0070709_10000225 | 3300005434 | Bacteria | 36698 |
| 250 | Ga0070709_11183573 | 3300005434 | Bacteria | 614 |
| 251 | Ga0070714_100010651 | 3300005435 | Bacteria | 7275 |
| 252 | Ga0070714_100534842 | 3300005435 | Bacteria | 1121 |
| 253 | Ga0070713_100013772 | 3300005436 | Bacteria | 5982 |
| 254 | Ga0070713_100402863 | 3300005436 | Bacteria | 1278 |
| 255 | Ga0070710_10516476 | 3300005437 | Bacteria | 820 |
| 256 | Ga0070710_10672815 | 3300005437 | Bacteria | 728 |
| 257 | Ga0070710_11248828 | 3300005437 | Bacteria | 551 |
| 258 | Ga0070701_10000713 | 3300005438 | Bacteria | 11773 |
| 259 | Ga0070701_10029761 | 3300005438 | Bacteria | 2696 |
| 260 | Ga0070701_10313934 | 3300005438 | Bacteria | 968 |
| 261 | Ga0070711_100000237 | 3300005439 | Bacteria | 28263 |
| 262 | Ga0070711_100629191 | 3300005439 | Bacteria | 898 |
| 263 | Ga0070711_101126626 | 3300005439 | Bacteria | 677 |
| 264 | Ga0070705_100000934 | 3300005440 | Bacteria | 16371 |
| 265 | Ga0070705_100116536 | 3300005440 | Bacteria | 1717 |
| 266 | Ga0070705_100178976 | 3300005440 | Bacteria | 1435 |
| 267 | Ga0070700_100008931 | 3300005441 | Bacteria | 5482 |
| 268 | Ga0070700_100030356 | 3300005441 | Bacteria | 3230 |
| 269 | Ga0070700_100035052 | 3300005441 | Bacteria | 3034 |
| 270 | Ga0070700_100281035 | 3300005441 | Bacteria | 1207 |
| 271 | Ga0070700_100422249 | 3300005441 | Bacteria | 1008 |
| 272 | Ga0070700_100442035 | 3300005441 | Bacteria | 987 |
| 273 | Ga0070700_100818039 | 3300005441 | Bacteria | 752 |
| 274 | Ga0070694_100006630 | 3300005444 | Bacteria | 7036 |
| 275 | Ga0070694_100725800 | 3300005444 | Bacteria | 810 |
| 276 | Ga0070708_100052438 | 3300005445 | Bacteria | 3617 |
| 277 | Ga0070708_101560542 | 3300005445 | Bacteria | 615 |
| 278 | Ga0070663_100000497 | 3300005455 | Bacteria | 20743 |
| 279 | Ga0070663_100020880 | 3300005455 | Bacteria | 4343 |
| 280 | Ga0070663_100067038 | 3300005455 | Bacteria | 2602 |
| 281 | Ga0070663_100073988 | 3300005455 | Bacteria | 2486 |
| 282 | Ga0070663_100094287 | 3300005455 | Bacteria | 2222 |
| 283 | Ga0070663_100221819 | 3300005455 | Bacteria | 1485 |
| 284 | Ga0070663_100272767 | 3300005455 | Bacteria | 1345 |
| 285 | Ga0070663_100454112 | 3300005455 | Bacteria | 1057 |
| 286 | Ga0070678_100003959 | 3300005456 | Bacteria | 8327 |
| 287 | Ga0070678_100143973 | 3300005456 | Bacteria | 1911 |
| 288 | Ga0070678_100252705 | 3300005456 | Bacteria | 1479 |
| 289 | Ga0070678_101236258 | 3300005456 | Bacteria | 693 |
| 290 | Ga0070662_100002792 | 3300005457 | Bacteria | 10814 |
| 291 | Ga0070662_100004743 | 3300005457 | Bacteria | 8616 |
| 292 | Ga0070662_100215228 | 3300005457 | Bacteria | 1530 |
| 293 | Ga0070662_100629863 | 3300005457 | Bacteria | 904 |
| 294 | Ga0070662_100920695 | 3300005457 | Bacteria | 746 |
| 295 | Ga0070681_10011638 | 3300005458 | Bacteria | 8710 |
| 296 | Ga0070681_10035996 | 3300005458 | Bacteria | 4972 |
| 297 | Ga0070681_10292766 | 3300005458 | Bacteria | 1538 |
| 298 | Ga0070681_10369511 | 3300005458 | Bacteria | 1345 |
| 299 | Ga0070681_10473062 | 3300005458 | Bacteria | 1166 |
| 300 | Ga0070681_12004575 | 3300005458 | Bacteria | 507 |
| 301 | Ga0068867_100033471 | 3300005459 | Bacteria | 3722 |
| 302 | Ga0068867_100108248 | 3300005459 | Bacteria | 2131 |
| 303 | Ga0068867_100129295 | 3300005459 | Bacteria | 1961 |
| 304 | Ga0068867_100156147 | 3300005459 | Bacteria | 1796 |
| 305 | Ga0068867_100308340 | 3300005459 | Bacteria | 1307 |
| 306 | Ga0068867_101601851 | 3300005459 | Bacteria | 609 |
| 307 | Ga0068867_101713003 | 3300005459 | Bacteria | 590 |
| 308 | Ga0070685_10014056 | 3300005466 | Bacteria | 4234 |
| 309 | Ga0070685_10078251 | 3300005466 | Bacteria | 1976 |
| 310 | Ga0070685_11169043 | 3300005466 | Bacteria | 584 |
| 311 | Ga0070707_100229142 | 3300005468 | Bacteria | 1809 |
| 312 | Ga0070707_101308724 | 3300005468 | Bacteria | 691 |
| 313 | Ga0070679_100009637 | 3300005530 | Bacteria | 9134 |
| 314 | Ga0070679_100205823 | 3300005530 | Bacteria | 1932 |
| 315 | Ga0070679_100304300 | 3300005530 | Bacteria | 1545 |
| 316 | Ga0070679_100356781 | 3300005530 | Bacteria | 1409 |
| 317 | Ga0070679_100460451 | 3300005530 | Bacteria | 1216 |
| 318 | Ga0070679_100987862 | 3300005530 | Bacteria | 786 |
| 319 | Ga0070684_100020003 | 3300005535 | Bacteria | 5549 |
| 320 | Ga0070684_100154029 | 3300005535 | Bacteria | 2083 |
| 321 | Ga0070684_100471018 | 3300005535 | Bacteria | 1162 |
| 322 | Ga0070684_101214535 | 3300005535 | Bacteria | 709 |
| 323 | Ga0070697_100004352 | 3300005536 | Bacteria | 10861 |
| 324 | Ga0068853_100001129 | 3300005539 | Bacteria | 18917 |
| 325 | Ga0068853_100002735 | 3300005539 | Bacteria | 13316 |
| 326 | Ga0068853_100035403 | 3300005539 | Bacteria | 4241 |
| 327 | Ga0068853_100103310 | 3300005539 | Bacteria | 2522 |
| 328 | Ga0068853_100200594 | 3300005539 | Bacteria | 1815 |
| 329 | Ga0068853_100280041 | 3300005539 | Bacteria | 1537 |
| 330 | Ga0068853_100306321 | 3300005539 | Bacteria | 1469 |
| 331 | Ga0068853_100636422 | 3300005539 | Bacteria | 1014 |
| 332 | Ga0068853_100719926 | 3300005539 | Bacteria | 953 |
| 333 | Ga0068853_102161994 | 3300005539 | Bacteria | 539 |
| 334 | Ga0070672_100001428 | 3300005543 | Bacteria | 14759 |
| 335 | Ga0070672_100132101 | 3300005543 | Bacteria | 2053 |
| 336 | Ga0070672_100645023 | 3300005543 | Bacteria | 925 |
| 337 | Ga0070686_100000180 | 3300005544 | Bacteria | 44847 |
| 338 | Ga0070686_100000710 | 3300005544 | Bacteria | 19361 |
| 339 | Ga0070686_100147930 | 3300005544 | Bacteria | 1642 |
| 340 | Ga0070686_100340905 | 3300005544 | Bacteria | 1123 |
| 341 | Ga0070686_100618113 | 3300005544 | Bacteria | 856 |
| 342 | Ga0070686_100664360 | 3300005544 | Bacteria | 828 |
| 343 | Ga0070695_100000578 | 3300005545 | Bacteria | 19309 |
| 344 | Ga0070695_100002848 | 3300005545 | Bacteria | 10058 |
| 345 | Ga0070696_100000325 | 3300005546 | Bacteria | 28995 |
| 346 | Ga0070696_100024910 | 3300005546 | Bacteria | 4066 |
| 347 | Ga0070696_100132064 | 3300005546 | Bacteria | 1817 |
| 348 | Ga0070693_100012681 | 3300005547 | Bacteria | 4271 |
| 349 | Ga0070693_100564453 | 3300005547 | Bacteria | 817 |
| 350 | Ga0070665_100000079 | 3300005548 | Bacteria | 186925 |
| 351 | Ga0070665_100000296 | 3300005548 | Bacteria | 78411 |
| 352 | Ga0070665_100007214 | 3300005548 | Bacteria | 11295 |
| 353 | Ga0070665_100016450 | 3300005548 | Bacteria | 7416 |
| 354 | Ga0070665_100025820 | 3300005548 | Bacteria | 5916 |
| 355 | Ga0070665_100035098 | 3300005548 | Bacteria | 5042 |
| 356 | Ga0070665_100045038 | 3300005548 | Bacteria | 4430 |
| 357 | Ga0070665_100096351 | 3300005548 | Bacteria | 2964 |
| 358 | Ga0070665_100194694 | 3300005548 | Bacteria | 2028 |
| 359 | Ga0070665_100520073 | 3300005548 | Bacteria | 1202 |
| 360 | Ga0070665_100715964 | 3300005548 | Bacteria | 1014 |
| 361 | Ga0070665_101355634 | 3300005548 | Bacteria | 721 |
| 362 | Ga0070665_101645239 | 3300005548 | Bacteria | 650 |
| 363 | Ga0070665_101718934 | 3300005548 | Bacteria | 634 |
| 364 | Ga0070665_102014263 | 3300005548 | Bacteria | 582 |
| 365 | Ga0070704_100011048 | 3300005549 | Bacteria | 5511 |
| 366 | Ga0068855_100006792 | 3300005563 | Bacteria | 13880 |
| 367 | Ga0068855_100013711 | 3300005563 | Bacteria | 9772 |
| 368 | Ga0068855_100019332 | 3300005563 | Bacteria | 8185 |
| 369 | Ga0068855_100022265 | 3300005563 | Bacteria | 7593 |
| 370 | Ga0068855_100048203 | 3300005563 | Bacteria | 5030 |
| 371 | Ga0068855_100149492 | 3300005563 | Bacteria | 2656 |
| 372 | Ga0068855_100151509 | 3300005563 | Bacteria | 2637 |
| 373 | Ga0068855_100252767 | 3300005563 | Bacteria | 1965 |
| 374 | Ga0068855_100280798 | 3300005563 | Bacteria | 1849 |
| 375 | Ga0068855_100300284 | 3300005563 | Bacteria | 1778 |
| 376 | Ga0068855_100352292 | 3300005563 | Bacteria | 1621 |
| 377 | Ga0068855_100563257 | 3300005563 | Bacteria | 1232 |
| 378 | Ga0068855_101260806 | 3300005563 | Bacteria | 766 |
| 379 | Ga0068855_101298053 | 3300005563 | Bacteria | 753 |
| 380 | Ga0068855_101361997 | 3300005563 | Bacteria | 732 |
| 381 | Ga0070664_100005810 | 3300005564 | Bacteria | 9952 |
| 382 | Ga0070664_100052478 | 3300005564 | Bacteria | 3454 |
| 383 | Ga0070664_100054332 | 3300005564 | Bacteria | 3397 |
| 384 | Ga0070664_100241839 | 3300005564 | Bacteria | 1620 |
| 385 | Ga0070664_100434352 | 3300005564 | Bacteria | 1204 |
| 386 | Ga0070664_100930601 | 3300005564 | Bacteria | 815 |
| 387 | Ga0070664_101394205 | 3300005564 | Bacteria | 662 |
| 388 | Ga0068857_100002722 | 3300005577 | Bacteria | 14509 |
| 389 | Ga0068857_100015261 | 3300005577 | Bacteria | 6705 |
| 390 | Ga0068857_100033167 | 3300005577 | Bacteria | 4566 |
| 391 | Ga0068857_100348275 | 3300005577 | Bacteria | 1371 |
| 392 | Ga0068857_100405100 | 3300005577 | Bacteria | 1270 |
| 393 | Ga0068857_100461560 | 3300005577 | Bacteria | 1189 |
| 394 | Ga0068857_100630845 | 3300005577 | Bacteria | 1014 |
| 395 | Ga0068857_100985947 | 3300005577 | Bacteria | 811 |
| 396 | Ga0068857_101200472 | 3300005577 | Bacteria | 734 |
| 397 | Ga0068857_101290001 | 3300005577 | Bacteria | 708 |
| 398 | Ga0068857_101514112 | 3300005577 | Bacteria | 654 |
| 399 | Ga0068857_101679906 | 3300005577 | Bacteria | 621 |
| 400 | Ga0068854_100000389 | 3300005578 | Bacteria | 27589 |
| 401 | Ga0068854_100028613 | 3300005578 | Bacteria | 3852 |
| 402 | Ga0068854_100032623 | 3300005578 | Bacteria | 3625 |
| 403 | Ga0068854_100035059 | 3300005578 | Bacteria | 3510 |
| 404 | Ga0068854_100062705 | 3300005578 | Bacteria | 2696 |
| 405 | Ga0068854_100133400 | 3300005578 | Bacteria | 1898 |
| 406 | Ga0068854_100133726 | 3300005578 | Bacteria | 1896 |
| 407 | Ga0068854_100192007 | 3300005578 | Bacteria | 1601 |
| 408 | Ga0068854_100198525 | 3300005578 | Bacteria | 1576 |
| 409 | Ga0068854_100631004 | 3300005578 | Bacteria | 918 |
| 410 | Ga0068854_101544537 | 3300005578 | Bacteria | 603 |
| 411 | Ga0068854_101583692 | 3300005578 | Bacteria | 596 |
| 412 | Ga0068854_101854222 | 3300005578 | Bacteria | 554 |
| 413 | Ga0068854_101972686 | 3300005578 | Bacteria | 537 |
| 414 | Ga0068856_100001928 | 3300005614 | Bacteria | 21621 |
| 415 | Ga0068856_100002574 | 3300005614 | Bacteria | 18686 |
| 416 | Ga0068856_100022744 | 3300005614 | Bacteria | 6095 |
| 417 | Ga0068856_100026525 | 3300005614 | Bacteria | 5649 |
| 418 | Ga0068856_100147182 | 3300005614 | Bacteria | 2363 |
| 419 | Ga0068856_100204231 | 3300005614 | Bacteria | 1990 |
| 420 | Ga0068856_100289963 | 3300005614 | Bacteria | 1653 |
| 421 | Ga0068856_100620084 | 3300005614 | Bacteria | 1102 |
| 422 | Ga0068856_100957019 | 3300005614 | Bacteria | 875 |
| 423 | Ga0068856_101117063 | 3300005614 | Bacteria | 805 |
| 424 | Ga0068856_101135505 | 3300005614 | Bacteria | 798 |
| 425 | Ga0070702_100000088 | 3300005615 | Bacteria | 27195 |
| 426 | Ga0070702_100074831 | 3300005615 | Bacteria | 2010 |
| 427 | Ga0068852_100014137 | 3300005616 | Bacteria | 6131 |
| 428 | Ga0068852_100104161 | 3300005616 | Bacteria | 2567 |
| 429 | Ga0068852_100225405 | 3300005616 | Bacteria | 1784 |
| 430 | Ga0068852_100235764 | 3300005616 | Bacteria | 1746 |
| 431 | Ga0068852_100327281 | 3300005616 | Bacteria | 1490 |
| 432 | Ga0068852_100509361 | 3300005616 | Bacteria | 1199 |
| 433 | Ga0068852_100521503 | 3300005616 | Bacteria | 1186 |
| 434 | Ga0068852_100711923 | 3300005616 | Bacteria | 1014 |
| 435 | Ga0068852_100712043 | 3300005616 | Bacteria | 1014 |
| 436 | Ga0068852_101268045 | 3300005616 | Bacteria | 758 |
| 437 | Ga0068859_100000162 | 3300005617 | Bacteria | 65033 |
| 438 | Ga0068859_100002269 | 3300005617 | Bacteria | 19505 |
| 439 | Ga0068859_100362355 | 3300005617 | Bacteria | 1545 |
| 440 | Ga0068859_100556770 | 3300005617 | Bacteria | 1241 |
| 441 | Ga0068859_100669333 | 3300005617 | Bacteria | 1129 |
| 442 | Ga0068864_100002565 | 3300005618 | Bacteria | 14997 |
| 443 | Ga0068864_100003629 | 3300005618 | Bacteria | 12763 |
| 444 | Ga0068864_100004757 | 3300005618 | Bacteria | 11123 |
| 445 | Ga0068864_100113697 | 3300005618 | Bacteria | 2413 |
| 446 | Ga0068864_100882244 | 3300005618 | Bacteria | 883 |
| 447 | Ga0068864_101043020 | 3300005618 | Bacteria | 812 |
| 448 | Ga0068864_101245018 | 3300005618 | Bacteria | 743 |
| 449 | Ga0068866_10008498 | 3300005718 | Bacteria | 4331 |
| 450 | Ga0068866_10032331 | 3300005718 | Bacteria | 2529 |
| 451 | Ga0068861_100000952 | 3300005719 | Bacteria | 17599 |
| 452 | Ga0068861_100001387 | 3300005719 | Bacteria | 15217 |
| 453 | Ga0068861_100007263 | 3300005719 | Bacteria | 7592 |
| 454 | Ga0068861_100199975 | 3300005719 | Bacteria | 1677 |
| 455 | Ga0068861_100203136 | 3300005719 | Bacteria | 1665 |
| 456 | Ga0068861_100425121 | 3300005719 | Bacteria | 1185 |
| 457 | Ga0068861_100734483 | 3300005719 | Bacteria | 921 |
| 458 | Ga0068861_101179441 | 3300005719 | Bacteria | 739 |
| 459 | Ga0068861_102574236 | 3300005719 | Bacteria | 512 |
| 460 | Ga0068851_10040441 | 3300005834 | Bacteria | 2343 |
| 461 | Ga0068851_10081837 | 3300005834 | Bacteria | 1687 |
| 462 | Ga0068870_10057602 | 3300005840 | Bacteria | 2078 |
| 463 | Ga0068863_100000103 | 3300005841 | Bacteria | 91380 |
| 464 | Ga0068863_100000470 | 3300005841 | Bacteria | 41201 |
| 465 | Ga0068863_100004418 | 3300005841 | Bacteria | 13866 |
| 466 | Ga0068863_100005989 | 3300005841 | Bacteria | 11923 |
| 467 | Ga0068863_100032893 | 3300005841 | Bacteria | 4941 |
| 468 | Ga0068863_100037604 | 3300005841 | Bacteria | 4608 |
| 469 | Ga0068863_100082631 | 3300005841 | Bacteria | 3044 |
| 470 | Ga0068863_100586385 | 3300005841 | Bacteria | 1103 |
| 471 | Ga0068863_100778089 | 3300005841 | Bacteria | 954 |
| 472 | Ga0068858_100000240 | 3300005842 | Bacteria | 59201 |
| 473 | Ga0068858_100002072 | 3300005842 | Bacteria | 20404 |
| 474 | Ga0068858_100002314 | 3300005842 | Bacteria | 19259 |
| 475 | Ga0068858_100004410 | 3300005842 | Bacteria | 13808 |
| 476 | Ga0068858_100048093 | 3300005842 | Bacteria | 3953 |
| 477 | Ga0068858_100069876 | 3300005842 | Bacteria | 3255 |
| 478 | Ga0068858_100090763 | 3300005842 | Bacteria | 2843 |
| 479 | Ga0068858_100131895 | 3300005842 | Bacteria | 2343 |
| 480 | Ga0068858_100140077 | 3300005842 | Bacteria | 2270 |
| 481 | Ga0068858_100167885 | 3300005842 | Bacteria | 2068 |
| 482 | Ga0068858_100268179 | 3300005842 | Bacteria | 1624 |
| 483 | Ga0068858_101354931 | 3300005842 | Bacteria | 701 |
| 484 | Ga0068858_101426778 | 3300005842 | Bacteria | 682 |
| 485 | Ga0068860_100000093 | 3300005843 | Bacteria | 150034 |
| 486 | Ga0068860_100003367 | 3300005843 | Bacteria | 16456 |
| 487 | Ga0068860_100004581 | 3300005843 | Bacteria | 14112 |
| 488 | Ga0068860_100005041 | 3300005843 | Bacteria | 13445 |
| 489 | Ga0068860_100013991 | 3300005843 | Bacteria | 7870 |
| 490 | Ga0068860_100022991 | 3300005843 | Bacteria | 6029 |
| 491 | Ga0068860_100084995 | 3300005843 | Bacteria | 3010 |
| 492 | Ga0068860_100113883 | 3300005843 | Bacteria | 2586 |
| 493 | Ga0068860_100527067 | 3300005843 | Bacteria | 1182 |
| 494 | Ga0068860_100540490 | 3300005843 | Bacteria | 1167 |
| 495 | Ga0068860_100776527 | 3300005843 | Bacteria | 971 |
| 496 | Ga0068860_100900779 | 3300005843 | Bacteria | 901 |
| 497 | Ga0068862_100001170 | 3300005844 | Bacteria | 24721 |
| 498 | Ga0068862_100001387 | 3300005844 | Bacteria | 22482 |
| 499 | Ga0068862_100004889 | 3300005844 | Bacteria | 11286 |
| 500 | Ga0068862_100030244 | 3300005844 | Bacteria | 4564 |
| 501 | Ga0068862_100064939 | 3300005844 | Bacteria | 3143 |
| 502 | Ga0068862_100083636 | 3300005844 | Bacteria | 2771 |
| 503 | Ga0068862_100119545 | 3300005844 | Bacteria | 2321 |
| 504 | Ga0068862_100177531 | 3300005844 | Bacteria | 1910 |
| 505 | Ga0068862_100223523 | 3300005844 | Bacteria | 1705 |
| 506 | Ga0068862_100286699 | 3300005844 | Bacteria | 1511 |
| 507 | Ga0068862_100305585 | 3300005844 | Bacteria | 1464 |
| 508 | Ga0068862_100605152 | 3300005844 | Bacteria | 1053 |
| 509 | Ga0068862_101160773 | 3300005844 | Bacteria | 769 |
| 510 | Ga0081455_10001416 | 3300005937 | Bacteria | 29700 |
| 511 | Ga0081455_10006703 | 3300005937 | Bacteria | 12304 |
| 512 | Ga0081455_10198838 | 3300005937 | Bacteria | 1502 |
| 513 | Ga0081538_10201233 | 3300005981 | Bacteria | 818 |
| 514 | Ga0081540_1088598 | 3300005983 | Bacteria | 1368 |
| 515 | Ga0081540_1106603 | 3300005983 | Bacteria | 1194 |
| 516 | Ga0081539_10187932 | 3300005985 | Bacteria | 964 |
| 517 | Ga0081539_10462094 | 3300005985 | Bacteria | 526 |
| 518 | Ga0070717_11593547 | 3300006028 | Bacteria | 592 |
| 519 | Ga0075365_10014968 | 3300006038 | Bacteria | 4679 |
| 520 | Ga0075365_10017980 | 3300006038 | Bacteria | 4338 |
| 521 | Ga0075365_10031317 | 3300006038 | Bacteria | 3411 |
| 522 | Ga0075365_10502787 | 3300006038 | Bacteria | 857 |
| 523 | Ga0075365_10511976 | 3300006038 | Bacteria | 848 |
| 524 | Ga0075365_10611234 | 3300006038 | Bacteria | 771 |
| 525 | Ga0075365_11075421 | 3300006038 | Bacteria | 566 |
| 526 | Ga0075368_10001183 | 3300006042 | Bacteria | 8227 |
| 527 | Ga0075368_10001519 | 3300006042 | Bacteria | 7432 |
| 528 | Ga0075368_10008487 | 3300006042 | Bacteria | 3661 |
| 529 | Ga0075368_10034408 | 3300006042 | Bacteria | 1974 |
| 530 | Ga0075368_10168999 | 3300006042 | Bacteria | 918 |
| 531 | Ga0075368_10573514 | 3300006042 | Bacteria | 509 |
| 532 | Ga0075363_100000096 | 3300006048 | Bacteria | 19488 |
| 533 | Ga0075363_100025336 | 3300006048 | Bacteria | 3024 |
| 534 | Ga0075363_100097619 | 3300006048 | Bacteria | 1623 |
| 535 | Ga0075363_100320506 | 3300006048 | Bacteria | 902 |
| 536 | Ga0075363_100565137 | 3300006048 | Bacteria | 679 |
| 537 | Ga0075363_100596728 | 3300006048 | Bacteria | 661 |
| 538 | Ga0075364_10005322 | 3300006051 | Bacteria | 7468 |
| 539 | Ga0075364_10008502 | 3300006051 | Bacteria | 6139 |
| 540 | Ga0075364_10010176 | 3300006051 | Bacteria | 5672 |
| 541 | Ga0075364_10079128 | 3300006051 | Bacteria | 2172 |
| 542 | Ga0075364_10217649 | 3300006051 | Bacteria | 1295 |
| 543 | Ga0075364_10433331 | 3300006051 | Bacteria | 898 |
| 544 | Ga0075364_10773171 | 3300006051 | Bacteria | 655 |
| 545 | Ga0075364_10804910 | 3300006051 | Bacteria | 641 |
| 546 | Ga0075432_10073267 | 3300006058 | Bacteria | 1233 |
| 547 | Ga0075432_10129092 | 3300006058 | Bacteria | 956 |
| 548 | Ga0070715_10000291 | 3300006163 | Bacteria | 12275 |
| 549 | Ga0070716_100001118 | 3300006173 | Bacteria | 11820 |
| 550 | Ga0070716_101229369 | 3300006173 | Bacteria | 603 |
| 551 | Ga0070716_101551373 | 3300006173 | Bacteria | 543 |
| 552 | Ga0070712_100001476 | 3300006175 | Bacteria | 14336 |
| 553 | Ga0070712_100383962 | 3300006175 | Bacteria | 1157 |
| 554 | Ga0070712_100608373 | 3300006175 | Bacteria | 925 |
| 555 | Ga0075362_10000046 | 3300006177 | Bacteria | 42578 |
| 556 | Ga0075362_10000497 | 3300006177 | Bacteria | 11481 |
| 557 | Ga0075362_10035176 | 3300006177 | Bacteria | 2186 |
| 558 | Ga0075362_10138488 | 3300006177 | Bacteria | 1162 |
| 559 | Ga0075362_10177958 | 3300006177 | Bacteria | 1030 |
| 560 | Ga0075362_10179116 | 3300006177 | Bacteria | 1026 |
| 561 | Ga0075367_10001647 | 3300006178 | Bacteria | 9723 |
| 562 | Ga0075367_10021430 | 3300006178 | Bacteria | 3611 |
| 563 | Ga0075367_10027526 | 3300006178 | Bacteria | 3235 |
| 564 | Ga0075367_10030522 | 3300006178 | Bacteria | 3091 |
| 565 | Ga0075367_10319971 | 3300006178 | Bacteria | 977 |
| 566 | Ga0075367_10946747 | 3300006178 | Bacteria | 549 |
| 567 | Ga0075369_10015892 | 3300006186 | Bacteria | 3029 |
| 568 | Ga0075369_10016540 | 3300006186 | Bacteria | 2978 |
| 569 | Ga0075369_10021076 | 3300006186 | Bacteria | 2674 |
| 570 | Ga0075369_10039066 | 3300006186 | Bacteria | 2026 |
| 571 | Ga0075369_10048256 | 3300006186 | Bacteria | 1837 |
| 572 | Ga0075369_10342322 | 3300006186 | Bacteria | 701 |
| 573 | Ga0075366_10000241 | 3300006195 | Bacteria | 24314 |
| 574 | Ga0075366_10001502 | 3300006195 | Bacteria | 11639 |
| 575 | Ga0075366_10037075 | 3300006195 | Bacteria | 2877 |
| 576 | Ga0075366_10043580 | 3300006195 | Bacteria | 2658 |
| 577 | Ga0075366_10068362 | 3300006195 | Bacteria | 2114 |
| 578 | Ga0075366_10097395 | 3300006195 | Bacteria | 1764 |
| 579 | Ga0075366_10279790 | 3300006195 | Bacteria | 1020 |
| 580 | Ga0075366_10498372 | 3300006195 | Bacteria | 753 |
| 581 | Ga0097621_100028733 | 3300006237 | Bacteria | 4386 |
| 582 | Ga0097621_100049047 | 3300006237 | Bacteria | 3429 |
| 583 | Ga0097621_100272760 | 3300006237 | Bacteria | 1487 |
| 584 | Ga0097621_100358242 | 3300006237 | Bacteria | 1299 |
| 585 | Ga0097621_102080544 | 3300006237 | Bacteria | 543 |
| 586 | Ga0075370_10000321 | 3300006353 | Bacteria | 17276 |
| 587 | Ga0075370_10000552 | 3300006353 | Bacteria | 14338 |
| 588 | Ga0075370_10007347 | 3300006353 | Bacteria | 5607 |
| 589 | Ga0075370_10030291 | 3300006353 | Bacteria | 3018 |
| 590 | Ga0075370_10033069 | 3300006353 | Bacteria | 2893 |
| 591 | Ga0075370_10048234 | 3300006353 | Bacteria | 2413 |
| 592 | Ga0075370_10062810 | 3300006353 | Bacteria | 2117 |
| 593 | Ga0075370_10076731 | 3300006353 | Bacteria | 1917 |
| 594 | Ga0075370_10104865 | 3300006353 | Bacteria | 1638 |
| 595 | Ga0075370_10134495 | 3300006353 | Bacteria | 1444 |
| 596 | Ga0075370_10449126 | 3300006353 | Bacteria | 776 |
| 597 | Ga0075370_10483391 | 3300006353 | Bacteria | 746 |
| 598 | Ga0068871_100104063 | 3300006358 | Bacteria | 2381 |
| 599 | Ga0068871_100186874 | 3300006358 | Bacteria | 1783 |
| 600 | Ga0068871_100205579 | 3300006358 | Bacteria | 1701 |
| 601 | Ga0068871_100317687 | 3300006358 | Bacteria | 1370 |
| 602 | Ga0068871_101231305 | 3300006358 | Bacteria | 703 |
| 603 | Ga0075428_100081367 | 3300006844 | Bacteria | 3534 |
| 604 | Ga0075428_100164917 | 3300006844 | Bacteria | 2404 |
| 605 | Ga0075428_100797818 | 3300006844 | Bacteria | 1004 |
| 606 | Ga0075428_101155925 | 3300006844 | Unclassified | 817 |
| 607 | Ga0075430_100072586 | 3300006846 | Bacteria | 2886 |
| 608 | Ga0075430_100854469 | 3300006846 | Bacteria | 750 |
| 609 | Ga0075431_100021252 | 3300006847 | Bacteria | 6633 |
| 610 | Ga0075431_100646685 | 3300006847 | Bacteria | 1038 |
| 611 | Ga0075431_101111348 | 3300006847 | Unclassified | 755 |
| 612 | Ga0075433_10006318 | 3300006852 | Bacteria | 9360 |
| 613 | Ga0075433_10317467 | 3300006852 | Bacteria | 1379 |
| 614 | Ga0075434_100436550 | 3300006871 | Bacteria | 1330 |
| 615 | Ga0075434_100489892 | 3300006871 | Bacteria | 1250 |
| 616 | Ga0075429_100011000 | 3300006880 | Bacteria | 7829 |
| 617 | Ga0075429_100170206 | 3300006880 | Bacteria | 1908 |
| 618 | Ga0068865_100000212 | 3300006881 | Bacteria | 32489 |
| 619 | Ga0068865_100038165 | 3300006881 | Bacteria | 3249 |
| 620 | Ga0068865_100328907 | 3300006881 | Bacteria | 1232 |
| 621 | Ga0075436_100005000 | 3300006914 | Bacteria | 9107 |
| 622 | Ga0097620_100000162 | 3300006931 | Bacteria | 65033 |
| 623 | Ga0097620_100002269 | 3300006931 | Bacteria | 19505 |
| 624 | Ga0097620_100362395 | 3300006931 | Bacteria | 1545 |
| 625 | Ga0097620_100556807 | 3300006931 | Bacteria | 1241 |
| 626 | Ga0097620_100669344 | 3300006931 | Bacteria | 1129 |
| 627 | Ga0079104_1016558 | 3300006946 | Bacteria | 2151 |
| 628 | Ga0079104_1056291 | 3300006946 | Bacteria | 860 |
| 629 | Ga0079104_1109781 | 3300006946 | Bacteria | 547 |
| 630 | Ga0099826_10195975 | 3300006948 | Bacteria | 1110 |
| 631 | Ga0075435_100036066 | 3300007076 | Bacteria | 3928 |
| 632 | Ga0075435_100039582 | 3300007076 | Bacteria | 3762 |
| 633 | Ga0075435_102023647 | 3300007076 | Bacteria | 506 |
| 634 | Ga0105251_10000534 | 3300009011 | Bacteria | 35913 |
| 635 | Ga0105251_10031794 | 3300009011 | Bacteria | 2637 |
| 636 | Ga0105251_10070853 | 3300009011 | Bacteria | 1623 |
| 637 | Ga0105251_10100684 | 3300009011 | Bacteria | 1321 |
| 638 | Ga0105251_10234748 | 3300009011 | Bacteria | 826 |
| 639 | Ga0105251_10476000 | 3300009011 | Bacteria | 581 |
| 640 | Ga0105250_10012839 | 3300009092 | Bacteria | 3451 |
| 641 | Ga0105250_10031842 | 3300009092 | Bacteria | 2118 |
| 642 | Ga0105250_10055977 | 3300009092 | Bacteria | 1583 |
| 643 | Ga0105250_10056543 | 3300009092 | Bacteria | 1574 |
| 644 | Ga0105250_10204992 | 3300009092 | Bacteria | 832 |
| 645 | Ga0105240_10010783 | 3300009093 | Bacteria | 12808 |
| 646 | Ga0105240_10011600 | 3300009093 | Bacteria | 12261 |
| 647 | Ga0105240_10033337 | 3300009093 | Bacteria | 6655 |
| 648 | Ga0105240_10037140 | 3300009093 | Bacteria | 6261 |
| 649 | Ga0105240_10172559 | 3300009093 | Bacteria | 2559 |
| 650 | Ga0105240_10193654 | 3300009093 | Bacteria | 2389 |
| 651 | Ga0105240_10208565 | 3300009093 | Bacteria | 2285 |
| 652 | Ga0105240_10280501 | 3300009093 | Bacteria | 1914 |
| 653 | Ga0105240_10436407 | 3300009093 | Bacteria | 1468 |
| 654 | Ga0105240_11169015 | 3300009093 | Bacteria | 816 |
| 655 | Ga0105240_11177219 | 3300009093 | Bacteria | 813 |
| 656 | Ga0105240_11846607 | 3300009093 | Bacteria | 629 |
| 657 | Ga0105240_12000063 | 3300009093 | Bacteria | 602 |
| 658 | Ga0111539_10046885 | 3300009094 | Bacteria | 5168 |
| 659 | Ga0111539_10542321 | 3300009094 | Bacteria | 1355 |
| 660 | Ga0111539_10763422 | 3300009094 | Bacteria | 1125 |
| 661 | Ga0111539_11859565 | 3300009094 | Bacteria | 698 |
| 662 | Ga0111539_12061013 | 3300009094 | Bacteria | 662 |
| 663 | Ga0105245_10000107 | 3300009098 | Bacteria | 80101 |
| 664 | Ga0105245_10000318 | 3300009098 | Bacteria | 45618 |
| 665 | Ga0105245_10004915 | 3300009098 | Bacteria | 11760 |
| 666 | Ga0105245_10158902 | 3300009098 | Bacteria | 2143 |
| 667 | Ga0105245_10208349 | 3300009098 | Bacteria | 1881 |
| 668 | Ga0105245_10508226 | 3300009098 | Bacteria | 1222 |
| 669 | Ga0105245_12234787 | 3300009098 | Bacteria | 601 |
| 670 | Ga0105247_10000925 | 3300009101 | Bacteria | 22094 |
| 671 | Ga0105247_10001548 | 3300009101 | Bacteria | 16396 |
| 672 | Ga0105247_10001892 | 3300009101 | Bacteria | 14614 |
| 673 | Ga0105247_10024382 | 3300009101 | Bacteria | 3645 |
| 674 | Ga0105247_10089889 | 3300009101 | Bacteria | 1948 |
| 675 | Ga0105247_10150437 | 3300009101 | Bacteria | 1533 |
| 676 | Ga0105247_10425180 | 3300009101 | Bacteria | 952 |
| 677 | Ga0114129_10269746 | 3300009147 | Bacteria | 2277 |
| 678 | Ga0114129_10278187 | 3300009147 | Bacteria | 2237 |
| 679 | Ga0114129_12775333 | 3300009147 | Bacteria | 583 |
| 680 | Ga0114129_12775800 | 3300009147 | Bacteria | 583 |
| 681 | Ga0105243_10000944 | 3300009148 | Bacteria | 27244 |
| 682 | Ga0105243_10001886 | 3300009148 | Bacteria | 17865 |
| 683 | Ga0105243_10022283 | 3300009148 | Bacteria | 4813 |
| 684 | Ga0105243_10194387 | 3300009148 | Bacteria | 1775 |
| 685 | Ga0105243_10428990 | 3300009148 | Bacteria | 1235 |
| 686 | Ga0105243_10440144 | 3300009148 | Bacteria | 1220 |
| 687 | Ga0105243_12506502 | 3300009148 | Bacteria | 555 |
| 688 | Ga0105241_10002673 | 3300009174 | Bacteria | 13358 |
| 689 | Ga0105241_10029901 | 3300009174 | Bacteria | 4067 |
| 690 | Ga0105241_10123227 | 3300009174 | Bacteria | 2090 |
| 691 | Ga0105241_10406239 | 3300009174 | Bacteria | 1196 |
| 692 | Ga0105241_10831370 | 3300009174 | Bacteria | 853 |
| 693 | Ga0105241_10840621 | 3300009174 | Bacteria | 848 |
| 694 | Ga0105241_11549111 | 3300009174 | Bacteria | 639 |
| 695 | Ga0105241_12068996 | 3300009174 | Bacteria | 562 |
| 696 | Ga0105241_12107003 | 3300009174 | Bacteria | 557 |
| 697 | Ga0105242_10030348 | 3300009176 | Bacteria | 4316 |
| 698 | Ga0105242_10096840 | 3300009176 | Bacteria | 2494 |
| 699 | Ga0105242_10102404 | 3300009176 | Bacteria | 2428 |
| 700 | Ga0105242_10155865 | 3300009176 | Bacteria | 1995 |
| 701 | Ga0105242_10177452 | 3300009176 | Bacteria | 1877 |
| 702 | Ga0105242_10205409 | 3300009176 | Bacteria | 1752 |
| 703 | Ga0105248_10010654 | 3300009177 | Bacteria | 10141 |
| 704 | Ga0105248_10014164 | 3300009177 | Bacteria | 8779 |
| 705 | Ga0105248_10040085 | 3300009177 | Bacteria | 5249 |
| 706 | Ga0105248_10115172 | 3300009177 | Bacteria | 3032 |
| 707 | Ga0105248_10210904 | 3300009177 | Bacteria | 2188 |
| 708 | Ga0105248_10251683 | 3300009177 | Bacteria | 1988 |
| 709 | Ga0105248_10372767 | 3300009177 | Bacteria | 1607 |
| 710 | Ga0105248_10411651 | 3300009177 | Bacteria | 1522 |
| 711 | Ga0105248_10427522 | 3300009177 | Bacteria | 1491 |
| 712 | Ga0105248_10570189 | 3300009177 | Bacteria | 1277 |
| 713 | Ga0105248_10577791 | 3300009177 | Bacteria | 1268 |
| 714 | Ga0105248_10694502 | 3300009177 | Bacteria | 1148 |
| 715 | Ga0105248_11441774 | 3300009177 | Bacteria | 779 |
| 716 | Ga0105248_12202955 | 3300009177 | Bacteria | 627 |
| 717 | Ga0105237_10276377 | 3300009545 | Bacteria | 1682 |
| 718 | Ga0105237_10321660 | 3300009545 | Bacteria | 1551 |
| 719 | Ga0105237_10497074 | 3300009545 | Bacteria | 1226 |
| 720 | Ga0105237_10531298 | 3300009545 | Bacteria | 1183 |
| 721 | Ga0105237_10555384 | 3300009545 | Bacteria | 1155 |
| 722 | Ga0105237_11116429 | 3300009545 | Bacteria | 795 |
| 723 | Ga0105238_10003956 | 3300009551 | Bacteria | 14705 |
| 724 | Ga0105238_10069194 | 3300009551 | Bacteria | 3530 |
| 725 | Ga0105238_10681721 | 3300009551 | Bacteria | 1039 |
| 726 | Ga0105238_10714458 | 3300009551 | Bacteria | 1014 |
| 727 | Ga0105238_11153412 | 3300009551 | Bacteria | 798 |
| 728 | Ga0105238_11168907 | 3300009551 | Bacteria | 793 |
| 729 | Ga0105238_11385148 | 3300009551 | Bacteria | 730 |
| 730 | Ga0105238_11992100 | 3300009551 | Bacteria | 614 |
| 731 | Ga0105249_10001629 | 3300009553 | Bacteria | 19666 |
| 732 | Ga0105249_10002562 | 3300009553 | Bacteria | 15732 |
| 733 | Ga0105249_10035761 | 3300009553 | Bacteria | 4504 |
| 734 | Ga0105249_10054363 | 3300009553 | Bacteria | 3661 |
| 735 | Ga0105249_10295522 | 3300009553 | Bacteria | 1623 |
| 736 | Ga0105249_10316735 | 3300009553 | Bacteria | 1570 |
| 737 | Ga0105249_12278545 | 3300009553 | Bacteria | 614 |
| 738 | Ga0105249_12456644 | 3300009553 | Bacteria | 594 |
| 739 | Ga0105239_10002915 | 3300010375 | Bacteria | 21370 |
| 740 | Ga0105239_10031698 | 3300010375 | Bacteria | 5809 |
| 741 | Ga0105239_10059516 | 3300010375 | Bacteria | 4192 |
| 742 | Ga0105239_10141412 | 3300010375 | Bacteria | 2682 |
| 743 | Ga0105239_10561942 | 3300010375 | Bacteria | 1300 |
| 744 | Ga0105239_10903803 | 3300010375 | Bacteria | 1013 |
| 745 | Ga0105239_11128643 | 3300010375 | Bacteria | 903 |
| 746 | Ga0105239_12306236 | 3300010375 | Bacteria | 626 |
| 747 | Ga0105246_10001471 | 3300011119 | Bacteria | 13986 |
| 748 | Ga0105246_10004041 | 3300011119 | Bacteria | 8911 |
| 749 | Ga0105246_10427618 | 3300011119 | Bacteria | 1107 |
| 750 | Ga0105246_10624096 | 3300011119 | Bacteria | 935 |
| 751 | Ga0105246_11081648 | 3300011119 | Bacteria | 731 |
| 752 | Ga0105246_11296518 | 3300011119 | Bacteria | 675 |
| 753 | Ga0157322_1020236 | 3300012490 | Bacteria | 635 |
| 754 | Ga0157347_1013462 | 3300012502 | Bacteria | 894 |
| 755 | Ga0157327_1020044 | 3300012512 | Bacteria | 746 |
| 756 | Ga0157326_1028903 | 3300012513 | Bacteria | 724 |
| 757 | Ga0157373_10005865 | 3300013100 | Bacteria | 9190 |
| 758 | Ga0157373_10008328 | 3300013100 | Bacteria | 7704 |
| 759 | Ga0157373_10024910 | 3300013100 | Bacteria | 4332 |
| 760 | Ga0157373_10098658 | 3300013100 | Bacteria | 2056 |
| 761 | Ga0157373_10160202 | 3300013100 | Bacteria | 1583 |
| 762 | Ga0157373_10185021 | 3300013100 | Bacteria | 1467 |
| 763 | Ga0157373_10245679 | 3300013100 | Bacteria | 1265 |
| 764 | Ga0157373_10383688 | 3300013100 | Bacteria | 1005 |
| 765 | Ga0157373_10532665 | 3300013100 | Bacteria | 850 |
| 766 | Ga0157373_10736905 | 3300013100 | Bacteria | 724 |
| 767 | Ga0157371_10000062 | 3300013102 | Bacteria | 169669 |
| 768 | Ga0157371_10003718 | 3300013102 | Bacteria | 13677 |
| 769 | Ga0157371_10008946 | 3300013102 | Bacteria | 7925 |
| 770 | Ga0157371_10036317 | 3300013102 | Bacteria | 3529 |
| 771 | Ga0157371_10045817 | 3300013102 | Bacteria | 3111 |
| 772 | Ga0157371_10097128 | 3300013102 | Bacteria | 2088 |
| 773 | Ga0157371_10154772 | 3300013102 | Bacteria | 1636 |
| 774 | Ga0157371_10227238 | 3300013102 | Bacteria | 1341 |
| 775 | Ga0157371_10247635 | 3300013102 | Bacteria | 1283 |
| 776 | Ga0157371_10256002 | 3300013102 | Bacteria | 1261 |
| 777 | Ga0157371_10363897 | 3300013102 | Bacteria | 1054 |
| 778 | Ga0157371_10365486 | 3300013102 | Bacteria | 1052 |
| 779 | Ga0157371_11184456 | 3300013102 | Bacteria | 588 |
| 780 | Ga0157370_10003643 | 3300013104 | Bacteria | 18008 |
| 781 | Ga0157370_10043858 | 3300013104 | Bacteria | 4302 |
| 782 | Ga0157370_10140416 | 3300013104 | Bacteria | 2251 |
| 783 | Ga0157370_10187429 | 3300013104 | Bacteria | 1920 |
| 784 | Ga0157370_10282834 | 3300013104 | Bacteria | 1532 |
| 785 | Ga0157370_10283619 | 3300013104 | Bacteria | 1530 |
| 786 | Ga0157370_10484582 | 3300013104 | Bacteria | 1136 |
| 787 | Ga0157370_10525805 | 3300013104 | Bacteria | 1085 |
| 788 | Ga0157370_10650499 | 3300013104 | Bacteria | 963 |
| 789 | Ga0157370_10683278 | 3300013104 | Bacteria | 937 |
| 790 | Ga0157370_11051939 | 3300013104 | Bacteria | 736 |
| 791 | Ga0157370_11523973 | 3300013104 | Bacteria | 601 |
| 792 | Ga0157369_10000043 | 3300013105 | Bacteria | 180713 |
| 793 | Ga0157369_10001048 | 3300013105 | Bacteria | 34926 |
| 794 | Ga0157369_10011006 | 3300013105 | Bacteria | 10295 |
| 795 | Ga0157369_10047977 | 3300013105 | Bacteria | 4635 |
| 796 | Ga0157369_10105295 | 3300013105 | Bacteria | 3003 |
| 797 | Ga0157369_10130301 | 3300013105 | Bacteria | 2666 |
| 798 | Ga0157369_10259506 | 3300013105 | Bacteria | 1812 |
| 799 | Ga0157369_10646473 | 3300013105 | Bacteria | 1091 |
| 800 | Ga0157369_10736481 | 3300013105 | Bacteria | 1014 |
| 801 | Ga0157369_10737756 | 3300013105 | Bacteria | 1014 |
| 802 | Ga0157369_11052570 | 3300013105 | Bacteria | 832 |
| 803 | Ga0157369_11755479 | 3300013105 | Bacteria | 630 |
| 804 | Ga0157369_12662165 | 3300013105 | Bacteria | 504 |
| 805 | Ga0157374_10004151 | 3300013296 | Bacteria | 12161 |
| 806 | Ga0157374_10008229 | 3300013296 | Bacteria | 8910 |
| 807 | Ga0157374_10077068 | 3300013296 | Bacteria | 3154 |
| 808 | Ga0157374_10155442 | 3300013296 | Bacteria | 2225 |
| 809 | Ga0157374_10245465 | 3300013296 | Bacteria | 1761 |
| 810 | Ga0157378_10012986 | 3300013297 | Bacteria | 7285 |
| 811 | Ga0157378_10015354 | 3300013297 | Bacteria | 6707 |
| 812 | Ga0157378_10105700 | 3300013297 | Bacteria | 2574 |
| 813 | Ga0157378_10106116 | 3300013297 | Bacteria | 2569 |
| 814 | Ga0157378_10648012 | 3300013297 | Bacteria | 1072 |
| 815 | Ga0157378_11337921 | 3300013297 | Bacteria | 758 |
| 816 | Ga0157378_13243432 | 3300013297 | Bacteria | 505 |
| 817 | Ga0163162_10000823 | 3300013306 | Bacteria | 28858 |
| 818 | Ga0163162_10006344 | 3300013306 | Bacteria | 11451 |
| 819 | Ga0163162_10007216 | 3300013306 | Bacteria | 10788 |
| 820 | Ga0163162_10023724 | 3300013306 | Bacteria | 6054 |
| 821 | Ga0163162_10111614 | 3300013306 | Bacteria | 2832 |
| 822 | Ga0163162_10146476 | 3300013306 | Bacteria | 2478 |
| 823 | Ga0163162_10267452 | 3300013306 | Bacteria | 1841 |
| 824 | Ga0163162_10331280 | 3300013306 | Bacteria | 1655 |
| 825 | Ga0163162_10572536 | 3300013306 | Bacteria | 1257 |
| 826 | Ga0163162_10939429 | 3300013306 | Bacteria | 976 |
| 827 | Ga0163162_11336930 | 3300013306 | Bacteria | 815 |
| 828 | Ga0163162_11633696 | 3300013306 | Bacteria | 735 |
| 829 | Ga0163162_12003456 | 3300013306 | Bacteria | 663 |
| 830 | Ga0163162_12172311 | 3300013306 | Bacteria | 637 |
| 831 | Ga0163162_13197198 | 3300013306 | Bacteria | 526 |
| 832 | Ga0157372_10002837 | 3300013307 | Bacteria | 18732 |
| 833 | Ga0157372_10025453 | 3300013307 | Bacteria | 6434 |
| 834 | Ga0157372_10039997 | 3300013307 | Bacteria | 5178 |
| 835 | Ga0157372_10141581 | 3300013307 | Bacteria | 2771 |
| 836 | Ga0157372_10415389 | 3300013307 | Bacteria | 1568 |
| 837 | Ga0157372_10778361 | 3300013307 | Bacteria | 1112 |
| 838 | Ga0157372_10919623 | 3300013307 | Bacteria | 1014 |
| 839 | Ga0157372_11166798 | 3300013307 | Bacteria | 890 |
| 840 | Ga0157375_10001015 | 3300013308 | Bacteria | 24304 |
| 841 | Ga0157375_10106173 | 3300013308 | Bacteria | 2900 |
| 842 | Ga0157375_10114281 | 3300013308 | Bacteria | 2801 |
| 843 | Ga0157375_10242307 | 3300013308 | Bacteria | 1963 |
| 844 | Ga0157375_10262279 | 3300013308 | Bacteria | 1889 |
| 845 | Ga0157375_10269885 | 3300013308 | Bacteria | 1863 |
| 846 | Ga0157375_10314419 | 3300013308 | Bacteria | 1731 |
| 847 | Ga0157375_10721260 | 3300013308 | Bacteria | 1150 |
| 848 | Ga0157375_11235593 | 3300013308 | Bacteria | 877 |
| 849 | Ga0157375_11363990 | 3300013308 | Bacteria | 835 |
| 850 | Ga0163163_10004874 | 3300014325 | Bacteria | 11536 |
| 851 | Ga0163163_10095231 | 3300014325 | Bacteria | 2997 |
| 852 | Ga0163163_10098327 | 3300014325 | Bacteria | 2947 |
| 853 | Ga0163163_10411813 | 3300014325 | Bacteria | 1410 |
| 854 | Ga0163163_10422424 | 3300014325 | Bacteria | 1392 |
| 855 | Ga0163163_10727617 | 3300014325 | Bacteria | 1056 |
| 856 | Ga0163163_10936956 | 3300014325 | Bacteria | 929 |
| 857 | Ga0163163_11212785 | 3300014325 | Bacteria | 817 |
| 858 | Ga0163163_11817517 | 3300014325 | Bacteria | 670 |
| 859 | Ga0163163_12792931 | 3300014325 | Bacteria | 545 |
| 860 | Ga0157380_10016517 | 3300014326 | Bacteria | 5444 |
| 861 | Ga0157380_10039666 | 3300014326 | Bacteria | 3664 |
| 862 | Ga0157380_10101524 | 3300014326 | Bacteria | 2397 |
| 863 | Ga0157380_10270474 | 3300014326 | Bacteria | 1549 |
| 864 | Ga0157380_10785256 | 3300014326 | Bacteria | 968 |
| 865 | Ga0157380_10830803 | 3300014326 | Bacteria | 944 |
| 866 | Ga0157380_11081820 | 3300014326 | Bacteria | 840 |
| 867 | Ga0182008_10034454 | 3300014497 | Bacteria | 2538 |
| 868 | Ga0182008_10265103 | 3300014497 | Bacteria | 889 |
| 869 | Ga0182008_10292256 | 3300014497 | Bacteria | 851 |
| 870 | Ga0157377_10001125 | 3300014745 | Bacteria | 11329 |
| 871 | Ga0157377_10019427 | 3300014745 | Bacteria | 3550 |
| 872 | Ga0157377_11527519 | 3300014745 | Bacteria | 532 |
| 873 | Ga0157379_10008925 | 3300014968 | Bacteria | 8742 |
| 874 | Ga0157379_10010069 | 3300014968 | Bacteria | 8240 |
| 875 | Ga0157379_10500846 | 3300014968 | Bacteria | 1126 |
| 876 | Ga0157379_10755116 | 3300014968 | Bacteria | 916 |
| 877 | Ga0157379_11463918 | 3300014968 | Bacteria | 663 |
| 878 | Ga0157376_10001406 | 3300014969 | Bacteria | 15824 |
| 879 | Ga0157376_10025105 | 3300014969 | Bacteria | 4690 |
| 880 | Ga0157376_10040093 | 3300014969 | Bacteria | 3825 |
| 881 | Ga0157376_11372001 | 3300014969 | Bacteria | 738 |
| 882 | Ga0157376_12417710 | 3300014969 | Bacteria | 565 |
| 883 | Ga0183363_1010 | 3300015690 | Bacteria | 108191 |
| 884 | Ga0163161_10003384 | 3300017792 | Bacteria | 11194 |
| 885 | Ga0163161_10006732 | 3300017792 | Bacteria | 7945 |
| 886 | Ga0163161_10009585 | 3300017792 | Bacteria | 6695 |
| 887 | Ga0163161_10228318 | 3300017792 | Bacteria | 1444 |
| 888 | Ga0163161_10485376 | 3300017792 | Bacteria | 1004 |
| 889 | Ga0163161_10599458 | 3300017792 | Bacteria | 908 |
| 890 | Ga0163161_10671694 | 3300017792 | Bacteria | 860 |
| 891 | Ga0163161_10866013 | 3300017792 | Bacteria | 763 |
| 892 | Ga0163161_11106532 | 3300017792 | Bacteria | 681 |
| 893 | Ga0163161_11184614 | 3300017792 | Bacteria | 660 |
| 894 | Ga0163161_11619609 | 3300017792 | Bacteria | 571 |
| 895 | Ga0184598_117135 | 3300019182 | Bacteria | 828 |
| 896 | Ga0206356_10714324 | 3300020070 | Bacteria | 727 |
| 897 | Ga0206356_11133344 | 3300020070 | Bacteria | 951 |
| 898 | Ga0206355_1484588 | 3300020076 | Bacteria | 584 |
| 899 | Ga0206351_10987137 | 3300020077 | Bacteria | 676 |
| 900 | Ga0206352_10149205 | 3300020078 | Bacteria | 676 |
| 901 | Ga0206354_10229996 | 3300020081 | Bacteria | 1213 |
| 902 | Ga0206354_11017406 | 3300020081 | Bacteria | 729 |
| 903 | Ga0154015_1061162 | 3300020610 | Bacteria | 689 |
| 904 | Ga0213873_10032494 | 3300021358 | Bacteria | 1304 |
| 905 | Ga0213872_10334032 | 3300021361 | Bacteria | 624 |
| 906 | Ga0213874_10044093 | 3300021377 | Bacteria | 1346 |
| 907 | Ga0213874_10380212 | 3300021377 | Bacteria | 546 |
| 908 | Ga0213876_10000232 | 3300021384 | Bacteria | 54674 |
| 909 | Ga0213876_10021404 | 3300021384 | Bacteria | 3419 |
| 910 | Ga0213876_10562904 | 3300021384 | Bacteria | 606 |
| 911 | Ga0213871_10061314 | 3300021441 | Bacteria | 1048 |
| 912 | Ga0224712_10176773 | 3300022467 | Bacteria | 960 |
| 913 | Ga0224712_10306085 | 3300022467 | Bacteria | 744 |
| 914 | Ga0209147_101180 | 3300025229 | Bacteria | 10615 |
| 915 | Ga0209437_100050 | 3300025233 | Bacteria | 394010 |
| 916 | Ga0207425_1000005 | 3300025245 | Bacteria | 900502 |
| 917 | Ga0209026_1007893 | 3300025250 | Bacteria | 2305 |
| 918 | Ga0209129_1001455 | 3300025258 | Bacteria | 13206 |
| 919 | Ga0209233_1000037 | 3300025261 | Bacteria | 554620 |
| 920 | Ga0209565_1000007 | 3300025263 | Bacteria | 784361 |
| 921 | Ga0209565_1000850 | 3300025263 | Bacteria | 17233 |
| 922 | Ga0209455_1005872 | 3300025272 | Bacteria | 3714 |
| 923 | Ga0209455_1024602 | 3300025272 | Bacteria | 1109 |
| 924 | Ga0209455_1025055 | 3300025272 | Bacteria | 1092 |
| 925 | Ga0209673_1007333 | 3300025273 | Bacteria | 5109 |
| 926 | Ga0209673_1008711 | 3300025273 | Bacteria | 4485 |
| 927 | Ga0207673_1001765 | 3300025290 | Bacteria | 2399 |
| 928 | Ga0209675_1000169 | 3300025291 | Bacteria | 78355 |
| 929 | Ga0209675_1016124 | 3300025291 | Bacteria | 2188 |
| 930 | Ga0209676_1000256 | 3300025292 | Bacteria | 112819 |
| 931 | Ga0209676_1000651 | 3300025292 | Bacteria | 49756 |
| 932 | Ga0209676_1000807 | 3300025292 | Bacteria | 41068 |
| 933 | Ga0209676_1001585 | 3300025292 | Bacteria | 20263 |
| 934 | Ga0209676_1012139 | 3300025292 | Bacteria | 3414 |
| 935 | Ga0209676_1022177 | 3300025292 | Bacteria | 2110 |
| 936 | Ga0209025_1000477 | 3300025294 | Bacteria | 77692 |
| 937 | Ga0209025_1016458 | 3300025294 | Bacteria | 4361 |
| 938 | Ga0209025_1035205 | 3300025294 | Bacteria | 2267 |
| 939 | Ga0209564_1001268 | 3300025295 | Bacteria | 27785 |
| 940 | Ga0209758_1000002 | 3300025297 | Bacteria | 1400310 |
| 941 | Ga0209758_1020798 | 3300025297 | Bacteria | 3087 |
| 942 | Ga0209758_1073008 | 3300025297 | Bacteria | 1071 |
| 943 | Ga0209050_1000001 | 3300025298 | Bacteria | 3563507 |
| 944 | Ga0209050_1000071 | 3300025298 | Bacteria | 295478 |
| 945 | Ga0209050_1000213 | 3300025298 | Bacteria | 129359 |
| 946 | Ga0209050_1000310 | 3300025298 | Bacteria | 99292 |
| 947 | Ga0209050_1000937 | 3300025298 | Bacteria | 38116 |
| 948 | Ga0209050_1012711 | 3300025298 | Bacteria | 3828 |
| 949 | Ga0209050_1022136 | 3300025298 | Bacteria | 2288 |
| 950 | Ga0209050_1023898 | 3300025298 | Bacteria | 2133 |
| 951 | Ga0209050_1027937 | 3300025298 | Bacteria | 1844 |
| 952 | Ga0209256_1000008 | 3300025299 | Bacteria | 975723 |
| 953 | Ga0209051_1001344 | 3300025303 | Bacteria | 21373 |
| 954 | Ga0209257_1000027 | 3300025304 | Bacteria | 703541 |
| 955 | Ga0209257_1000113 | 3300025304 | Bacteria | 233523 |
| 956 | Ga0209257_1000379 | 3300025304 | Bacteria | 88845 |
| 957 | Ga0209257_1002330 | 3300025304 | Bacteria | 19148 |
| 958 | Ga0209257_1002535 | 3300025304 | Bacteria | 17892 |
| 959 | Ga0209257_1008172 | 3300025304 | Bacteria | 6056 |
| 960 | Ga0209257_1073908 | 3300025304 | Bacteria | 891 |
| 961 | Ga0207697_10003130 | 3300025315 | Bacteria | 8262 |
| 962 | Ga0207697_10049627 | 3300025315 | Bacteria | 1733 |
| 963 | Ga0207697_10495982 | 3300025315 | Bacteria | 539 |
| 964 | Ga0207656_10015606 | 3300025321 | Bacteria | 2942 |
| 965 | Ga0207656_10053971 | 3300025321 | Bacteria | 1746 |
| 966 | Ga0207696_1009621 | 3300025711 | Bacteria | 3595 |
| 967 | Ga0207696_1032104 | 3300025711 | Bacteria | 1583 |
| 968 | Ga0207696_1181536 | 3300025711 | Bacteria | 556 |
| 969 | Ga0207696_1182462 | 3300025711 | Bacteria | 554 |
| 970 | Ga0207713_1002133 | 3300025735 | Bacteria | 14743 |
| 971 | Ga0207713_1027808 | 3300025735 | Bacteria | 2561 |
| 972 | Ga0207653_10009975 | 3300025885 | Bacteria | 2962 |
| 973 | Ga0207682_10489826 | 3300025893 | Bacteria | 582 |
| 974 | Ga0207692_10498065 | 3300025898 | Bacteria | 773 |
| 975 | Ga0207642_10023025 | 3300025899 | Bacteria | 2482 |
| 976 | Ga0207642_11127734 | 3300025899 | Bacteria | 508 |
| 977 | Ga0207710_10001500 | 3300025900 | Bacteria | 11557 |
| 978 | Ga0207710_10009894 | 3300025900 | Bacteria | 4008 |
| 979 | Ga0207710_10052376 | 3300025900 | Bacteria | 1835 |
| 980 | Ga0207710_10087066 | 3300025900 | Bacteria | 1456 |
| 981 | Ga0207710_10186876 | 3300025900 | Bacteria | 1019 |
| 982 | Ga0207710_10353504 | 3300025900 | Bacteria | 749 |
| 983 | Ga0207710_10611203 | 3300025900 | Bacteria | 570 |
| 984 | Ga0207688_10000228 | 3300025901 | Bacteria | 25406 |
| 985 | Ga0207688_10306066 | 3300025901 | Bacteria | 972 |
| 986 | Ga0207680_10003876 | 3300025903 | Bacteria | 7053 |
| 987 | Ga0207680_10015591 | 3300025903 | Bacteria | 3970 |
| 988 | Ga0207680_10034344 | 3300025903 | Bacteria | 2901 |
| 989 | Ga0207680_10266087 | 3300025903 | Bacteria | 1188 |
| 990 | Ga0207680_11061657 | 3300025903 | Bacteria | 579 |
| 991 | Ga0207647_10015010 | 3300025904 | Bacteria | 5325 |
| 992 | Ga0207647_10074284 | 3300025904 | Bacteria | 2048 |
| 993 | Ga0207647_10188502 | 3300025904 | Bacteria | 1196 |
| 994 | Ga0207647_10257697 | 3300025904 | Bacteria | 999 |
| 995 | Ga0207685_10022529 | 3300025905 | Bacteria | 2131 |
| 996 | Ga0207699_10006725 | 3300025906 | Bacteria | 5582 |
| 997 | Ga0207645_10005056 | 3300025907 | Bacteria | 9664 |
| 998 | Ga0207645_10157581 | 3300025907 | Bacteria | 1484 |
| 999 | Ga0207645_10491243 | 3300025907 | Bacteria | 831 |
| 1000 | Ga0207643_10562209 | 3300025908 | Bacteria | 732 |
| 1001 | Ga0207705_10000033 | 3300025909 | Bacteria | 223997 |
| 1002 | Ga0207705_10000037 | 3300025909 | Bacteria | 197951 |
| 1003 | Ga0207705_10001756 | 3300025909 | Bacteria | 17138 |
| 1004 | Ga0207705_10101733 | 3300025909 | Bacteria | 2114 |
| 1005 | Ga0207705_10198026 | 3300025909 | Bacteria | 1521 |
| 1006 | Ga0207705_10257550 | 3300025909 | Bacteria | 1332 |
| 1007 | Ga0207705_10286787 | 3300025909 | Bacteria | 1261 |
| 1008 | Ga0207705_10305783 | 3300025909 | Bacteria | 1220 |
| 1009 | Ga0207705_10372330 | 3300025909 | Bacteria | 1103 |
| 1010 | Ga0207705_10515727 | 3300025909 | Bacteria | 929 |
| 1011 | Ga0207684_11523488 | 3300025910 | Bacteria | 543 |
| 1012 | Ga0207684_11701422 | 3300025910 | Bacteria | 508 |
| 1013 | Ga0207654_10205025 | 3300025911 | Bacteria | 1301 |
| 1014 | Ga0207654_10403323 | 3300025911 | Bacteria | 951 |
| 1015 | Ga0207654_10565528 | 3300025911 | Bacteria | 809 |
| 1016 | Ga0207654_10949379 | 3300025911 | Bacteria | 624 |
| 1017 | Ga0207707_10032620 | 3300025912 | Bacteria | 4558 |
| 1018 | Ga0207707_10093782 | 3300025912 | Bacteria | 2622 |
| 1019 | Ga0207707_10229056 | 3300025912 | Bacteria | 1617 |
| 1020 | Ga0207707_10431688 | 3300025912 | Bacteria | 1128 |
| 1021 | Ga0207707_11558563 | 3300025912 | Bacteria | 522 |
| 1022 | Ga0207695_10001285 | 3300025913 | Bacteria | 42674 |
| 1023 | Ga0207695_10002063 | 3300025913 | Bacteria | 30645 |
| 1024 | Ga0207695_10003382 | 3300025913 | Bacteria | 22540 |
| 1025 | Ga0207695_10041989 | 3300025913 | Bacteria | 4890 |
| 1026 | Ga0207695_10063442 | 3300025913 | Bacteria | 3809 |
| 1027 | Ga0207695_10090796 | 3300025913 | Bacteria | 3069 |
| 1028 | Ga0207695_10114464 | 3300025913 | Bacteria | 2672 |
| 1029 | Ga0207695_10229651 | 3300025913 | Bacteria | 1761 |
| 1030 | Ga0207695_10271816 | 3300025913 | Bacteria | 1590 |
| 1031 | Ga0207695_10425775 | 3300025913 | Bacteria | 1211 |
| 1032 | Ga0207695_11008826 | 3300025913 | Bacteria | 712 |
| 1033 | Ga0207671_10022726 | 3300025914 | Bacteria | 4738 |
| 1034 | Ga0207671_10123662 | 3300025914 | Bacteria | 1979 |
| 1035 | Ga0207693_10000892 | 3300025915 | Bacteria | 26789 |
| 1036 | Ga0207693_10190416 | 3300025915 | Bacteria | 1614 |
| 1037 | Ga0207693_10702145 | 3300025915 | Bacteria | 783 |
| 1038 | Ga0207693_10905594 | 3300025915 | Bacteria | 677 |
| 1039 | Ga0207693_11129049 | 3300025915 | Bacteria | 594 |
| 1040 | Ga0207663_10000847 | 3300025916 | Bacteria | 13892 |
| 1041 | Ga0207663_10311044 | 3300025916 | Bacteria | 1181 |
| 1042 | Ga0207663_10582076 | 3300025916 | Bacteria | 878 |
| 1043 | Ga0207663_11241778 | 3300025916 | Bacteria | 600 |
| 1044 | Ga0207660_10016689 | 3300025917 | Bacteria | 4866 |
| 1045 | Ga0207660_10019569 | 3300025917 | Bacteria | 4526 |
| 1046 | Ga0207660_10126937 | 3300025917 | Bacteria | 1938 |
| 1047 | Ga0207660_10263836 | 3300025917 | Bacteria | 1363 |
| 1048 | Ga0207660_10470764 | 3300025917 | Bacteria | 1017 |
| 1049 | Ga0207660_10939625 | 3300025917 | Bacteria | 706 |
| 1050 | Ga0207660_10959431 | 3300025917 | Bacteria | 698 |
| 1051 | Ga0207662_10025150 | 3300025918 | Bacteria | 3428 |
| 1052 | Ga0207657_10000227 | 3300025919 | Bacteria | 58998 |
| 1053 | Ga0207657_10000695 | 3300025919 | Bacteria | 35770 |
| 1054 | Ga0207657_10001202 | 3300025919 | Bacteria | 27550 |
| 1055 | Ga0207657_10053790 | 3300025919 | Bacteria | 3485 |
| 1056 | Ga0207657_10167794 | 3300025919 | Bacteria | 1780 |
| 1057 | Ga0207657_10309432 | 3300025919 | Bacteria | 1251 |
| 1058 | Ga0207649_10001202 | 3300025920 | Bacteria | 15623 |
| 1059 | Ga0207649_10002320 | 3300025920 | Bacteria | 10689 |
| 1060 | Ga0207649_10012168 | 3300025920 | Bacteria | 4764 |
| 1061 | Ga0207649_10187528 | 3300025920 | Bacteria | 1452 |
| 1062 | Ga0207649_10921635 | 3300025920 | Bacteria | 686 |
| 1063 | Ga0207649_11334309 | 3300025920 | Bacteria | 567 |
| 1064 | Ga0207652_10000474 | 3300025921 | Bacteria | 41182 |
| 1065 | Ga0207652_10003357 | 3300025921 | Bacteria | 13223 |
| 1066 | Ga0207652_10078695 | 3300025921 | Bacteria | 2879 |
| 1067 | Ga0207652_10421608 | 3300025921 | Bacteria | 1204 |
| 1068 | Ga0207652_10571168 | 3300025921 | Bacteria | 1015 |
| 1069 | Ga0207681_10000030 | 3300025923 | Bacteria | 173766 |
| 1070 | Ga0207681_10000120 | 3300025923 | Bacteria | 66235 |
| 1071 | Ga0207681_10000188 | 3300025923 | Bacteria | 50361 |
| 1072 | Ga0207681_10000261 | 3300025923 | Bacteria | 40384 |
| 1073 | Ga0207681_10015620 | 3300025923 | Bacteria | 4737 |
| 1074 | Ga0207681_10116214 | 3300025923 | Bacteria | 1954 |
| 1075 | Ga0207681_10121656 | 3300025923 | Bacteria | 1915 |
| 1076 | Ga0207681_10188480 | 3300025923 | Bacteria | 1576 |
| 1077 | Ga0207681_10191146 | 3300025923 | Bacteria | 1566 |
| 1078 | Ga0207681_10701429 | 3300025923 | Bacteria | 841 |
| 1079 | Ga0207681_10753446 | 3300025923 | Bacteria | 812 |
| 1080 | Ga0207694_10032047 | 3300025924 | Bacteria | 4021 |
| 1081 | Ga0207694_10205261 | 3300025924 | Bacteria | 1604 |
| 1082 | Ga0207694_10756678 | 3300025924 | Bacteria | 820 |
| 1083 | Ga0207694_11085333 | 3300025924 | Bacteria | 677 |
| 1084 | Ga0207694_11687627 | 3300025924 | Bacteria | 533 |
| 1085 | Ga0207650_10007097 | 3300025925 | Bacteria | 7630 |
| 1086 | Ga0207650_10022682 | 3300025925 | Bacteria | 4446 |
| 1087 | Ga0207650_10034458 | 3300025925 | Bacteria | 3672 |
| 1088 | Ga0207650_10091393 | 3300025925 | Bacteria | 2326 |
| 1089 | Ga0207650_10165351 | 3300025925 | Bacteria | 1755 |
| 1090 | Ga0207650_10293222 | 3300025925 | Bacteria | 1327 |
| 1091 | Ga0207650_10330158 | 3300025925 | Bacteria | 1251 |
| 1092 | Ga0207650_10503856 | 3300025925 | Bacteria | 1012 |
| 1093 | Ga0207659_10007934 | 3300025926 | Bacteria | 6565 |
| 1094 | Ga0207659_10037022 | 3300025926 | Bacteria | 3385 |
| 1095 | Ga0207659_11366318 | 3300025926 | Bacteria | 608 |
| 1096 | Ga0207687_10000239 | 3300025927 | Bacteria | 37602 |
| 1097 | Ga0207687_10000398 | 3300025927 | Bacteria | 29475 |
| 1098 | Ga0207687_10021033 | 3300025927 | Bacteria | 4332 |
| 1099 | Ga0207687_10032848 | 3300025927 | Bacteria | 3517 |
| 1100 | Ga0207687_10053051 | 3300025927 | Bacteria | 2831 |
| 1101 | Ga0207687_10109163 | 3300025927 | Bacteria | 2050 |
| 1102 | Ga0207687_11230628 | 3300025927 | Bacteria | 643 |
| 1103 | Ga0207700_10391087 | 3300025928 | Bacteria | 1217 |
| 1104 | Ga0207664_10033627 | 3300025929 | Bacteria | 3941 |
| 1105 | Ga0207664_10377153 | 3300025929 | Bacteria | 1259 |
| 1106 | Ga0207664_11123777 | 3300025929 | Bacteria | 702 |
| 1107 | Ga0207644_10000008 | 3300025931 | Bacteria | 354219 |
| 1108 | Ga0207644_10000017 | 3300025931 | Bacteria | 177818 |
| 1109 | Ga0207644_10000275 | 3300025931 | Bacteria | 34149 |
| 1110 | Ga0207644_10000758 | 3300025931 | Bacteria | 20469 |
| 1111 | Ga0207644_10014424 | 3300025931 | Bacteria | 5285 |
| 1112 | Ga0207644_10038642 | 3300025931 | Bacteria | 3364 |
| 1113 | Ga0207644_10101281 | 3300025931 | Bacteria | 2164 |
| 1114 | Ga0207644_10524958 | 3300025931 | Bacteria | 978 |
| 1115 | Ga0207644_10587733 | 3300025931 | Bacteria | 924 |
| 1116 | Ga0207644_11147826 | 3300025931 | Bacteria | 653 |
| 1117 | Ga0207690_10000002 | 3300025932 | Bacteria | 807473 |
| 1118 | Ga0207690_10000033 | 3300025932 | Bacteria | 149705 |
| 1119 | Ga0207690_10000791 | 3300025932 | Bacteria | 20392 |
| 1120 | Ga0207690_10000978 | 3300025932 | Bacteria | 18314 |
| 1121 | Ga0207690_10007053 | 3300025932 | Bacteria | 6669 |
| 1122 | Ga0207690_10231150 | 3300025932 | Bacteria | 1420 |
| 1123 | Ga0207706_10001092 | 3300025933 | Bacteria | 27557 |
| 1124 | Ga0207706_10002029 | 3300025933 | Bacteria | 19849 |
| 1125 | Ga0207706_10020532 | 3300025933 | Bacteria | 5937 |
| 1126 | Ga0207706_10139104 | 3300025933 | Bacteria | 2136 |
| 1127 | Ga0207706_10256104 | 3300025933 | Bacteria | 1528 |
| 1128 | Ga0207706_10349971 | 3300025933 | Bacteria | 1285 |
| 1129 | Ga0207706_10509923 | 3300025933 | Bacteria | 1038 |
| 1130 | Ga0207706_10784238 | 3300025933 | Bacteria | 810 |
| 1131 | Ga0207686_10002670 | 3300025934 | Bacteria | 9680 |
| 1132 | Ga0207686_10062631 | 3300025934 | Bacteria | 2363 |
| 1133 | Ga0207686_10146674 | 3300025934 | Bacteria | 1638 |
| 1134 | Ga0207686_11494933 | 3300025934 | Bacteria | 557 |
| 1135 | Ga0207709_10009544 | 3300025935 | Bacteria | 5341 |
| 1136 | Ga0207709_10180597 | 3300025935 | Bacteria | 1490 |
| 1137 | Ga0207709_10748070 | 3300025935 | Bacteria | 786 |
| 1138 | Ga0207709_10966756 | 3300025935 | Bacteria | 695 |
| 1139 | Ga0207709_11047834 | 3300025935 | Bacteria | 668 |
| 1140 | Ga0207670_10005805 | 3300025936 | Bacteria | 6814 |
| 1141 | Ga0207670_10344537 | 3300025936 | Bacteria | 1178 |
| 1142 | Ga0207670_10598185 | 3300025936 | Bacteria | 905 |
| 1143 | Ga0207670_11424369 | 3300025936 | Bacteria | 588 |
| 1144 | Ga0207669_10003850 | 3300025937 | Bacteria | 6540 |
| 1145 | Ga0207669_10116677 | 3300025937 | Bacteria | 1802 |
| 1146 | Ga0207669_10194822 | 3300025937 | Bacteria | 1465 |
| 1147 | Ga0207669_10793850 | 3300025937 | Bacteria | 785 |
| 1148 | Ga0207669_11479566 | 3300025937 | Bacteria | 579 |
| 1149 | Ga0207704_10017213 | 3300025938 | Bacteria | 3740 |
| 1150 | Ga0207704_10034319 | 3300025938 | Bacteria | 2894 |
| 1151 | Ga0207704_10414271 | 3300025938 | Bacteria | 1067 |
| 1152 | Ga0207665_10000425 | 3300025939 | Bacteria | 29075 |
| 1153 | Ga0207665_11129404 | 3300025939 | Bacteria | 625 |
| 1154 | Ga0207691_10002632 | 3300025940 | Bacteria | 17529 |
| 1155 | Ga0207691_10216626 | 3300025940 | Bacteria | 1661 |
| 1156 | Ga0207691_10407224 | 3300025940 | Bacteria | 1160 |
| 1157 | Ga0207691_10918344 | 3300025940 | Bacteria | 732 |
| 1158 | Ga0207711_10000424 | 3300025941 | Bacteria | 44295 |
| 1159 | Ga0207711_10009142 | 3300025941 | Bacteria | 8276 |
| 1160 | Ga0207711_10024579 | 3300025941 | Bacteria | 5051 |
| 1161 | Ga0207711_10028129 | 3300025941 | Bacteria | 4728 |
| 1162 | Ga0207711_10079894 | 3300025941 | Bacteria | 2855 |
| 1163 | Ga0207711_10107428 | 3300025941 | Bacteria | 2478 |
| 1164 | Ga0207711_10126112 | 3300025941 | Bacteria | 2290 |
| 1165 | Ga0207711_10136431 | 3300025941 | Bacteria | 2204 |
| 1166 | Ga0207711_10297055 | 3300025941 | Bacteria | 1489 |
| 1167 | Ga0207711_10430961 | 3300025941 | Bacteria | 1227 |
| 1168 | Ga0207711_10443263 | 3300025941 | Bacteria | 1208 |
| 1169 | Ga0207711_11911995 | 3300025941 | Bacteria | 536 |
| 1170 | Ga0207689_10154385 | 3300025942 | Bacteria | 1892 |
| 1171 | Ga0207689_10972965 | 3300025942 | Bacteria | 716 |
| 1172 | Ga0207661_10166015 | 3300025944 | Bacteria | 1918 |
| 1173 | Ga0207661_10225868 | 3300025944 | Bacteria | 1656 |
| 1174 | Ga0207661_10329297 | 3300025944 | Bacteria | 1374 |
| 1175 | Ga0207661_11041435 | 3300025944 | Bacteria | 754 |
| 1176 | Ga0207661_11169481 | 3300025944 | Bacteria | 708 |
| 1177 | Ga0207679_10004122 | 3300025945 | Bacteria | 9026 |
| 1178 | Ga0207679_10062647 | 3300025945 | Bacteria | 2772 |
| 1179 | Ga0207679_10141829 | 3300025945 | Bacteria | 1943 |
| 1180 | Ga0207679_10198386 | 3300025945 | Bacteria | 1675 |
| 1181 | Ga0207679_10311780 | 3300025945 | Bacteria | 1360 |
| 1182 | Ga0207679_11095037 | 3300025945 | Bacteria | 731 |
| 1183 | Ga0207679_11674967 | 3300025945 | Bacteria | 582 |
| 1184 | Ga0207667_10004469 | 3300025949 | Bacteria | 17115 |
| 1185 | Ga0207667_10007100 | 3300025949 | Bacteria | 13519 |
| 1186 | Ga0207667_10009657 | 3300025949 | Bacteria | 11349 |
| 1187 | Ga0207667_10028735 | 3300025949 | Bacteria | 6037 |
| 1188 | Ga0207667_10064744 | 3300025949 | Bacteria | 3815 |
| 1189 | Ga0207667_10084062 | 3300025949 | Bacteria | 3295 |
| 1190 | Ga0207667_10133914 | 3300025949 | Bacteria | 2552 |
| 1191 | Ga0207667_10160095 | 3300025949 | Bacteria | 2316 |
| 1192 | Ga0207667_10283960 | 3300025949 | Bacteria | 1691 |
| 1193 | Ga0207667_10504900 | 3300025949 | Bacteria | 1226 |
| 1194 | Ga0207651_10005591 | 3300025960 | Bacteria | 6474 |
| 1195 | Ga0207651_10738092 | 3300025960 | Bacteria | 870 |
| 1196 | Ga0207651_10827572 | 3300025960 | Bacteria | 822 |
| 1197 | Ga0207651_11099308 | 3300025960 | Bacteria | 712 |
| 1198 | Ga0207712_10003733 | 3300025961 | Bacteria | 9614 |
| 1199 | Ga0207712_10011358 | 3300025961 | Bacteria | 5674 |
| 1200 | Ga0207712_10068985 | 3300025961 | Bacteria | 2535 |
| 1201 | Ga0207712_10108368 | 3300025961 | Bacteria | 2078 |
| 1202 | Ga0207712_10523654 | 3300025961 | Bacteria | 1016 |
| 1203 | Ga0207712_10691242 | 3300025961 | Bacteria | 890 |
| 1204 | Ga0207712_10734217 | 3300025961 | Bacteria | 864 |
| 1205 | Ga0207668_10000033 | 3300025972 | Bacteria | 121080 |
| 1206 | Ga0207668_10000403 | 3300025972 | Bacteria | 27203 |
| 1207 | Ga0207668_10000620 | 3300025972 | Bacteria | 22083 |
| 1208 | Ga0207668_10004688 | 3300025972 | Bacteria | 8043 |
| 1209 | Ga0207668_10005395 | 3300025972 | Bacteria | 7527 |
| 1210 | Ga0207668_10013122 | 3300025972 | Bacteria | 5092 |
| 1211 | Ga0207668_10064519 | 3300025972 | Bacteria | 2588 |
| 1212 | Ga0207668_10177129 | 3300025972 | Bacteria | 1678 |
| 1213 | Ga0207668_10298211 | 3300025972 | Bacteria | 1329 |
| 1214 | Ga0207668_10372637 | 3300025972 | Bacteria | 1199 |
| 1215 | Ga0207668_10407814 | 3300025972 | Bacteria | 1150 |
| 1216 | Ga0207668_10521861 | 3300025972 | Bacteria | 1025 |
| 1217 | Ga0207668_10815345 | 3300025972 | Bacteria | 827 |
| 1218 | Ga0207668_11184631 | 3300025972 | Bacteria | 686 |
| 1219 | Ga0207640_10001288 | 3300025981 | Bacteria | 13632 |
| 1220 | Ga0207640_10002534 | 3300025981 | Bacteria | 9792 |
| 1221 | Ga0207640_10004079 | 3300025981 | Bacteria | 7893 |
| 1222 | Ga0207640_10020742 | 3300025981 | Bacteria | 3905 |
| 1223 | Ga0207640_10033791 | 3300025981 | Bacteria | 3185 |
| 1224 | Ga0207640_10064291 | 3300025981 | Bacteria | 2442 |
| 1225 | Ga0207640_10099354 | 3300025981 | Bacteria | 2037 |
| 1226 | Ga0207640_11211206 | 3300025981 | Bacteria | 672 |
| 1227 | Ga0207640_11415498 | 3300025981 | Bacteria | 623 |
| 1228 | Ga0207658_10000737 | 3300025986 | Bacteria | 28241 |
| 1229 | Ga0207658_10001017 | 3300025986 | Bacteria | 22871 |
| 1230 | Ga0207658_10001740 | 3300025986 | Bacteria | 16408 |
| 1231 | Ga0207658_10004840 | 3300025986 | Bacteria | 9306 |
| 1232 | Ga0207658_10020333 | 3300025986 | Bacteria | 4596 |
| 1233 | Ga0207658_10034101 | 3300025986 | Bacteria | 3635 |
| 1234 | Ga0207658_10065651 | 3300025986 | Bacteria | 2727 |
| 1235 | Ga0207658_10485692 | 3300025986 | Bacteria | 1098 |
| 1236 | Ga0207658_10665284 | 3300025986 | Bacteria | 939 |
| 1237 | Ga0207658_10899019 | 3300025986 | Bacteria | 806 |
| 1238 | Ga0207658_11027688 | 3300025986 | Bacteria | 752 |
| 1239 | Ga0207658_11291393 | 3300025986 | Bacteria | 667 |
| 1240 | Ga0207677_10000043 | 3300026023 | Bacteria | 110161 |
| 1241 | Ga0207677_10004385 | 3300026023 | Bacteria | 7562 |
| 1242 | Ga0207677_10244171 | 3300026023 | Bacteria | 1454 |
| 1243 | Ga0207677_10507965 | 3300026023 | Bacteria | 1043 |
| 1244 | Ga0207677_10564414 | 3300026023 | Bacteria | 994 |
| 1245 | Ga0207703_10000079 | 3300026035 | Bacteria | 112451 |
| 1246 | Ga0207703_10003192 | 3300026035 | Bacteria | 13798 |
| 1247 | Ga0207703_10003477 | 3300026035 | Bacteria | 13183 |
| 1248 | Ga0207703_10008313 | 3300026035 | Bacteria | 8198 |
| 1249 | Ga0207703_10019595 | 3300026035 | Bacteria | 5286 |
| 1250 | Ga0207703_10043560 | 3300026035 | Bacteria | 3603 |
| 1251 | Ga0207703_10044815 | 3300026035 | Bacteria | 3556 |
| 1252 | Ga0207703_10285304 | 3300026035 | Bacteria | 1501 |
| 1253 | Ga0207703_10287847 | 3300026035 | Bacteria | 1494 |
| 1254 | Ga0207703_10438240 | 3300026035 | Bacteria | 1218 |
| 1255 | Ga0207703_10452911 | 3300026035 | Bacteria | 1199 |
| 1256 | Ga0207703_10534317 | 3300026035 | Bacteria | 1104 |
| 1257 | Ga0207703_10728259 | 3300026035 | Bacteria | 944 |
| 1258 | Ga0207703_11537737 | 3300026035 | Bacteria | 640 |
| 1259 | Ga0207639_10002795 | 3300026041 | Bacteria | 11720 |
| 1260 | Ga0207639_10016083 | 3300026041 | Bacteria | 5285 |
| 1261 | Ga0207639_10037841 | 3300026041 | Bacteria | 3586 |
| 1262 | Ga0207639_10362187 | 3300026041 | Bacteria | 1298 |
| 1263 | Ga0207639_10787614 | 3300026041 | Bacteria | 885 |
| 1264 | Ga0207639_11080696 | 3300026041 | Bacteria | 752 |
| 1265 | Ga0207678_10000884 | 3300026067 | Bacteria | 27549 |
| 1266 | Ga0207678_10001466 | 3300026067 | Bacteria | 21650 |
| 1267 | Ga0207678_10034999 | 3300026067 | Bacteria | 4373 |
| 1268 | Ga0207678_10134765 | 3300026067 | Bacteria | 2107 |
| 1269 | Ga0207678_10272004 | 3300026067 | Bacteria | 1453 |
| 1270 | Ga0207678_10787375 | 3300026067 | Bacteria | 839 |
| 1271 | Ga0207678_11443500 | 3300026067 | Bacteria | 608 |
| 1272 | Ga0207678_11454183 | 3300026067 | Bacteria | 605 |
| 1273 | Ga0207708_10000785 | 3300026075 | Bacteria | 23946 |
| 1274 | Ga0207708_10075845 | 3300026075 | Bacteria | 2578 |
| 1275 | Ga0207708_10145397 | 3300026075 | Bacteria | 1863 |
| 1276 | Ga0207708_10367232 | 3300026075 | Bacteria | 1184 |
| 1277 | Ga0207708_10452388 | 3300026075 | Bacteria | 1070 |
| 1278 | Ga0207708_11127932 | 3300026075 | Bacteria | 684 |
| 1279 | Ga0207702_10001194 | 3300026078 | Bacteria | 26369 |
| 1280 | Ga0207702_10012659 | 3300026078 | Bacteria | 7021 |
| 1281 | Ga0207702_10014307 | 3300026078 | Bacteria | 6588 |
| 1282 | Ga0207702_10033715 | 3300026078 | Bacteria | 4278 |
| 1283 | Ga0207702_10051771 | 3300026078 | Bacteria | 3472 |
| 1284 | Ga0207702_10058096 | 3300026078 | Bacteria | 3291 |
| 1285 | Ga0207702_10123220 | 3300026078 | Bacteria | 2323 |
| 1286 | Ga0207641_10000034 | 3300026088 | Bacteria | 217752 |
| 1287 | Ga0207641_10000113 | 3300026088 | Bacteria | 119188 |
| 1288 | Ga0207641_10001192 | 3300026088 | Bacteria | 26082 |
| 1289 | Ga0207641_10005506 | 3300026088 | Bacteria | 10795 |
| 1290 | Ga0207641_10040794 | 3300026088 | Bacteria | 3888 |
| 1291 | Ga0207641_10092440 | 3300026088 | Bacteria | 2650 |
| 1292 | Ga0207641_10132678 | 3300026088 | Bacteria | 2238 |
| 1293 | Ga0207641_11189814 | 3300026088 | Bacteria | 762 |
| 1294 | Ga0207641_11495290 | 3300026088 | Bacteria | 677 |
| 1295 | Ga0207641_11594920 | 3300026088 | Bacteria | 654 |
| 1296 | Ga0207648_10019921 | 3300026089 | Bacteria | 6054 |
| 1297 | Ga0207648_10046864 | 3300026089 | Bacteria | 3790 |
| 1298 | Ga0207648_10059376 | 3300026089 | Bacteria | 3336 |
| 1299 | Ga0207648_10201266 | 3300026089 | Bacteria | 1766 |
| 1300 | Ga0207676_10000103 | 3300026095 | Bacteria | 76865 |
| 1301 | Ga0207676_10003461 | 3300026095 | Bacteria | 11169 |
| 1302 | Ga0207676_10023358 | 3300026095 | Bacteria | 4561 |
| 1303 | Ga0207676_10037206 | 3300026095 | Bacteria | 3707 |
| 1304 | Ga0207676_10187021 | 3300026095 | Bacteria | 1819 |
| 1305 | Ga0207676_10411528 | 3300026095 | Bacteria | 1266 |
| 1306 | Ga0207676_10503127 | 3300026095 | Bacteria | 1151 |
| 1307 | Ga0207676_10784422 | 3300026095 | Bacteria | 929 |
| 1308 | Ga0207676_11201633 | 3300026095 | Bacteria | 751 |
| 1309 | Ga0207674_10004708 | 3300026116 | Bacteria | 16359 |
| 1310 | Ga0207674_10008209 | 3300026116 | Bacteria | 12100 |
| 1311 | Ga0207674_10018149 | 3300026116 | Bacteria | 7655 |
| 1312 | Ga0207674_10022498 | 3300026116 | Bacteria | 6767 |
| 1313 | Ga0207674_10344010 | 3300026116 | Bacteria | 1442 |
| 1314 | Ga0207674_10364107 | 3300026116 | Bacteria | 1398 |
| 1315 | Ga0207674_10689739 | 3300026116 | Bacteria | 986 |
| 1316 | Ga0207674_11311459 | 3300026116 | Bacteria | 693 |
| 1317 | Ga0207674_11692586 | 3300026116 | Bacteria | 601 |
| 1318 | Ga0207675_100000221 | 3300026118 | Bacteria | 53325 |
| 1319 | Ga0207675_100000933 | 3300026118 | Bacteria | 29221 |
| 1320 | Ga0207675_100032035 | 3300026118 | Bacteria | 4897 |
| 1321 | Ga0207675_100048571 | 3300026118 | Bacteria | 3961 |
| 1322 | Ga0207675_100551440 | 3300026118 | Bacteria | 1152 |
| 1323 | Ga0207675_100927386 | 3300026118 | Bacteria | 888 |
| 1324 | Ga0207675_101438004 | 3300026118 | Bacteria | 710 |
| 1325 | Ga0207683_10000861 | 3300026121 | Bacteria | 27809 |
| 1326 | Ga0207683_10457651 | 3300026121 | Bacteria | 1177 |
| 1327 | Ga0207683_10468017 | 3300026121 | Bacteria | 1163 |
| 1328 | Ga0207683_10704558 | 3300026121 | Bacteria | 936 |
| 1329 | Ga0207683_10889630 | 3300026121 | Bacteria | 827 |
| 1330 | Ga0207698_10023240 | 3300026142 | Bacteria | 4327 |
| 1331 | Ga0207698_10042867 | 3300026142 | Bacteria | 3385 |
| 1332 | Ga0207698_10493207 | 3300026142 | Bacteria | 1190 |
| 1333 | Ga0207698_10498066 | 3300026142 | Bacteria | 1185 |
| 1334 | Ga0207698_10534432 | 3300026142 | Bacteria | 1146 |
| 1335 | Ga0207698_10538591 | 3300026142 | Bacteria | 1142 |
| 1336 | Ga0207698_10731586 | 3300026142 | Bacteria | 987 |
| 1337 | Ga0207698_10829874 | 3300026142 | Bacteria | 928 |
| 1338 | Ga0207698_10917793 | 3300026142 | Bacteria | 883 |
| 1339 | Ga0207698_11378092 | 3300026142 | Bacteria | 720 |
| 1340 | Ga0209281_1035841 | 3300027111 | Bacteria | 860 |
| 1341 | Ga0209281_1062390 | 3300027111 | Bacteria | 565 |
| 1342 | Ga0209371_1057678 | 3300027312 | Bacteria | 723 |
| 1343 | Ga0209969_1066951 | 3300027360 | Bacteria | 569 |
| 1344 | Ga0209981_1009685 | 3300027378 | Bacteria | 1320 |
| 1345 | Ga0209996_1056539 | 3300027395 | Bacteria | 599 |
| 1346 | Ga0210000_1081151 | 3300027462 | Bacteria | 532 |
| 1347 | Ga0209999_1005300 | 3300027543 | Bacteria | 2320 |
| 1348 | Ga0209999_1067543 | 3300027543 | Bacteria | 684 |
| 1349 | Ga0209983_1008334 | 3300027665 | Bacteria | 2119 |
| 1350 | Ga0209983_1069405 | 3300027665 | Bacteria | 784 |
| 1351 | Ga0209282_1254740 | 3300027666 | Bacteria | 772 |
| 1352 | Ga0209998_10130355 | 3300027717 | Bacteria | 638 |
| 1353 | Ga0209813_10000014 | 3300027866 | Bacteria | 87712 |
| 1354 | Ga0209813_10000230 | 3300027866 | Bacteria | 17157 |
| 1355 | Ga0209813_10006694 | 3300027866 | Bacteria | 2854 |
| 1356 | Ga0209813_10008755 | 3300027866 | Bacteria | 2567 |
| 1357 | Ga0209813_10020418 | 3300027866 | Bacteria | 1854 |
| 1358 | Ga0209813_10077130 | 3300027866 | Bacteria | 1095 |
| 1359 | Ga0209974_10007355 | 3300027876 | Bacteria | 3793 |
| 1360 | Ga0209974_10013244 | 3300027876 | Bacteria | 2748 |
| 1361 | Ga0209974_10312524 | 3300027876 | Bacteria | 603 |
| 1362 | Ga0207428_10033106 | 3300027907 | Bacteria | 4247 |
| 1363 | Ga0207428_10232679 | 3300027907 | Bacteria | 1379 |
| 1364 | Ga0207428_10247950 | 3300027907 | Bacteria | 1329 |
| 1365 | Ga0207428_10378638 | 3300027907 | Bacteria | 1038 |
| 1366 | Ga0268266_10000002 | 3300028379 | Bacteria | 3059047 |
| 1367 | Ga0268266_10000175 | 3300028379 | Bacteria | 115897 |
| 1368 | Ga0268266_10002211 | 3300028379 | Bacteria | 21259 |
| 1369 | Ga0268266_10002389 | 3300028379 | Bacteria | 20264 |
| 1370 | Ga0268266_10003113 | 3300028379 | Bacteria | 16889 |
| 1371 | Ga0268266_10029371 | 3300028379 | Bacteria | 4674 |
| 1372 | Ga0268266_10067263 | 3300028379 | Bacteria | 3101 |
| 1373 | Ga0268266_10068435 | 3300028379 | Bacteria | 3074 |
| 1374 | Ga0268266_10110749 | 3300028379 | Bacteria | 2432 |
| 1375 | Ga0268266_10130141 | 3300028379 | Bacteria | 2250 |
| 1376 | Ga0268266_10139743 | 3300028379 | Bacteria | 2173 |
| 1377 | Ga0268266_10314309 | 3300028379 | Bacteria | 1464 |
| 1378 | Ga0268266_11339979 | 3300028379 | Bacteria | 691 |
| 1379 | Ga0268266_11475120 | 3300028379 | Bacteria | 656 |
| 1380 | Ga0268265_10000074 | 3300028380 | Bacteria | 127599 |
| 1381 | Ga0268265_10006282 | 3300028380 | Bacteria | 8047 |
| 1382 | Ga0268265_10012220 | 3300028380 | Bacteria | 5814 |
| 1383 | Ga0268265_10023312 | 3300028380 | Bacteria | 4362 |
| 1384 | Ga0268265_10035883 | 3300028380 | Bacteria | 3627 |
| 1385 | Ga0268265_10140009 | 3300028380 | Bacteria | 2024 |
| 1386 | Ga0268265_10178490 | 3300028380 | Bacteria | 1822 |
| 1387 | Ga0268265_10401274 | 3300028380 | Bacteria | 1267 |
| 1388 | Ga0268265_10627317 | 3300028380 | Bacteria | 1030 |
| 1389 | Ga0268265_10925105 | 3300028380 | Bacteria | 857 |
| 1390 | Ga0268265_11531053 | 3300028380 | Bacteria | 671 |
| 1391 | Ga0268264_10000067 | 3300028381 | Bacteria | 284445 |
| 1392 | Ga0268264_10000215 | 3300028381 | Bacteria | 113994 |
| 1393 | Ga0268264_10013477 | 3300028381 | Bacteria | 6732 |
| 1394 | Ga0268264_10015091 | 3300028381 | Bacteria | 6336 |
| 1395 | Ga0268264_10024453 | 3300028381 | Bacteria | 4931 |
| 1396 | Ga0268264_10039933 | 3300028381 | Bacteria | 3877 |
| 1397 | Ga0268264_10068596 | 3300028381 | Bacteria | 2997 |
| 1398 | Ga0268264_10191637 | 3300028381 | Bacteria | 1864 |
| 1399 | Ga0268264_10333039 | 3300028381 | Bacteria | 1439 |
| 1400 | Ga0268264_10664297 | 3300028381 | Bacteria | 1032 |
| 1401 | Ga0268264_10732494 | 3300028381 | Bacteria | 984 |
| 1402 | Ga0268264_10753907 | 3300028381 | Bacteria | 970 |
| 1403 | Ga0268264_11707721 | 3300028381 | Bacteria | 640 |
| 1404 | Ga0268264_12052361 | 3300028381 | Bacteria | 581 |
| 1405 | Ga0265326_10024973 | 3300028558 | Bacteria | 1704 |
| 1406 | Ga0265334_10044496 | 3300028573 | Bacteria | 1724 |
| 1407 | Ga0307517_10097484 | 3300028786 | Bacteria | 2347 |
| 1408 | Ga0307517_10143392 | 3300028786 | Bacteria | 1667 |
| 1409 | Ga0265338_10010218 | 3300028800 | Bacteria | 11057 |
| 1410 | Ga0265338_10011065 | 3300028800 | Bacteria | 10463 |
| 1411 | Ga0268256_1064671 | 3300030500 | Bacteria | 723 |
| 1412 | Ga0316177_1186482 | 3300030731 | Bacteria | 1480 |
| 1413 | Ga0314311_1038512 | 3300030733 | Bacteria | 2891 |
| 1414 | Ga0316182_1427119 | 3300030745 | Bacteria | 796 |
| 1415 | Ga0265762_1040596 | 3300030760 | Bacteria | 910 |
| 1416 | Ga0265766_1007313 | 3300030863 | Bacteria | 740 |
| 1417 | Ga0265325_10072483 | 3300031241 | Bacteria | 1726 |
| 1418 | Ga0265340_10060998 | 3300031247 | Bacteria | 1805 |
| 1419 | Ga0265340_10503640 | 3300031247 | Bacteria | 533 |
| 1420 | Ga0265339_10147493 | 3300031249 | Bacteria | 1192 |
| 1421 | Ga0265331_10006566 | 3300031250 | Bacteria | 6858 |
| 1422 | Ga0265327_10000454 | 3300031251 | Bacteria | 73503 |
| 1423 | Ga0265327_10016302 | 3300031251 | Bacteria | 4727 |
| 1424 | Ga0307513_10013182 | 3300031456 | Bacteria | 10155 |
| 1425 | Ga0307513_10133646 | 3300031456 | Bacteria | 2421 |
| 1426 | Ga0307513_10483897 | 3300031456 | Bacteria | 957 |
| 1427 | Ga0307513_10640871 | 3300031456 | Bacteria | 770 |
| 1428 | Ga0307513_10660788 | 3300031456 | Bacteria | 752 |
| 1429 | Ga0307408_100004861 | 3300031548 | Bacteria | 9050 |
| 1430 | Ga0307408_100049461 | 3300031548 | Bacteria | 3019 |
| 1431 | Ga0307408_100205359 | 3300031548 | Bacteria | 1597 |
| 1432 | Ga0307408_100345626 | 3300031548 | Bacteria | 1260 |
| 1433 | Ga0307408_100531713 | 3300031548 | Bacteria | 1034 |
| 1434 | Ga0265313_10022615 | 3300031595 | Bacteria | 3405 |
| 1435 | Ga0307508_10000011 | 3300031616 | Bacteria | 248001 |
| 1436 | Ga0307508_10217158 | 3300031616 | Bacteria | 1512 |
| 1437 | Ga0316575_10083397 | 3300031665 | Bacteria | 1290 |
| 1438 | Ga0316575_10169027 | 3300031665 | Bacteria | 906 |
| 1439 | Ga0316579_10007369 | 3300031691 | Bacteria | 4542 |
| 1440 | Ga0316579_10016916 | 3300031691 | Bacteria | 3193 |
| 1441 | Ga0265314_10128194 | 3300031711 | Bacteria | 1586 |
| 1442 | Ga0265314_10293885 | 3300031711 | Bacteria | 914 |
| 1443 | Ga0265314_10526871 | 3300031711 | Bacteria | 618 |
| 1444 | Ga0265342_10299559 | 3300031712 | Bacteria | 847 |
| 1445 | Ga0316576_10403734 | 3300031727 | Bacteria | 1012 |
| 1446 | Ga0316576_10504923 | 3300031727 | Bacteria | 889 |
| 1447 | Ga0316576_10746205 | 3300031727 | Bacteria | 707 |
| 1448 | Ga0316576_11027791 | 3300031727 | Bacteria | 586 |
| 1449 | Ga0316578_10081398 | 3300031728 | Bacteria | 1926 |
| 1450 | Ga0307516_10264534 | 3300031730 | Bacteria | 1409 |
| 1451 | Ga0307516_10307958 | 3300031730 | Bacteria | 1258 |
| 1452 | Ga0307405_10000196 | 3300031731 | Bacteria | 22239 |
| 1453 | Ga0307405_10010011 | 3300031731 | Bacteria | 4889 |
| 1454 | Ga0307405_10022461 | 3300031731 | Bacteria | 3567 |
| 1455 | Ga0307405_10041042 | 3300031731 | Bacteria | 2806 |
| 1456 | Ga0307405_10111030 | 3300031731 | Bacteria | 1857 |
| 1457 | Ga0307405_10318671 | 3300031731 | Bacteria | 1187 |
| 1458 | Ga0307405_10464827 | 3300031731 | Bacteria | 1006 |
| 1459 | Ga0307405_10847687 | 3300031731 | Bacteria | 769 |
| 1460 | Ga0307405_10964875 | 3300031731 | Bacteria | 725 |
| 1461 | Ga0307405_11859349 | 3300031731 | Bacteria | 536 |
| 1462 | Ga0316577_10044978 | 3300031733 | Bacteria | 2468 |
| 1463 | Ga0316577_10264495 | 3300031733 | Bacteria | 973 |
| 1464 | Ga0307413_10078911 | 3300031824 | Bacteria | 2102 |
| 1465 | Ga0307413_10089977 | 3300031824 | Bacteria | 1996 |
| 1466 | Ga0307413_10150544 | 3300031824 | Bacteria | 1621 |
| 1467 | Ga0307413_10230820 | 3300031824 | Bacteria | 1359 |
| 1468 | Ga0307413_10274293 | 3300031824 | Bacteria | 1264 |
| 1469 | Ga0307413_10379746 | 3300031824 | Bacteria | 1100 |
| 1470 | Ga0307413_10413584 | 3300031824 | Bacteria | 1060 |
| 1471 | Ga0307413_10578605 | 3300031824 | Bacteria | 915 |
| 1472 | Ga0307413_10733319 | 3300031824 | Bacteria | 824 |
| 1473 | Ga0307413_11031583 | 3300031824 | Bacteria | 707 |
| 1474 | Ga0307413_12063674 | 3300031824 | Bacteria | 515 |
| 1475 | Ga0307410_10009373 | 3300031852 | Bacteria | 5488 |
| 1476 | Ga0307410_10011923 | 3300031852 | Bacteria | 4997 |
| 1477 | Ga0307410_10015917 | 3300031852 | Bacteria | 4471 |
| 1478 | Ga0307410_10303638 | 3300031852 | Bacteria | 1260 |
| 1479 | Ga0307410_10380611 | 3300031852 | Bacteria | 1135 |
| 1480 | Ga0307410_10406987 | 3300031852 | Bacteria | 1100 |
| 1481 | Ga0307410_10595253 | 3300031852 | Bacteria | 922 |
| 1482 | Ga0307410_10640323 | 3300031852 | Bacteria | 891 |
| 1483 | Ga0307410_11592286 | 3300031852 | Bacteria | 577 |
| 1484 | Ga0307410_12142697 | 3300031852 | Bacteria | 500 |
| 1485 | Ga0307406_10001425 | 3300031901 | Bacteria | 13250 |
| 1486 | Ga0307406_10051708 | 3300031901 | Bacteria | 2610 |
| 1487 | Ga0307406_10083387 | 3300031901 | Bacteria | 2131 |
| 1488 | Ga0307406_10146427 | 3300031901 | Bacteria | 1679 |
| 1489 | Ga0307406_10258244 | 3300031901 | Bacteria | 1316 |
| 1490 | Ga0307406_10495425 | 3300031901 | Bacteria | 989 |
| 1491 | Ga0307406_10804140 | 3300031901 | Bacteria | 794 |
| 1492 | Ga0307407_10132995 | 3300031903 | Bacteria | 1594 |
| 1493 | Ga0307407_10321829 | 3300031903 | Bacteria | 1085 |
| 1494 | Ga0307407_10464876 | 3300031903 | Bacteria | 921 |
| 1495 | Ga0307407_10481382 | 3300031903 | Bacteria | 906 |
| 1496 | Ga0307407_10575746 | 3300031903 | Bacteria | 835 |
| 1497 | Ga0307407_10942369 | 3300031903 | Bacteria | 664 |
| 1498 | Ga0307412_10016048 | 3300031911 | Bacteria | 4451 |
| 1499 | Ga0307412_10020098 | 3300031911 | Bacteria | 4058 |
| 1500 | Ga0307412_10024329 | 3300031911 | Bacteria | 3738 |
| 1501 | Ga0307412_10029631 | 3300031911 | Bacteria | 3437 |
| 1502 | Ga0307412_10060113 | 3300031911 | Bacteria | 2549 |
| 1503 | Ga0307412_10085252 | 3300031911 | Bacteria | 2195 |
| 1504 | Ga0307412_10212445 | 3300031911 | Bacteria | 1477 |
| 1505 | Ga0307412_10496938 | 3300031911 | Bacteria | 1015 |
| 1506 | Ga0307412_10499734 | 3300031911 | Bacteria | 1012 |
| 1507 | Ga0307412_10500432 | 3300031911 | Bacteria | 1011 |
| 1508 | Ga0307412_10501543 | 3300031911 | Bacteria | 1010 |
| 1509 | Ga0307412_10673017 | 3300031911 | Bacteria | 885 |
| 1510 | Ga0307409_100010502 | 3300031995 | Bacteria | 5763 |
| 1511 | Ga0307409_100049412 | 3300031995 | Bacteria | 3207 |
| 1512 | Ga0307409_100121708 | 3300031995 | Bacteria | 2211 |
| 1513 | Ga0307409_100253909 | 3300031995 | Bacteria | 1609 |
| 1514 | Ga0307409_100483059 | 3300031995 | Bacteria | 1202 |
| 1515 | Ga0307409_100498590 | 3300031995 | Bacteria | 1185 |
| 1516 | Ga0307409_101042606 | 3300031995 | Bacteria | 837 |
| 1517 | Ga0307409_101184418 | 3300031995 | Bacteria | 787 |
| 1518 | Ga0307409_101743755 | 3300031995 | Bacteria | 652 |
| 1519 | Ga0307409_101823183 | 3300031995 | Bacteria | 637 |
| 1520 | Ga0307409_102434774 | 3300031995 | Bacteria | 552 |
| 1521 | Ga0307416_100029861 | 3300032002 | Bacteria | 4080 |
| 1522 | Ga0307416_100101817 | 3300032002 | Bacteria | 2502 |
| 1523 | Ga0307416_100116550 | 3300032002 | Bacteria | 2368 |
| 1524 | Ga0307416_100313124 | 3300032002 | Bacteria | 1567 |
| 1525 | Ga0307416_100439929 | 3300032002 | Bacteria | 1354 |
| 1526 | Ga0307416_100870387 | 3300032002 | Bacteria | 1000 |
| 1527 | Ga0307416_101362775 | 3300032002 | Bacteria | 815 |
| 1528 | Ga0307416_101746545 | 3300032002 | Bacteria | 726 |
| 1529 | Ga0307416_101867127 | 3300032002 | Bacteria | 704 |
| 1530 | Ga0307416_102513524 | 3300032002 | Bacteria | 613 |
| 1531 | Ga0307414_10000371 | 3300032004 | Bacteria | 24637 |
| 1532 | Ga0307414_10004614 | 3300032004 | Bacteria | 7494 |
| 1533 | Ga0307414_10008100 | 3300032004 | Bacteria | 5937 |
| 1534 | Ga0307414_10027055 | 3300032004 | Bacteria | 3700 |
| 1535 | Ga0307414_10035772 | 3300032004 | Bacteria | 3308 |
| 1536 | Ga0307414_10069418 | 3300032004 | Bacteria | 2533 |
| 1537 | Ga0307414_10087115 | 3300032004 | Bacteria | 2306 |
| 1538 | Ga0307414_10096364 | 3300032004 | Bacteria | 2213 |
| 1539 | Ga0307414_10104259 | 3300032004 | Bacteria | 2141 |
| 1540 | Ga0307414_10148592 | 3300032004 | Bacteria | 1845 |
| 1541 | Ga0307414_10183494 | 3300032004 | Bacteria | 1685 |
| 1542 | Ga0307414_10192892 | 3300032004 | Bacteria | 1650 |
| 1543 | Ga0307414_10226868 | 3300032004 | Bacteria | 1537 |
| 1544 | Ga0307414_10386670 | 3300032004 | Bacteria | 1211 |
| 1545 | Ga0307414_10529256 | 3300032004 | Bacteria | 1047 |
| 1546 | Ga0307414_10717603 | 3300032004 | Bacteria | 906 |
| 1547 | Ga0307414_11388803 | 3300032004 | Bacteria | 652 |
| 1548 | Ga0307414_12036146 | 3300032004 | Bacteria | 536 |
| 1549 | Ga0307414_12092507 | 3300032004 | Bacteria | 528 |
| 1550 | Ga0307411_10029626 | 3300032005 | Bacteria | 3346 |
| 1551 | Ga0307411_10037350 | 3300032005 | Bacteria | 3053 |
| 1552 | Ga0307411_10072538 | 3300032005 | Bacteria | 2338 |
| 1553 | Ga0307411_10133316 | 3300032005 | Bacteria | 1819 |
| 1554 | Ga0307411_10191465 | 3300032005 | Bacteria | 1562 |
| 1555 | Ga0307411_10511312 | 3300032005 | Bacteria | 1017 |
| 1556 | Ga0307411_10582115 | 3300032005 | Bacteria | 960 |
| 1557 | Ga0307411_10665199 | 3300032005 | Bacteria | 903 |
| 1558 | Ga0307411_10759396 | 3300032005 | Bacteria | 850 |
| 1559 | Ga0307411_11016560 | 3300032005 | Bacteria | 743 |
| 1560 | Ga0307411_12118556 | 3300032005 | Bacteria | 526 |
| 1561 | Ga0307415_100191609 | 3300032126 | Bacteria | 1614 |
| 1562 | Ga0307415_100211944 | 3300032126 | Bacteria | 1546 |
| 1563 | Ga0307415_100499301 | 3300032126 | Bacteria | 1063 |
| 1564 | Ga0307415_100501856 | 3300032126 | Bacteria | 1061 |
| 1565 | Ga0307415_100524571 | 3300032126 | Bacteria | 1040 |
| 1566 | Ga0307415_101203147 | 3300032126 | Bacteria | 714 |
| 1567 | Ga0307415_101279797 | 3300032126 | Bacteria | 694 |
| 1568 | Ga0307415_101749277 | 3300032126 | Bacteria | 600 |
| 1569 | Ga0316580_10117988 | 3300032139 | Bacteria | 812 |
| 1570 | Ga0316593_10033954 | 3300032168 | Bacteria | 1672 |
| 1571 | Ga0307510_10155235 | 3300033180 | Bacteria | 1897 |
| 1572 | Ga0316592_1054171 | 3300033524 | Bacteria | 897 |
| 1573 | Ga0316588_1049789 | 3300033528 | Bacteria | 1014 |
| 1574 | Ga0316588_1121282 | 3300033528 | Bacteria | 662 |
| 1575 | Ga0316596_1021836 | 3300033541 | Bacteria | 1634 |
| 1576 | Ga0316596_1081013 | 3300033541 | Bacteria | 873 |
| 1577 | Ga0373948_0006065 | 3300034817 | Bacteria | 1983 |
| 1578 | Ga0373938_0090470 | 3300034957 | Bacteria | 756 |
| 1579 | Ga0373928_0026493 | 3300035084 | Bacteria | 1256 |
| 1580 | Ga0373929_0027435 | 3300035085 | Bacteria | 1196 |
| 1581 | Ga0373929_0042826 | 3300035085 | Bacteria | 1011 |
| 1582 | Ga0373929_0096835 | 3300035085 | Bacteria | 739 |
| 1583 | Ga0373929_0247468 | 3300035085 | Bacteria | 516 |
| 1584 | Ga0373940_0003431 | 3300035088 | Bacteria | 3237 |
| 1585 | Ga0373951_0150911 | 3300035091 | Bacteria | 651 |
| 1586 | Ga0373952_0031133 | 3300035092 | Bacteria | 1185 |
| 1587 | Ga0373923_0342435 | 3300035111 | Bacteria | 713 |
| 1588 | Ga0373932_0180066 | 3300035112 | Bacteria | 741 |
| 1589 | Ga0373939_0005439 | 3300035114 | Bacteria | 3034 |
| 1590 | Ga0373939_0391762 | 3300035114 | Bacteria | 574 |
| 1591 | Ga0373939_0424902 | 3300035114 | Bacteria | 555 |
| 1592 | Ga0373941_0000122 | 3300035115 | Bacteria | 13384 |
| 1593 | Ga0373941_0012044 | 3300035115 | Bacteria | 2251 |
| 1594 | Ga0373941_0186789 | 3300035115 | Bacteria | 781 |
| 1595 | Ga0373956_0581413 | 3300035119 | Bacteria | 535 |
| 1596 | Ga0373957_0273689 | 3300035120 | Bacteria | 713 |
| 1597 | Ga0373960_0005313 | 3300035121 | Bacteria | 2978 |
| 1598 | Ga0373960_0111217 | 3300035121 | Bacteria | 899 |
| 1599 | Ga0373960_0287076 | 3300035121 | Bacteria | 608 |
| 1600 | Ga0373942_0058443 | 3300035207 | Bacteria | 1099 |
| 1601 | Ga0373961_0006874 | 3300035241 | Bacteria | 2737 |
| 1602 | Ga0373962_0019956 | 3300035242 | Bacteria | 1756 |
| 1603 | Ga0373962_0146685 | 3300035242 | Bacteria | 770 |
| 1604 | Ga0316574_0037577 | 3300035398 | Bacteria | 2970 |
| 1605 | Ga0316574_0322702 | 3300035398 | Bacteria | 980 |
| 1606 | Ga0373924_0404487 | 3300035410 | Bacteria | 610 |
| 1607 | Ga0373931_0005809 | 3300035691 | Bacteria | 5740 |
| 1608 | Ga0373931_0007458 | 3300035691 | Bacteria | 5153 |
| 1609 | Ga0373931_0017420 | 3300035691 | Bacteria | 3553 |
| 1610 | Ga0373931_0034633 | 3300035691 | Bacteria | 2622 |
| 1611 | Ga0373931_0462120 | 3300035691 | Bacteria | 813 |
| 1612 | Ga0373931_0975101 | 3300035691 | Bacteria | 573 |
| 1613 | Ga0373931_0986633 | 3300035691 | Bacteria | 569 |
| 1614 | Ga0373935_0793286 | 3300035692 | Bacteria | 699 |
| 1615 | Ga0373927_0279401 | 3300035695 | Bacteria | 1098 |
| 1616 | Ga0373927_0613566 | 3300035695 | Bacteria | 719 |
| 1617 | Ga0373933_0335654 | 3300035724 | Bacteria | 981 |
| 1618 | Ga0373947_0421765 | 3300035725 | Bacteria | 902 |
| 1619 | Ga0373947_0708922 | 3300035725 | Bacteria | 687 |
| 1620 | Ga0373947_1029478 | 3300035725 | Bacteria | 562 |
| 1621 | Ga0373937_0756978 | 3300036401 | Bacteria | 919 |
| 1622 | Ga0373937_0767158 | 3300036401 | Bacteria | 912 |
| 1623 | Ga0373937_1269106 | 3300036401 | Bacteria | 685 |
| 1624 | Ga0316582_0014084 | 3300036647 | Bacteria | 4528 |
| 1625 | Ga0316584_0012127 | 3300036712 | Bacteria | 6073 |
| 1626 | Ga0316584_0075207 | 3300036712 | Bacteria | 2532 |
| 1627 | Ga0316584_0124021 | 3300036712 | Bacteria | 1929 |
| 1628 | Ga0316584_0354608 | 3300036712 | Bacteria | 1053 |
| 1629 | Ga0395899_0004516 | 3300037312 | Bacteria | 10849 |
| 1630 | Ga0395899_0009175 | 3300037312 | Bacteria | 7595 |
| 1631 | Ga0395899_0058394 | 3300037312 | Bacteria | 2845 |
| 1632 | Ga0395899_0065715 | 3300037312 | Bacteria | 2665 |
| 1633 | Ga0395899_0092715 | 3300037312 | Bacteria | 2187 |
| 1634 | Ga0395900_0001724 | 3300037418 | Bacteria | 25250 |
| 1635 | Ga0395900_0038265 | 3300037418 | Bacteria | 4944 |
| 1636 | Ga0395900_0085349 | 3300037418 | Bacteria | 3244 |
| 1637 | Ga0395900_0088445 | 3300037418 | Bacteria | 3184 |
| 1638 | Ga0395900_0301128 | 3300037418 | Bacteria | 1589 |
| 1639 | Ga0395900_0386171 | 3300037418 | Bacteria | 1367 |
| 1640 | Ga0395900_0499091 | 3300037418 | Bacteria | 1167 |
| 1641 | Ga0395898_0157878 | 3300037466 | Bacteria | 2169 |
| 1642 | Ga0395898_0221767 | 3300037466 | Bacteria | 1803 |
| 1643 | Ga0395898_0534956 | 3300037466 | Bacteria | 1113 |
| 1644 | Ga0395905_0000608 | 3300037471 | Bacteria | 47958 |
| 1645 | Ga0395905_0001310 | 3300037471 | Bacteria | 30585 |
| 1646 | Ga0395905_0068245 | 3300037471 | Bacteria | 3331 |
| 1647 | Ga0395905_1239144 | 3300037471 | Bacteria | 650 |
| 1648 | Ga0395905_1491671 | 3300037471 | Bacteria | 580 |
| 1649 | Ga0316581_0042912 | 3300037588 | Bacteria | 1380 |
| 1650 | Ga0316581_0049060 | 3300037588 | Bacteria | 1292 |
| 1651 | Ga0436364_0084899 | 3300037853 | Bacteria | 904 |
| 1652 | Ga0436364_0222939 | 3300037853 | Bacteria | 956 |
| 1653 | Ga0436364_1178388 | 3300037853 | Bacteria | 790 |
| 1654 | Ga0436364_1497021 | 3300037853 | Bacteria | 586 |
| 1655 | Ga0436364_1558455 | 3300037853 | Bacteria | 3181 |
| 1656 | Ga0395901_0077970 | 3300038443 | Bacteria | 3458 |
| 1657 | Ga0395901_0124118 | 3300038443 | Bacteria | 2713 |
| 1658 | Ga0395901_0189909 | 3300038443 | Bacteria | 2154 |
| 1659 | Ga0395901_0217858 | 3300038443 | Bacteria | 1996 |
| 1660 | Ga0395901_0354199 | 3300038443 | Bacteria | 1514 |
| 1661 | Ga0242420_003405 | 3300038996 | Bacteria | 2348 |
| 1662 | Ga0400483_067380 | 3300039062 | Bacteria | 3443 |
| 1663 | Ga0400483_068661 | 3300039062 | Bacteria | 1414 |
| 1664 | Ga0400483_173078 | 3300039062 | Bacteria | 2102 |
| 1665 | Ga0400483_180542 | 3300039062 | Bacteria | 1549 |
| 1666 | Ga0400483_204874 | 3300039062 | Bacteria | 1569 |
| 1667 | Ga0436365_0105609 | 3300039437 | Bacteria | 6219 |
| 1668 | Ga0436365_0331130 | 3300039437 | Bacteria | 1043 |
| 1669 | Ga0436365_0614931 | 3300039437 | Bacteria | 537 |
| 1670 | Ga0436365_0926226 | 3300039437 | Bacteria | 665 |
| 1671 | Ga0436365_1426025 | 3300039437 | Bacteria | 31887 |
| 1672 | Ga0436365_1472042 | 3300039437 | Bacteria | 506 |
| 1673 | Ga0436365_1924518 | 3300039437 | Bacteria | 7094 |
| 1674 | Ga0436360_0160866 | 3300039438 | Bacteria | 1398 |
| 1675 | Ga0436360_0343032 | 3300039438 | Bacteria | 551 |
| 1676 | Ga0436360_0349025 | 3300039438 | Bacteria | 1682 |
| 1677 | Ga0436360_0374078 | 3300039438 | Bacteria | 1879 |
| 1678 | Ga0436360_1022661 | 3300039438 | Bacteria | 552 |
| 1679 | Ga0436360_1036016 | 3300039438 | Bacteria | 3942 |
| 1680 | Ga0436361_0696162 | 3300039447 | Bacteria | 4324 |
| 1681 | Ga0436361_0738968 | 3300039447 | Bacteria | 605 |
| 1682 | Ga0436361_0777262 | 3300039447 | Bacteria | 2722 |
| 1683 | Ga0436361_1026066 | 3300039447 | Bacteria | 738 |
| 1684 | Ga0436363_0381568 | 3300039450 | Bacteria | 1460 |
| 1685 | Ga0436363_0564773 | 3300039450 | Bacteria | 526 |
| 1686 | Ga0436363_1349972 | 3300039450 | Bacteria | 5207 |
| 1687 | Ga0436363_1573256 | 3300039450 | Bacteria | 882 |
| 1688 | Ga0436363_1597741 | 3300039450 | Bacteria | 870 |
| 1689 | Ga0436362_0064393 | 3300039453 | Bacteria | 507 |
| 1690 | Ga0436362_0215979 | 3300039453 | Bacteria | 754 |
| 1691 | Ga0436362_0526587 | 3300039453 | Bacteria | 649 |
| 1692 | Ga0436362_0535229 | 3300039453 | Bacteria | 540 |
| 1693 | Ga0436362_0567947 | 3300039453 | Bacteria | 817 |
| 1694 | Ga0436362_0634200 | 3300039453 | Bacteria | 922 |
| 1695 | Ga0436362_0835643 | 3300039453 | Bacteria | 802 |
| 1696 | Ga0436362_1034769 | 3300039453 | Bacteria | 1538 |
| 1697 | Ga0436362_1285925 | 3300039453 | Bacteria | 714 |
| 1698 | Ga0439436_0064552 | 3300041404 | Bacteria | 1023 |
| 1699 | Ga0439439_0005078 | 3300041406 | Bacteria | 2992 |
| 1700 | Ga0439447_059227 | 3300041407 | Bacteria | 903 |
| 1701 | Ga0439461_0010778 | 3300041410 | Bacteria | 1684 |
| 1702 | Ga0439466_0019806 | 3300041411 | Bacteria | 2405 |
| 1703 | Ga0439465_0001868 | 3300041413 | Bacteria | 6883 |
| 1704 | Ga0439465_0003473 | 3300041413 | Bacteria | 5139 |
| 1705 | Ga0451789_0509383 | 3300041443 | Bacteria | 541 |
| 1706 | Ga0451789_0762327 | 3300041443 | Bacteria | 1424 |
| 1707 | Ga0451790_26137 | 3300041444 | Bacteria | 617 |
| 1708 | Ga0451792_07864 | 3300041445 | Bacteria | 679 |
| 1709 | Ga0451794_20066 | 3300041446 | Bacteria | 807 |
| 1710 | Ga0451794_34299 | 3300041446 | Bacteria | 654 |
| 1711 | Ga0451791_1586556 | 3300041451 | Bacteria | 865 |
| 1712 | Ga0451791_1679327 | 3300041451 | Bacteria | 653 |
| 1713 | Ga0451793_0354107 | 3300041452 | Bacteria | 828 |
| 1714 | Ga0451793_0668171 | 3300041452 | Bacteria | 571 |
| 1715 | Ga0451797_1467030 | 3300041453 | Bacteria | 1188 |
| 1716 | Ga0451801_34670 | 3300041455 | Bacteria | 848 |
| 1717 | Ga0451798_0032465 | 3300041458 | Bacteria | 571 |
| 1718 | Ga0451798_0965105 | 3300041458 | Bacteria | 614 |
| 1719 | Ga0451800_1517120 | 3300041459 | Bacteria | 687 |
| 1720 | Ga0451802_0200424 | 3300041460 | Bacteria | 651 |
| 1721 | Ga0451802_0604284 | 3300041460 | Bacteria | 538 |
| 1722 | Ga0451802_1735810 | 3300041460 | Bacteria | 612 |
| 1723 | Ga0451806_501791 | 3300041462 | Bacteria | 806 |
| 1724 | Ga0451804_0497676 | 3300041463 | Bacteria | 658 |
| 1725 | Ga0451804_0831235 | 3300041463 | Bacteria | 930 |
| 1726 | Ga0451807_0346685 | 3300041486 | Bacteria | 1035 |
| 1727 | Ga0451807_1013799 | 3300041486 | Bacteria | 504 |
| 1728 | Ga0451833_0170114 | 3300041491 | Bacteria | 748 |
| 1729 | Ga0451835_0912455 | 3300041492 | Bacteria | 727 |
| 1730 | Ga0451841_0666561 | 3300041498 | Bacteria | 1353 |
| 1731 | Ga0451841_0761262 | 3300041498 | Bacteria | 630 |
| 1732 | Ga0451841_1387938 | 3300041498 | Bacteria | 941 |
| 1733 | Ga0451845_0989282 | 3300041501 | Bacteria | 575 |
| 1734 | Ga0451849_0506178 | 3300041505 | Bacteria | 916 |
| 1735 | Ga0451849_1361625 | 3300041505 | Bacteria | 518 |
| 1736 | Ga0451851_1228336 | 3300041507 | Bacteria | 632 |
| 1737 | Ga0451843_1470911 | 3300041509 | Bacteria | 679 |
| 1738 | Ga0451855_0483205 | 3300041511 | Bacteria | 535 |
| 1739 | Ga0451855_1086033 | 3300041511 | Bacteria | 742 |
| 1740 | Ga0451853_0214658 | 3300041512 | Bacteria | 544 |
| 1741 | Ga0451853_2334469 | 3300041512 | Bacteria | 771 |
| 1742 | Ga0451853_3229958 | 3300041512 | Bacteria | 1671 |
| 1743 | Ga0439431_0000104 | 3300041997 | Bacteria | 14348 |
| 1744 | Ga0439431_0003546 | 3300041997 | Bacteria | 3442 |
| 1745 | Ga0439442_000783 | 3300042002 | Bacteria | 6617 |
| 1746 | Ga0439443_030922 | 3300042003 | Bacteria | 882 |
| 1747 | Ga0439445_0001513 | 3300042004 | Bacteria | 5051 |
| 1748 | Ga0439445_0025857 | 3300042004 | Bacteria | 1499 |
| 1749 | Ga0439445_0093162 | 3300042004 | Bacteria | 850 |
| 1750 | Ga0439432_001274 | 3300042006 | Bacteria | 9538 |
| 1751 | Ga0439432_018010 | 3300042006 | Bacteria | 2364 |
| 1752 | Ga0439452_022629 | 3300042010 | Bacteria | 1624 |
| 1753 | Ga0439457_005922 | 3300042014 | Bacteria | 3026 |
| 1754 | Ga0439462_0000844 | 3300042015 | Bacteria | 6416 |
| 1755 | Ga0439462_0002785 | 3300042015 | Bacteria | 4113 |
| 1756 | Ga0439462_0012289 | 3300042015 | Bacteria | 2186 |
| 1757 | Ga0450912_022816 | 3300042116 | Bacteria | 614 |
| 1758 | Ga0450923_025883 | 3300042125 | Bacteria | 1172 |
| 1759 | Ga0450888_078432 | 3300042126 | Bacteria | 505 |
| 1760 | Ga0450898_033574 | 3300042134 | Bacteria | 950 |
| 1761 | Ga0450889_000023 | 3300042144 | Bacteria | 13616 |
| 1762 | Ga0439446_0145781 | 3300042156 | Bacteria | 776 |
| 1763 | Ga0450909_009470 | 3300042185 | Bacteria | 1422 |
| 1764 | Ga0439434_0005357 | 3300042435 | Bacteria | 3755 |
| 1765 | Ga0439434_0098487 | 3300042435 | Bacteria | 940 |
| 1766 | Ga0439435_0009252 | 3300042436 | Bacteria | 2307 |
| 1767 | Ga0439435_0193719 | 3300042436 | Bacteria | 668 |
| 1768 | Ga0439459_0050109 | 3300042438 | Bacteria | 914 |
| 1769 | Ga0439459_0053607 | 3300042438 | Bacteria | 893 |
| 1770 | Ga0451577_1620962 | 3300042876 | Bacteria | 570 |
| 1771 | Ga0466969_0010778 | 3300044656 | Bacteria | 4842 |
| 1772 | Ga0466969_0091069 | 3300044656 | Bacteria | 1445 |
| 1773 | Ga0466965_0545941 | 3300044683 | Bacteria | 654 |
| 1774 | Ga0466966_0000021 | 3300044684 | Bacteria | 116714 |
| 1775 | Ga0466966_0001996 | 3300044684 | Bacteria | 13224 |
| 1776 | Ga0466966_0003640 | 3300044684 | Bacteria | 10171 |
| 1777 | Ga0466966_0738248 | 3300044684 | Bacteria | 593 |
| 1778 | Ga0466961_0008264 | 3300044693 | Bacteria | 6630 |
| 1779 | Ga0466963_0016990 | 3300044694 | Bacteria | 4532 |
| 1780 | Ga0466963_0254291 | 3300044694 | Bacteria | 1233 |
| 1781 | Ga0466964_0460823 | 3300044706 | Bacteria | 676 |
| 1782 | Ga0453684_0000018 | 3300044712 | Bacteria | 921850 |
| 1783 | Ga0453684_0299680 | 3300044712 | Bacteria | 1827 |
| 1784 | Ga0453684_0658612 | 3300044712 | Bacteria | 1142 |
| 1785 | Ga0453684_2537308 | 3300044712 | Bacteria | 505 |
| 1786 | Ga0466971_0000846 | 3300044719 | Bacteria | 12460 |
| 1787 | Ga0466971_0147659 | 3300044719 | Bacteria | 1097 |
| 1788 | Ga0466970_0006718 | 3300044765 | Bacteria | 5756 |
| 1789 | Ga0466970_0521680 | 3300044765 | Bacteria | 685 |
| 1790 | Ga0466957_0002162 | 3300044842 | Bacteria | 10524 |
| 1791 | Ga0466957_0826159 | 3300044842 | Bacteria | 659 |
| 1792 | Ga0466959_0006500 | 3300045049 | Bacteria | 8102 |
| 1793 | Ga0466959_0013668 | 3300045049 | Bacteria | 5890 |
| 1794 | Ga0466959_0038377 | 3300045049 | Bacteria | 3539 |
| 1795 | Ga0466959_0240105 | 3300045049 | Bacteria | 1252 |
| 1796 | Ga0451576_0000024 | 3300045051 | Bacteria | 470499 |
| 1797 | Ga0451576_0001525 | 3300045051 | Bacteria | 38988 |
| 1798 | Ga0451576_0015898 | 3300045051 | Bacteria | 8320 |
| 1799 | Ga0451576_0049961 | 3300045051 | Bacteria | 4388 |
| 1800 | Ga0451576_0104195 | 3300045051 | Bacteria | 2951 |
| 1801 | Ga0451576_1337580 | 3300045051 | Bacteria | 746 |
| 1802 | Ga0451576_2738626 | 3300045051 | Bacteria | 502 |
| 1803 | Ga0466958_0009405 | 3300045836 | Bacteria | 5446 |
| 1804 | Ga0466958_0110375 | 3300045836 | Bacteria | 1717 |
| 1805 | Ga0466967_0825658 | 3300045976 | Bacteria | 921 |
| 1806 | Ga0495617_005172 | 3300046452 | Bacteria | 4658 |
| 1807 | Ga0495627_000295 | 3300046453 | Bacteria | 49392 |
| 1808 | Ga0495627_000507 | 3300046453 | Bacteria | 32459 |
| 1809 | Ga0495627_000928 | 3300046453 | Bacteria | 20202 |
| 1810 | Ga0495627_017826 | 3300046453 | Bacteria | 2405 |
| 1811 | Ga0495627_110900 | 3300046453 | Bacteria | 779 |
| 1812 | Ga0495629_0452251 | 3300046459 | Bacteria | 869 |
| 1813 | Ga0495638_0000207 | 3300046460 | Bacteria | 83805 |
| 1814 | Ga0495638_0143540 | 3300046460 | Bacteria | 1391 |
| 1815 | Ga0495638_0151305 | 3300046460 | Bacteria | 1346 |
| 1816 | Ga0495638_0158058 | 3300046460 | Bacteria | 1310 |
| 1817 | Ga0495638_0351577 | 3300046460 | Bacteria | 778 |
| 1818 | Ga0495638_0408671 | 3300046460 | Bacteria | 703 |
| 1819 | Ga0495641_0500518 | 3300046461 | Bacteria | 554 |
| 1820 | Ga0495651_0217711 | 3300046462 | Bacteria | 1324 |
| 1821 | Ga0495650_0004608 | 3300046471 | Bacteria | 9356 |
| 1822 | Ga0495650_0047173 | 3300046471 | Bacteria | 1803 |
| 1823 | Ga0495650_0303078 | 3300046471 | Bacteria | 534 |
| 1824 | Ga0495580_0035969 | 3300046472 | Bacteria | 3559 |
| 1825 | Ga0495580_0617920 | 3300046472 | Bacteria | 715 |
| 1826 | Ga0495582_0198735 | 3300046473 | Bacteria | 1145 |
| 1827 | Ga0495605_0088630 | 3300046474 | Bacteria | 1437 |
| 1828 | Ga0495639_0266775 | 3300046475 | Bacteria | 849 |
| 1829 | Ga0495639_0267650 | 3300046475 | Bacteria | 848 |
| 1830 | Ga0495639_0431714 | 3300046475 | Bacteria | 668 |
| 1831 | Ga0495664_0412313 | 3300046477 | Bacteria | 811 |
| 1832 | Ga0495584_0056669 | 3300046491 | Bacteria | 1972 |
| 1833 | Ga0495585_0119990 | 3300046492 | Bacteria | 1391 |
| 1834 | Ga0495594_0126085 | 3300046499 | Bacteria | 1449 |
| 1835 | Ga0495596_0000153 | 3300046500 | Bacteria | 47822 |
| 1836 | Ga0495596_0000154 | 3300046500 | Bacteria | 47820 |
| 1837 | Ga0495596_0201578 | 3300046500 | Bacteria | 773 |
| 1838 | Ga0495607_0009022 | 3300046501 | Bacteria | 6780 |
| 1839 | Ga0495583_0085714 | 3300046506 | Bacteria | 1363 |
| 1840 | Ga0495583_0183298 | 3300046506 | Bacteria | 856 |
| 1841 | Ga0495606_0009651 | 3300046507 | Bacteria | 8129 |
| 1842 | Ga0495606_0169262 | 3300046507 | Bacteria | 1269 |
| 1843 | Ga0495610_0000015 | 3300046512 | Bacteria | 391489 |
| 1844 | Ga0495610_0000102 | 3300046512 | Bacteria | 98985 |
| 1845 | Ga0495610_0001230 | 3300046512 | Bacteria | 23022 |
| 1846 | Ga0495610_0001618 | 3300046512 | Bacteria | 19803 |
| 1847 | Ga0495610_0048245 | 3300046512 | Bacteria | 2091 |
| 1848 | Ga0495610_0143157 | 3300046512 | Bacteria | 1027 |
| 1849 | Ga0495610_0173077 | 3300046512 | Bacteria | 904 |
| 1850 | Ga0495610_0350328 | 3300046512 | Bacteria | 556 |
| 1851 | Ga0495618_0448869 | 3300046514 | Bacteria | 783 |
| 1852 | Ga0495620_0007378 | 3300046515 | Bacteria | 5977 |
| 1853 | Ga0495620_0158030 | 3300046515 | Bacteria | 882 |
| 1854 | Ga0495630_0523333 | 3300046517 | Bacteria | 909 |
| 1855 | Ga0495631_0026605 | 3300046518 | Bacteria | 2654 |
| 1856 | Ga0495631_0369642 | 3300046518 | Bacteria | 610 |
| 1857 | Ga0495632_0000013 | 3300046519 | Bacteria | 247879 |
| 1858 | Ga0495632_0004141 | 3300046519 | Bacteria | 9961 |
| 1859 | Ga0495632_0142646 | 3300046519 | Bacteria | 1110 |
| 1860 | Ga0495632_0144521 | 3300046519 | Bacteria | 1102 |
| 1861 | Ga0495637_0000336 | 3300046520 | Bacteria | 36345 |
| 1862 | Ga0495637_0002839 | 3300046520 | Bacteria | 9394 |
| 1863 | Ga0495637_0092301 | 3300046520 | Bacteria | 1193 |
| 1864 | Ga0495643_0000010 | 3300046522 | Bacteria | 341431 |
| 1865 | Ga0495643_0000080 | 3300046522 | Bacteria | 161872 |
| 1866 | Ga0495643_0001635 | 3300046522 | Bacteria | 19778 |
| 1867 | Ga0495643_0005120 | 3300046522 | Bacteria | 8965 |
| 1868 | Ga0495643_0018560 | 3300046522 | Bacteria | 4039 |
| 1869 | Ga0495643_0039818 | 3300046522 | Bacteria | 2569 |
| 1870 | Ga0495643_0145927 | 3300046522 | Bacteria | 1176 |
| 1871 | Ga0495644_0198558 | 3300046523 | Bacteria | 773 |
| 1872 | Ga0495648_0018736 | 3300046524 | Bacteria | 4887 |
| 1873 | Ga0495648_0045425 | 3300046524 | Bacteria | 2732 |
| 1874 | Ga0495663_0000004 | 3300046525 | Bacteria | 355166 |
| 1875 | Ga0495663_0063329 | 3300046525 | Bacteria | 1166 |
| 1876 | Ga0495663_0133121 | 3300046525 | Bacteria | 840 |
| 1877 | Ga0495642_0058469 | 3300046528 | Bacteria | 1596 |
| 1878 | Ga0495652_0275174 | 3300046529 | Bacteria | 1235 |
| 1879 | Ga0495654_0038375 | 3300046530 | Bacteria | 2396 |
| 1880 | Ga0495654_0272704 | 3300046530 | Bacteria | 698 |
| 1881 | Ga0495665_0047755 | 3300046531 | Bacteria | 2271 |
| 1882 | Ga0495640_0155677 | 3300046533 | Bacteria | 1467 |
| 1883 | Ga0495586_0042387 | 3300046535 | Bacteria | 2451 |
| 1884 | Ga0495586_0700630 | 3300046535 | Bacteria | 585 |
| 1885 | Ga0495587_0093132 | 3300046536 | Bacteria | 1740 |
| 1886 | Ga0495598_0013519 | 3300046537 | Bacteria | 2025 |
| 1887 | Ga0495609_0001714 | 3300046538 | Bacteria | 14212 |
| 1888 | Ga0495609_0014892 | 3300046538 | Bacteria | 3649 |
| 1889 | Ga0495621_0066212 | 3300046539 | Bacteria | 1321 |
| 1890 | Ga0495621_0465570 | 3300046539 | Bacteria | 542 |
| 1891 | Ga0495597_0001366 | 3300046542 | Bacteria | 17637 |
| 1892 | Ga0495622_0002718 | 3300046557 | Bacteria | 8469 |
| 1893 | Ga0495633_0000092 | 3300046558 | Bacteria | 121446 |
| 1894 | Ga0495633_0001239 | 3300046558 | Bacteria | 20410 |
| 1895 | Ga0495633_0009946 | 3300046558 | Bacteria | 5222 |
| 1896 | Ga0495633_0042220 | 3300046558 | Bacteria | 2167 |
| 1897 | Ga0495667_0192194 | 3300046559 | Bacteria | 1308 |
| 1898 | Ga0495656_0508253 | 3300046615 | Bacteria | 639 |
| 1899 | Ga0495668_0000087 | 3300046616 | Bacteria | 151819 |
| 1900 | Ga0495668_0056696 | 3300046616 | Bacteria | 2162 |
| 1901 | Ga0495668_0060236 | 3300046616 | Bacteria | 2094 |
| 1902 | Ga0495668_0168756 | 3300046616 | Bacteria | 1199 |
| 1903 | Ga0495668_0268427 | 3300046616 | Bacteria | 934 |
| 1904 | Ga0495668_0423788 | 3300046616 | Bacteria | 732 |
| 1905 | Ga0495668_0442675 | 3300046616 | Bacteria | 715 |
| 1906 | Ga0495668_0660372 | 3300046616 | Bacteria | 578 |
| 1907 | Ga0495634_0209916 | 3300046642 | Bacteria | 1206 |
| 1908 | Ga0495625_0000275 | 3300046660 | Bacteria | 80062 |
| 1909 | Ga0495625_0001182 | 3300046660 | Bacteria | 33512 |
| 1910 | Ga0495625_0137896 | 3300046660 | Bacteria | 1647 |
| 1911 | Ga0495625_0151972 | 3300046660 | Bacteria | 1556 |
| 1912 | Ga0495625_0371219 | 3300046660 | Bacteria | 900 |
| 1913 | Ga0495625_0502195 | 3300046660 | Bacteria | 741 |
| 1914 | Ga0495635_0109018 | 3300046663 | Bacteria | 1892 |
| 1915 | Ga0495661_0039270 | 3300046665 | Bacteria | 2942 |
| 1916 | Ga0495657_0257287 | 3300046675 | Bacteria | 1050 |
| 1917 | Ga0495669_0276085 | 3300046684 | Bacteria | 808 |
| 1918 | Ga0495613_0181570 | 3300046689 | Bacteria | 1490 |
| 1919 | Ga0495670_0000010 | 3300046691 | Bacteria | 174071 |
| 1920 | Ga0495670_0019654 | 3300046691 | Bacteria | 3329 |
| 1921 | Ga0495671_0000014 | 3300046692 | Bacteria | 341431 |
| 1922 | Ga0495649_0277269 | 3300046694 | Bacteria | 857 |
| 1923 | Ga0495600_0464772 | 3300046809 | Bacteria | 781 |
| 1924 | Ga0495604_0234463 | 3300047317 | Bacteria | 1258 |
| 1925 | Ga0495674_0215529 | 3300047319 | Bacteria | 1589 |
| 1926 | Ga0495672_0000949 | 3300047320 | Bacteria | 30213 |
| 1927 | Ga0495672_0105363 | 3300047320 | Bacteria | 1522 |
| 1928 | Ga0495676_0980730 | 3300047321 | Bacteria | 540 |
| 1929 | Ga0495683_0171932 | 3300047323 | Bacteria | 995 |
| 1930 | Ga0495683_0329538 | 3300047323 | Bacteria | 649 |
| 1931 | Ga0495687_070086 | 3300047443 | Bacteria | 1409 |
| 1932 | Ga0495675_0511700 | 3300047444 | Bacteria | 688 |
| 1933 | Ga0495673_0143742 | 3300047469 | Bacteria | 928 |
| 1934 | Ga0495673_0170489 | 3300047469 | Bacteria | 830 |
| 1935 | Ga0495681_0000046 | 3300047470 | Bacteria | 111547 |
| 1936 | Ga0495681_0000062 | 3300047470 | Bacteria | 99851 |
| 1937 | Ga0495681_0024722 | 3300047470 | Bacteria | 3155 |
| 1938 | Ga0495681_0111775 | 3300047470 | Bacteria | 1182 |
| 1939 | Ga0495681_0207630 | 3300047470 | Bacteria | 791 |
| 1940 | Ga0495681_0241178 | 3300047470 | Bacteria | 717 |
| 1941 | Ga0495686_0000354 | 3300047472 | Bacteria | 75066 |
| 1942 | Ga0495686_0006459 | 3300047472 | Bacteria | 8969 |
| 1943 | Ga0495686_0017144 | 3300047472 | Bacteria | 4889 |
| 1944 | Ga0495686_0023999 | 3300047472 | Bacteria | 4011 |
| 1945 | Ga0495686_0214633 | 3300047472 | Bacteria | 1097 |
| 1946 | Ga0495593_0132220 | 3300047673 | Bacteria | 1266 |
| 1947 | Ga0495602_0544390 | 3300048088 | Bacteria | 805 |
| 1948 | Ga0495602_0601516 | 3300048088 | Bacteria | 756 |
| 1949 | Ga0495614_0330860 | 3300048089 | Bacteria | 708 |
| 1950 | Ga0495615_0000114 | 3300048090 | Bacteria | 20560 |
| 1951 | Ga0495626_0000459 | 3300048091 | Bacteria | 41540 |
| 1952 | Ga0496100_0000708 | 3300048903 | Bacteria | 15932 |
| 1953 | Ga0496100_0012625 | 3300048903 | Bacteria | 4848 |
| 1954 | Ga0496100_0088978 | 3300048903 | Bacteria | 2102 |
| 1955 | Ga0496100_0738193 | 3300048903 | Bacteria | 769 |
| 1956 | Ga0496100_0739231 | 3300048903 | Bacteria | 769 |
| 1957 | Ga0496100_0784641 | 3300048903 | Bacteria | 746 |
| 1958 | Ga0496100_1222405 | 3300048903 | Bacteria | 593 |
| 1959 | Ga0496101_0003342 | 3300048904 | Bacteria | 9992 |
| 1960 | Ga0496101_0006157 | 3300048904 | Bacteria | 7705 |
| 1961 | Ga0496101_0072704 | 3300048904 | Bacteria | 2524 |
| 1962 | Ga0496101_0171874 | 3300048904 | Bacteria | 1666 |
| 1963 | Ga0496101_0172161 | 3300048904 | Bacteria | 1664 |
| 1964 | Ga0496101_0269458 | 3300048904 | Bacteria | 1329 |
| 1965 | Ga0496101_0699349 | 3300048904 | Bacteria | 800 |
| 1966 | Ga0496102_0002803 | 3300048905 | Bacteria | 14861 |
| 1967 | Ga0496102_0150254 | 3300048905 | Bacteria | 2188 |
| 1968 | Ga0496102_0246461 | 3300048905 | Bacteria | 1684 |
| 1969 | Ga0496102_0263736 | 3300048905 | Bacteria | 1624 |
| 1970 | Ga0496102_0456756 | 3300048905 | Bacteria | 1198 |
| 1971 | Ga0496102_0792194 | 3300048905 | Bacteria | 870 |
| 1972 | Ga0496103_0001927 | 3300048906 | Bacteria | 13444 |
| 1973 | Ga0496103_0025181 | 3300048906 | Bacteria | 3595 |
| 1974 | Ga0496103_0031156 | 3300048906 | Bacteria | 3248 |
| 1975 | Ga0496103_0032759 | 3300048906 | Bacteria | 3173 |
| 1976 | Ga0496103_0166053 | 3300048906 | Bacteria | 1416 |
| 1977 | Ga0496103_0209714 | 3300048906 | Bacteria | 1253 |
| 1978 | Ga0496104_0000521 | 3300048907 | Bacteria | 32903 |
| 1979 | Ga0496104_0034766 | 3300048907 | Bacteria | 4700 |
| 1980 | Ga0496104_0045446 | 3300048907 | Bacteria | 4130 |
| 1981 | Ga0496104_0075540 | 3300048907 | Bacteria | 3208 |
| 1982 | Ga0496104_0081421 | 3300048907 | Bacteria | 3087 |
| 1983 | Ga0496104_0105804 | 3300048907 | Bacteria | 2696 |
| 1984 | Ga0496104_0123318 | 3300048907 | Bacteria | 2487 |
| 1985 | Ga0496104_0384608 | 3300048907 | Bacteria | 1316 |
| 1986 | Ga0496104_0620043 | 3300048907 | Bacteria | 991 |
| 1987 | Ga0496104_1507275 | 3300048907 | Bacteria | 575 |
| 1988 | Ga0496105_0000224 | 3300048908 | Bacteria | 38048 |
| 1989 | Ga0496105_0004218 | 3300048908 | Bacteria | 10799 |
| 1990 | Ga0496105_0017714 | 3300048908 | Bacteria | 5715 |
| 1991 | Ga0496105_0023279 | 3300048908 | Bacteria | 5022 |
| 1992 | Ga0496105_0045068 | 3300048908 | Bacteria | 3639 |
| 1993 | Ga0496105_0073984 | 3300048908 | Bacteria | 2814 |
| 1994 | Ga0496105_0245083 | 3300048908 | Bacteria | 1453 |
| 1995 | Ga0496105_0535018 | 3300048908 | Bacteria | 916 |
| 1996 | Ga0496105_0890584 | 3300048908 | Bacteria | 671 |
| 1997 | Ga0496106_0000171 | 3300048909 | Bacteria | 47281 |
| 1998 | Ga0496106_0001491 | 3300048909 | Bacteria | 17594 |
| 1999 | Ga0496106_0016755 | 3300048909 | Bacteria | 5422 |
| 2000 | Ga0496106_0247417 | 3300048909 | Bacteria | 1425 |
| 2001 | Ga0496106_0387377 | 3300048909 | Bacteria | 1123 |
| 2002 | Ga0496106_0400803 | 3300048909 | Bacteria | 1103 |
| 2003 | Ga0496106_0865491 | 3300048909 | Bacteria | 715 |
| 2004 | Ga0496106_0912581 | 3300048909 | Bacteria | 693 |
| 2005 | Ga0496106_1001594 | 3300048909 | Bacteria | 657 |
| 2006 | Ga0496107_0002333 | 3300048910 | Bacteria | 12249 |
| 2007 | Ga0496107_0006109 | 3300048910 | Bacteria | 8275 |
| 2008 | Ga0496108_0000270 | 3300048911 | Bacteria | 44669 |
| 2009 | Ga0496108_0010399 | 3300048911 | Bacteria | 7557 |
| 2010 | Ga0496108_0011935 | 3300048911 | Bacteria | 7068 |
| 2011 | Ga0496108_0040196 | 3300048911 | Bacteria | 3897 |
| 2012 | Ga0496108_0053300 | 3300048911 | Bacteria | 3392 |
| 2013 | Ga0496108_0317759 | 3300048911 | Bacteria | 1357 |
| 2014 | Ga0496109_0003581 | 3300048912 | Bacteria | 12965 |
| 2015 | Ga0496109_0005918 | 3300048912 | Bacteria | 10260 |
| 2016 | Ga0496109_0018512 | 3300048912 | Bacteria | 6117 |
| 2017 | Ga0496109_0019052 | 3300048912 | Bacteria | 6044 |
| 2018 | Ga0496109_0124323 | 3300048912 | Bacteria | 2404 |
| 2019 | Ga0496109_0131795 | 3300048912 | Bacteria | 2333 |
| 2020 | Ga0496109_0240083 | 3300048912 | Bacteria | 1705 |
| 2021 | Ga0496110_0000727 | 3300048913 | Bacteria | 22766 |
| 2022 | Ga0496110_0035372 | 3300048913 | Bacteria | 4333 |
| 2023 | Ga0496110_0060694 | 3300048913 | Bacteria | 3335 |
| 2024 | Ga0496110_0135456 | 3300048913 | Bacteria | 2225 |
| 2025 | Ga0496110_0158134 | 3300048913 | Bacteria | 2053 |
| 2026 | Ga0496110_0216349 | 3300048913 | Bacteria | 1742 |
| 2027 | Ga0496110_0249281 | 3300048913 | Bacteria | 1616 |
| 2028 | Ga0496110_0271362 | 3300048913 | Bacteria | 1544 |
| 2029 | Ga0496110_0582163 | 3300048913 | Bacteria | 1016 |
| 2030 | Ga0496110_1481549 | 3300048913 | Bacteria | 588 |
| 2031 | Ga0496111_0002340 | 3300048914 | Bacteria | 11422 |
| 2032 | Ga0496111_0008968 | 3300048914 | Bacteria | 6652 |
| 2033 | Ga0496111_0027330 | 3300048914 | Bacteria | 4035 |
| 2034 | Ga0496111_0392728 | 3300048914 | Bacteria | 1025 |
| 2035 | Ga0496111_0483177 | 3300048914 | Bacteria | 912 |
| 2036 | Ga0496111_0785082 | 3300048914 | Bacteria | 690 |
| 2037 | Ga0496111_1174580 | 3300048914 | Bacteria | 545 |
| 2038 | Ga0496111_1248166 | 3300048914 | Bacteria | 525 |
| 2039 | Ga0496112_0006537 | 3300048915 | Bacteria | 10251 |
| 2040 | Ga0496112_0010740 | 3300048915 | Bacteria | 8326 |
| 2041 | Ga0496112_0015294 | 3300048915 | Bacteria | 7155 |
| 2042 | Ga0496112_0079683 | 3300048915 | Bacteria | 3240 |
| 2043 | Ga0496112_0138104 | 3300048915 | Bacteria | 2407 |
| 2044 | Ga0496112_0172444 | 3300048915 | Bacteria | 2128 |
| 2045 | Ga0496112_0293746 | 3300048915 | Bacteria | 1571 |
| 2046 | Ga0496112_0458278 | 3300048915 | Bacteria | 1212 |
| 2047 | Ga0496113_0002327 | 3300048916 | Bacteria | 10980 |
| 2048 | Ga0496113_0002792 | 3300048916 | Bacteria | 10271 |
| 2049 | Ga0496113_0011945 | 3300048916 | Bacteria | 5820 |
| 2050 | Ga0496113_0018160 | 3300048916 | Bacteria | 4895 |
| 2051 | Ga0496113_0051757 | 3300048916 | Bacteria | 3065 |
| 2052 | Ga0496113_0182228 | 3300048916 | Bacteria | 1665 |
| 2053 | Ga0496113_0185350 | 3300048916 | Bacteria | 1650 |
| 2054 | Ga0496114_0012238 | 3300048917 | Bacteria | 6865 |
| 2055 | Ga0496114_0049077 | 3300048917 | Bacteria | 3511 |
| 2056 | Ga0496114_1063801 | 3300048917 | Bacteria | 693 |
| 2057 | Ga0496115_0000325 | 3300048918 | Bacteria | 40655 |
| 2058 | Ga0496115_0022580 | 3300048918 | Bacteria | 4877 |
| 2059 | Ga0496115_0126838 | 3300048918 | Bacteria | 2102 |
| 2060 | Ga0496115_0272478 | 3300048918 | Bacteria | 1390 |
| 2061 | Ga0496116_0000045 | 3300048919 | Bacteria | 324307 |
| 2062 | Ga0496116_0048305 | 3300048919 | Bacteria | 2857 |
| 2063 | Ga0496116_0085482 | 3300048919 | Bacteria | 1938 |
| 2064 | Ga0496116_0208824 | 3300048919 | Bacteria | 1014 |
| 2065 | Ga0496117_0015681 | 3300048920 | Bacteria | 6438 |
| 2066 | Ga0496117_0043619 | 3300048920 | Bacteria | 3258 |
| 2067 | Ga0496117_0182822 | 3300048920 | Bacteria | 1203 |
| 2068 | Ga0496117_0455486 | 3300048920 | Bacteria | 631 |
| 2069 | Ga0496118_0001632 | 3300048921 | Bacteria | 33061 |
| 2070 | Ga0496118_0079231 | 3300048921 | Bacteria | 2319 |
| 2071 | Ga0496118_0167629 | 3300048921 | Bacteria | 1347 |
| 2072 | Ga0496118_0200944 | 3300048921 | Bacteria | 1181 |
| 2073 | Ga0496118_0210434 | 3300048921 | Bacteria | 1141 |
| 2074 | Ga0496118_0441539 | 3300048921 | Bacteria | 663 |
| 2075 | Ga0496118_0453005 | 3300048921 | Bacteria | 651 |
| 2076 | Ga0496118_0514098 | 3300048921 | Bacteria | 592 |
| 2077 | Ga0496119_0009439 | 3300048922 | Bacteria | 8374 |
| 2078 | Ga0496119_0012109 | 3300048922 | Bacteria | 7044 |
| 2079 | Ga0496119_0307964 | 3300048922 | Bacteria | 779 |
| 2080 | Ga0496119_0313285 | 3300048922 | Bacteria | 770 |
| 2081 | Ga0496120_0096375 | 3300048923 | Bacteria | 1571 |
| 2082 | Ga0496120_0240170 | 3300048923 | Bacteria | 855 |
| 2083 | Ga0496120_0391774 | 3300048923 | Bacteria | 615 |
| 2084 | Ga0496121_0000017 | 3300048924 | Bacteria | 546415 |
| 2085 | Ga0496121_0000128 | 3300048924 | Bacteria | 168457 |
| 2086 | Ga0496121_0001842 | 3300048924 | Bacteria | 34183 |
| 2087 | Ga0496121_0003936 | 3300048924 | Bacteria | 20562 |
| 2088 | Ga0496121_0014449 | 3300048924 | Bacteria | 8378 |
| 2089 | Ga0496121_0016508 | 3300048924 | Bacteria | 7619 |
| 2090 | Ga0496121_0017871 | 3300048924 | Bacteria | 7198 |
| 2091 | Ga0496121_0027742 | 3300048924 | Bacteria | 5292 |
| 2092 | Ga0496121_0185075 | 3300048924 | Bacteria | 1499 |
| 2093 | Ga0496121_0190824 | 3300048924 | Bacteria | 1469 |
| 2094 | Ga0496121_0268463 | 3300048924 | Bacteria | 1174 |
| 2095 | Ga0496121_0325408 | 3300048924 | Bacteria | 1033 |
| 2096 | Ga0496121_0372495 | 3300048924 | Bacteria | 944 |
| 2097 | Ga0496121_0394494 | 3300048924 | Bacteria | 908 |
| 2098 | Ga0496122_0003264 | 3300048925 | Bacteria | 21512 |
| 2099 | Ga0496122_0012455 | 3300048925 | Bacteria | 8464 |
| 2100 | Ga0496122_0084726 | 3300048925 | Bacteria | 2190 |
| 2101 | Ga0496122_0157005 | 3300048925 | Bacteria | 1394 |
| 2102 | Ga0496122_0234297 | 3300048925 | Bacteria | 1041 |
| 2103 | Ga0496122_0311926 | 3300048925 | Bacteria | 841 |
| 2104 | Ga0496122_0507230 | 3300048925 | Bacteria | 584 |
| 2105 | Ga0496123_0002307 | 3300048926 | Bacteria | 23963 |
| 2106 | Ga0496123_0002815 | 3300048926 | Bacteria | 20643 |
| 2107 | Ga0496123_0059229 | 3300048926 | Bacteria | 2478 |
| 2108 | Ga0496123_0065788 | 3300048926 | Bacteria | 2301 |
| 2109 | Ga0496123_0067431 | 3300048926 | Bacteria | 2260 |
| 2110 | Ga0496123_0113838 | 3300048926 | Bacteria | 1539 |
| 2111 | Ga0496123_0259082 | 3300048926 | Bacteria | 853 |
| 2112 | Ga0496124_0010966 | 3300048927 | Bacteria | 9111 |
| 2113 | Ga0496124_0019874 | 3300048927 | Bacteria | 6231 |
| 2114 | Ga0496124_0020151 | 3300048927 | Bacteria | 6173 |
| 2115 | Ga0496124_0021231 | 3300048927 | Bacteria | 5986 |
| 2116 | Ga0496124_0037039 | 3300048927 | Bacteria | 4246 |
| 2117 | Ga0496124_0089650 | 3300048927 | Bacteria | 2510 |
| 2118 | Ga0496124_0145848 | 3300048927 | Bacteria | 1862 |
| 2119 | Ga0496124_0367649 | 3300048927 | Bacteria | 1011 |
| 2120 | Ga0496125_0009436 | 3300048928 | Bacteria | 10020 |
| 2121 | Ga0496125_0012308 | 3300048928 | Bacteria | 8499 |
| 2122 | Ga0496125_0013394 | 3300048928 | Bacteria | 8065 |
| 2123 | Ga0496125_0021356 | 3300048928 | Bacteria | 6041 |
| 2124 | Ga0496125_0042770 | 3300048928 | Bacteria | 3853 |
| 2125 | Ga0496125_0069740 | 3300048928 | Bacteria | 2755 |
| 2126 | Ga0496125_0333205 | 3300048928 | Bacteria | 914 |
| 2127 | Ga0496125_0544777 | 3300048928 | Bacteria | 644 |
| 2128 | Ga0496125_0564098 | 3300048928 | Bacteria | 628 |
| 2129 | Ga0496125_0753732 | 3300048928 | Bacteria | 510 |
| 2130 | Ga0496126_0000365 | 3300048929 | Bacteria | 93461 |
| 2131 | Ga0496126_0000568 | 3300048929 | Bacteria | 70707 |
| 2132 | Ga0496126_0031442 | 3300048929 | Bacteria | 5016 |
| 2133 | Ga0496126_0042950 | 3300048929 | Bacteria | 4173 |
| 2134 | Ga0496126_0047416 | 3300048929 | Bacteria | 3933 |
| 2135 | Ga0496126_0065970 | 3300048929 | Bacteria | 3237 |
| 2136 | Ga0496126_0154602 | 3300048929 | Bacteria | 1964 |
| 2137 | Ga0496126_1351587 | 3300048929 | Bacteria | 516 |
| 2138 | Ga0495678_010130 | 3300049459 | Bacteria | 4598 |
| 2139 | Ga0495678_128165 | 3300049459 | Bacteria | 844 |
| 2140 | Ga0495682_0163019 | 3300049460 | Bacteria | 794 |
| 2141 | Ga0501311_034984 | 3300049527 | Bacteria | 742 |
| 2142 | Ga0501311_073298 | 3300049527 | Bacteria | 571 |
| 2143 | Ga0501313_066165 | 3300049529 | Bacteria | 518 |
| 2144 | Ga0501314_013551 | 3300049530 | Bacteria | 791 |
| 2145 | Ga0501314_021872 | 3300049530 | Bacteria | 670 |
| 2146 | Ga0501317_048036 | 3300049533 | Bacteria | 670 |
| 2147 | Ga0501322_009290 | 3300049538 | Bacteria | 743 |
| 2148 | Ga0501334_11529 | 3300049550 | Bacteria | 648 |
| 2149 | Ga0501335_024020 | 3300049551 | Bacteria | 663 |
| 2150 | Ga0501031_0173637 | 3300049568 | Bacteria | 1408 |
| 2151 | Ga0501031_0338726 | 3300049568 | Bacteria | 974 |
| 2152 | Ga0501032_0017922 | 3300049569 | Bacteria | 4968 |
| 2153 | Ga0501032_0040485 | 3300049569 | Bacteria | 3168 |
| 2154 | Ga0501032_0144429 | 3300049569 | Bacteria | 1566 |
| 2155 | Ga0501032_0200349 | 3300049569 | Bacteria | 1303 |
| 2156 | Ga0501032_0532459 | 3300049569 | Bacteria | 749 |
| 2157 | Ga0501032_0666305 | 3300049569 | Bacteria | 660 |
| 2158 | Ga0501032_0992583 | 3300049569 | Bacteria | 527 |
| 2159 | Ga0501033_0007968 | 3300049570 | Bacteria | 8205 |
| 2160 | Ga0501033_0016714 | 3300049570 | Bacteria | 5549 |
| 2161 | Ga0501033_0076879 | 3300049570 | Bacteria | 2450 |
| 2162 | Ga0501033_0178915 | 3300049570 | Bacteria | 1521 |
| 2163 | Ga0501033_0413660 | 3300049570 | Bacteria | 939 |
| 2164 | Ga0501033_0459338 | 3300049570 | Bacteria | 884 |
| 2165 | Ga0501034_0000089 | 3300049571 | Bacteria | 165644 |
| 2166 | Ga0501034_0002186 | 3300049571 | Bacteria | 24191 |
| 2167 | Ga0501034_0007572 | 3300049571 | Bacteria | 11554 |
| 2168 | Ga0501034_0009998 | 3300049571 | Bacteria | 9911 |
| 2169 | Ga0501034_0056473 | 3300049571 | Bacteria | 3950 |
| 2170 | Ga0501034_0118260 | 3300049571 | Bacteria | 2637 |
| 2171 | Ga0501034_0256658 | 3300049571 | Bacteria | 1691 |
| 2172 | Ga0501034_0284235 | 3300049571 | Bacteria | 1593 |
| 2173 | Ga0501034_0310532 | 3300049571 | Bacteria | 1511 |
| 2174 | Ga0501034_0388576 | 3300049571 | Bacteria | 1319 |
| 2175 | Ga0501034_0887119 | 3300049571 | Bacteria | 780 |
| 2176 | Ga0501036_0002470 | 3300049572 | Bacteria | 14485 |
| 2177 | Ga0501036_0003258 | 3300049572 | Bacteria | 12948 |
| 2178 | Ga0501036_0028055 | 3300049572 | Bacteria | 4758 |
| 2179 | Ga0501036_0100626 | 3300049572 | Bacteria | 2445 |
| 2180 | Ga0501036_0100890 | 3300049572 | Bacteria | 2441 |
| 2181 | Ga0501036_0161118 | 3300049572 | Bacteria | 1891 |
| 2182 | Ga0501037_0009229 | 3300049573 | Bacteria | 7231 |
| 2183 | Ga0501037_0148798 | 3300049573 | Bacteria | 1674 |
| 2184 | Ga0501037_0166470 | 3300049573 | Bacteria | 1569 |
| 2185 | Ga0501037_0217469 | 3300049573 | Bacteria | 1345 |
| 2186 | Ga0501037_0259870 | 3300049573 | Bacteria | 1213 |
| 2187 | Ga0501037_0515667 | 3300049573 | Bacteria | 810 |
| 2188 | Ga0501038_0087146 | 3300049574 | Bacteria | 2622 |
| 2189 | Ga0501038_0114232 | 3300049574 | Bacteria | 2233 |
| 2190 | Ga0501038_0436995 | 3300049574 | Bacteria | 1008 |
| 2191 | Ga0501038_0680091 | 3300049574 | Bacteria | 773 |
| 2192 | Ga0501038_1364301 | 3300049574 | Bacteria | 510 |
| 2193 | Ga0501039_0065472 | 3300049575 | Bacteria | 2819 |
| 2194 | Ga0501039_0116878 | 3300049575 | Bacteria | 2088 |
| 2195 | Ga0501039_0442683 | 3300049575 | Bacteria | 1020 |
| 2196 | Ga0501039_0601038 | 3300049575 | Bacteria | 862 |
| 2197 | Ga0501040_0010428 | 3300049576 | Bacteria | 6076 |
| 2198 | Ga0501040_0104758 | 3300049576 | Bacteria | 1976 |
| 2199 | Ga0501040_0307954 | 3300049576 | Bacteria | 1132 |
| 2200 | Ga0501040_1086431 | 3300049576 | Bacteria | 580 |
| 2201 | Ga0501041_0169978 | 3300049577 | Bacteria | 1364 |
| 2202 | Ga0501042_0104688 | 3300049578 | Bacteria | 2036 |
| 2203 | Ga0501042_0633232 | 3300049578 | Bacteria | 778 |
| 2204 | Ga0501042_0639191 | 3300049578 | Bacteria | 773 |
| 2205 | Ga0501042_0710384 | 3300049578 | Bacteria | 731 |
| 2206 | Ga0501043_0206640 | 3300049579 | Bacteria | 1522 |
| 2207 | Ga0501043_0245024 | 3300049579 | Bacteria | 1381 |
| 2208 | Ga0501043_0323972 | 3300049579 | Bacteria | 1174 |
| 2209 | Ga0501043_0397103 | 3300049579 | Bacteria | 1042 |
| 2210 | Ga0501043_0599375 | 3300049579 | Bacteria | 814 |
| 2211 | Ga0501043_0770683 | 3300049579 | Bacteria | 698 |
| 2212 | Ga0501043_1140725 | 3300049579 | Bacteria | 549 |
| 2213 | Ga0501046_0000058 | 3300049580 | Bacteria | 127462 |
| 2214 | Ga0501046_0025198 | 3300049580 | Bacteria | 4870 |
| 2215 | Ga0501046_0064915 | 3300049580 | Bacteria | 2849 |
| 2216 | Ga0501046_0068840 | 3300049580 | Bacteria | 2754 |
| 2217 | Ga0501046_0112332 | 3300049580 | Bacteria | 2080 |
| 2218 | Ga0501046_0313040 | 3300049580 | Bacteria | 1145 |
| 2219 | Ga0501046_0457290 | 3300049580 | Unclassified | 917 |
| 2220 | Ga0501046_0583279 | 3300049580 | Bacteria | 794 |
| 2221 | Ga0501046_0759272 | 3300049580 | Bacteria | 681 |
| 2222 | Ga0501046_1219056 | 3300049580 | Bacteria | 516 |
| 2223 | Ga0501047_0000097 | 3300049581 | Bacteria | 107310 |
| 2224 | Ga0501047_0026712 | 3300049581 | Bacteria | 5557 |
| 2225 | Ga0501047_0033769 | 3300049581 | Bacteria | 4938 |
| 2226 | Ga0501047_0066831 | 3300049581 | Bacteria | 3466 |
| 2227 | Ga0501047_0258739 | 3300049581 | Bacteria | 1588 |
| 2228 | Ga0501047_0431512 | 3300049581 | Bacteria | 1148 |
| 2229 | Ga0501047_0465574 | 3300049581 | Bacteria | 1092 |
| 2230 | Ga0501047_0495578 | 3300049581 | Bacteria | 1048 |
| 2231 | Ga0501047_0615752 | 3300049581 | Bacteria | 906 |
| 2232 | Ga0501047_0657915 | 3300049581 | Bacteria | 867 |
| 2233 | Ga0501047_0822508 | 3300049581 | Bacteria | 743 |
| 2234 | Ga0501047_0863175 | 3300049581 | Bacteria | 719 |
| 2235 | Ga0501048_0001777 | 3300049582 | Bacteria | 16389 |
| 2236 | Ga0501048_0094504 | 3300049582 | Bacteria | 2109 |
| 2237 | Ga0501048_0121964 | 3300049582 | Bacteria | 1842 |
| 2238 | Ga0501048_0172033 | 3300049582 | Bacteria | 1534 |
| 2239 | Ga0501048_0510115 | 3300049582 | Bacteria | 862 |
| 2240 | Ga0501048_0597836 | 3300049582 | Bacteria | 792 |
| 2241 | Ga0501048_0847012 | 3300049582 | Bacteria | 657 |
| 2242 | Ga0501048_0998715 | 3300049582 | Bacteria | 602 |
| 2243 | Ga0501067_0010136 | 3300049583 | Bacteria | 5212 |
| 2244 | Ga0501067_0067680 | 3300049583 | Bacteria | 1977 |
| 2245 | Ga0501067_0168573 | 3300049583 | Bacteria | 1220 |
| 2246 | Ga0501067_0268333 | 3300049583 | Bacteria | 950 |
| 2247 | Ga0501067_0668564 | 3300049583 | Bacteria | 583 |
| 2248 | Ga0501068_0019141 | 3300049584 | Bacteria | 3971 |
| 2249 | Ga0501068_0177162 | 3300049584 | Bacteria | 1347 |
| 2250 | Ga0501068_0374610 | 3300049584 | Bacteria | 916 |
| 2251 | Ga0501068_0565874 | 3300049584 | Bacteria | 739 |
| 2252 | Ga0501069_0003384 | 3300049585 | Bacteria | 8188 |
| 2253 | Ga0501069_0011661 | 3300049585 | Bacteria | 4660 |
| 2254 | Ga0501069_0021339 | 3300049585 | Bacteria | 3513 |
| 2255 | Ga0501069_0060396 | 3300049585 | Bacteria | 2116 |
| 2256 | Ga0501069_0063967 | 3300049585 | Bacteria | 2055 |
| 2257 | Ga0501069_0295308 | 3300049585 | Bacteria | 950 |
| 2258 | Ga0501069_0777613 | 3300049585 | Bacteria | 580 |
| 2259 | Ga0501070_0008856 | 3300049586 | Bacteria | 8506 |
| 2260 | Ga0501070_0030273 | 3300049586 | Bacteria | 4535 |
| 2261 | Ga0501070_0094098 | 3300049586 | Bacteria | 2479 |
| 2262 | Ga0501070_0178014 | 3300049586 | Bacteria | 1750 |
| 2263 | Ga0501070_0333171 | 3300049586 | Bacteria | 1233 |
| 2264 | Ga0501070_0488029 | 3300049586 | Bacteria | 990 |
| 2265 | Ga0501070_0781897 | 3300049586 | Bacteria | 751 |
| 2266 | Ga0501070_1212261 | 3300049586 | Bacteria | 579 |
| 2267 | Ga0501071_0013639 | 3300049587 | Bacteria | 5541 |
| 2268 | Ga0501071_0244426 | 3300049587 | Bacteria | 1353 |
| 2269 | Ga0501071_0446407 | 3300049587 | Bacteria | 990 |
| 2270 | Ga0501072_0041181 | 3300049588 | Bacteria | 3627 |
| 2271 | Ga0501072_0042687 | 3300049588 | Bacteria | 3562 |
| 2272 | Ga0501072_0261799 | 3300049588 | Bacteria | 1376 |
| 2273 | Ga0501072_0330079 | 3300049588 | Bacteria | 1212 |
| 2274 | Ga0501072_0344974 | 3300049588 | Bacteria | 1182 |
| 2275 | Ga0501072_0394663 | 3300049588 | Bacteria | 1097 |
| 2276 | Ga0501072_0438394 | 3300049588 | Bacteria | 1035 |
| 2277 | Ga0501072_1407628 | 3300049588 | Bacteria | 539 |
| 2278 | Ga0501072_1562280 | 3300049588 | Bacteria | 509 |
| 2279 | Ga0501073_0104971 | 3300049589 | Bacteria | 1961 |
| 2280 | Ga0501073_0162062 | 3300049589 | Bacteria | 1549 |
| 2281 | Ga0501073_0260852 | 3300049589 | Bacteria | 1196 |
| 2282 | Ga0501073_0344055 | 3300049589 | Bacteria | 1029 |
| 2283 | Ga0501073_0395722 | 3300049589 | Bacteria | 954 |
| 2284 | Ga0501073_0601853 | 3300049589 | Bacteria | 759 |
| 2285 | Ga0501073_1066095 | 3300049589 | Bacteria | 556 |
| 2286 | Ga0501074_0005920 | 3300049590 | Bacteria | 8816 |
| 2287 | Ga0501074_0088240 | 3300049590 | Bacteria | 2221 |
| 2288 | Ga0501074_0090189 | 3300049590 | Bacteria | 2195 |
| 2289 | Ga0501074_0095446 | 3300049590 | Bacteria | 2130 |
| 2290 | Ga0501074_0233823 | 3300049590 | Bacteria | 1308 |
| 2291 | Ga0501074_0328918 | 3300049590 | Bacteria | 1085 |
| 2292 | Ga0501074_0407258 | 3300049590 | Bacteria | 964 |
| 2293 | Ga0501074_0637862 | 3300049590 | Bacteria | 753 |
| 2294 | Ga0501075_0050918 | 3300049591 | Bacteria | 3113 |
| 2295 | Ga0501075_0332423 | 3300049591 | Bacteria | 1158 |
| 2296 | Ga0501075_0715526 | 3300049591 | Bacteria | 762 |
| 2297 | Ga0501075_1008779 | 3300049591 | Bacteria | 632 |
| 2298 | Ga0501076_0013557 | 3300049592 | Bacteria | 6111 |
| 2299 | Ga0501076_0024210 | 3300049592 | Bacteria | 4690 |
| 2300 | Ga0501076_0079146 | 3300049592 | Bacteria | 2638 |
| 2301 | Ga0501076_0614010 | 3300049592 | Bacteria | 897 |
| 2302 | Ga0501077_0002811 | 3300049593 | Bacteria | 10442 |
| 2303 | Ga0501077_0041128 | 3300049593 | Bacteria | 2943 |
| 2304 | Ga0501077_0097383 | 3300049593 | Bacteria | 1864 |
| 2305 | Ga0501077_0154000 | 3300049593 | Bacteria | 1459 |
| 2306 | Ga0501077_0370705 | 3300049593 | Bacteria | 914 |
| 2307 | Ga0501077_0864776 | 3300049593 | Bacteria | 581 |
| 2308 | Ga0501224_002711 | 3300049664 | Bacteria | 2437 |
| 2309 | Ga0501227_190098 | 3300049665 | Bacteria | 579 |
| 2310 | Ga0501248_007378 | 3300049678 | Bacteria | 918 |
| 2311 | Ga0501249_012622 | 3300049679 | Bacteria | 1787 |
| 2312 | Ga0501253_058522 | 3300049683 | Bacteria | 825 |
| 2313 | Ga0501257_149816 | 3300049686 | Bacteria | 643 |
| 2314 | Ga0501079_0113836 | 3300049741 | Bacteria | 2103 |
| 2315 | Ga0501079_0204732 | 3300049741 | Bacteria | 1541 |
| 2316 | Ga0501079_0296612 | 3300049741 | Bacteria | 1264 |
| 2317 | Ga0501079_0346874 | 3300049741 | Bacteria | 1163 |
| 2318 | Ga0501079_0836975 | 3300049741 | Bacteria | 724 |
| 2319 | Ga0501080_0000045 | 3300049742 | Bacteria | 79211 |
| 2320 | Ga0501080_0025689 | 3300049742 | Bacteria | 5470 |
| 2321 | Ga0501080_0026650 | 3300049742 | Bacteria | 5370 |
| 2322 | Ga0501080_0115490 | 3300049742 | Bacteria | 2489 |
| 2323 | Ga0501080_1031409 | 3300049742 | Bacteria | 712 |
| 2324 | Ga0501080_1353415 | 3300049742 | Bacteria | 608 |
| 2325 | Ga0501081_0081250 | 3300049743 | Bacteria | 2270 |
| 2326 | Ga0501081_0088169 | 3300049743 | Bacteria | 2179 |
| 2327 | Ga0501081_0187943 | 3300049743 | Bacteria | 1495 |
| 2328 | Ga0501081_0366046 | 3300049743 | Bacteria | 1064 |
| 2329 | Ga0501083_0008419 | 3300049744 | Bacteria | 7290 |
| 2330 | Ga0501083_0015459 | 3300049744 | Bacteria | 5345 |
| 2331 | Ga0501083_0126870 | 3300049744 | Bacteria | 1673 |
| 2332 | Ga0501083_0221159 | 3300049744 | Bacteria | 1233 |
| 2333 | Ga0501083_0401085 | 3300049744 | Bacteria | 892 |
| 2334 | Ga0501083_0591541 | 3300049744 | Bacteria | 722 |
| 2335 | Ga0501083_0780607 | 3300049744 | Bacteria | 622 |
| 2336 | Ga0501241_016730 | 3300049758 | Bacteria | 1338 |
| 2337 | Ga0501282_027800 | 3300049778 | Bacteria | 639 |
| 2338 | Ga0501035_0001208 | 3300049822 | Bacteria | 26922 |
| 2339 | Ga0501035_0081680 | 3300049822 | Bacteria | 2852 |
| 2340 | Ga0501035_0331216 | 3300049822 | Bacteria | 1277 |
| 2341 | Ga0501035_0673981 | 3300049822 | Bacteria | 836 |
| 2342 | Ga0501044_0002552 | 3300049823 | Bacteria | 20740 |
| 2343 | Ga0501044_0010970 | 3300049823 | Bacteria | 9835 |
| 2344 | Ga0501044_0012045 | 3300049823 | Bacteria | 9365 |
| 2345 | Ga0501044_0115709 | 3300049823 | Bacteria | 2687 |
| 2346 | Ga0501044_0137965 | 3300049823 | Bacteria | 2428 |
| 2347 | Ga0501044_0151534 | 3300049823 | Bacteria | 2301 |
| 2348 | Ga0501044_0425008 | 3300049823 | Bacteria | 1238 |
| 2349 | Ga0501044_0628645 | 3300049823 | Bacteria | 964 |
| 2350 | Ga0501044_0631558 | 3300049823 | Bacteria | 961 |
| 2351 | Ga0501044_0764053 | 3300049823 | Bacteria | 848 |
| 2352 | Ga0501044_0938970 | 3300049823 | Bacteria | 738 |
| 2353 | Ga0501044_0989905 | 3300049823 | Bacteria | 713 |
| 2354 | Ga0501044_1502438 | 3300049823 | Bacteria | 539 |
| 2355 | Ga0501044_1554325 | 3300049823 | Bacteria | 526 |
| 2356 | Ga0501045_0016406 | 3300049824 | Bacteria | 5259 |
| 2357 | Ga0501045_0964239 | 3300049824 | Bacteria | 626 |
| 2358 | nmdc:mga03683_189888_c1 | 3300050489 | Bacteria | 940 |
| 2359 | nmdc:mga03683_2_c1 | 3300050489 | Bacteria | 289140 |
| 2360 | nmdc:mga03683_308774_c1 | 3300050489 | Bacteria | 743 |
| 2361 | nmdc:mga03683_51312_c1 | 3300050489 | Bacteria | 1721 |
| 2362 | nmdc:mga03683_543904_c1 | 3300050489 | Bacteria | 565 |
| 2363 | nmdc:mga03683_61_c1 | 3300050489 | Bacteria | 41527 |
| 2364 | nmdc:mga03683_88534_c1 | 3300050489 | Bacteria | 1347 |
| 2365 | nmdc:mga03n38_131721_c1 | 3300050490 | Bacteria | 1240 |
| 2366 | nmdc:mga03n38_1829_c1 | 3300050490 | Bacteria | 6336 |
| 2367 | nmdc:mga03n38_227884_c1 | 3300050490 | Bacteria | 976 |
| 2368 | nmdc:mga03n38_287541_c1 | 3300050490 | Bacteria | 879 |
| 2369 | nmdc:mga03n38_372525_c1 | 3300050490 | Bacteria | 781 |
| 2370 | nmdc:mga03n38_526_c1 | 3300050490 | Bacteria | 9692 |
| 2371 | nmdc:mga00v17_1044520_c1 | 3300050491 | Bacteria | 513 |
| 2372 | nmdc:mga00v17_1089555_c1 | 3300050491 | Bacteria | 500 |
| 2373 | nmdc:mga00v17_1572_c1 | 3300050491 | Bacteria | 11922 |
| 2374 | nmdc:mga00v17_179731_c1 | 3300050491 | Bacteria | 1365 |
| 2375 | nmdc:mga00v17_26014_c1 | 3300050491 | Bacteria | 3406 |
| 2376 | nmdc:mga00v17_40398_c1 | 3300050491 | Bacteria | 2798 |
| 2377 | nmdc:mga00v17_992721_c1 | 3300050491 | Bacteria | 529 |
| 2378 | nmdc:mga0yw44_19458_c1 | 3300050492 | Bacteria | 3745 |
| 2379 | nmdc:mga0yw44_202483_c1 | 3300050492 | Bacteria | 1311 |
| 2380 | nmdc:mga0yw44_620001_c1 | 3300050492 | Bacteria | 735 |
| 2381 | nmdc:mga0k408_12410_c1 | 3300050493 | Bacteria | 4657 |
| 2382 | nmdc:mga0k408_174625_c1 | 3300050493 | Bacteria | 1281 |
| 2383 | nmdc:mga0k408_240791_c1 | 3300050493 | Bacteria | 1080 |
| 2384 | nmdc:mga0k408_258052_c1 | 3300050493 | Bacteria | 1041 |
| 2385 | nmdc:mga0k408_2_c1 | 3300050493 | Bacteria | 395671 |
| 2386 | nmdc:mga0k408_3799_c1 | 3300050493 | Bacteria | 8002 |
| 2387 | nmdc:mga0k408_597285_c1 | 3300050493 | Bacteria | 651 |
| 2388 | nmdc:mga0k408_635812_c1 | 3300050493 | Bacteria | 628 |
| 2389 | nmdc:mga06z11_332_c1 | 3300050494 | Bacteria | 17928 |
| 2390 | nmdc:mga06z11_3726_c1 | 3300050494 | Bacteria | 5921 |
| 2391 | nmdc:mga06z11_38986_c1 | 3300050494 | Bacteria | 2363 |
| 2392 | nmdc:mga06z11_39210_c1 | 3300050494 | Bacteria | 2356 |
| 2393 | nmdc:mga06z11_40485_c1 | 3300050494 | Bacteria | 2326 |
| 2394 | nmdc:mga06z11_47_c1 | 3300050494 | Bacteria | 51206 |
| 2395 | nmdc:mga06z11_49020_c1 | 3300050494 | Bacteria | 2153 |
| 2396 | nmdc:mga06z11_88737_c1 | 3300050494 | Bacteria | 1675 |
| 2397 | nmdc:mga04h51_14887_c1 | 3300050495 | Bacteria | 2232 |
| 2398 | nmdc:mga04h51_182_c1 | 3300050495 | Bacteria | 17567 |
| 2399 | nmdc:mga04h51_187_c1 | 3300050495 | Bacteria | 17156 |
| 2400 | nmdc:mga04h51_4410_c1 | 3300050495 | Bacteria | 3500 |
| 2401 | nmdc:mga07m45_108019_c1 | 3300050496 | Bacteria | 1601 |
| 2402 | nmdc:mga07m45_1364_c1 | 3300050496 | Bacteria | 11133 |
| 2403 | nmdc:mga07m45_151799_c1 | 3300050496 | Bacteria | 1344 |
| 2404 | nmdc:mga07m45_152392_c1 | 3300050496 | Bacteria | 1341 |
| 2405 | nmdc:mga07m45_191370_c1 | 3300050496 | Bacteria | 1190 |
| 2406 | nmdc:mga07m45_20437_c1 | 3300050496 | Bacteria | 3595 |
| 2407 | nmdc:mga07m45_23094_c1 | 3300050496 | Bacteria | 3398 |
| 2408 | nmdc:mga07m45_26_c1 | 3300050496 | Bacteria | 94168 |
| 2409 | nmdc:mga07m45_283946_c1 | 3300050496 | Bacteria | 963 |
| 2410 | nmdc:mga07m45_55881_c1 | 3300050496 | Bacteria | 2231 |
| 2411 | nmdc:mga05p37_1758866_c1 | 3300050507 | Bacteria | 601 |
| 2412 | nmdc:mga05p37_742319_c1 | 3300050507 | Unclassified | 1083 |
| 2413 | nmdc:mga05p37_949199_c1 | 3300050507 | Bacteria | 921 |
| 2414 | nmdc:mga09592_230970_c1 | 3300050508 | Bacteria | 1603 |
| 2415 | nmdc:mga09592_29697_c1 | 3300050508 | Bacteria | 4546 |
| 2416 | nmdc:mga0qj67_186566_c1 | 3300050509 | Bacteria | 1685 |
| 2417 | nmdc:mga0qj67_27585_c1 | 3300050509 | Bacteria | 4403 |
| 2418 | nmdc:mga0qj67_813960_c1 | 3300050509 | Bacteria | 739 |
| 2419 | nmdc:mga0qj67_990138_c1 | 3300050509 | Unclassified | 660 |
| 2420 | nmdc:mga06r32_5167_c1 | 3300050510 | Bacteria | 11729 |
| 2421 | nmdc:mga08y16_55896_c1 | 3300050511 | Bacteria | 4124 |
| 2422 | nmdc:mga0n895_404601_c1 | 3300050512 | Bacteria | 1380 |
| 2423 | nmdc:mga0n895_457599_c1 | 3300050512 | Bacteria | 1288 |
| 2424 | nmdc:mga0rr50_1285414_c1 | 3300050513 | Bacteria | 621 |
| 2425 | nmdc:mga0rr50_201409_c1 | 3300050513 | Bacteria | 1636 |
| 2426 | nmdc:mga0rr50_813484_c1 | 3300050513 | Bacteria | 797 |
| 2427 | nmdc:mga08x19_16664_c1 | 3300050514 | Bacteria | 4485 |
| 2428 | nmdc:mga0a205_298312_c1 | 3300050515 | Bacteria | 1485 |
| 2429 | nmdc:mga0a205_44519_c1 | 3300050515 | Bacteria | 4279 |
| 2430 | nmdc:mga0a205_871553_c1 | 3300050515 | Bacteria | 747 |
| 2431 | nmdc:mga0sz30_1158_c1 | 3300050516 | Bacteria | 9448 |
| 2432 | nmdc:mga0sz30_156233_c1 | 3300050516 | Bacteria | 1010 |
| 2433 | nmdc:mga0sz30_196701_c2 | 3300050516 | Bacteria | 514 |
| 2434 | nmdc:mga0sz30_219875_c1 | 3300050516 | Bacteria | 844 |
| 2435 | nmdc:mga0sz30_3200_c1 | 3300050516 | Bacteria | 3029 |
| 2436 | nmdc:mga0sz30_44210_c1 | 3300050516 | Bacteria | 1876 |
| 2437 | Ga0495601_0050386 | 3300053077 | Bacteria | 2626 |
| 2438 | Ga0495612_0271102 | 3300053078 | Bacteria | 757 |
| 2439 | Ga0495619_0143229 | 3300053085 | Bacteria | 1647 |
| 2440 | Ga0500578_0179768 | 3300053086 | Bacteria | 1304 |
| 2441 | Ga0500643_000005 | 3300053087 | Bacteria | 539775 |
| 2442 | Ga0500643_011852 | 3300053087 | Bacteria | 3155 |
| 2443 | Ga0500643_045660 | 3300053087 | Bacteria | 1268 |
| 2444 | Ga0500647_0092474 | 3300053091 | Bacteria | 1447 |
| 2445 | Ga0500647_0192714 | 3300053091 | Bacteria | 929 |
| 2446 | Ga0500583_0316102 | 3300053092 | Bacteria | 762 |
| 2447 | Ga0500651_0014119 | 3300053093 | Bacteria | 4882 |
| 2448 | Ga0500651_0162496 | 3300053093 | Bacteria | 1335 |
| 2449 | Ga0500651_0327603 | 3300053093 | Bacteria | 873 |
| 2450 | Ga0500566_0000259 | 3300053094 | Bacteria | 28513 |
| 2451 | Ga0500641_0000659 | 3300053096 | Bacteria | 12423 |
| 2452 | Ga0500641_0006777 | 3300053096 | Bacteria | 4075 |
| 2453 | Ga0500641_0009270 | 3300053096 | Bacteria | 3536 |
| 2454 | Ga0500641_0294615 | 3300053096 | Bacteria | 668 |
| 2455 | Ga0500555_070730 | 3300053103 | Bacteria | 921 |
| 2456 | Ga0500562_000398 | 3300053108 | Bacteria | 10551 |
| 2457 | Ga0500562_015570 | 3300053108 | Bacteria | 1952 |
| 2458 | Ga0500562_035044 | 3300053108 | Bacteria | 1329 |
| 2459 | Ga0500562_077438 | 3300053108 | Bacteria | 899 |
| 2460 | Ga0500569_005008 | 3300053109 | Bacteria | 2824 |
| 2461 | Ga0500572_084547 | 3300053111 | Bacteria | 998 |
| 2462 | Ga0500572_103445 | 3300053111 | Bacteria | 912 |
| 2463 | Ga0500592_008128 | 3300053116 | Bacteria | 1663 |
| 2464 | Ga0500592_054953 | 3300053116 | Bacteria | 649 |
| 2465 | Ga0500594_0027842 | 3300053118 | Bacteria | 1466 |
| 2466 | Ga0500594_0029841 | 3300053118 | Bacteria | 1428 |
| 2467 | Ga0500594_0053854 | 3300053118 | Bacteria | 1141 |
| 2468 | Ga0500595_002712 | 3300053119 | Bacteria | 8578 |
| 2469 | Ga0500595_007699 | 3300053119 | Bacteria | 4453 |
| 2470 | Ga0500595_008471 | 3300053119 | Bacteria | 4196 |
| 2471 | Ga0500595_013870 | 3300053119 | Bacteria | 3074 |
| 2472 | Ga0500595_120560 | 3300053119 | Bacteria | 741 |
| 2473 | Ga0500597_181793 | 3300053120 | Bacteria | 891 |
| 2474 | Ga0500607_000060 | 3300053121 | Bacteria | 77770 |
| 2475 | Ga0500607_000152 | 3300053121 | Bacteria | 59345 |
| 2476 | Ga0500608_000074 | 3300053122 | Bacteria | 42636 |
| 2477 | Ga0500608_002556 | 3300053122 | Bacteria | 6646 |
| 2478 | Ga0500614_010872 | 3300053123 | Bacteria | 1960 |
| 2479 | Ga0500614_143692 | 3300053123 | Bacteria | 715 |
| 2480 | Ga0500618_002141 | 3300053125 | Bacteria | 7758 |
| 2481 | Ga0500618_010860 | 3300053125 | Bacteria | 2431 |
| 2482 | Ga0500626_064675 | 3300053128 | Bacteria | 1633 |
| 2483 | Ga0500652_000198 | 3300053131 | Bacteria | 23141 |
| 2484 | Ga0500652_156648 | 3300053131 | Bacteria | 943 |
| 2485 | Ga0500658_0001309 | 3300053134 | Bacteria | 10078 |
| 2486 | Ga0500658_0049193 | 3300053134 | Bacteria | 1717 |
| 2487 | Ga0500658_0088968 | 3300053134 | Bacteria | 1332 |
| 2488 | Ga0500559_0003528 | 3300053136 | Bacteria | 7662 |
| 2489 | Ga0500559_0009475 | 3300053136 | Bacteria | 4213 |
| 2490 | Ga0500564_214222 | 3300053138 | Bacteria | 783 |
| 2491 | Ga0500568_0006304 | 3300053139 | Bacteria | 5974 |
| 2492 | Ga0500568_0060966 | 3300053139 | Bacteria | 1460 |
| 2493 | Ga0500568_0342059 | 3300053139 | Bacteria | 542 |
| 2494 | Ga0500573_0000010 | 3300053140 | Bacteria | 210704 |
| 2495 | Ga0500573_0058350 | 3300053140 | Bacteria | 2213 |
| 2496 | Ga0500577_0173127 | 3300053142 | Bacteria | 924 |
| 2497 | Ga0500588_0041045 | 3300053146 | Bacteria | 1394 |
| 2498 | Ga0500588_0270775 | 3300053146 | Bacteria | 640 |
| 2499 | Ga0500590_001355 | 3300053148 | Bacteria | 9974 |
| 2500 | Ga0500590_067276 | 3300053148 | Bacteria | 1788 |
| 2501 | Ga0500590_090953 | 3300053148 | Bacteria | 1482 |
| 2502 | Ga0500604_0018944 | 3300053151 | Bacteria | 1923 |
| 2503 | Ga0500604_0100552 | 3300053151 | Bacteria | 953 |
| 2504 | Ga0500604_0125217 | 3300053151 | Bacteria | 861 |
| 2505 | Ga0500604_0208186 | 3300053151 | Bacteria | 673 |
| 2506 | Ga0500616_0001865 | 3300053153 | Bacteria | 19033 |
| 2507 | Ga0500616_0005539 | 3300053153 | Bacteria | 8555 |
| 2508 | Ga0500616_0134187 | 3300053153 | Bacteria | 1166 |
| 2509 | Ga0500616_0209444 | 3300053153 | Bacteria | 858 |
| 2510 | Ga0500619_027359 | 3300053154 | Bacteria | 1707 |
| 2511 | Ga0500620_057430 | 3300053155 | Bacteria | 1318 |
| 2512 | Ga0500622_0012682 | 3300053156 | Bacteria | 4560 |
| 2513 | Ga0500622_0334066 | 3300053156 | Bacteria | 634 |
| 2514 | Ga0500624_000005 | 3300053157 | Bacteria | 187122 |
| 2515 | Ga0500627_0000009 | 3300053158 | Bacteria | 153203 |
| 2516 | Ga0500627_0056561 | 3300053158 | Bacteria | 1719 |
| 2517 | Ga0500638_143809 | 3300053162 | Bacteria | 1068 |
| 2518 | Ga0500638_152825 | 3300053162 | Bacteria | 1025 |
| 2519 | Ga0500636_0308214 | 3300053177 | Bacteria | 776 |
| 2520 | Ga0500567_003234 | 3300053723 | Bacteria | 7213 |
| 2521 | Ga0500625_000004 | 3300053729 | Bacteria | 245905 |
| 2522 | Ga0500645_003136 | 3300053730 | Bacteria | 6883 |
| 2523 | Ga0500645_075751 | 3300053730 | Bacteria | 963 |
| 2524 | Ga0500656_075007 | 3300053732 | Bacteria | 526 |
| 2525 | Ga0500552_044069 | 3300053733 | Bacteria | 736 |
| 2526 | Ga0500552_096926 | 3300053733 | Bacteria | 557 |
| 2527 | Ga0500596_001392 | 3300053735 | Bacteria | 4888 |
| 2528 | Ga0501084_0005823 | 3300054114 | Bacteria | 10144 |
| 2529 | Ga0501084_0310208 | 3300054114 | Bacteria | 1332 |
| 2530 | Ga0501084_0679721 | 3300054114 | Bacteria | 868 |
| 2531 | Ga0587084_010598 | 3300059477 | Bacteria | 1211 |
| 2532 | Ga0587084_033847 | 3300059477 | Bacteria | 837 |
| 2533 | Ga0587093_029285 | 3300059478 | Bacteria | 784 |
| 2534 | Ga0587070_044808 | 3300059491 | Bacteria | 861 |
| 2535 | Ga0587070_069660 | 3300059491 | Bacteria | 747 |
| 2536 | Ga0587070_086986 | 3300059491 | Bacteria | 696 |
| 2537 | Ga0587070_090623 | 3300059491 | Bacteria | 687 |
| 2538 | Ga0587073_0144873 | 3300059492 | Bacteria | 666 |
| 2539 | Ga0587077_094062 | 3300059493 | Bacteria | 709 |
| 2540 | Ga0587077_118346 | 3300059493 | Bacteria | 658 |
| 2541 | Ga0587077_137970 | 3300059493 | Bacteria | 625 |
| 2542 | Ga0587082_063565 | 3300059504 | Bacteria | 733 |
| 2543 | Ga0587082_070831 | 3300059504 | Bacteria | 708 |
| 2544 | Ga0587082_083955 | 3300059504 | Bacteria | 668 |
| 2545 | Ga0587083_0128226 | 3300059505 | Bacteria | 663 |
| 2546 | Ga0587085_112733 | 3300059506 | Bacteria | 588 |
| 2547 | Ga0587086_023832 | 3300059507 | Bacteria | 856 |
| 2548 | Ga0587086_037199 | 3300059507 | Bacteria | 739 |
| 2549 | Ga0587086_052061 | 3300059507 | Bacteria | 662 |
| 2550 | Ga0587088_005977 | 3300059508 | Bacteria | 1623 |
| 2551 | Ga0587088_184216 | 3300059508 | Bacteria | 525 |
| 2552 | Ga0587089_031636 | 3300059509 | Bacteria | 783 |
| 2553 | Ga0587090_044225 | 3300059510 | Bacteria | 795 |
| 2554 | Ga0587090_054494 | 3300059510 | Bacteria | 742 |
| 2555 | Ga0587090_059379 | 3300059510 | Bacteria | 722 |
| 2556 | Ga0587090_075884 | 3300059510 | Bacteria | 665 |
| 2557 | Ga0587091_008973 | 3300059511 | Bacteria | 1493 |
| 2558 | Ga0587091_031859 | 3300059511 | Bacteria | 994 |
| 2559 | Ga0587091_054643 | 3300059511 | Bacteria | 830 |
| 2560 | Ga0587091_058928 | 3300059511 | Bacteria | 810 |
| 2561 | Ga0587091_099441 | 3300059511 | Bacteria | 680 |
| 2562 | Ga0587091_104615 | 3300059511 | Bacteria | 668 |
| 2563 | Ga0587091_109358 | 3300059511 | Bacteria | 658 |
| 2564 | Ga0587092_079574 | 3300059512 | Bacteria | 645 |
| 2565 | Ga0587092_120063 | 3300059512 | Bacteria | 561 |
| 2566 | Ga0587094_030473 | 3300059513 | Bacteria | 834 |
| 2567 | Ga0587098_014190 | 3300059604 | Bacteria | 937 |
| 2568 | Ga0587106_003817 | 3300059605 | Bacteria | 1614 |
| 2569 | Ga0587106_064527 | 3300059605 | Bacteria | 680 |
| 2570 | Ga0587125_013380 | 3300059607 | Bacteria | 886 |
| 2571 | Ga0587129_007039 | 3300059608 | Bacteria | 808 |
| 2572 | Ga0587101_063203 | 3300059623 | Bacteria | 666 |
| 2573 | Ga0587109_053459 | 3300059624 | Bacteria | 834 |
| 2574 | Ga0587109_111546 | 3300059624 | Bacteria | 640 |
| 2575 | Ga0587115_027471 | 3300059626 | Bacteria | 828 |
| 2576 | Ga0587115_028126 | 3300059626 | Bacteria | 822 |
| 2577 | Ga0587115_049365 | 3300059626 | Bacteria | 679 |
| 2578 | Ga0587115_053735 | 3300059626 | Bacteria | 660 |
| 2579 | Ga0587128_021056 | 3300059630 | Bacteria | 1002 |
| 2580 | Ga0587128_051545 | 3300059630 | Bacteria | 753 |
| 2581 | Ga0587128_060599 | 3300059630 | Bacteria | 714 |
| 2582 | Ga0587128_061801 | 3300059630 | Bacteria | 709 |
| 2583 | Ga0587128_156556 | 3300059630 | Bacteria | 522 |
| 2584 | Ga0587062_022984 | 3300059639 | Bacteria | 900 |
| 2585 | Ga0587062_029906 | 3300059639 | Bacteria | 828 |
| 2586 | Ga0587062_051120 | 3300059639 | Bacteria | 700 |
| 2587 | Ga0587062_057944 | 3300059639 | Bacteria | 672 |
| 2588 | Ga0587068_045621 | 3300059641 | Bacteria | 806 |
| 2589 | Ga0587068_055079 | 3300059641 | Bacteria | 753 |
| 2590 | Ga0587068_077127 | 3300059641 | Bacteria | 667 |
| 2591 | Ga0587072_020475 | 3300059643 | Bacteria | 1166 |
| 2592 | Ga0587072_110335 | 3300059643 | Bacteria | 627 |
| 2593 | Ga0587072_174039 | 3300059643 | Bacteria | 533 |
| 2594 | Ga0587075_050672 | 3300059644 | Bacteria | 724 |
| 2595 | Ga0587076_042906 | 3300059645 | Bacteria | 852 |
| 2596 | Ga0587076_070182 | 3300059645 | Bacteria | 726 |
| 2597 | Ga0587076_074743 | 3300059645 | Bacteria | 711 |
| 2598 | Ga0587076_091031 | 3300059645 | Bacteria | 667 |
| 2599 | Ga0587078_006441 | 3300059646 | Bacteria | 1277 |
| 2600 | Ga0587078_021911 | 3300059646 | Bacteria | 813 |
| 2601 | Ga0587078_038780 | 3300059646 | Bacteria | 667 |
| 2602 | Ga0587100_005937 | 3300059648 | Bacteria | 925 |
| 2603 | Ga0587100_017547 | 3300059648 | Bacteria | 672 |
| 2604 | Ga0587100_018158 | 3300059648 | Bacteria | 665 |
| 2605 | Ga0587104_011260 | 3300059650 | Bacteria | 665 |
| 2606 | Ga0587107_069451 | 3300059652 | Bacteria | 640 |
| 2607 | Ga0587107_094970 | 3300059652 | Bacteria | 582 |
| 2608 | Ga0587107_129916 | 3300059652 | Bacteria | 528 |
| 2609 | Ga0587108_008472 | 3300059653 | Bacteria | 834 |
| 2610 | Ga0587110_028280 | 3300059654 | Bacteria | 672 |
| 2611 | Ga0587110_062436 | 3300059654 | Bacteria | 518 |
| 2612 | Ga0587114_033008 | 3300059655 | Bacteria | 802 |
| 2613 | Ga0587114_080971 | 3300059655 | Bacteria | 604 |
| 2614 | Ga0587119_039732 | 3300059658 | Bacteria | 671 |
| 2615 | Ga0587124_009500 | 3300059660 | Bacteria | 853 |
| 2616 | Ga0587124_017999 | 3300059660 | Bacteria | 701 |
| 2617 | Ga0587124_029616 | 3300059660 | Bacteria | 599 |
| 2618 | Ga0587071_087886 | 3300060344 | Bacteria | 702 |
| 2619 | Ga0587071_180495 | 3300060344 | Bacteria | 542 |
| 2620 | Ga0587111_0018494 | 3300060346 | Bacteria | 1312 |
| 2621 | Ga0587111_0085023 | 3300060346 | Bacteria | 763 |
| 2622 | Ga0587111_0105828 | 3300060346 | Bacteria | 707 |
| 2623 | Ga0587111_0113064 | 3300060346 | Bacteria | 690 |
| 2624 | Ga0587111_0130291 | 3300060346 | Bacteria | 657 |
| 2625 | Ga0587111_0234668 | 3300060346 | Bacteria | 536 |
| 2626 | Ga0501082_0006851 | 3300060353 | Bacteria | 9854 |
| 2627 | Ga0501082_0011708 | 3300060353 | Bacteria | 7541 |
| 2628 | Ga0501082_0027632 | 3300060353 | Bacteria | 4883 |
| 2629 | Ga0501082_0062346 | 3300060353 | Bacteria | 3209 |
| 2630 | Ga0501082_0242864 | 3300060353 | Bacteria | 1567 |
| 2631 | Ga0501082_0400503 | 3300060353 | Bacteria | 1198 |
| 2632 | Ga0501082_0557627 | 3300060353 | Bacteria | 1002 |
| 2633 | Ga0501082_0680804 | 3300060353 | Bacteria | 900 |
| 2634 | Ga0501082_1357103 | 3300060353 | Bacteria | 621 |
| 2635 | Ga0501082_1389094 | 3300060353 | Bacteria | 613 |
| 2636 | Ga0466962_0002938 | 3300061719 | Bacteria | 8127 |
| 2637 | Ga0466962_0359011 | 3300061719 | Bacteria | 726 |
| 2638 | Ga0530510_0013825 | 3300061734 | Bacteria | 5683 |
| 2639 | Ga0530510_0233374 | 3300061734 | Bacteria | 1369 |
| 2640 | Ga0530510_0515857 | 3300061734 | Bacteria | 906 |
| 2641 | 2511130605 | 2510917021 | Bacteria | 5705459 |
| 2642 | 2512644639 | 2512564014 | Bacteria | 4639632 |
| 2643 | 2523466826 | 2523231067 | Bacteria | 5230452 |
| 2644 | 2535485560 | 2534681786 | Bacteria | 3308809 |
| 2645 | 2643729395 | 2643221541 | Bacteria | 5498788 |
| 2646 | 2643819107 | 2643221560 | Bacteria | 4801179 |
| 2647 | 2643835024 | 2643221563 | Bacteria | 4726935 |
| 2648 | 2643950964 | 2643221588 | Bacteria | 3692460 |
| 2649 | 2644045871 | 2643221606 | Bacteria | 5588032 |
| 2650 | 2644055951 | 2643221608 | Bacteria | 4724829 |
| 2651 | 2644393448 | 2643221671 | Bacteria | 5496681 |
| 2652 | 2671114049 | 2667528174 | Bacteria | 6435400 |
| 2653 | 2738710655 | 2738541275 | Bacteria | 4830863 |
| 2654 | 2738849080 | 2738541301 | Bacteria | 4834102 |
| 2655 | 2738864809 | 2738541304 | Bacteria | 4833665 |
| 2656 | 2739297327 | 2738543022 | Bacteria | 4835059 |
| 2657 | 2739348732 | 2738543031 | Bacteria | 5769731 |
| 2658 | 2739359005 | 2738543033 | Bacteria | 4833336 |
| 2659 | 2739650577 | 2739367664 | Bacteria | 4114334 |
| 2660 | 2740029050 | 2739367865 | Bacteria | 4114482 |
| 2661 | 2753360572 | 2751185800 | Bacteria | 5467370 |
| 2662 | 2758643012 | 2758568016 | Bacteria | 5645291 |
| 2663 | 2778125516 | 2775507255 | Bacteria | 3945731 |
| 2664 | 2809063343 | 2808606401 | Bacteria | 4586670 |
| 2665 | 2809079221 | 2808606404 | Bacteria | 4652788 |
| 2666 | 2809083405 | 2808606405 | Bacteria | 4586632 |
| 2667 | 2819551281 | 2818991438 | Bacteria | 5793701 |
| 2668 | 2830075727 | 2830075706 | Bacteria | 3855215 |
| 2669 | 2838029685 | 2838029111 | Bacteria | 6603031 |
| 2670 | 2842475885 | 2842475841 | Bacteria | 6603183 |
| 2671 | 2842503213 | 2842502639 | Bacteria | 6604161 |
| 2672 | 2842696171 | 2842694124 | Bacteria | 4063419 |
| 2673 | 2848298627 | 2848297114 | Bacteria | 3608511 |
| 2674 | 2852653613 | 2852653556 | Bacteria | 4050083 |
| 2675 | 2852683110 | 2852680915 | Bacteria | 4100189 |
| 2676 | 2854913761 | 2854911287 | Bacteria | 5582813 |
| 2677 | 2880520613 | 2880518877 | Bacteria | 5012590 |
| 2678 | 2882809453 | 2882806704 | Bacteria | 3007728 |
| 2679 | 2895881213 | 2895880812 | Bacteria | 11255272 |
| 2680 | 2896186028 | 2896184354 | Bacteria | 3258548 |
| 2681 | 2896255969 | 2896253425 | Bacteria | 3418029 |
| 2682 | 2917556263 | 2917554339 | Bacteria | 4987857 |
| 2683 | 2919143208 | 2919138771 | Bacteria | 5281312 |
| 2684 | 2919408408 | 2919408235 | Bacteria | 6149349 |
| 2685 | 2919712071 | 2919709256 | Bacteria | 4318106 |
| 2686 | 2928029438 | 2928027323 | Bacteria | 4382488 |
| 2687 | 2928100756 | 2928100450 | Bacteria | 4837635 |
| 2688 | 2928528094 | 2928526807 | Bacteria | 4760224 |
| 2689 | 2928960819 | 2928959182 | Bacteria | 4725774 |
| 2690 | 2929201313 | 2929199973 | Bacteria | 7260745 |
| 2691 | 2946789913 | 2946787523 | Bacteria | 4366789 |
| 2692 | 2984556636 | 2984555340 | Bacteria | 4247089 |
| 2693 | 2984565191 | 2984564862 | Bacteria | 4339992 |
| 2694 | 2990265818 | 2990265787 | Bacteria | 3943888 |
| 2695 | 2993356267 | 2993356040 | Bacteria | 4247105 |
| 2696 | 2993696391 | 2993693658 | Bacteria | 4040749 |
| 2697 | 8045868605 | 8045864390 | Bacteria | 5043873 |
| 2698 | 8054305463 | 8054302542 | Bacteria | 5698134 |
| 2699 | 8055910080 | 8055909800 | Bacteria | 7278581 |
| 2700 | 8057105458 | 8057101203 | Bacteria | 5034064 |
| 2701 | Ga0496102_0835597 | |||
| 2702 | RicEn_FSXC48362_g1 | |||
| 2703 | SwRhRL2b_contig_1023452 | |||
| 2704 | SwRhRL2b_contig_1878598 | |||
| 2705 | SwRhRL2b_contig_2614068 | |||
| 2706 | SwRhRL2b_contig_2761788 | |||
| 2707 | ARcpr5oldR_c006461 | |||
| 2708 | ARcpr5yngRDRAFT_c006253 | |||
| 2709 | ARCol0yngRDRAFT_1004808 | |||
| 2710 | JGI24736J21556_1000036 | |||
| 2711 | JGI24736J21556_1000841 | |||
| 2712 | JGI24736J21556_1012983 | |||
| 2713 | JGI24741J21665_1000048 | |||
| 2714 | JGI24741J21665_1003961 | |||
| 2715 | JGI24752J21851_1010676 | |||
| 2716 | JGI24740J21852_10029072 | |||
| 2717 | JGI24740J21852_10042206 | |||
| 2718 | JGI24740J21852_10054054 | |||
| 2719 | JGI24740J21852_10113049 | |||
| 2720 | JGI24740J21852_10169404 | |||
| 2721 | JGI24739J22299_10005112 | |||
| 2722 | JGI24739J22299_10017766 | |||
| 2723 | JGI24739J22299_10042319 | |||
| 2724 | JGI24739J22299_10092022 | |||
| 2725 | JGI24739J22299_10218492 | |||
| 2726 | JGI24737J22298_10010158 | |||
| 2727 | JGI24737J22298_10013520 | |||
| 2728 | JGI24737J22298_10016354 | |||
| 2729 | JGI24737J22298_10028620 | |||
| 2730 | JGI24737J22298_10257098 | |||
| 2731 | JGI24743J22301_10031593 | |||
| 2732 | JGI24750J21931_1005276 | |||
| 2733 | JGI24748J21848_1020079 | |||
| 2734 | JGI24738J21930_10007334 | |||
| 2735 | JGI24738J21930_10025901 | |||
| 2736 | JGI24738J21930_10051879 | |||
| 2737 | JGI24744J21845_10038391 | |||
| 2738 | JGI24035J26624_1007994 | |||
| 2739 | JGI24034J26672_10005335 | |||
| 2740 | JGI24034J26672_10034443 | |||
| 2741 | JGI24751J29686_10000476 | |||
| 2742 | JGI24751J29686_10014858 | |||
| 2743 | JGI24751J29686_10094936 | |||
| 2744 | JGI25157J39369_1022777 | |||
| 2745 | JGI25150J39212_1000067 | |||
| 2746 | JGI25150J39212_1034377 | |||
| 2747 | JGI25151J46595_10024018 | |||
| 2748 | JGI25153J46596_10000073 | |||
| 2749 | JGI25153J46596_10000417 | |||
| 2750 | JGI25153J46596_10010562 | |||
| 2751 | rootH2_10089335 | |||
| 2752 | JGI26145J50221_1008080 | |||
| 2753 | Ga0055525_1000119 | |||
| 2754 | Ga0055542_1000142 | |||
| 2755 | Ga0055542_1000783 | |||
| 2756 | Ga0055529_1000167 | |||
| 2757 | Ga0055537_1003859 | |||
| 2758 | Ga0055537_1007040 | |||
| 2759 | Ga0055524_1000154 | |||
| 2760 | Ga0055536_1009288 | |||
| 2761 | Ga0055536_1010360 | |||
| 2762 | Ga0055536_1014285 | |||
| 2763 | Ga0055536_1016129 | |||
| 2764 | Ga0055536_1056849 | |||
| 2765 | Ga0055534_1040661 | |||
| 2766 | Ga0055530_10000278 | |||
| 2767 | Ga0055530_10000919 | |||
| 2768 | Ga0055530_10008924 | |||
| 2769 | Ga0055530_10017727 | |||
| 2770 | Ga0055530_10098501 | |||
| 2771 | Ga0055540_1004222 | |||
| 2772 | Ga0055531_10000094 | |||
| 2773 | Ga0055531_10000576 | |||
| 2774 | Ga0055531_10002471 | |||
| 2775 | Ga0055531_10019986 | |||
| 2776 | Ga0055531_10079625 | |||
| 2777 | Ga0055531_10108249 | |||
| 2778 | Ga0055543_1028437 | |||
| 2779 | Ga0058859_11630952 | |||
| 2780 | Ga0065165_1077226 | |||
| 2781 | Ga0065165_1148841 | |||
| 2782 | Ga0065714_10445013 | |||
| 2783 | Ga0065704_10003962 | |||
| 2784 | Ga0065704_10070408 | |||
| 2785 | Ga0065704_10074213 | |||
| 2786 | Ga0065704_10075787 | |||
| 2787 | Ga0065704_10123182 | |||
| 2788 | Ga0065704_10337028 | |||
| 2789 | Ga0065704_10404655 | |||
| 2790 | Ga0065712_10077425 | |||
| 2791 | Ga0065715_10043060 | |||
| 2792 | Ga0065707_10089502 | |||
| 2793 | Ga0065707_10795077 | |||
| 2794 | Ga0070658_10001088 | |||
| 2795 | Ga0070658_10001818 | |||
| 2796 | Ga0070658_10004556 | |||
| 2797 | Ga0070658_10121705 | |||
| 2798 | Ga0070658_10132051 | |||
| 2799 | Ga0070658_10157951 | |||
| 2800 | Ga0070658_10226029 | |||
| 2801 | Ga0070658_10345800 | |||
| 2802 | Ga0070658_10363440 | |||
| 2803 | Ga0070658_10441636 | |||
| 2804 | Ga0070658_10753753 | |||
| 2805 | Ga0070658_10891125 | |||
| 2806 | Ga0070676_10001859 | |||
| 2807 | Ga0070676_10186173 | |||
| 2808 | Ga0070676_10220314 | |||
| 2809 | Ga0070676_10320630 | |||
| 2810 | Ga0070676_10777837 | |||
| 2811 | Ga0070683_100026014 | |||
| 2812 | Ga0070683_100027795 | |||
| 2813 | Ga0070683_100036618 | |||
| 2814 | Ga0070683_100915020 | |||
| 2815 | Ga0070683_101024501 | |||
| 2816 | Ga0070683_101072531 | |||
| 2817 | Ga0070683_101298110 | |||
| 2818 | Ga0070683_101876743 | |||
| 2819 | Ga0070690_100001067 | |||
| 2820 | Ga0070690_100230956 | |||
| 2821 | Ga0070690_100634766 | |||
| 2822 | Ga0070670_100001783 | |||
| 2823 | Ga0070670_100003330 | |||
| 2824 | Ga0070670_100034735 | |||
| 2825 | Ga0070670_100130100 | |||
| 2826 | Ga0070670_100191020 | |||
| 2827 | Ga0070670_100317880 | |||
| 2828 | Ga0070670_100595825 | |||
| 2829 | Ga0070670_101389547 | |||
| 2830 | Ga0068869_100047300 | |||
| 2831 | Ga0068869_100961881 | |||
| 2832 | Ga0070666_10000476 | |||
| 2833 | Ga0070666_10002290 | |||
| 2834 | Ga0070666_10008159 | |||
| 2835 | Ga0070666_10112794 | |||
| 2836 | Ga0070666_10351601 | |||
| 2837 | Ga0070666_10921308 | |||
| 2838 | Ga0070666_11289571 | |||
| 2839 | Ga0070680_100015107 | |||
| 2840 | Ga0070680_100018879 | |||
| 2841 | Ga0070680_100714063 | |||
| 2842 | Ga0070682_100003964 | |||
| 2843 | Ga0070682_100229299 | |||
| 2844 | Ga0070682_100246443 | |||
| 2845 | Ga0070682_100573061 | |||
| 2846 | Ga0068868_100000006 | |||
| 2847 | Ga0068868_100002615 | |||
| 2848 | Ga0068868_100257110 | |||
| 2849 | Ga0070660_100000584 | |||
| 2850 | Ga0070660_100004220 | |||
| 2851 | Ga0070660_100095160 | |||
| 2852 | Ga0070660_100124465 | |||
| 2853 | Ga0070660_100242779 | |||
| 2854 | Ga0070660_100292811 | |||
| 2855 | Ga0070660_100404291 | |||
| 2856 | Ga0070660_100511463 | |||
| 2857 | Ga0070660_100562380 | |||
| 2858 | Ga0070660_100644777 | |||
| 2859 | Ga0070689_100005611 | |||
| 2860 | Ga0070689_100060369 | |||
| 2861 | Ga0070689_100190728 | |||
| 2862 | Ga0070689_100698428 | |||
| 2863 | Ga0070691_10000302 | |||
| 2864 | Ga0070691_10004772 | |||
| 2865 | Ga0070691_10305346 | |||
| 2866 | Ga0070687_100000686 | |||
| 2867 | Ga0070687_100486630 | |||
| 2868 | Ga0070661_100000507 | |||
| 2869 | Ga0070661_100000976 | |||
| 2870 | Ga0070661_100039616 | |||
| 2871 | Ga0070661_100078488 | |||
| 2872 | Ga0070661_100206559 | |||
| 2873 | Ga0070661_100244966 | |||
| 2874 | Ga0070661_100281820 | |||
| 2875 | Ga0070661_100384803 | |||
| 2876 | Ga0070661_100635173 | |||
| 2877 | Ga0070661_101536523 | |||
| 2878 | Ga0070692_10000534 | |||
| 2879 | Ga0070692_10152416 | |||
| 2880 | Ga0070668_100005413 | |||
| 2881 | Ga0070668_100010434 | |||
| 2882 | Ga0070668_100024692 | |||
| 2883 | Ga0070668_100042071 | |||
| 2884 | Ga0070668_100050967 | |||
| 2885 | Ga0070668_100131066 | |||
| 2886 | Ga0070668_100345243 | |||
| 2887 | Ga0070668_100699953 | |||
| 2888 | Ga0070668_100834014 | |||
| 2889 | Ga0070668_101004698 | |||
| 2890 | Ga0070669_100000052 | |||
| 2891 | Ga0070669_100000074 | |||
| 2892 | Ga0070669_100000096 | |||
| 2893 | Ga0070669_100001148 | |||
| 2894 | Ga0070669_100001940 | |||
| 2895 | Ga0070669_100029003 | |||
| 2896 | Ga0070669_100043147 | |||
| 2897 | Ga0070669_100216629 | |||
| 2898 | Ga0070669_100331168 | |||
| 2899 | Ga0070669_100361280 | |||
| 2900 | Ga0070675_100001202 | |||
| 2901 | Ga0070675_100101930 | |||
| 2902 | Ga0070675_100214407 | |||
| 2903 | Ga0070675_100424323 | |||
| 2904 | Ga0070675_100568381 | |||
| 2905 | Ga0070675_100975029 | |||
| 2906 | Ga0070671_100000005 | |||
| 2907 | Ga0070671_100000045 | |||
| 2908 | Ga0070671_100001052 | |||
| 2909 | Ga0070671_100001262 | |||
| 2910 | Ga0070671_100002546 | |||
| 2911 | Ga0070671_100361216 | |||
| 2912 | Ga0070671_101495182 | |||
| 2913 | Ga0070674_100002525 | |||
| 2914 | Ga0070674_100016076 | |||
| 2915 | Ga0070674_100182352 | |||
| 2916 | Ga0070674_100624080 | |||
| 2917 | Ga0070674_101329822 | |||
| 2918 | Ga0070674_101386922 | |||
| 2919 | Ga0070674_102221935 | |||
| 2920 | Ga0070673_100000673 | |||
| 2921 | Ga0070673_100169382 | |||
| 2922 | Ga0070673_100212447 | |||
| 2923 | Ga0070673_100521796 | |||
| 2924 | Ga0070673_101275468 | |||
| 2925 | Ga0070688_100004077 | |||
| 2926 | Ga0070688_100027433 | |||
| 2927 | Ga0070688_100102443 | |||
| 2928 | Ga0070688_100269781 | |||
| 2929 | Ga0070688_101374121 | |||
| 2930 | Ga0070659_100000005 | |||
| 2931 | Ga0070659_100005781 | |||
| 2932 | Ga0070659_100006377 | |||
| 2933 | Ga0070659_100026584 | |||
| 2934 | Ga0070659_100163068 | |||
| 2935 | Ga0070659_100550632 | |||
| 2936 | Ga0070659_101456372 | |||
| 2937 | Ga0070667_100000126 | |||
| 2938 | Ga0070667_100000696 | |||
| 2939 | Ga0070667_100001801 | |||
| 2940 | Ga0070667_100045751 | |||
| 2941 | Ga0070667_100054770 | |||
| 2942 | Ga0070667_100092193 | |||
| 2943 | Ga0070667_100196352 | |||
| 2944 | Ga0070667_100210872 | |||
| 2945 | Ga0070667_100255166 | |||
| 2946 | Ga0070667_100279150 | |||
| 2947 | Ga0070667_100406367 | |||
| 2948 | Ga0070703_10017825 | |||
| 2949 | Ga0070709_10000225 | |||
| 2950 | Ga0070709_11183573 | |||
| 2951 | Ga0070714_100010651 | |||
| 2952 | Ga0070714_100534842 | |||
| 2953 | Ga0070713_100013772 | |||
| 2954 | Ga0070713_100402863 | |||
| 2955 | Ga0070710_10516476 | |||
| 2956 | Ga0070710_10672815 | |||
| 2957 | Ga0070710_11248828 | |||
| 2958 | Ga0070701_10000713 | |||
| 2959 | Ga0070701_10029761 | |||
| 2960 | Ga0070701_10313934 | |||
| 2961 | Ga0070711_100000237 | |||
| 2962 | Ga0070711_100629191 | |||
| 2963 | Ga0070711_101126626 | |||
| 2964 | Ga0070705_100000934 | |||
| 2965 | Ga0070705_100116536 | |||
| 2966 | Ga0070705_100178976 | |||
| 2967 | Ga0070700_100008931 | |||
| 2968 | Ga0070700_100030356 | |||
| 2969 | Ga0070700_100035052 | |||
| 2970 | Ga0070700_100281035 | |||
| 2971 | Ga0070700_100422249 | |||
| 2972 | Ga0070700_100442035 | |||
| 2973 | Ga0070700_100818039 | |||
| 2974 | Ga0070694_100006630 | |||
| 2975 | Ga0070694_100725800 | |||
| 2976 | Ga0070708_100052438 | |||
| 2977 | Ga0070708_101560542 | |||
| 2978 | Ga0070663_100000497 | |||
| 2979 | Ga0070663_100020880 | |||
| 2980 | Ga0070663_100067038 | |||
| 2981 | Ga0070663_100073988 | |||
| 2982 | Ga0070663_100094287 | |||
| 2983 | Ga0070663_100221819 | |||
| 2984 | Ga0070663_100272767 | |||
| 2985 | Ga0070663_100454112 | |||
| 2986 | Ga0070678_100003959 | |||
| 2987 | Ga0070678_100143973 | |||
| 2988 | Ga0070678_100252705 | |||
| 2989 | Ga0070678_101236258 | |||
| 2990 | Ga0070662_100002792 | |||
| 2991 | Ga0070662_100004743 | |||
| 2992 | Ga0070662_100215228 | |||
| 2993 | Ga0070662_100629863 | |||
| 2994 | Ga0070662_100920695 | |||
| 2995 | Ga0070681_10011638 | |||
| 2996 | Ga0070681_10035996 | |||
| 2997 | Ga0070681_10292766 | |||
| 2998 | Ga0070681_10369511 | |||
| 2999 | Ga0070681_10473062 | |||
| 3000 | Ga0070681_12004575 | |||
| 3001 | Ga0068867_100033471 | |||
| 3002 | Ga0068867_100108248 | |||
| 3003 | Ga0068867_100129295 | |||
| 3004 | Ga0068867_100156147 | |||
| 3005 | Ga0068867_100308340 | |||
| 3006 | Ga0068867_101601851 | |||
| 3007 | Ga0068867_101713003 | |||
| 3008 | Ga0070685_10014056 | |||
| 3009 | Ga0070685_10078251 | |||
| 3010 | Ga0070685_11169043 | |||
| 3011 | Ga0070707_100229142 | |||
| 3012 | Ga0070707_101308724 | |||
| 3013 | Ga0070679_100009637 | |||
| 3014 | Ga0070679_100205823 | |||
| 3015 | Ga0070679_100304300 | |||
| 3016 | Ga0070679_100356781 | |||
| 3017 | Ga0070679_100460451 | |||
| 3018 | Ga0070679_100987862 | |||
| 3019 | Ga0070684_100020003 | |||
| 3020 | Ga0070684_100154029 | |||
| 3021 | Ga0070684_100471018 | |||
| 3022 | Ga0070684_101214535 | |||
| 3023 | Ga0070697_100004352 | |||
| 3024 | Ga0068853_100001129 | |||
| 3025 | Ga0068853_100002735 | |||
| 3026 | Ga0068853_100035403 | |||
| 3027 | Ga0068853_100103310 | |||
| 3028 | Ga0068853_100200594 | |||
| 3029 | Ga0068853_100280041 | |||
| 3030 | Ga0068853_100306321 | |||
| 3031 | Ga0068853_100636422 | |||
| 3032 | Ga0068853_100719926 | |||
| 3033 | Ga0068853_102161994 | |||
| 3034 | Ga0070672_100001428 | |||
| 3035 | Ga0070672_100132101 | |||
| 3036 | Ga0070672_100645023 | |||
| 3037 | Ga0070686_100000180 | |||
| 3038 | Ga0070686_100000710 | |||
| 3039 | Ga0070686_100147930 | |||
| 3040 | Ga0070686_100340905 | |||
| 3041 | Ga0070686_100618113 | |||
| 3042 | Ga0070686_100664360 | |||
| 3043 | Ga0070695_100000578 | |||
| 3044 | Ga0070695_100002848 | |||
| 3045 | Ga0070696_100000325 | |||
| 3046 | Ga0070696_100024910 | |||
| 3047 | Ga0070696_100132064 | |||
| 3048 | Ga0070693_100012681 | |||
| 3049 | Ga0070693_100564453 | |||
| 3050 | Ga0070665_100000079 | |||
| 3051 | Ga0070665_100000296 | |||
| 3052 | Ga0070665_100007214 | |||
| 3053 | Ga0070665_100016450 | |||
| 3054 | Ga0070665_100025820 | |||
| 3055 | Ga0070665_100035098 | |||
| 3056 | Ga0070665_100045038 | |||
| 3057 | Ga0070665_100096351 | |||
| 3058 | Ga0070665_100194694 | |||
| 3059 | Ga0070665_100520073 | |||
| 3060 | Ga0070665_100715964 | |||
| 3061 | Ga0070665_101355634 | |||
| 3062 | Ga0070665_101645239 | |||
| 3063 | Ga0070665_101718934 | |||
| 3064 | Ga0070665_102014263 | |||
| 3065 | Ga0070704_100011048 | |||
| 3066 | Ga0068855_100006792 | |||
| 3067 | Ga0068855_100013711 | |||
| 3068 | Ga0068855_100019332 | |||
| 3069 | Ga0068855_100022265 | |||
| 3070 | Ga0068855_100048203 | |||
| 3071 | Ga0068855_100149492 | |||
| 3072 | Ga0068855_100151509 | |||
| 3073 | Ga0068855_100252767 | |||
| 3074 | Ga0068855_100280798 | |||
| 3075 | Ga0068855_100300284 | |||
| 3076 | Ga0068855_100352292 | |||
| 3077 | Ga0068855_100563257 | |||
| 3078 | Ga0068855_101260806 | |||
| 3079 | Ga0068855_101298053 | |||
| 3080 | Ga0068855_101361997 | |||
| 3081 | Ga0070664_100005810 | |||
| 3082 | Ga0070664_100052478 | |||
| 3083 | Ga0070664_100054332 | |||
| 3084 | Ga0070664_100241839 | |||
| 3085 | Ga0070664_100434352 | |||
| 3086 | Ga0070664_100930601 | |||
| 3087 | Ga0070664_101394205 | |||
| 3088 | Ga0068857_100002722 | |||
| 3089 | Ga0068857_100015261 | |||
| 3090 | Ga0068857_100033167 | |||
| 3091 | Ga0068857_100348275 | |||
| 3092 | Ga0068857_100405100 | |||
| 3093 | Ga0068857_100461560 | |||
| 3094 | Ga0068857_100630845 | |||
| 3095 | Ga0068857_100985947 | |||
| 3096 | Ga0068857_101200472 | |||
| 3097 | Ga0068857_101290001 | |||
| 3098 | Ga0068857_101514112 | |||
| 3099 | Ga0068857_101679906 | |||
| 3100 | Ga0068854_100000389 | |||
| 3101 | Ga0068854_100028613 | |||
| 3102 | Ga0068854_100032623 | |||
| 3103 | Ga0068854_100035059 | |||
| 3104 | Ga0068854_100062705 | |||
| 3105 | Ga0068854_100133400 | |||
| 3106 | Ga0068854_100133726 | |||
| 3107 | Ga0068854_100192007 | |||
| 3108 | Ga0068854_100198525 | |||
| 3109 | Ga0068854_100631004 | |||
| 3110 | Ga0068854_101544537 | |||
| 3111 | Ga0068854_101583692 | |||
| 3112 | Ga0068854_101854222 | |||
| 3113 | Ga0068854_101972686 | |||
| 3114 | Ga0068856_100001928 | |||
| 3115 | Ga0068856_100002574 | |||
| 3116 | Ga0068856_100022744 | |||
| 3117 | Ga0068856_100026525 | |||
| 3118 | Ga0068856_100147182 | |||
| 3119 | Ga0068856_100204231 | |||
| 3120 | Ga0068856_100289963 | |||
| 3121 | Ga0068856_100620084 | |||
| 3122 | Ga0068856_100957019 | |||
| 3123 | Ga0068856_101117063 | |||
| 3124 | Ga0068856_101135505 | |||
| 3125 | Ga0070702_100000088 | |||
| 3126 | Ga0070702_100074831 | |||
| 3127 | Ga0068852_100014137 | |||
| 3128 | Ga0068852_100104161 | |||
| 3129 | Ga0068852_100225405 | |||
| 3130 | Ga0068852_100235764 | |||
| 3131 | Ga0068852_100327281 | |||
| 3132 | Ga0068852_100509361 | |||
| 3133 | Ga0068852_100521503 | |||
| 3134 | Ga0068852_100711923 | |||
| 3135 | Ga0068852_100712043 | |||
| 3136 | Ga0068852_101268045 | |||
| 3137 | Ga0068859_100000162 | |||
| 3138 | Ga0068859_100002269 | |||
| 3139 | Ga0068859_100362355 | |||
| 3140 | Ga0068859_100556770 | |||
| 3141 | Ga0068859_100669333 | |||
| 3142 | Ga0068864_100002565 | |||
| 3143 | Ga0068864_100003629 | |||
| 3144 | Ga0068864_100004757 | |||
| 3145 | Ga0068864_100113697 | |||
| 3146 | Ga0068864_100882244 | |||
| 3147 | Ga0068864_101043020 | |||
| 3148 | Ga0068864_101245018 | |||
| 3149 | Ga0068866_10008498 | |||
| 3150 | Ga0068866_10032331 | |||
| 3151 | Ga0068861_100000952 | |||
| 3152 | Ga0068861_100001387 | |||
| 3153 | Ga0068861_100007263 | |||
| 3154 | Ga0068861_100199975 | |||
| 3155 | Ga0068861_100203136 | |||
| 3156 | Ga0068861_100425121 | |||
| 3157 | Ga0068861_100734483 | |||
| 3158 | Ga0068861_101179441 | |||
| 3159 | Ga0068861_102574236 | |||
| 3160 | Ga0068851_10040441 | |||
| 3161 | Ga0068851_10081837 | |||
| 3162 | Ga0068870_10057602 | |||
| 3163 | Ga0068863_100000103 | |||
| 3164 | Ga0068863_100000470 | |||
| 3165 | Ga0068863_100004418 | |||
| 3166 | Ga0068863_100005989 | |||
| 3167 | Ga0068863_100032893 | |||
| 3168 | Ga0068863_100037604 | |||
| 3169 | Ga0068863_100082631 | |||
| 3170 | Ga0068863_100586385 | |||
| 3171 | Ga0068863_100778089 | |||
| 3172 | Ga0068858_100000240 | |||
| 3173 | Ga0068858_100002072 | |||
| 3174 | Ga0068858_100002314 | |||
| 3175 | Ga0068858_100004410 | |||
| 3176 | Ga0068858_100048093 | |||
| 3177 | Ga0068858_100069876 | |||
| 3178 | Ga0068858_100090763 | |||
| 3179 | Ga0068858_100131895 | |||
| 3180 | Ga0068858_100140077 | |||
| 3181 | Ga0068858_100167885 | |||
| 3182 | Ga0068858_100268179 | |||
| 3183 | Ga0068858_101354931 | |||
| 3184 | Ga0068858_101426778 | |||
| 3185 | Ga0068860_100000093 | |||
| 3186 | Ga0068860_100003367 | |||
| 3187 | Ga0068860_100004581 | |||
| 3188 | Ga0068860_100005041 | |||
| 3189 | Ga0068860_100013991 | |||
| 3190 | Ga0068860_100022991 | |||
| 3191 | Ga0068860_100084995 | |||
| 3192 | Ga0068860_100113883 | |||
| 3193 | Ga0068860_100527067 | |||
| 3194 | Ga0068860_100540490 | |||
| 3195 | Ga0068860_100776527 | |||
| 3196 | Ga0068860_100900779 | |||
| 3197 | Ga0068862_100001170 | |||
| 3198 | Ga0068862_100001387 | |||
| 3199 | Ga0068862_100004889 | |||
| 3200 | Ga0068862_100030244 | |||
| 3201 | Ga0068862_100064939 | |||
| 3202 | Ga0068862_100083636 | |||
| 3203 | Ga0068862_100119545 | |||
| 3204 | Ga0068862_100177531 | |||
| 3205 | Ga0068862_100223523 | |||
| 3206 | Ga0068862_100286699 | |||
| 3207 | Ga0068862_100305585 | |||
| 3208 | Ga0068862_100605152 | |||
| 3209 | Ga0068862_101160773 | |||
| 3210 | Ga0081455_10001416 | |||
| 3211 | Ga0081455_10006703 | |||
| 3212 | Ga0081455_10198838 | |||
| 3213 | Ga0081538_10201233 | |||
| 3214 | Ga0081540_1088598 | |||
| 3215 | Ga0081540_1106603 | |||
| 3216 | Ga0081539_10187932 | |||
| 3217 | Ga0081539_10462094 | |||
| 3218 | Ga0070717_11593547 | |||
| 3219 | Ga0075365_10014968 | |||
| 3220 | Ga0075365_10017980 | |||
| 3221 | Ga0075365_10031317 | |||
| 3222 | Ga0075365_10502787 | |||
| 3223 | Ga0075365_10511976 | |||
| 3224 | Ga0075365_10611234 | |||
| 3225 | Ga0075365_11075421 | |||
| 3226 | Ga0075368_10001183 | |||
| 3227 | Ga0075368_10001519 | |||
| 3228 | Ga0075368_10008487 | |||
| 3229 | Ga0075368_10034408 | |||
| 3230 | Ga0075368_10168999 | |||
| 3231 | Ga0075368_10573514 | |||
| 3232 | Ga0075363_100000096 | |||
| 3233 | Ga0075363_100025336 | |||
| 3234 | Ga0075363_100097619 | |||
| 3235 | Ga0075363_100320506 | |||
| 3236 | Ga0075363_100565137 | |||
| 3237 | Ga0075363_100596728 | |||
| 3238 | Ga0075364_10005322 | |||
| 3239 | Ga0075364_10008502 | |||
| 3240 | Ga0075364_10010176 | |||
| 3241 | Ga0075364_10079128 | |||
| 3242 | Ga0075364_10217649 | |||
| 3243 | Ga0075364_10433331 | |||
| 3244 | Ga0075364_10773171 | |||
| 3245 | Ga0075364_10804910 | |||
| 3246 | Ga0075432_10073267 | |||
| 3247 | Ga0075432_10129092 | |||
| 3248 | Ga0070715_10000291 | |||
| 3249 | Ga0070716_100001118 | |||
| 3250 | Ga0070716_101229369 | |||
| 3251 | Ga0070716_101551373 | |||
| 3252 | Ga0070712_100001476 | |||
| 3253 | Ga0070712_100383962 | |||
| 3254 | Ga0070712_100608373 | |||
| 3255 | Ga0075362_10000046 | |||
| 3256 | Ga0075362_10000497 | |||
| 3257 | Ga0075362_10035176 | |||
| 3258 | Ga0075362_10138488 | |||
| 3259 | Ga0075362_10177958 | |||
| 3260 | Ga0075362_10179116 | |||
| 3261 | Ga0075367_10001647 | |||
| 3262 | Ga0075367_10021430 | |||
| 3263 | Ga0075367_10027526 | |||
| 3264 | Ga0075367_10030522 | |||
| 3265 | Ga0075367_10319971 | |||
| 3266 | Ga0075367_10946747 | |||
| 3267 | Ga0075369_10015892 | |||
| 3268 | Ga0075369_10016540 | |||
| 3269 | Ga0075369_10021076 | |||
| 3270 | Ga0075369_10039066 | |||
| 3271 | Ga0075369_10048256 | |||
| 3272 | Ga0075369_10342322 | |||
| 3273 | Ga0075366_10000241 | |||
| 3274 | Ga0075366_10001502 | |||
| 3275 | Ga0075366_10037075 | |||
| 3276 | Ga0075366_10043580 | |||
| 3277 | Ga0075366_10068362 | |||
| 3278 | Ga0075366_10097395 | |||
| 3279 | Ga0075366_10279790 | |||
| 3280 | Ga0075366_10498372 | |||
| 3281 | Ga0097621_100028733 | |||
| 3282 | Ga0097621_100049047 | |||
| 3283 | Ga0097621_100272760 | |||
| 3284 | Ga0097621_100358242 | |||
| 3285 | Ga0097621_102080544 | |||
| 3286 | Ga0075370_10000321 | |||
| 3287 | Ga0075370_10000552 | |||
| 3288 | Ga0075370_10007347 | |||
| 3289 | Ga0075370_10030291 | |||
| 3290 | Ga0075370_10033069 | |||
| 3291 | Ga0075370_10048234 | |||
| 3292 | Ga0075370_10062810 | |||
| 3293 | Ga0075370_10076731 | |||
| 3294 | Ga0075370_10104865 | |||
| 3295 | Ga0075370_10134495 | |||
| 3296 | Ga0075370_10449126 | |||
| 3297 | Ga0075370_10483391 | |||
| 3298 | Ga0068871_100104063 | |||
| 3299 | Ga0068871_100186874 | |||
| 3300 | Ga0068871_100205579 | |||
| 3301 | Ga0068871_100317687 | |||
| 3302 | Ga0068871_101231305 | |||
| 3303 | Ga0075428_100081367 | |||
| 3304 | Ga0075428_100164917 | |||
| 3305 | Ga0075428_100797818 | |||
| 3306 | Ga0075428_101155925 | |||
| 3307 | Ga0075430_100072586 | |||
| 3308 | Ga0075430_100854469 | |||
| 3309 | Ga0075431_100021252 | |||
| 3310 | Ga0075431_100646685 | |||
| 3311 | Ga0075431_101111348 | |||
| 3312 | Ga0075433_10006318 | |||
| 3313 | Ga0075433_10317467 | |||
| 3314 | Ga0075434_100436550 | |||
| 3315 | Ga0075434_100489892 | |||
| 3316 | Ga0075429_100011000 | |||
| 3317 | Ga0075429_100170206 | |||
| 3318 | Ga0068865_100000212 | |||
| 3319 | Ga0068865_100038165 | |||
| 3320 | Ga0068865_100328907 | |||
| 3321 | Ga0075436_100005000 | |||
| 3322 | Ga0097620_100000162 | |||
| 3323 | Ga0097620_100002269 | |||
| 3324 | Ga0097620_100362395 | |||
| 3325 | Ga0097620_100556807 | |||
| 3326 | Ga0097620_100669344 | |||
| 3327 | Ga0079104_1016558 | |||
| 3328 | Ga0079104_1056291 | |||
| 3329 | Ga0079104_1109781 | |||
| 3330 | Ga0099826_10195975 | |||
| 3331 | Ga0075435_100036066 | |||
| 3332 | Ga0075435_100039582 | |||
| 3333 | Ga0075435_102023647 | |||
| 3334 | Ga0105251_10000534 | |||
| 3335 | Ga0105251_10031794 | |||
| 3336 | Ga0105251_10070853 | |||
| 3337 | Ga0105251_10100684 | |||
| 3338 | Ga0105251_10234748 | |||
| 3339 | Ga0105251_10476000 | |||
| 3340 | Ga0105250_10012839 | |||
| 3341 | Ga0105250_10031842 | |||
| 3342 | Ga0105250_10055977 | |||
| 3343 | Ga0105250_10056543 | |||
| 3344 | Ga0105250_10204992 | |||
| 3345 | Ga0105240_10010783 | |||
| 3346 | Ga0105240_10011600 | |||
| 3347 | Ga0105240_10033337 | |||
| 3348 | Ga0105240_10037140 | |||
| 3349 | Ga0105240_10172559 | |||
| 3350 | Ga0105240_10193654 | |||
| 3351 | Ga0105240_10208565 | |||
| 3352 | Ga0105240_10280501 | |||
| 3353 | Ga0105240_10436407 | |||
| 3354 | Ga0105240_11169015 | |||
| 3355 | Ga0105240_11177219 | |||
| 3356 | Ga0105240_11846607 | |||
| 3357 | Ga0105240_12000063 | |||
| 3358 | Ga0111539_10046885 | |||
| 3359 | Ga0111539_10542321 | |||
| 3360 | Ga0111539_10763422 | |||
| 3361 | Ga0111539_11859565 | |||
| 3362 | Ga0111539_12061013 | |||
| 3363 | Ga0105245_10000107 | |||
| 3364 | Ga0105245_10000318 | |||
| 3365 | Ga0105245_10004915 | |||
| 3366 | Ga0105245_10158902 | |||
| 3367 | Ga0105245_10208349 | |||
| 3368 | Ga0105245_10508226 | |||
| 3369 | Ga0105245_12234787 | |||
| 3370 | Ga0105247_10000925 | |||
| 3371 | Ga0105247_10001548 | |||
| 3372 | Ga0105247_10001892 | |||
| 3373 | Ga0105247_10024382 | |||
| 3374 | Ga0105247_10089889 | |||
| 3375 | Ga0105247_10150437 | |||
| 3376 | Ga0105247_10425180 | |||
| 3377 | Ga0114129_10269746 | |||
| 3378 | Ga0114129_10278187 | |||
| 3379 | Ga0114129_12775333 | |||
| 3380 | Ga0114129_12775800 | |||
| 3381 | Ga0105243_10000944 | |||
| 3382 | Ga0105243_10001886 | |||
| 3383 | Ga0105243_10022283 | |||
| 3384 | Ga0105243_10194387 | |||
| 3385 | Ga0105243_10428990 | |||
| 3386 | Ga0105243_10440144 | |||
| 3387 | Ga0105243_12506502 | |||
| 3388 | Ga0105241_10002673 | |||
| 3389 | Ga0105241_10029901 | |||
| 3390 | Ga0105241_10123227 | |||
| 3391 | Ga0105241_10406239 | |||
| 3392 | Ga0105241_10831370 | |||
| 3393 | Ga0105241_10840621 | |||
| 3394 | Ga0105241_11549111 | |||
| 3395 | Ga0105241_12068996 | |||
| 3396 | Ga0105241_12107003 | |||
| 3397 | Ga0105242_10030348 | |||
| 3398 | Ga0105242_10096840 | |||
| 3399 | Ga0105242_10102404 | |||
| 3400 | Ga0105242_10155865 | |||
| 3401 | Ga0105242_10177452 | |||
| 3402 | Ga0105242_10205409 | |||
| 3403 | Ga0105248_10010654 | |||
| 3404 | Ga0105248_10014164 | |||
| 3405 | Ga0105248_10040085 | |||
| 3406 | Ga0105248_10115172 | |||
| 3407 | Ga0105248_10210904 | |||
| 3408 | Ga0105248_10251683 | |||
| 3409 | Ga0105248_10372767 | |||
| 3410 | Ga0105248_10411651 | |||
| 3411 | Ga0105248_10427522 | |||
| 3412 | Ga0105248_10570189 | |||
| 3413 | Ga0105248_10577791 | |||
| 3414 | Ga0105248_10694502 | |||
| 3415 | Ga0105248_11441774 | |||
| 3416 | Ga0105248_12202955 | |||
| 3417 | Ga0105237_10276377 | |||
| 3418 | Ga0105237_10321660 | |||
| 3419 | Ga0105237_10497074 | |||
| 3420 | Ga0105237_10531298 | |||
| 3421 | Ga0105237_10555384 | |||
| 3422 | Ga0105237_11116429 | |||
| 3423 | Ga0105238_10003956 | |||
| 3424 | Ga0105238_10069194 | |||
| 3425 | Ga0105238_10681721 | |||
| 3426 | Ga0105238_10714458 | |||
| 3427 | Ga0105238_11153412 | |||
| 3428 | Ga0105238_11168907 | |||
| 3429 | Ga0105238_11385148 | |||
| 3430 | Ga0105238_11992100 | |||
| 3431 | Ga0105249_10001629 | |||
| 3432 | Ga0105249_10002562 | |||
| 3433 | Ga0105249_10035761 | |||
| 3434 | Ga0105249_10054363 | |||
| 3435 | Ga0105249_10295522 | |||
| 3436 | Ga0105249_10316735 | |||
| 3437 | Ga0105249_12278545 | |||
| 3438 | Ga0105249_12456644 | |||
| 3439 | Ga0105239_10002915 | |||
| 3440 | Ga0105239_10031698 | |||
| 3441 | Ga0105239_10059516 | |||
| 3442 | Ga0105239_10141412 | |||
| 3443 | Ga0105239_10561942 | |||
| 3444 | Ga0105239_10903803 | |||
| 3445 | Ga0105239_11128643 | |||
| 3446 | Ga0105239_12306236 | |||
| 3447 | Ga0105246_10001471 | |||
| 3448 | Ga0105246_10004041 | |||
| 3449 | Ga0105246_10427618 | |||
| 3450 | Ga0105246_10624096 | |||
| 3451 | Ga0105246_11081648 | |||
| 3452 | Ga0105246_11296518 | |||
| 3453 | Ga0157322_1020236 | |||
| 3454 | Ga0157347_1013462 | |||
| 3455 | Ga0157327_1020044 | |||
| 3456 | Ga0157326_1028903 | |||
| 3457 | Ga0157373_10005865 | |||
| 3458 | Ga0157373_10008328 | |||
| 3459 | Ga0157373_10024910 | |||
| 3460 | Ga0157373_10098658 | |||
| 3461 | Ga0157373_10160202 | |||
| 3462 | Ga0157373_10185021 | |||
| 3463 | Ga0157373_10245679 | |||
| 3464 | Ga0157373_10383688 | |||
| 3465 | Ga0157373_10532665 | |||
| 3466 | Ga0157373_10736905 | |||
| 3467 | Ga0157371_10000062 | |||
| 3468 | Ga0157371_10003718 | |||
| 3469 | Ga0157371_10008946 | |||
| 3470 | Ga0157371_10036317 | |||
| 3471 | Ga0157371_10045817 | |||
| 3472 | Ga0157371_10097128 | |||
| 3473 | Ga0157371_10154772 | |||
| 3474 | Ga0157371_10227238 | |||
| 3475 | Ga0157371_10247635 | |||
| 3476 | Ga0157371_10256002 | |||
| 3477 | Ga0157371_10363897 | |||
| 3478 | Ga0157371_10365486 | |||
| 3479 | Ga0157371_11184456 | |||
| 3480 | Ga0157370_10003643 | |||
| 3481 | Ga0157370_10043858 | |||
| 3482 | Ga0157370_10140416 | |||
| 3483 | Ga0157370_10187429 | |||
| 3484 | Ga0157370_10282834 | |||
| 3485 | Ga0157370_10283619 | |||
| 3486 | Ga0157370_10484582 | |||
| 3487 | Ga0157370_10525805 | |||
| 3488 | Ga0157370_10650499 | |||
| 3489 | Ga0157370_10683278 | |||
| 3490 | Ga0157370_11051939 | |||
| 3491 | Ga0157370_11523973 | |||
| 3492 | Ga0157369_10000043 | |||
| 3493 | Ga0157369_10001048 | |||
| 3494 | Ga0157369_10011006 | |||
| 3495 | Ga0157369_10047977 | |||
| 3496 | Ga0157369_10105295 | |||
| 3497 | Ga0157369_10130301 | |||
| 3498 | Ga0157369_10259506 | |||
| 3499 | Ga0157369_10646473 | |||
| 3500 | Ga0157369_10736481 | |||
| 3501 | Ga0157369_10737756 | |||
| 3502 | Ga0157369_11052570 | |||
| 3503 | Ga0157369_11755479 | |||
| 3504 | Ga0157369_12662165 | |||
| 3505 | Ga0157374_10004151 | |||
| 3506 | Ga0157374_10008229 | |||
| 3507 | Ga0157374_10077068 | |||
| 3508 | Ga0157374_10155442 | |||
| 3509 | Ga0157374_10245465 | |||
| 3510 | Ga0157378_10012986 | |||
| 3511 | Ga0157378_10015354 | |||
| 3512 | Ga0157378_10105700 | |||
| 3513 | Ga0157378_10106116 | |||
| 3514 | Ga0157378_10648012 | |||
| 3515 | Ga0157378_11337921 | |||
| 3516 | Ga0157378_13243432 | |||
| 3517 | Ga0163162_10000823 | |||
| 3518 | Ga0163162_10006344 | |||
| 3519 | Ga0163162_10007216 | |||
| 3520 | Ga0163162_10023724 | |||
| 3521 | Ga0163162_10111614 | |||
| 3522 | Ga0163162_10146476 | |||
| 3523 | Ga0163162_10267452 | |||
| 3524 | Ga0163162_10331280 | |||
| 3525 | Ga0163162_10572536 | |||
| 3526 | Ga0163162_10939429 | |||
| 3527 | Ga0163162_11336930 | |||
| 3528 | Ga0163162_11633696 | |||
| 3529 | Ga0163162_12003456 | |||
| 3530 | Ga0163162_12172311 | |||
| 3531 | Ga0163162_13197198 | |||
| 3532 | Ga0157372_10002837 | |||
| 3533 | Ga0157372_10025453 | |||
| 3534 | Ga0157372_10039997 | |||
| 3535 | Ga0157372_10141581 | |||
| 3536 | Ga0157372_10415389 | |||
| 3537 | Ga0157372_10778361 | |||
| 3538 | Ga0157372_10919623 | |||
| 3539 | Ga0157372_11166798 | |||
| 3540 | Ga0157375_10001015 | |||
| 3541 | Ga0157375_10106173 | |||
| 3542 | Ga0157375_10114281 | |||
| 3543 | Ga0157375_10242307 | |||
| 3544 | Ga0157375_10262279 | |||
| 3545 | Ga0157375_10269885 | |||
| 3546 | Ga0157375_10314419 | |||
| 3547 | Ga0157375_10721260 | |||
| 3548 | Ga0157375_11235593 | |||
| 3549 | Ga0157375_11363990 | |||
| 3550 | Ga0163163_10004874 | |||
| 3551 | Ga0163163_10095231 | |||
| 3552 | Ga0163163_10098327 | |||
| 3553 | Ga0163163_10411813 | |||
| 3554 | Ga0163163_10422424 | |||
| 3555 | Ga0163163_10727617 | |||
| 3556 | Ga0163163_10936956 | |||
| 3557 | Ga0163163_11212785 | |||
| 3558 | Ga0163163_11817517 | |||
| 3559 | Ga0163163_12792931 | |||
| 3560 | Ga0157380_10016517 | |||
| 3561 | Ga0157380_10039666 | |||
| 3562 | Ga0157380_10101524 | |||
| 3563 | Ga0157380_10270474 | |||
| 3564 | Ga0157380_10785256 | |||
| 3565 | Ga0157380_10830803 | |||
| 3566 | Ga0157380_11081820 | |||
| 3567 | Ga0182008_10034454 | |||
| 3568 | Ga0182008_10265103 | |||
| 3569 | Ga0182008_10292256 | |||
| 3570 | Ga0157377_10001125 | |||
| 3571 | Ga0157377_10019427 | |||
| 3572 | Ga0157377_11527519 | |||
| 3573 | Ga0157379_10008925 | |||
| 3574 | Ga0157379_10010069 | |||
| 3575 | Ga0157379_10500846 | |||
| 3576 | Ga0157379_10755116 | |||
| 3577 | Ga0157379_11463918 | |||
| 3578 | Ga0157376_10001406 | |||
| 3579 | Ga0157376_10025105 | |||
| 3580 | Ga0157376_10040093 | |||
| 3581 | Ga0157376_11372001 | |||
| 3582 | Ga0157376_12417710 | |||
| 3583 | Ga0183363_1010 | |||
| 3584 | Ga0163161_10003384 | |||
| 3585 | Ga0163161_10006732 | |||
| 3586 | Ga0163161_10009585 | |||
| 3587 | Ga0163161_10228318 | |||
| 3588 | Ga0163161_10485376 | |||
| 3589 | Ga0163161_10599458 | |||
| 3590 | Ga0163161_10671694 | |||
| 3591 | Ga0163161_10866013 | |||
| 3592 | Ga0163161_11106532 | |||
| 3593 | Ga0163161_11184614 | |||
| 3594 | Ga0163161_11619609 | |||
| 3595 | Ga0184598_117135 | |||
| 3596 | Ga0206356_10714324 | |||
| 3597 | Ga0206356_11133344 | |||
| 3598 | Ga0206355_1484588 | |||
| 3599 | Ga0206351_10987137 | |||
| 3600 | Ga0206352_10149205 | |||
| 3601 | Ga0206354_10229996 | |||
| 3602 | Ga0206354_11017406 | |||
| 3603 | Ga0154015_1061162 | |||
| 3604 | Ga0213873_10032494 | |||
| 3605 | Ga0213872_10334032 | |||
| 3606 | Ga0213874_10044093 | |||
| 3607 | Ga0213874_10380212 | |||
| 3608 | Ga0213876_10000232 | |||
| 3609 | Ga0213876_10021404 | |||
| 3610 | Ga0213876_10562904 | |||
| 3611 | Ga0213871_10061314 | |||
| 3612 | Ga0224712_10176773 | |||
| 3613 | Ga0224712_10306085 | |||
| 3614 | Ga0209147_101180 | |||
| 3615 | Ga0209437_100050 | |||
| 3616 | Ga0207425_1000005 | |||
| 3617 | Ga0209026_1007893 | |||
| 3618 | Ga0209129_1001455 | |||
| 3619 | Ga0209233_1000037 | |||
| 3620 | Ga0209565_1000007 | |||
| 3621 | Ga0209565_1000850 | |||
| 3622 | Ga0209455_1005872 | |||
| 3623 | Ga0209455_1024602 | |||
| 3624 | Ga0209455_1025055 | |||
| 3625 | Ga0209673_1007333 | |||
| 3626 | Ga0209673_1008711 | |||
| 3627 | Ga0207673_1001765 | |||
| 3628 | Ga0209675_1000169 | |||
| 3629 | Ga0209675_1016124 | |||
| 3630 | Ga0209676_1000256 | |||
| 3631 | Ga0209676_1000651 | |||
| 3632 | Ga0209676_1000807 | |||
| 3633 | Ga0209676_1001585 | |||
| 3634 | Ga0209676_1012139 | |||
| 3635 | Ga0209676_1022177 | |||
| 3636 | Ga0209025_1000477 | |||
| 3637 | Ga0209025_1016458 | |||
| 3638 | Ga0209025_1035205 | |||
| 3639 | Ga0209564_1001268 | |||
| 3640 | Ga0209758_1000002 | |||
| 3641 | Ga0209758_1020798 | |||
| 3642 | Ga0209758_1073008 | |||
| 3643 | Ga0209050_1000001 | |||
| 3644 | Ga0209050_1000071 | |||
| 3645 | Ga0209050_1000213 | |||
| 3646 | Ga0209050_1000310 | |||
| 3647 | Ga0209050_1000937 | |||
| 3648 | Ga0209050_1012711 | |||
| 3649 | Ga0209050_1022136 | |||
| 3650 | Ga0209050_1023898 | |||
| 3651 | Ga0209050_1027937 | |||
| 3652 | Ga0209256_1000008 | |||
| 3653 | Ga0209051_1001344 | |||
| 3654 | Ga0209257_1000027 | |||
| 3655 | Ga0209257_1000113 | |||
| 3656 | Ga0209257_1000379 | |||
| 3657 | Ga0209257_1002330 | |||
| 3658 | Ga0209257_1002535 | |||
| 3659 | Ga0209257_1008172 | |||
| 3660 | Ga0209257_1073908 | |||
| 3661 | Ga0207697_10003130 | |||
| 3662 | Ga0207697_10049627 | |||
| 3663 | Ga0207697_10495982 | |||
| 3664 | Ga0207656_10015606 | |||
| 3665 | Ga0207656_10053971 | |||
| 3666 | Ga0207696_1009621 | |||
| 3667 | Ga0207696_1032104 | |||
| 3668 | Ga0207696_1181536 | |||
| 3669 | Ga0207696_1182462 | |||
| 3670 | Ga0207713_1002133 | |||
| 3671 | Ga0207713_1027808 | |||
| 3672 | Ga0207653_10009975 | |||
| 3673 | Ga0207682_10489826 | |||
| 3674 | Ga0207692_10498065 | |||
| 3675 | Ga0207642_10023025 | |||
| 3676 | Ga0207642_11127734 | |||
| 3677 | Ga0207710_10001500 | |||
| 3678 | Ga0207710_10009894 | |||
| 3679 | Ga0207710_10052376 | |||
| 3680 | Ga0207710_10087066 | |||
| 3681 | Ga0207710_10186876 | |||
| 3682 | Ga0207710_10353504 | |||
| 3683 | Ga0207710_10611203 | |||
| 3684 | Ga0207688_10000228 | |||
| 3685 | Ga0207688_10306066 | |||
| 3686 | Ga0207680_10003876 | |||
| 3687 | Ga0207680_10015591 | |||
| 3688 | Ga0207680_10034344 | |||
| 3689 | Ga0207680_10266087 | |||
| 3690 | Ga0207680_11061657 | |||
| 3691 | Ga0207647_10015010 | |||
| 3692 | Ga0207647_10074284 | |||
| 3693 | Ga0207647_10188502 | |||
| 3694 | Ga0207647_10257697 | |||
| 3695 | Ga0207685_10022529 | |||
| 3696 | Ga0207699_10006725 | |||
| 3697 | Ga0207645_10005056 | |||
| 3698 | Ga0207645_10157581 | |||
| 3699 | Ga0207645_10491243 | |||
| 3700 | Ga0207643_10562209 | |||
| 3701 | Ga0207705_10000033 | |||
| 3702 | Ga0207705_10000037 | |||
| 3703 | Ga0207705_10001756 | |||
| 3704 | Ga0207705_10101733 | |||
| 3705 | Ga0207705_10198026 | |||
| 3706 | Ga0207705_10257550 | |||
| 3707 | Ga0207705_10286787 | |||
| 3708 | Ga0207705_10305783 | |||
| 3709 | Ga0207705_10372330 | |||
| 3710 | Ga0207705_10515727 | |||
| 3711 | Ga0207684_11523488 | |||
| 3712 | Ga0207684_11701422 | |||
| 3713 | Ga0207654_10205025 | |||
| 3714 | Ga0207654_10403323 | |||
| 3715 | Ga0207654_10565528 | |||
| 3716 | Ga0207654_10949379 | |||
| 3717 | Ga0207707_10032620 | |||
| 3718 | Ga0207707_10093782 | |||
| 3719 | Ga0207707_10229056 | |||
| 3720 | Ga0207707_10431688 | |||
| 3721 | Ga0207707_11558563 | |||
| 3722 | Ga0207695_10001285 | |||
| 3723 | Ga0207695_10002063 | |||
| 3724 | Ga0207695_10003382 | |||
| 3725 | Ga0207695_10041989 | |||
| 3726 | Ga0207695_10063442 | |||
| 3727 | Ga0207695_10090796 | |||
| 3728 | Ga0207695_10114464 | |||
| 3729 | Ga0207695_10229651 | |||
| 3730 | Ga0207695_10271816 | |||
| 3731 | Ga0207695_10425775 | |||
| 3732 | Ga0207695_11008826 | |||
| 3733 | Ga0207671_10022726 | |||
| 3734 | Ga0207671_10123662 | |||
| 3735 | Ga0207693_10000892 | |||
| 3736 | Ga0207693_10190416 | |||
| 3737 | Ga0207693_10702145 | |||
| 3738 | Ga0207693_10905594 | |||
| 3739 | Ga0207693_11129049 | |||
| 3740 | Ga0207663_10000847 | |||
| 3741 | Ga0207663_10311044 | |||
| 3742 | Ga0207663_10582076 | |||
| 3743 | Ga0207663_11241778 | |||
| 3744 | Ga0207660_10016689 | |||
| 3745 | Ga0207660_10019569 | |||
| 3746 | Ga0207660_10126937 | |||
| 3747 | Ga0207660_10263836 | |||
| 3748 | Ga0207660_10470764 | |||
| 3749 | Ga0207660_10939625 | |||
| 3750 | Ga0207660_10959431 | |||
| 3751 | Ga0207662_10025150 | |||
| 3752 | Ga0207657_10000227 | |||
| 3753 | Ga0207657_10000695 | |||
| 3754 | Ga0207657_10001202 | |||
| 3755 | Ga0207657_10053790 | |||
| 3756 | Ga0207657_10167794 | |||
| 3757 | Ga0207657_10309432 | |||
| 3758 | Ga0207649_10001202 | |||
| 3759 | Ga0207649_10002320 | |||
| 3760 | Ga0207649_10012168 | |||
| 3761 | Ga0207649_10187528 | |||
| 3762 | Ga0207649_10921635 | |||
| 3763 | Ga0207649_11334309 | |||
| 3764 | Ga0207652_10000474 | |||
| 3765 | Ga0207652_10003357 | |||
| 3766 | Ga0207652_10078695 | |||
| 3767 | Ga0207652_10421608 | |||
| 3768 | Ga0207652_10571168 | |||
| 3769 | Ga0207681_10000030 | |||
| 3770 | Ga0207681_10000120 | |||
| 3771 | Ga0207681_10000188 | |||
| 3772 | Ga0207681_10000261 | |||
| 3773 | Ga0207681_10015620 | |||
| 3774 | Ga0207681_10116214 | |||
| 3775 | Ga0207681_10121656 | |||
| 3776 | Ga0207681_10188480 | |||
| 3777 | Ga0207681_10191146 | |||
| 3778 | Ga0207681_10701429 | |||
| 3779 | Ga0207681_10753446 | |||
| 3780 | Ga0207694_10032047 | |||
| 3781 | Ga0207694_10205261 | |||
| 3782 | Ga0207694_10756678 | |||
| 3783 | Ga0207694_11085333 | |||
| 3784 | Ga0207694_11687627 | |||
| 3785 | Ga0207650_10007097 | |||
| 3786 | Ga0207650_10022682 | |||
| 3787 | Ga0207650_10034458 | |||
| 3788 | Ga0207650_10091393 | |||
| 3789 | Ga0207650_10165351 | |||
| 3790 | Ga0207650_10293222 | |||
| 3791 | Ga0207650_10330158 | |||
| 3792 | Ga0207650_10503856 | |||
| 3793 | Ga0207659_10007934 | |||
| 3794 | Ga0207659_10037022 | |||
| 3795 | Ga0207659_11366318 | |||
| 3796 | Ga0207687_10000239 | |||
| 3797 | Ga0207687_10000398 | |||
| 3798 | Ga0207687_10021033 | |||
| 3799 | Ga0207687_10032848 | |||
| 3800 | Ga0207687_10053051 | |||
| 3801 | Ga0207687_10109163 | |||
| 3802 | Ga0207687_11230628 | |||
| 3803 | Ga0207700_10391087 | |||
| 3804 | Ga0207664_10033627 | |||
| 3805 | Ga0207664_10377153 | |||
| 3806 | Ga0207664_11123777 | |||
| 3807 | Ga0207644_10000008 | |||
| 3808 | Ga0207644_10000017 | |||
| 3809 | Ga0207644_10000275 | |||
| 3810 | Ga0207644_10000758 | |||
| 3811 | Ga0207644_10014424 | |||
| 3812 | Ga0207644_10038642 | |||
| 3813 | Ga0207644_10101281 | |||
| 3814 | Ga0207644_10524958 | |||
| 3815 | Ga0207644_10587733 | |||
| 3816 | Ga0207644_11147826 | |||
| 3817 | Ga0207690_10000002 | |||
| 3818 | Ga0207690_10000033 | |||
| 3819 | Ga0207690_10000791 | |||
| 3820 | Ga0207690_10000978 | |||
| 3821 | Ga0207690_10007053 | |||
| 3822 | Ga0207690_10231150 | |||
| 3823 | Ga0207706_10001092 | |||
| 3824 | Ga0207706_10002029 | |||
| 3825 | Ga0207706_10020532 | |||
| 3826 | Ga0207706_10139104 | |||
| 3827 | Ga0207706_10256104 | |||
| 3828 | Ga0207706_10349971 | |||
| 3829 | Ga0207706_10509923 | |||
| 3830 | Ga0207706_10784238 | |||
| 3831 | Ga0207686_10002670 | |||
| 3832 | Ga0207686_10062631 | |||
| 3833 | Ga0207686_10146674 | |||
| 3834 | Ga0207686_11494933 | |||
| 3835 | Ga0207709_10009544 | |||
| 3836 | Ga0207709_10180597 | |||
| 3837 | Ga0207709_10748070 | |||
| 3838 | Ga0207709_10966756 | |||
| 3839 | Ga0207709_11047834 | |||
| 3840 | Ga0207670_10005805 | |||
| 3841 | Ga0207670_10344537 | |||
| 3842 | Ga0207670_10598185 | |||
| 3843 | Ga0207670_11424369 | |||
| 3844 | Ga0207669_10003850 | |||
| 3845 | Ga0207669_10116677 | |||
| 3846 | Ga0207669_10194822 | |||
| 3847 | Ga0207669_10793850 | |||
| 3848 | Ga0207669_11479566 | |||
| 3849 | Ga0207704_10017213 | |||
| 3850 | Ga0207704_10034319 | |||
| 3851 | Ga0207704_10414271 | |||
| 3852 | Ga0207665_10000425 | |||
| 3853 | Ga0207665_11129404 | |||
| 3854 | Ga0207691_10002632 | |||
| 3855 | Ga0207691_10216626 | |||
| 3856 | Ga0207691_10407224 | |||
| 3857 | Ga0207691_10918344 | |||
| 3858 | Ga0207711_10000424 | |||
| 3859 | Ga0207711_10009142 | |||
| 3860 | Ga0207711_10024579 | |||
| 3861 | Ga0207711_10028129 | |||
| 3862 | Ga0207711_10079894 | |||
| 3863 | Ga0207711_10107428 | |||
| 3864 | Ga0207711_10126112 | |||
| 3865 | Ga0207711_10136431 | |||
| 3866 | Ga0207711_10297055 | |||
| 3867 | Ga0207711_10430961 | |||
| 3868 | Ga0207711_10443263 | |||
| 3869 | Ga0207711_11911995 | |||
| 3870 | Ga0207689_10154385 | |||
| 3871 | Ga0207689_10972965 | |||
| 3872 | Ga0207661_10166015 | |||
| 3873 | Ga0207661_10225868 | |||
| 3874 | Ga0207661_10329297 | |||
| 3875 | Ga0207661_11041435 | |||
| 3876 | Ga0207661_11169481 | |||
| 3877 | Ga0207679_10004122 | |||
| 3878 | Ga0207679_10062647 | |||
| 3879 | Ga0207679_10141829 | |||
| 3880 | Ga0207679_10198386 | |||
| 3881 | Ga0207679_10311780 | |||
| 3882 | Ga0207679_11095037 | |||
| 3883 | Ga0207679_11674967 | |||
| 3884 | Ga0207667_10004469 | |||
| 3885 | Ga0207667_10007100 | |||
| 3886 | Ga0207667_10009657 | |||
| 3887 | Ga0207667_10028735 | |||
| 3888 | Ga0207667_10064744 | |||
| 3889 | Ga0207667_10084062 | |||
| 3890 | Ga0207667_10133914 | |||
| 3891 | Ga0207667_10160095 | |||
| 3892 | Ga0207667_10283960 | |||
| 3893 | Ga0207667_10504900 | |||
| 3894 | Ga0207651_10005591 | |||
| 3895 | Ga0207651_10738092 | |||
| 3896 | Ga0207651_10827572 | |||
| 3897 | Ga0207651_11099308 | |||
| 3898 | Ga0207712_10003733 | |||
| 3899 | Ga0207712_10011358 | |||
| 3900 | Ga0207712_10068985 | |||
| 3901 | Ga0207712_10108368 | |||
| 3902 | Ga0207712_10523654 | |||
| 3903 | Ga0207712_10691242 | |||
| 3904 | Ga0207712_10734217 | |||
| 3905 | Ga0207668_10000033 | |||
| 3906 | Ga0207668_10000403 | |||
| 3907 | Ga0207668_10000620 | |||
| 3908 | Ga0207668_10004688 | |||
| 3909 | Ga0207668_10005395 | |||
| 3910 | Ga0207668_10013122 | |||
| 3911 | Ga0207668_10064519 | |||
| 3912 | Ga0207668_10177129 | |||
| 3913 | Ga0207668_10298211 | |||
| 3914 | Ga0207668_10372637 | |||
| 3915 | Ga0207668_10407814 | |||
| 3916 | Ga0207668_10521861 | |||
| 3917 | Ga0207668_10815345 | |||
| 3918 | Ga0207668_11184631 | |||
| 3919 | Ga0207640_10001288 | |||
| 3920 | Ga0207640_10002534 | |||
| 3921 | Ga0207640_10004079 | |||
| 3922 | Ga0207640_10020742 | |||
| 3923 | Ga0207640_10033791 | |||
| 3924 | Ga0207640_10064291 | |||
| 3925 | Ga0207640_10099354 | |||
| 3926 | Ga0207640_11211206 | |||
| 3927 | Ga0207640_11415498 | |||
| 3928 | Ga0207658_10000737 | |||
| 3929 | Ga0207658_10001017 | |||
| 3930 | Ga0207658_10001740 | |||
| 3931 | Ga0207658_10004840 | |||
| 3932 | Ga0207658_10020333 | |||
| 3933 | Ga0207658_10034101 | |||
| 3934 | Ga0207658_10065651 | |||
| 3935 | Ga0207658_10485692 | |||
| 3936 | Ga0207658_10665284 | |||
| 3937 | Ga0207658_10899019 | |||
| 3938 | Ga0207658_11027688 | |||
| 3939 | Ga0207658_11291393 | |||
| 3940 | Ga0207677_10000043 | |||
| 3941 | Ga0207677_10004385 | |||
| 3942 | Ga0207677_10244171 | |||
| 3943 | Ga0207677_10507965 | |||
| 3944 | Ga0207677_10564414 | |||
| 3945 | Ga0207703_10000079 | |||
| 3946 | Ga0207703_10003192 | |||
| 3947 | Ga0207703_10003477 | |||
| 3948 | Ga0207703_10008313 | |||
| 3949 | Ga0207703_10019595 | |||
| 3950 | Ga0207703_10043560 | |||
| 3951 | Ga0207703_10044815 | |||
| 3952 | Ga0207703_10285304 | |||
| 3953 | Ga0207703_10287847 | |||
| 3954 | Ga0207703_10438240 | |||
| 3955 | Ga0207703_10452911 | |||
| 3956 | Ga0207703_10534317 | |||
| 3957 | Ga0207703_10728259 | |||
| 3958 | Ga0207703_11537737 | |||
| 3959 | Ga0207639_10002795 | |||
| 3960 | Ga0207639_10016083 | |||
| 3961 | Ga0207639_10037841 | |||
| 3962 | Ga0207639_10362187 | |||
| 3963 | Ga0207639_10787614 | |||
| 3964 | Ga0207639_11080696 | |||
| 3965 | Ga0207678_10000884 | |||
| 3966 | Ga0207678_10001466 | |||
| 3967 | Ga0207678_10034999 | |||
| 3968 | Ga0207678_10134765 | |||
| 3969 | Ga0207678_10272004 | |||
| 3970 | Ga0207678_10787375 | |||
| 3971 | Ga0207678_11443500 | |||
| 3972 | Ga0207678_11454183 | |||
| 3973 | Ga0207708_10000785 | |||
| 3974 | Ga0207708_10075845 | |||
| 3975 | Ga0207708_10145397 | |||
| 3976 | Ga0207708_10367232 | |||
| 3977 | Ga0207708_10452388 | |||
| 3978 | Ga0207708_11127932 | |||
| 3979 | Ga0207702_10001194 | |||
| 3980 | Ga0207702_10012659 | |||
| 3981 | Ga0207702_10014307 | |||
| 3982 | Ga0207702_10033715 | |||
| 3983 | Ga0207702_10051771 | |||
| 3984 | Ga0207702_10058096 | |||
| 3985 | Ga0207702_10123220 | |||
| 3986 | Ga0207641_10000034 | |||
| 3987 | Ga0207641_10000113 | |||
| 3988 | Ga0207641_10001192 | |||
| 3989 | Ga0207641_10005506 | |||
| 3990 | Ga0207641_10040794 | |||
| 3991 | Ga0207641_10092440 | |||
| 3992 | Ga0207641_10132678 | |||
| 3993 | Ga0207641_11189814 | |||
| 3994 | Ga0207641_11495290 | |||
| 3995 | Ga0207641_11594920 | |||
| 3996 | Ga0207648_10019921 | |||
| 3997 | Ga0207648_10046864 | |||
| 3998 | Ga0207648_10059376 | |||
| 3999 | Ga0207648_10201266 | |||
| 4000 | Ga0207676_10000103 | |||
| 4001 | Ga0207676_10003461 | |||
| 4002 | Ga0207676_10023358 | |||
| 4003 | Ga0207676_10037206 | |||
| 4004 | Ga0207676_10187021 | |||
| 4005 | Ga0207676_10411528 | |||
| 4006 | Ga0207676_10503127 | |||
| 4007 | Ga0207676_10784422 | |||
| 4008 | Ga0207676_11201633 | |||
| 4009 | Ga0207674_10004708 | |||
| 4010 | Ga0207674_10008209 | |||
| 4011 | Ga0207674_10018149 | |||
| 4012 | Ga0207674_10022498 | |||
| 4013 | Ga0207674_10344010 | |||
| 4014 | Ga0207674_10364107 | |||
| 4015 | Ga0207674_10689739 | |||
| 4016 | Ga0207674_11311459 | |||
| 4017 | Ga0207674_11692586 | |||
| 4018 | Ga0207675_100000221 | |||
| 4019 | Ga0207675_100000933 | |||
| 4020 | Ga0207675_100032035 | |||
| 4021 | Ga0207675_100048571 | |||
| 4022 | Ga0207675_100551440 | |||
| 4023 | Ga0207675_100927386 | |||
| 4024 | Ga0207675_101438004 | |||
| 4025 | Ga0207683_10000861 | |||
| 4026 | Ga0207683_10457651 | |||
| 4027 | Ga0207683_10468017 | |||
| 4028 | Ga0207683_10704558 | |||
| 4029 | Ga0207683_10889630 | |||
| 4030 | Ga0207698_10023240 | |||
| 4031 | Ga0207698_10042867 | |||
| 4032 | Ga0207698_10493207 | |||
| 4033 | Ga0207698_10498066 | |||
| 4034 | Ga0207698_10534432 | |||
| 4035 | Ga0207698_10538591 | |||
| 4036 | Ga0207698_10731586 | |||
| 4037 | Ga0207698_10829874 | |||
| 4038 | Ga0207698_10917793 | |||
| 4039 | Ga0207698_11378092 | |||
| 4040 | Ga0209281_1035841 | |||
| 4041 | Ga0209281_1062390 | |||
| 4042 | Ga0209371_1057678 | |||
| 4043 | Ga0209969_1066951 | |||
| 4044 | Ga0209981_1009685 | |||
| 4045 | Ga0209996_1056539 | |||
| 4046 | Ga0210000_1081151 | |||
| 4047 | Ga0209999_1005300 | |||
| 4048 | Ga0209999_1067543 | |||
| 4049 | Ga0209983_1008334 | |||
| 4050 | Ga0209983_1069405 | |||
| 4051 | Ga0209282_1254740 | |||
| 4052 | Ga0209998_10130355 | |||
| 4053 | Ga0209813_10000014 | |||
| 4054 | Ga0209813_10000230 | |||
| 4055 | Ga0209813_10006694 | |||
| 4056 | Ga0209813_10008755 | |||
| 4057 | Ga0209813_10020418 | |||
| 4058 | Ga0209813_10077130 | |||
| 4059 | Ga0209974_10007355 | |||
| 4060 | Ga0209974_10013244 | |||
| 4061 | Ga0209974_10312524 | |||
| 4062 | Ga0207428_10033106 | |||
| 4063 | Ga0207428_10232679 | |||
| 4064 | Ga0207428_10247950 | |||
| 4065 | Ga0207428_10378638 | |||
| 4066 | Ga0268266_10000002 | |||
| 4067 | Ga0268266_10000175 | |||
| 4068 | Ga0268266_10002211 | |||
| 4069 | Ga0268266_10002389 | |||
| 4070 | Ga0268266_10003113 | |||
| 4071 | Ga0268266_10029371 | |||
| 4072 | Ga0268266_10067263 | |||
| 4073 | Ga0268266_10068435 | |||
| 4074 | Ga0268266_10110749 | |||
| 4075 | Ga0268266_10130141 | |||
| 4076 | Ga0268266_10139743 | |||
| 4077 | Ga0268266_10314309 | |||
| 4078 | Ga0268266_11339979 | |||
| 4079 | Ga0268266_11475120 | |||
| 4080 | Ga0268265_10000074 | |||
| 4081 | Ga0268265_10006282 | |||
| 4082 | Ga0268265_10012220 | |||
| 4083 | Ga0268265_10023312 | |||
| 4084 | Ga0268265_10035883 | |||
| 4085 | Ga0268265_10140009 | |||
| 4086 | Ga0268265_10178490 | |||
| 4087 | Ga0268265_10401274 | |||
| 4088 | Ga0268265_10627317 | |||
| 4089 | Ga0268265_10925105 | |||
| 4090 | Ga0268265_11531053 | |||
| 4091 | Ga0268264_10000067 | |||
| 4092 | Ga0268264_10000215 | |||
| 4093 | Ga0268264_10013477 | |||
| 4094 | Ga0268264_10015091 | |||
| 4095 | Ga0268264_10024453 | |||
| 4096 | Ga0268264_10039933 | |||
| 4097 | Ga0268264_10068596 | |||
| 4098 | Ga0268264_10191637 | |||
| 4099 | Ga0268264_10333039 | |||
| 4100 | Ga0268264_10664297 | |||
| 4101 | Ga0268264_10732494 | |||
| 4102 | Ga0268264_10753907 | |||
| 4103 | Ga0268264_11707721 | |||
| 4104 | Ga0268264_12052361 | |||
| 4105 | Ga0265326_10024973 | |||
| 4106 | Ga0265334_10044496 | |||
| 4107 | Ga0307517_10097484 | |||
| 4108 | Ga0307517_10143392 | |||
| 4109 | Ga0265338_10010218 | |||
| 4110 | Ga0265338_10011065 | |||
| 4111 | Ga0268256_1064671 | |||
| 4112 | Ga0316177_1186482 | |||
| 4113 | Ga0314311_1038512 | |||
| 4114 | Ga0316182_1427119 | |||
| 4115 | Ga0265762_1040596 | |||
| 4116 | Ga0265766_1007313 | |||
| 4117 | Ga0265325_10072483 | |||
| 4118 | Ga0265340_10060998 | |||
| 4119 | Ga0265340_10503640 | |||
| 4120 | Ga0265339_10147493 | |||
| 4121 | Ga0265331_10006566 | |||
| 4122 | Ga0265327_10000454 | |||
| 4123 | Ga0265327_10016302 | |||
| 4124 | Ga0307513_10013182 | |||
| 4125 | Ga0307513_10133646 | |||
| 4126 | Ga0307513_10483897 | |||
| 4127 | Ga0307513_10640871 | |||
| 4128 | Ga0307513_10660788 | |||
| 4129 | Ga0307408_100004861 | |||
| 4130 | Ga0307408_100049461 | |||
| 4131 | Ga0307408_100205359 | |||
| 4132 | Ga0307408_100345626 | |||
| 4133 | Ga0307408_100531713 | |||
| 4134 | Ga0265313_10022615 | |||
| 4135 | Ga0307508_10000011 | |||
| 4136 | Ga0307508_10217158 | |||
| 4137 | Ga0316575_10083397 | |||
| 4138 | Ga0316575_10169027 | |||
| 4139 | Ga0316579_10007369 | |||
| 4140 | Ga0316579_10016916 | |||
| 4141 | Ga0265314_10128194 | |||
| 4142 | Ga0265314_10293885 | |||
| 4143 | Ga0265314_10526871 | |||
| 4144 | Ga0265342_10299559 | |||
| 4145 | Ga0316576_10403734 | |||
| 4146 | Ga0316576_10504923 | |||
| 4147 | Ga0316576_10746205 | |||
| 4148 | Ga0316576_11027791 | |||
| 4149 | Ga0316578_10081398 | |||
| 4150 | Ga0307516_10264534 | |||
| 4151 | Ga0307516_10307958 | |||
| 4152 | Ga0307405_10000196 | |||
| 4153 | Ga0307405_10010011 | |||
| 4154 | Ga0307405_10022461 | |||
| 4155 | Ga0307405_10041042 | |||
| 4156 | Ga0307405_10111030 | |||
| 4157 | Ga0307405_10318671 | |||
| 4158 | Ga0307405_10464827 | |||
| 4159 | Ga0307405_10847687 | |||
| 4160 | Ga0307405_10964875 | |||
| 4161 | Ga0307405_11859349 | |||
| 4162 | Ga0316577_10044978 | |||
| 4163 | Ga0316577_10264495 | |||
| 4164 | Ga0307413_10078911 | |||
| 4165 | Ga0307413_10089977 | |||
| 4166 | Ga0307413_10150544 | |||
| 4167 | Ga0307413_10230820 | |||
| 4168 | Ga0307413_10274293 | |||
| 4169 | Ga0307413_10379746 | |||
| 4170 | Ga0307413_10413584 | |||
| 4171 | Ga0307413_10578605 | |||
| 4172 | Ga0307413_10733319 | |||
| 4173 | Ga0307413_11031583 | |||
| 4174 | Ga0307413_12063674 | |||
| 4175 | Ga0307410_10009373 | |||
| 4176 | Ga0307410_10011923 | |||
| 4177 | Ga0307410_10015917 | |||
| 4178 | Ga0307410_10303638 | |||
| 4179 | Ga0307410_10380611 | |||
| 4180 | Ga0307410_10406987 | |||
| 4181 | Ga0307410_10595253 | |||
| 4182 | Ga0307410_10640323 | |||
| 4183 | Ga0307410_11592286 | |||
| 4184 | Ga0307410_12142697 | |||
| 4185 | Ga0307406_10001425 | |||
| 4186 | Ga0307406_10051708 | |||
| 4187 | Ga0307406_10083387 | |||
| 4188 | Ga0307406_10146427 | |||
| 4189 | Ga0307406_10258244 | |||
| 4190 | Ga0307406_10495425 | |||
| 4191 | Ga0307406_10804140 | |||
| 4192 | Ga0307407_10132995 | |||
| 4193 | Ga0307407_10321829 | |||
| 4194 | Ga0307407_10464876 | |||
| 4195 | Ga0307407_10481382 | |||
| 4196 | Ga0307407_10575746 | |||
| 4197 | Ga0307407_10942369 | |||
| 4198 | Ga0307412_10016048 | |||
| 4199 | Ga0307412_10020098 | |||
| 4200 | Ga0307412_10024329 | |||
| 4201 | Ga0307412_10029631 | |||
| 4202 | Ga0307412_10060113 | |||
| 4203 | Ga0307412_10085252 | |||
| 4204 | Ga0307412_10212445 | |||
| 4205 | Ga0307412_10496938 | |||
| 4206 | Ga0307412_10499734 | |||
| 4207 | Ga0307412_10500432 | |||
| 4208 | Ga0307412_10501543 | |||
| 4209 | Ga0307412_10673017 | |||
| 4210 | Ga0307409_100010502 | |||
| 4211 | Ga0307409_100049412 | |||
| 4212 | Ga0307409_100121708 | |||
| 4213 | Ga0307409_100253909 | |||
| 4214 | Ga0307409_100483059 | |||
| 4215 | Ga0307409_100498590 | |||
| 4216 | Ga0307409_101042606 | |||
| 4217 | Ga0307409_101184418 | |||
| 4218 | Ga0307409_101743755 | |||
| 4219 | Ga0307409_101823183 | |||
| 4220 | Ga0307409_102434774 | |||
| 4221 | Ga0307416_100029861 | |||
| 4222 | Ga0307416_100101817 | |||
| 4223 | Ga0307416_100116550 | |||
| 4224 | Ga0307416_100313124 | |||
| 4225 | Ga0307416_100439929 | |||
| 4226 | Ga0307416_100870387 | |||
| 4227 | Ga0307416_101362775 | |||
| 4228 | Ga0307416_101746545 | |||
| 4229 | Ga0307416_101867127 | |||
| 4230 | Ga0307416_102513524 | |||
| 4231 | Ga0307414_10000371 | |||
| 4232 | Ga0307414_10004614 | |||
| 4233 | Ga0307414_10008100 | |||
| 4234 | Ga0307414_10027055 | |||
| 4235 | Ga0307414_10035772 | |||
| 4236 | Ga0307414_10069418 | |||
| 4237 | Ga0307414_10087115 | |||
| 4238 | Ga0307414_10096364 | |||
| 4239 | Ga0307414_10104259 | |||
| 4240 | Ga0307414_10148592 | |||
| 4241 | Ga0307414_10183494 | |||
| 4242 | Ga0307414_10192892 | |||
| 4243 | Ga0307414_10226868 | |||
| 4244 | Ga0307414_10386670 | |||
| 4245 | Ga0307414_10529256 | |||
| 4246 | Ga0307414_10717603 | |||
| 4247 | Ga0307414_11388803 | |||
| 4248 | Ga0307414_12036146 | |||
| 4249 | Ga0307414_12092507 | |||
| 4250 | Ga0307411_10029626 | |||
| 4251 | Ga0307411_10037350 | |||
| 4252 | Ga0307411_10072538 | |||
| 4253 | Ga0307411_10133316 | |||
| 4254 | Ga0307411_10191465 | |||
| 4255 | Ga0307411_10511312 | |||
| 4256 | Ga0307411_10582115 | |||
| 4257 | Ga0307411_10665199 | |||
| 4258 | Ga0307411_10759396 | |||
| 4259 | Ga0307411_11016560 | |||
| 4260 | Ga0307411_12118556 | |||
| 4261 | Ga0307415_100191609 | |||
| 4262 | Ga0307415_100211944 | |||
| 4263 | Ga0307415_100499301 | |||
| 4264 | Ga0307415_100501856 | |||
| 4265 | Ga0307415_100524571 | |||
| 4266 | Ga0307415_101203147 | |||
| 4267 | Ga0307415_101279797 | |||
| 4268 | Ga0307415_101749277 | |||
| 4269 | Ga0316580_10117988 | |||
| 4270 | Ga0316593_10033954 | |||
| 4271 | Ga0307510_10155235 | |||
| 4272 | Ga0316592_1054171 | |||
| 4273 | Ga0316588_1049789 | |||
| 4274 | Ga0316588_1121282 | |||
| 4275 | Ga0316596_1021836 | |||
| 4276 | Ga0316596_1081013 | |||
| 4277 | Ga0373948_0006065 | |||
| 4278 | Ga0373938_0090470 | |||
| 4279 | Ga0373928_0026493 | |||
| 4280 | Ga0373929_0027435 | |||
| 4281 | Ga0373929_0042826 | |||
| 4282 | Ga0373929_0096835 | |||
| 4283 | Ga0373929_0247468 | |||
| 4284 | Ga0373940_0003431 | |||
| 4285 | Ga0373951_0150911 | |||
| 4286 | Ga0373952_0031133 | |||
| 4287 | Ga0373923_0342435 | |||
| 4288 | Ga0373932_0180066 | |||
| 4289 | Ga0373939_0005439 | |||
| 4290 | Ga0373939_0391762 | |||
| 4291 | Ga0373939_0424902 | |||
| 4292 | Ga0373941_0000122 | |||
| 4293 | Ga0373941_0012044 | |||
| 4294 | Ga0373941_0186789 | |||
| 4295 | Ga0373956_0581413 | |||
| 4296 | Ga0373957_0273689 | |||
| 4297 | Ga0373960_0005313 | |||
| 4298 | Ga0373960_0111217 | |||
| 4299 | Ga0373960_0287076 | |||
| 4300 | Ga0373942_0058443 | |||
| 4301 | Ga0373961_0006874 | |||
| 4302 | Ga0373962_0019956 | |||
| 4303 | Ga0373962_0146685 | |||
| 4304 | Ga0316574_0037577 | |||
| 4305 | Ga0316574_0322702 | |||
| 4306 | Ga0373924_0404487 | |||
| 4307 | Ga0373931_0005809 | |||
| 4308 | Ga0373931_0007458 | |||
| 4309 | Ga0373931_0017420 | |||
| 4310 | Ga0373931_0034633 | |||
| 4311 | Ga0373931_0462120 | |||
| 4312 | Ga0373931_0975101 | |||
| 4313 | Ga0373931_0986633 | |||
| 4314 | Ga0373935_0793286 | |||
| 4315 | Ga0373927_0279401 | |||
| 4316 | Ga0373927_0613566 | |||
| 4317 | Ga0373933_0335654 | |||
| 4318 | Ga0373947_0421765 | |||
| 4319 | Ga0373947_0708922 | |||
| 4320 | Ga0373947_1029478 | |||
| 4321 | Ga0373937_0756978 | |||
| 4322 | Ga0373937_0767158 | |||
| 4323 | Ga0373937_1269106 | |||
| 4324 | Ga0316582_0014084 | |||
| 4325 | Ga0316584_0012127 | |||
| 4326 | Ga0316584_0075207 | |||
| 4327 | Ga0316584_0124021 | |||
| 4328 | Ga0316584_0354608 | |||
| 4329 | Ga0395899_0004516 | |||
| 4330 | Ga0395899_0009175 | |||
| 4331 | Ga0395899_0058394 | |||
| 4332 | Ga0395899_0065715 | |||
| 4333 | Ga0395899_0092715 | |||
| 4334 | Ga0395900_0001724 | |||
| 4335 | Ga0395900_0038265 | |||
| 4336 | Ga0395900_0085349 | |||
| 4337 | Ga0395900_0088445 | |||
| 4338 | Ga0395900_0301128 | |||
| 4339 | Ga0395900_0386171 | |||
| 4340 | Ga0395900_0499091 | |||
| 4341 | Ga0395898_0157878 | |||
| 4342 | Ga0395898_0221767 | |||
| 4343 | Ga0395898_0534956 | |||
| 4344 | Ga0395905_0000608 | |||
| 4345 | Ga0395905_0001310 | |||
| 4346 | Ga0395905_0068245 | |||
| 4347 | Ga0395905_1239144 | |||
| 4348 | Ga0395905_1491671 | |||
| 4349 | Ga0316581_0042912 | |||
| 4350 | Ga0316581_0049060 | |||
| 4351 | Ga0436364_0084899 | |||
| 4352 | Ga0436364_0222939 | |||
| 4353 | Ga0436364_1178388 | |||
| 4354 | Ga0436364_1497021 | |||
| 4355 | Ga0436364_1558455 | |||
| 4356 | Ga0395901_0077970 | |||
| 4357 | Ga0395901_0124118 | |||
| 4358 | Ga0395901_0189909 | |||
| 4359 | Ga0395901_0217858 | |||
| 4360 | Ga0395901_0354199 | |||
| 4361 | Ga0242420_003405 | |||
| 4362 | Ga0400483_067380 | |||
| 4363 | Ga0400483_068661 | |||
| 4364 | Ga0400483_173078 | |||
| 4365 | Ga0400483_180542 | |||
| 4366 | Ga0400483_204874 | |||
| 4367 | Ga0436365_0105609 | |||
| 4368 | Ga0436365_0331130 | |||
| 4369 | Ga0436365_0614931 | |||
| 4370 | Ga0436365_0926226 | |||
| 4371 | Ga0436365_1426025 | |||
| 4372 | Ga0436365_1472042 | |||
| 4373 | Ga0436365_1924518 | |||
| 4374 | Ga0436360_0160866 | |||
| 4375 | Ga0436360_0343032 | |||
| 4376 | Ga0436360_0349025 | |||
| 4377 | Ga0436360_0374078 | |||
| 4378 | Ga0436360_1022661 | |||
| 4379 | Ga0436360_1036016 | |||
| 4380 | Ga0436361_0696162 | |||
| 4381 | Ga0436361_0738968 | |||
| 4382 | Ga0436361_0777262 | |||
| 4383 | Ga0436361_1026066 | |||
| 4384 | Ga0436363_0381568 | |||
| 4385 | Ga0436363_0564773 | |||
| 4386 | Ga0436363_1349972 | |||
| 4387 | Ga0436363_1573256 | |||
| 4388 | Ga0436363_1597741 | |||
| 4389 | Ga0436362_0064393 | |||
| 4390 | Ga0436362_0215979 | |||
| 4391 | Ga0436362_0526587 | |||
| 4392 | Ga0436362_0535229 | |||
| 4393 | Ga0436362_0567947 | |||
| 4394 | Ga0436362_0634200 | |||
| 4395 | Ga0436362_0835643 | |||
| 4396 | Ga0436362_1034769 | |||
| 4397 | Ga0436362_1285925 | |||
| 4398 | Ga0439436_0064552 | |||
| 4399 | Ga0439439_0005078 | |||
| 4400 | Ga0439447_059227 | |||
| 4401 | Ga0439461_0010778 | |||
| 4402 | Ga0439466_0019806 | |||
| 4403 | Ga0439465_0001868 | |||
| 4404 | Ga0439465_0003473 | |||
| 4405 | Ga0451789_0509383 | |||
| 4406 | Ga0451789_0762327 | |||
| 4407 | Ga0451790_26137 | |||
| 4408 | Ga0451792_07864 | |||
| 4409 | Ga0451794_20066 | |||
| 4410 | Ga0451794_34299 | |||
| 4411 | Ga0451791_1586556 | |||
| 4412 | Ga0451791_1679327 | |||
| 4413 | Ga0451793_0354107 | |||
| 4414 | Ga0451793_0668171 | |||
| 4415 | Ga0451797_1467030 | |||
| 4416 | Ga0451801_34670 | |||
| 4417 | Ga0451798_0032465 | |||
| 4418 | Ga0451798_0965105 | |||
| 4419 | Ga0451800_1517120 | |||
| 4420 | Ga0451802_0200424 | |||
| 4421 | Ga0451802_0604284 | |||
| 4422 | Ga0451802_1735810 | |||
| 4423 | Ga0451806_501791 | |||
| 4424 | Ga0451804_0497676 | |||
| 4425 | Ga0451804_0831235 | |||
| 4426 | Ga0451807_0346685 | |||
| 4427 | Ga0451807_1013799 | |||
| 4428 | Ga0451833_0170114 | |||
| 4429 | Ga0451835_0912455 | |||
| 4430 | Ga0451841_0666561 | |||
| 4431 | Ga0451841_0761262 | |||
| 4432 | Ga0451841_1387938 | |||
| 4433 | Ga0451845_0989282 | |||
| 4434 | Ga0451849_0506178 | |||
| 4435 | Ga0451849_1361625 | |||
| 4436 | Ga0451851_1228336 | |||
| 4437 | Ga0451843_1470911 | |||
| 4438 | Ga0451855_0483205 | |||
| 4439 | Ga0451855_1086033 | |||
| 4440 | Ga0451853_0214658 | |||
| 4441 | Ga0451853_2334469 | |||
| 4442 | Ga0451853_3229958 | |||
| 4443 | Ga0439431_0000104 | |||
| 4444 | Ga0439431_0003546 | |||
| 4445 | Ga0439442_000783 | |||
| 4446 | Ga0439443_030922 | |||
| 4447 | Ga0439445_0001513 | |||
| 4448 | Ga0439445_0025857 | |||
| 4449 | Ga0439445_0093162 | |||
| 4450 | Ga0439432_001274 | |||
| 4451 | Ga0439432_018010 | |||
| 4452 | Ga0439452_022629 | |||
| 4453 | Ga0439457_005922 | |||
| 4454 | Ga0439462_0000844 | |||
| 4455 | Ga0439462_0002785 | |||
| 4456 | Ga0439462_0012289 | |||
| 4457 | Ga0450912_022816 | |||
| 4458 | Ga0450923_025883 | |||
| 4459 | Ga0450888_078432 | |||
| 4460 | Ga0450898_033574 | |||
| 4461 | Ga0450889_000023 | |||
| 4462 | Ga0439446_0145781 | |||
| 4463 | Ga0450909_009470 | |||
| 4464 | Ga0439434_0005357 | |||
| 4465 | Ga0439434_0098487 | |||
| 4466 | Ga0439435_0009252 | |||
| 4467 | Ga0439435_0193719 | |||
| 4468 | Ga0439459_0050109 | |||
| 4469 | Ga0439459_0053607 | |||
| 4470 | Ga0451577_1620962 | |||
| 4471 | Ga0466969_0010778 | |||
| 4472 | Ga0466969_0091069 | |||
| 4473 | Ga0466965_0545941 | |||
| 4474 | Ga0466966_0000021 | |||
| 4475 | Ga0466966_0001996 | |||
| 4476 | Ga0466966_0003640 | |||
| 4477 | Ga0466966_0738248 | |||
| 4478 | Ga0466961_0008264 | |||
| 4479 | Ga0466963_0016990 | |||
| 4480 | Ga0466963_0254291 | |||
| 4481 | Ga0466964_0460823 | |||
| 4482 | Ga0453684_0000018 | |||
| 4483 | Ga0453684_0299680 | |||
| 4484 | Ga0453684_0658612 | |||
| 4485 | Ga0453684_2537308 | |||
| 4486 | Ga0466971_0000846 | |||
| 4487 | Ga0466971_0147659 | |||
| 4488 | Ga0466970_0006718 | |||
| 4489 | Ga0466970_0521680 | |||
| 4490 | Ga0466957_0002162 | |||
| 4491 | Ga0466957_0826159 | |||
| 4492 | Ga0466959_0006500 | |||
| 4493 | Ga0466959_0013668 | |||
| 4494 | Ga0466959_0038377 | |||
| 4495 | Ga0466959_0240105 | |||
| 4496 | Ga0451576_0000024 | |||
| 4497 | Ga0451576_0001525 | |||
| 4498 | Ga0451576_0015898 | |||
| 4499 | Ga0451576_0049961 | |||
| 4500 | Ga0451576_0104195 | |||
| 4501 | Ga0451576_1337580 | |||
| 4502 | Ga0451576_2738626 | |||
| 4503 | Ga0466958_0009405 | |||
| 4504 | Ga0466958_0110375 | |||
| 4505 | Ga0466967_0825658 | |||
| 4506 | Ga0495617_005172 | |||
| 4507 | Ga0495627_000295 | |||
| 4508 | Ga0495627_000507 | |||
| 4509 | Ga0495627_000928 | |||
| 4510 | Ga0495627_017826 | |||
| 4511 | Ga0495627_110900 | |||
| 4512 | Ga0495629_0452251 | |||
| 4513 | Ga0495638_0000207 | |||
| 4514 | Ga0495638_0143540 | |||
| 4515 | Ga0495638_0151305 | |||
| 4516 | Ga0495638_0158058 | |||
| 4517 | Ga0495638_0351577 | |||
| 4518 | Ga0495638_0408671 | |||
| 4519 | Ga0495641_0500518 | |||
| 4520 | Ga0495651_0217711 | |||
| 4521 | Ga0495650_0004608 | |||
| 4522 | Ga0495650_0047173 | |||
| 4523 | Ga0495650_0303078 | |||
| 4524 | Ga0495580_0035969 | |||
| 4525 | Ga0495580_0617920 | |||
| 4526 | Ga0495582_0198735 | |||
| 4527 | Ga0495605_0088630 | |||
| 4528 | Ga0495639_0266775 | |||
| 4529 | Ga0495639_0267650 | |||
| 4530 | Ga0495639_0431714 | |||
| 4531 | Ga0495664_0412313 | |||
| 4532 | Ga0495584_0056669 | |||
| 4533 | Ga0495585_0119990 | |||
| 4534 | Ga0495594_0126085 | |||
| 4535 | Ga0495596_0000153 | |||
| 4536 | Ga0495596_0000154 | |||
| 4537 | Ga0495596_0201578 | |||
| 4538 | Ga0495607_0009022 | |||
| 4539 | Ga0495583_0085714 | |||
| 4540 | Ga0495583_0183298 | |||
| 4541 | Ga0495606_0009651 | |||
| 4542 | Ga0495606_0169262 | |||
| 4543 | Ga0495610_0000015 | |||
| 4544 | Ga0495610_0000102 | |||
| 4545 | Ga0495610_0001230 | |||
| 4546 | Ga0495610_0001618 | |||
| 4547 | Ga0495610_0048245 | |||
| 4548 | Ga0495610_0143157 | |||
| 4549 | Ga0495610_0173077 | |||
| 4550 | Ga0495610_0350328 | |||
| 4551 | Ga0495618_0448869 | |||
| 4552 | Ga0495620_0007378 | |||
| 4553 | Ga0495620_0158030 | |||
| 4554 | Ga0495630_0523333 | |||
| 4555 | Ga0495631_0026605 | |||
| 4556 | Ga0495631_0369642 | |||
| 4557 | Ga0495632_0000013 | |||
| 4558 | Ga0495632_0004141 | |||
| 4559 | Ga0495632_0142646 | |||
| 4560 | Ga0495632_0144521 | |||
| 4561 | Ga0495637_0000336 | |||
| 4562 | Ga0495637_0002839 | |||
| 4563 | Ga0495637_0092301 | |||
| 4564 | Ga0495643_0000010 | |||
| 4565 | Ga0495643_0000080 | |||
| 4566 | Ga0495643_0001635 | |||
| 4567 | Ga0495643_0005120 | |||
| 4568 | Ga0495643_0018560 | |||
| 4569 | Ga0495643_0039818 | |||
| 4570 | Ga0495643_0145927 | |||
| 4571 | Ga0495644_0198558 | |||
| 4572 | Ga0495648_0018736 | |||
| 4573 | Ga0495648_0045425 | |||
| 4574 | Ga0495663_0000004 | |||
| 4575 | Ga0495663_0063329 | |||
| 4576 | Ga0495663_0133121 | |||
| 4577 | Ga0495642_0058469 | |||
| 4578 | Ga0495652_0275174 | |||
| 4579 | Ga0495654_0038375 | |||
| 4580 | Ga0495654_0272704 | |||
| 4581 | Ga0495665_0047755 | |||
| 4582 | Ga0495640_0155677 | |||
| 4583 | Ga0495586_0042387 | |||
| 4584 | Ga0495586_0700630 | |||
| 4585 | Ga0495587_0093132 | |||
| 4586 | Ga0495598_0013519 | |||
| 4587 | Ga0495609_0001714 | |||
| 4588 | Ga0495609_0014892 | |||
| 4589 | Ga0495621_0066212 | |||
| 4590 | Ga0495621_0465570 | |||
| 4591 | Ga0495597_0001366 | |||
| 4592 | Ga0495622_0002718 | |||
| 4593 | Ga0495633_0000092 | |||
| 4594 | Ga0495633_0001239 | |||
| 4595 | Ga0495633_0009946 | |||
| 4596 | Ga0495633_0042220 | |||
| 4597 | Ga0495667_0192194 | |||
| 4598 | Ga0495656_0508253 | |||
| 4599 | Ga0495668_0000087 | |||
| 4600 | Ga0495668_0056696 | |||
| 4601 | Ga0495668_0060236 | |||
| 4602 | Ga0495668_0168756 | |||
| 4603 | Ga0495668_0268427 | |||
| 4604 | Ga0495668_0423788 | |||
| 4605 | Ga0495668_0442675 | |||
| 4606 | Ga0495668_0660372 | |||
| 4607 | Ga0495634_0209916 | |||
| 4608 | Ga0495625_0000275 | |||
| 4609 | Ga0495625_0001182 | |||
| 4610 | Ga0495625_0137896 | |||
| 4611 | Ga0495625_0151972 | |||
| 4612 | Ga0495625_0371219 | |||
| 4613 | Ga0495625_0502195 | |||
| 4614 | Ga0495635_0109018 | |||
| 4615 | Ga0495661_0039270 | |||
| 4616 | Ga0495657_0257287 | |||
| 4617 | Ga0495669_0276085 | |||
| 4618 | Ga0495613_0181570 | |||
| 4619 | Ga0495670_0000010 | |||
| 4620 | Ga0495670_0019654 | |||
| 4621 | Ga0495671_0000014 | |||
| 4622 | Ga0495649_0277269 | |||
| 4623 | Ga0495600_0464772 | |||
| 4624 | Ga0495604_0234463 | |||
| 4625 | Ga0495674_0215529 | |||
| 4626 | Ga0495672_0000949 | |||
| 4627 | Ga0495672_0105363 | |||
| 4628 | Ga0495676_0980730 | |||
| 4629 | Ga0495683_0171932 | |||
| 4630 | Ga0495683_0329538 | |||
| 4631 | Ga0495687_070086 | |||
| 4632 | Ga0495675_0511700 | |||
| 4633 | Ga0495673_0143742 | |||
| 4634 | Ga0495673_0170489 | |||
| 4635 | Ga0495681_0000046 | |||
| 4636 | Ga0495681_0000062 | |||
| 4637 | Ga0495681_0024722 | |||
| 4638 | Ga0495681_0111775 | |||
| 4639 | Ga0495681_0207630 | |||
| 4640 | Ga0495681_0241178 | |||
| 4641 | Ga0495686_0000354 | |||
| 4642 | Ga0495686_0006459 | |||
| 4643 | Ga0495686_0017144 | |||
| 4644 | Ga0495686_0023999 | |||
| 4645 | Ga0495686_0214633 | |||
| 4646 | Ga0495593_0132220 | |||
| 4647 | Ga0495602_0544390 | |||
| 4648 | Ga0495602_0601516 | |||
| 4649 | Ga0495614_0330860 | |||
| 4650 | Ga0495615_0000114 | |||
| 4651 | Ga0495626_0000459 | |||
| 4652 | Ga0496100_0000708 | |||
| 4653 | Ga0496100_0012625 | |||
| 4654 | Ga0496100_0088978 | |||
| 4655 | Ga0496100_0738193 | |||
| 4656 | Ga0496100_0739231 | |||
| 4657 | Ga0496100_0784641 | |||
| 4658 | Ga0496100_1222405 | |||
| 4659 | Ga0496101_0003342 | |||
| 4660 | Ga0496101_0006157 | |||
| 4661 | Ga0496101_0072704 | |||
| 4662 | Ga0496101_0171874 | |||
| 4663 | Ga0496101_0172161 | |||
| 4664 | Ga0496101_0269458 | |||
| 4665 | Ga0496101_0699349 | |||
| 4666 | Ga0496102_0002803 | |||
| 4667 | Ga0496102_0150254 | |||
| 4668 | Ga0496102_0246461 | |||
| 4669 | Ga0496102_0263736 | |||
| 4670 | Ga0496102_0456756 | |||
| 4671 | Ga0496102_0792194 | |||
| 4672 | Ga0496103_0001927 | |||
| 4673 | Ga0496103_0025181 | |||
| 4674 | Ga0496103_0031156 | |||
| 4675 | Ga0496103_0032759 | |||
| 4676 | Ga0496103_0166053 | |||
| 4677 | Ga0496103_0209714 | |||
| 4678 | Ga0496104_0000521 | |||
| 4679 | Ga0496104_0034766 | |||
| 4680 | Ga0496104_0045446 | |||
| 4681 | Ga0496104_0075540 | |||
| 4682 | Ga0496104_0081421 | |||
| 4683 | Ga0496104_0105804 | |||
| 4684 | Ga0496104_0123318 | |||
| 4685 | Ga0496104_0384608 | |||
| 4686 | Ga0496104_0620043 | |||
| 4687 | Ga0496104_1507275 | |||
| 4688 | Ga0496105_0000224 | |||
| 4689 | Ga0496105_0004218 | |||
| 4690 | Ga0496105_0017714 | |||
| 4691 | Ga0496105_0023279 | |||
| 4692 | Ga0496105_0045068 | |||
| 4693 | Ga0496105_0073984 | |||
| 4694 | Ga0496105_0245083 | |||
| 4695 | Ga0496105_0535018 | |||
| 4696 | Ga0496105_0890584 | |||
| 4697 | Ga0496106_0000171 | |||
| 4698 | Ga0496106_0001491 | |||
| 4699 | Ga0496106_0016755 | |||
| 4700 | Ga0496106_0247417 | |||
| 4701 | Ga0496106_0387377 | |||
| 4702 | Ga0496106_0400803 | |||
| 4703 | Ga0496106_0865491 | |||
| 4704 | Ga0496106_0912581 | |||
| 4705 | Ga0496106_1001594 | |||
| 4706 | Ga0496107_0002333 | |||
| 4707 | Ga0496107_0006109 | |||
| 4708 | Ga0496108_0000270 | |||
| 4709 | Ga0496108_0010399 | |||
| 4710 | Ga0496108_0011935 | |||
| 4711 | Ga0496108_0040196 | |||
| 4712 | Ga0496108_0053300 | |||
| 4713 | Ga0496108_0317759 | |||
| 4714 | Ga0496109_0003581 | |||
| 4715 | Ga0496109_0005918 | |||
| 4716 | Ga0496109_0018512 | |||
| 4717 | Ga0496109_0019052 | |||
| 4718 | Ga0496109_0124323 | |||
| 4719 | Ga0496109_0131795 | |||
| 4720 | Ga0496109_0240083 | |||
| 4721 | Ga0496110_0000727 | |||
| 4722 | Ga0496110_0035372 | |||
| 4723 | Ga0496110_0060694 | |||
| 4724 | Ga0496110_0135456 | |||
| 4725 | Ga0496110_0158134 | |||
| 4726 | Ga0496110_0216349 | |||
| 4727 | Ga0496110_0249281 | |||
| 4728 | Ga0496110_0271362 | |||
| 4729 | Ga0496110_0582163 | |||
| 4730 | Ga0496110_1481549 | |||
| 4731 | Ga0496111_0002340 | |||
| 4732 | Ga0496111_0008968 | |||
| 4733 | Ga0496111_0027330 | |||
| 4734 | Ga0496111_0392728 | |||
| 4735 | Ga0496111_0483177 | |||
| 4736 | Ga0496111_0785082 | |||
| 4737 | Ga0496111_1174580 | |||
| 4738 | Ga0496111_1248166 | |||
| 4739 | Ga0496112_0006537 | |||
| 4740 | Ga0496112_0010740 | |||
| 4741 | Ga0496112_0015294 | |||
| 4742 | Ga0496112_0079683 | |||
| 4743 | Ga0496112_0138104 | |||
| 4744 | Ga0496112_0172444 | |||
| 4745 | Ga0496112_0293746 | |||
| 4746 | Ga0496112_0458278 | |||
| 4747 | Ga0496113_0002327 | |||
| 4748 | Ga0496113_0002792 | |||
| 4749 | Ga0496113_0011945 | |||
| 4750 | Ga0496113_0018160 | |||
| 4751 | Ga0496113_0051757 | |||
| 4752 | Ga0496113_0182228 | |||
| 4753 | Ga0496113_0185350 | |||
| 4754 | Ga0496114_0012238 | |||
| 4755 | Ga0496114_0049077 | |||
| 4756 | Ga0496114_1063801 | |||
| 4757 | Ga0496115_0000325 | |||
| 4758 | Ga0496115_0022580 | |||
| 4759 | Ga0496115_0126838 | |||
| 4760 | Ga0496115_0272478 | |||
| 4761 | Ga0496116_0000045 | |||
| 4762 | Ga0496116_0048305 | |||
| 4763 | Ga0496116_0085482 | |||
| 4764 | Ga0496116_0208824 | |||
| 4765 | Ga0496117_0015681 | |||
| 4766 | Ga0496117_0043619 | |||
| 4767 | Ga0496117_0182822 | |||
| 4768 | Ga0496117_0455486 | |||
| 4769 | Ga0496118_0001632 | |||
| 4770 | Ga0496118_0079231 | |||
| 4771 | Ga0496118_0167629 | |||
| 4772 | Ga0496118_0200944 | |||
| 4773 | Ga0496118_0210434 | |||
| 4774 | Ga0496118_0441539 | |||
| 4775 | Ga0496118_0453005 | |||
| 4776 | Ga0496118_0514098 | |||
| 4777 | Ga0496119_0009439 | |||
| 4778 | Ga0496119_0012109 | |||
| 4779 | Ga0496119_0307964 | |||
| 4780 | Ga0496119_0313285 | |||
| 4781 | Ga0496120_0096375 | |||
| 4782 | Ga0496120_0240170 | |||
| 4783 | Ga0496120_0391774 | |||
| 4784 | Ga0496121_0000017 | |||
| 4785 | Ga0496121_0000128 | |||
| 4786 | Ga0496121_0001842 | |||
| 4787 | Ga0496121_0003936 | |||
| 4788 | Ga0496121_0014449 | |||
| 4789 | Ga0496121_0016508 | |||
| 4790 | Ga0496121_0017871 | |||
| 4791 | Ga0496121_0027742 | |||
| 4792 | Ga0496121_0185075 | |||
| 4793 | Ga0496121_0190824 | |||
| 4794 | Ga0496121_0268463 | |||
| 4795 | Ga0496121_0325408 | |||
| 4796 | Ga0496121_0372495 | |||
| 4797 | Ga0496121_0394494 | |||
| 4798 | Ga0496122_0003264 | |||
| 4799 | Ga0496122_0012455 | |||
| 4800 | Ga0496122_0084726 | |||
| 4801 | Ga0496122_0157005 | |||
| 4802 | Ga0496122_0234297 | |||
| 4803 | Ga0496122_0311926 | |||
| 4804 | Ga0496122_0507230 | |||
| 4805 | Ga0496123_0002307 | |||
| 4806 | Ga0496123_0002815 | |||
| 4807 | Ga0496123_0059229 | |||
| 4808 | Ga0496123_0065788 | |||
| 4809 | Ga0496123_0067431 | |||
| 4810 | Ga0496123_0113838 | |||
| 4811 | Ga0496123_0259082 | |||
| 4812 | Ga0496124_0010966 | |||
| 4813 | Ga0496124_0019874 | |||
| 4814 | Ga0496124_0020151 | |||
| 4815 | Ga0496124_0021231 | |||
| 4816 | Ga0496124_0037039 | |||
| 4817 | Ga0496124_0089650 | |||
| 4818 | Ga0496124_0145848 | |||
| 4819 | Ga0496124_0367649 | |||
| 4820 | Ga0496125_0009436 | |||
| 4821 | Ga0496125_0012308 | |||
| 4822 | Ga0496125_0013394 | |||
| 4823 | Ga0496125_0021356 | |||
| 4824 | Ga0496125_0042770 | |||
| 4825 | Ga0496125_0069740 | |||
| 4826 | Ga0496125_0333205 | |||
| 4827 | Ga0496125_0544777 | |||
| 4828 | Ga0496125_0564098 | |||
| 4829 | Ga0496125_0753732 | |||
| 4830 | Ga0496126_0000365 | |||
| 4831 | Ga0496126_0000568 | |||
| 4832 | Ga0496126_0031442 | |||
| 4833 | Ga0496126_0042950 | |||
| 4834 | Ga0496126_0047416 | |||
| 4835 | Ga0496126_0065970 | |||
| 4836 | Ga0496126_0154602 | |||
| 4837 | Ga0496126_1351587 | |||
| 4838 | Ga0495678_010130 | |||
| 4839 | Ga0495678_128165 | |||
| 4840 | Ga0495682_0163019 | |||
| 4841 | Ga0501311_034984 | |||
| 4842 | Ga0501311_073298 | |||
| 4843 | Ga0501313_066165 | |||
| 4844 | Ga0501314_013551 | |||
| 4845 | Ga0501314_021872 | |||
| 4846 | Ga0501317_048036 | |||
| 4847 | Ga0501322_009290 | |||
| 4848 | Ga0501334_11529 | |||
| 4849 | Ga0501335_024020 | |||
| 4850 | Ga0501031_0173637 | |||
| 4851 | Ga0501031_0338726 | |||
| 4852 | Ga0501032_0017922 | |||
| 4853 | Ga0501032_0040485 | |||
| 4854 | Ga0501032_0144429 | |||
| 4855 | Ga0501032_0200349 | |||
| 4856 | Ga0501032_0532459 | |||
| 4857 | Ga0501032_0666305 | |||
| 4858 | Ga0501032_0992583 | |||
| 4859 | Ga0501033_0007968 | |||
| 4860 | Ga0501033_0016714 | |||
| 4861 | Ga0501033_0076879 | |||
| 4862 | Ga0501033_0178915 | |||
| 4863 | Ga0501033_0413660 | |||
| 4864 | Ga0501033_0459338 | |||
| 4865 | Ga0501034_0000089 | |||
| 4866 | Ga0501034_0002186 | |||
| 4867 | Ga0501034_0007572 | |||
| 4868 | Ga0501034_0009998 | |||
| 4869 | Ga0501034_0056473 | |||
| 4870 | Ga0501034_0118260 | |||
| 4871 | Ga0501034_0256658 | |||
| 4872 | Ga0501034_0284235 | |||
| 4873 | Ga0501034_0310532 | |||
| 4874 | Ga0501034_0388576 | |||
| 4875 | Ga0501034_0887119 | |||
| 4876 | Ga0501036_0002470 | |||
| 4877 | Ga0501036_0003258 | |||
| 4878 | Ga0501036_0028055 | |||
| 4879 | Ga0501036_0100626 | |||
| 4880 | Ga0501036_0100890 | |||
| 4881 | Ga0501036_0161118 | |||
| 4882 | Ga0501037_0009229 | |||
| 4883 | Ga0501037_0148798 | |||
| 4884 | Ga0501037_0166470 | |||
| 4885 | Ga0501037_0217469 | |||
| 4886 | Ga0501037_0259870 | |||
| 4887 | Ga0501037_0515667 | |||
| 4888 | Ga0501038_0087146 | |||
| 4889 | Ga0501038_0114232 | |||
| 4890 | Ga0501038_0436995 | |||
| 4891 | Ga0501038_0680091 | |||
| 4892 | Ga0501038_1364301 | |||
| 4893 | Ga0501039_0065472 | |||
| 4894 | Ga0501039_0116878 | |||
| 4895 | Ga0501039_0442683 | |||
| 4896 | Ga0501039_0601038 | |||
| 4897 | Ga0501040_0010428 | |||
| 4898 | Ga0501040_0104758 | |||
| 4899 | Ga0501040_0307954 | |||
| 4900 | Ga0501040_1086431 | |||
| 4901 | Ga0501041_0169978 | |||
| 4902 | Ga0501042_0104688 | |||
| 4903 | Ga0501042_0633232 | |||
| 4904 | Ga0501042_0639191 | |||
| 4905 | Ga0501042_0710384 | |||
| 4906 | Ga0501043_0206640 | |||
| 4907 | Ga0501043_0245024 | |||
| 4908 | Ga0501043_0323972 | |||
| 4909 | Ga0501043_0397103 | |||
| 4910 | Ga0501043_0599375 | |||
| 4911 | Ga0501043_0770683 | |||
| 4912 | Ga0501043_1140725 | |||
| 4913 | Ga0501046_0000058 | |||
| 4914 | Ga0501046_0025198 | |||
| 4915 | Ga0501046_0064915 | |||
| 4916 | Ga0501046_0068840 | |||
| 4917 | Ga0501046_0112332 | |||
| 4918 | Ga0501046_0313040 | |||
| 4919 | Ga0501046_0457290 | |||
| 4920 | Ga0501046_0583279 | |||
| 4921 | Ga0501046_0759272 | |||
| 4922 | Ga0501046_1219056 | |||
| 4923 | Ga0501047_0000097 | |||
| 4924 | Ga0501047_0026712 | |||
| 4925 | Ga0501047_0033769 | |||
| 4926 | Ga0501047_0066831 | |||
| 4927 | Ga0501047_0258739 | |||
| 4928 | Ga0501047_0431512 | |||
| 4929 | Ga0501047_0465574 | |||
| 4930 | Ga0501047_0495578 | |||
| 4931 | Ga0501047_0615752 | |||
| 4932 | Ga0501047_0657915 | |||
| 4933 | Ga0501047_0822508 | |||
| 4934 | Ga0501047_0863175 | |||
| 4935 | Ga0501048_0001777 | |||
| 4936 | Ga0501048_0094504 | |||
| 4937 | Ga0501048_0121964 | |||
| 4938 | Ga0501048_0172033 | |||
| 4939 | Ga0501048_0510115 | |||
| 4940 | Ga0501048_0597836 | |||
| 4941 | Ga0501048_0847012 | |||
| 4942 | Ga0501048_0998715 | |||
| 4943 | Ga0501067_0010136 | |||
| 4944 | Ga0501067_0067680 | |||
| 4945 | Ga0501067_0168573 | |||
| 4946 | Ga0501067_0268333 | |||
| 4947 | Ga0501067_0668564 | |||
| 4948 | Ga0501068_0019141 | |||
| 4949 | Ga0501068_0177162 | |||
| 4950 | Ga0501068_0374610 | |||
| 4951 | Ga0501068_0565874 | |||
| 4952 | Ga0501069_0003384 | |||
| 4953 | Ga0501069_0011661 | |||
| 4954 | Ga0501069_0021339 | |||
| 4955 | Ga0501069_0060396 | |||
| 4956 | Ga0501069_0063967 | |||
| 4957 | Ga0501069_0295308 | |||
| 4958 | Ga0501069_0777613 | |||
| 4959 | Ga0501070_0008856 | |||
| 4960 | Ga0501070_0030273 | |||
| 4961 | Ga0501070_0094098 | |||
| 4962 | Ga0501070_0178014 | |||
| 4963 | Ga0501070_0333171 | |||
| 4964 | Ga0501070_0488029 | |||
| 4965 | Ga0501070_0781897 | |||
| 4966 | Ga0501070_1212261 | |||
| 4967 | Ga0501071_0013639 | |||
| 4968 | Ga0501071_0244426 | |||
| 4969 | Ga0501071_0446407 | |||
| 4970 | Ga0501072_0041181 | |||
| 4971 | Ga0501072_0042687 | |||
| 4972 | Ga0501072_0261799 | |||
| 4973 | Ga0501072_0330079 | |||
| 4974 | Ga0501072_0344974 | |||
| 4975 | Ga0501072_0394663 | |||
| 4976 | Ga0501072_0438394 | |||
| 4977 | Ga0501072_1407628 | |||
| 4978 | Ga0501072_1562280 | |||
| 4979 | Ga0501073_0104971 | |||
| 4980 | Ga0501073_0162062 | |||
| 4981 | Ga0501073_0260852 | |||
| 4982 | Ga0501073_0344055 | |||
| 4983 | Ga0501073_0395722 | |||
| 4984 | Ga0501073_0601853 | |||
| 4985 | Ga0501073_1066095 | |||
| 4986 | Ga0501074_0005920 | |||
| 4987 | Ga0501074_0088240 | |||
| 4988 | Ga0501074_0090189 | |||
| 4989 | Ga0501074_0095446 | |||
| 4990 | Ga0501074_0233823 | |||
| 4991 | Ga0501074_0328918 | |||
| 4992 | Ga0501074_0407258 | |||
| 4993 | Ga0501074_0637862 | |||
| 4994 | Ga0501075_0050918 | |||
| 4995 | Ga0501075_0332423 | |||
| 4996 | Ga0501075_0715526 | |||
| 4997 | Ga0501075_1008779 | |||
| 4998 | Ga0501076_0013557 | |||
| 4999 | Ga0501076_0024210 | |||
| 5000 | Ga0501076_0079146 | |||
| 5001 | Ga0501076_0614010 | |||
| 5002 | Ga0501077_0002811 | |||
| 5003 | Ga0501077_0041128 | |||
| 5004 | Ga0501077_0097383 | |||
| 5005 | Ga0501077_0154000 | |||
| 5006 | Ga0501077_0370705 | |||
| 5007 | Ga0501077_0864776 | |||
| 5008 | Ga0501224_002711 | |||
| 5009 | Ga0501227_190098 | |||
| 5010 | Ga0501248_007378 | |||
| 5011 | Ga0501249_012622 | |||
| 5012 | Ga0501253_058522 | |||
| 5013 | Ga0501257_149816 | |||
| 5014 | Ga0501079_0113836 | |||
| 5015 | Ga0501079_0204732 | |||
| 5016 | Ga0501079_0296612 | |||
| 5017 | Ga0501079_0346874 | |||
| 5018 | Ga0501079_0836975 | |||
| 5019 | Ga0501080_0000045 | |||
| 5020 | Ga0501080_0025689 | |||
| 5021 | Ga0501080_0026650 | |||
| 5022 | Ga0501080_0115490 | |||
| 5023 | Ga0501080_1031409 | |||
| 5024 | Ga0501080_1353415 | |||
| 5025 | Ga0501081_0081250 | |||
| 5026 | Ga0501081_0088169 | |||
| 5027 | Ga0501081_0187943 | |||
| 5028 | Ga0501081_0366046 | |||
| 5029 | Ga0501083_0008419 | |||
| 5030 | Ga0501083_0015459 | |||
| 5031 | Ga0501083_0126870 | |||
| 5032 | Ga0501083_0221159 | |||
| 5033 | Ga0501083_0401085 | |||
| 5034 | Ga0501083_0591541 | |||
| 5035 | Ga0501083_0780607 | |||
| 5036 | Ga0501241_016730 | |||
| 5037 | Ga0501282_027800 | |||
| 5038 | Ga0501035_0001208 | |||
| 5039 | Ga0501035_0081680 | |||
| 5040 | Ga0501035_0331216 | |||
| 5041 | Ga0501035_0673981 | |||
| 5042 | Ga0501044_0002552 | |||
| 5043 | Ga0501044_0010970 | |||
| 5044 | Ga0501044_0012045 | |||
| 5045 | Ga0501044_0115709 | |||
| 5046 | Ga0501044_0137965 | |||
| 5047 | Ga0501044_0151534 | |||
| 5048 | Ga0501044_0425008 | |||
| 5049 | Ga0501044_0628645 | |||
| 5050 | Ga0501044_0631558 | |||
| 5051 | Ga0501044_0764053 | |||
| 5052 | Ga0501044_0938970 | |||
| 5053 | Ga0501044_0989905 | |||
| 5054 | Ga0501044_1502438 | |||
| 5055 | Ga0501044_1554325 | |||
| 5056 | Ga0501045_0016406 | |||
| 5057 | Ga0501045_0964239 | |||
| 5058 | nmdc:mga03683_189888_c1 | |||
| 5059 | nmdc:mga03683_2_c1 | |||
| 5060 | nmdc:mga03683_308774_c1 | |||
| 5061 | nmdc:mga03683_51312_c1 | |||
| 5062 | nmdc:mga03683_543904_c1 | |||
| 5063 | nmdc:mga03683_61_c1 | |||
| 5064 | nmdc:mga03683_88534_c1 | |||
| 5065 | nmdc:mga03n38_131721_c1 | |||
| 5066 | nmdc:mga03n38_1829_c1 | |||
| 5067 | nmdc:mga03n38_227884_c1 | |||
| 5068 | nmdc:mga03n38_287541_c1 | |||
| 5069 | nmdc:mga03n38_372525_c1 | |||
| 5070 | nmdc:mga03n38_526_c1 | |||
| 5071 | nmdc:mga00v17_1044520_c1 | |||
| 5072 | nmdc:mga00v17_1089555_c1 | |||
| 5073 | nmdc:mga00v17_1572_c1 | |||
| 5074 | nmdc:mga00v17_179731_c1 | |||
| 5075 | nmdc:mga00v17_26014_c1 | |||
| 5076 | nmdc:mga00v17_40398_c1 | |||
| 5077 | nmdc:mga00v17_992721_c1 | |||
| 5078 | nmdc:mga0yw44_19458_c1 | |||
| 5079 | nmdc:mga0yw44_202483_c1 | |||
| 5080 | nmdc:mga0yw44_620001_c1 | |||
| 5081 | nmdc:mga0k408_12410_c1 | |||
| 5082 | nmdc:mga0k408_174625_c1 | |||
| 5083 | nmdc:mga0k408_240791_c1 | |||
| 5084 | nmdc:mga0k408_258052_c1 | |||
| 5085 | nmdc:mga0k408_2_c1 | |||
| 5086 | nmdc:mga0k408_3799_c1 | |||
| 5087 | nmdc:mga0k408_597285_c1 | |||
| 5088 | nmdc:mga0k408_635812_c1 | |||
| 5089 | nmdc:mga06z11_332_c1 | |||
| 5090 | nmdc:mga06z11_3726_c1 | |||
| 5091 | nmdc:mga06z11_38986_c1 | |||
| 5092 | nmdc:mga06z11_39210_c1 | |||
| 5093 | nmdc:mga06z11_40485_c1 | |||
| 5094 | nmdc:mga06z11_47_c1 | |||
| 5095 | nmdc:mga06z11_49020_c1 | |||
| 5096 | nmdc:mga06z11_88737_c1 | |||
| 5097 | nmdc:mga04h51_14887_c1 | |||
| 5098 | nmdc:mga04h51_182_c1 | |||
| 5099 | nmdc:mga04h51_187_c1 | |||
| 5100 | nmdc:mga04h51_4410_c1 | |||
| 5101 | nmdc:mga07m45_108019_c1 | |||
| 5102 | nmdc:mga07m45_1364_c1 | |||
| 5103 | nmdc:mga07m45_151799_c1 | |||
| 5104 | nmdc:mga07m45_152392_c1 | |||
| 5105 | nmdc:mga07m45_191370_c1 | |||
| 5106 | nmdc:mga07m45_20437_c1 | |||
| 5107 | nmdc:mga07m45_23094_c1 | |||
| 5108 | nmdc:mga07m45_26_c1 | |||
| 5109 | nmdc:mga07m45_283946_c1 | |||
| 5110 | nmdc:mga07m45_55881_c1 | |||
| 5111 | nmdc:mga05p37_1758866_c1 | |||
| 5112 | nmdc:mga05p37_742319_c1 | |||
| 5113 | nmdc:mga05p37_949199_c1 | |||
| 5114 | nmdc:mga09592_230970_c1 | |||
| 5115 | nmdc:mga09592_29697_c1 | |||
| 5116 | nmdc:mga0qj67_186566_c1 | |||
| 5117 | nmdc:mga0qj67_27585_c1 | |||
| 5118 | nmdc:mga0qj67_813960_c1 | |||
| 5119 | nmdc:mga0qj67_990138_c1 | |||
| 5120 | nmdc:mga06r32_5167_c1 | |||
| 5121 | nmdc:mga08y16_55896_c1 | |||
| 5122 | nmdc:mga0n895_404601_c1 | |||
| 5123 | nmdc:mga0n895_457599_c1 | |||
| 5124 | nmdc:mga0rr50_1285414_c1 | |||
| 5125 | nmdc:mga0rr50_201409_c1 | |||
| 5126 | nmdc:mga0rr50_813484_c1 | |||
| 5127 | nmdc:mga08x19_16664_c1 | |||
| 5128 | nmdc:mga0a205_298312_c1 | |||
| 5129 | nmdc:mga0a205_44519_c1 | |||
| 5130 | nmdc:mga0a205_871553_c1 | |||
| 5131 | nmdc:mga0sz30_1158_c1 | |||
| 5132 | nmdc:mga0sz30_156233_c1 | |||
| 5133 | nmdc:mga0sz30_196701_c2 | |||
| 5134 | nmdc:mga0sz30_219875_c1 | |||
| 5135 | nmdc:mga0sz30_3200_c1 | |||
| 5136 | nmdc:mga0sz30_44210_c1 | |||
| 5137 | Ga0495601_0050386 | |||
| 5138 | Ga0495612_0271102 | |||
| 5139 | Ga0495619_0143229 | |||
| 5140 | Ga0500578_0179768 | |||
| 5141 | Ga0500643_000005 | |||
| 5142 | Ga0500643_011852 | |||
| 5143 | Ga0500643_045660 | |||
| 5144 | Ga0500647_0092474 | |||
| 5145 | Ga0500647_0192714 | |||
| 5146 | Ga0500583_0316102 | |||
| 5147 | Ga0500651_0014119 | |||
| 5148 | Ga0500651_0162496 | |||
| 5149 | Ga0500651_0327603 | |||
| 5150 | Ga0500566_0000259 | |||
| 5151 | Ga0500641_0000659 | |||
| 5152 | Ga0500641_0006777 | |||
| 5153 | Ga0500641_0009270 | |||
| 5154 | Ga0500641_0294615 | |||
| 5155 | Ga0500555_070730 | |||
| 5156 | Ga0500562_000398 | |||
| 5157 | Ga0500562_015570 | |||
| 5158 | Ga0500562_035044 | |||
| 5159 | Ga0500562_077438 | |||
| 5160 | Ga0500569_005008 | |||
| 5161 | Ga0500572_084547 | |||
| 5162 | Ga0500572_103445 | |||
| 5163 | Ga0500592_008128 | |||
| 5164 | Ga0500592_054953 | |||
| 5165 | Ga0500594_0027842 | |||
| 5166 | Ga0500594_0029841 | |||
| 5167 | Ga0500594_0053854 | |||
| 5168 | Ga0500595_002712 | |||
| 5169 | Ga0500595_007699 | |||
| 5170 | Ga0500595_008471 | |||
| 5171 | Ga0500595_013870 | |||
| 5172 | Ga0500595_120560 | |||
| 5173 | Ga0500597_181793 | |||
| 5174 | Ga0500607_000060 | |||
| 5175 | Ga0500607_000152 | |||
| 5176 | Ga0500608_000074 | |||
| 5177 | Ga0500608_002556 | |||
| 5178 | Ga0500614_010872 | |||
| 5179 | Ga0500614_143692 | |||
| 5180 | Ga0500618_002141 | |||
| 5181 | Ga0500618_010860 | |||
| 5182 | Ga0500626_064675 | |||
| 5183 | Ga0500652_000198 | |||
| 5184 | Ga0500652_156648 | |||
| 5185 | Ga0500658_0001309 | |||
| 5186 | Ga0500658_0049193 | |||
| 5187 | Ga0500658_0088968 | |||
| 5188 | Ga0500559_0003528 | |||
| 5189 | Ga0500559_0009475 | |||
| 5190 | Ga0500564_214222 | |||
| 5191 | Ga0500568_0006304 | |||
| 5192 | Ga0500568_0060966 | |||
| 5193 | Ga0500568_0342059 | |||
| 5194 | Ga0500573_0000010 | |||
| 5195 | Ga0500573_0058350 | |||
| 5196 | Ga0500577_0173127 | |||
| 5197 | Ga0500588_0041045 | |||
| 5198 | Ga0500588_0270775 | |||
| 5199 | Ga0500590_001355 | |||
| 5200 | Ga0500590_067276 | |||
| 5201 | Ga0500590_090953 | |||
| 5202 | Ga0500604_0018944 | |||
| 5203 | Ga0500604_0100552 | |||
| 5204 | Ga0500604_0125217 | |||
| 5205 | Ga0500604_0208186 | |||
| 5206 | Ga0500616_0001865 | |||
| 5207 | Ga0500616_0005539 | |||
| 5208 | Ga0500616_0134187 | |||
| 5209 | Ga0500616_0209444 | |||
| 5210 | Ga0500619_027359 | |||
| 5211 | Ga0500620_057430 | |||
| 5212 | Ga0500622_0012682 | |||
| 5213 | Ga0500622_0334066 | |||
| 5214 | Ga0500624_000005 | |||
| 5215 | Ga0500627_0000009 | |||
| 5216 | Ga0500627_0056561 | |||
| 5217 | Ga0500638_143809 | |||
| 5218 | Ga0500638_152825 | |||
| 5219 | Ga0500636_0308214 | |||
| 5220 | Ga0500567_003234 | |||
| 5221 | Ga0500625_000004 | |||
| 5222 | Ga0500645_003136 | |||
| 5223 | Ga0500645_075751 | |||
| 5224 | Ga0500656_075007 | |||
| 5225 | Ga0500552_044069 | |||
| 5226 | Ga0500552_096926 | |||
| 5227 | Ga0500596_001392 | |||
| 5228 | Ga0501084_0005823 | |||
| 5229 | Ga0501084_0310208 | |||
| 5230 | Ga0501084_0679721 | |||
| 5231 | Ga0587084_010598 | |||
| 5232 | Ga0587084_033847 | |||
| 5233 | Ga0587093_029285 | |||
| 5234 | Ga0587070_044808 | |||
| 5235 | Ga0587070_069660 | |||
| 5236 | Ga0587070_086986 | |||
| 5237 | Ga0587070_090623 | |||
| 5238 | Ga0587073_0144873 | |||
| 5239 | Ga0587077_094062 | |||
| 5240 | Ga0587077_118346 | |||
| 5241 | Ga0587077_137970 | |||
| 5242 | Ga0587082_063565 | |||
| 5243 | Ga0587082_070831 | |||
| 5244 | Ga0587082_083955 | |||
| 5245 | Ga0587083_0128226 | |||
| 5246 | Ga0587085_112733 | |||
| 5247 | Ga0587086_023832 | |||
| 5248 | Ga0587086_037199 | |||
| 5249 | Ga0587086_052061 | |||
| 5250 | Ga0587088_005977 | |||
| 5251 | Ga0587088_184216 | |||
| 5252 | Ga0587089_031636 | |||
| 5253 | Ga0587090_044225 | |||
| 5254 | Ga0587090_054494 | |||
| 5255 | Ga0587090_059379 | |||
| 5256 | Ga0587090_075884 | |||
| 5257 | Ga0587091_008973 | |||
| 5258 | Ga0587091_031859 | |||
| 5259 | Ga0587091_054643 | |||
| 5260 | Ga0587091_058928 | |||
| 5261 | Ga0587091_099441 | |||
| 5262 | Ga0587091_104615 | |||
| 5263 | Ga0587091_109358 | |||
| 5264 | Ga0587092_079574 | |||
| 5265 | Ga0587092_120063 | |||
| 5266 | Ga0587094_030473 | |||
| 5267 | Ga0587098_014190 | |||
| 5268 | Ga0587106_003817 | |||
| 5269 | Ga0587106_064527 | |||
| 5270 | Ga0587125_013380 | |||
| 5271 | Ga0587129_007039 | |||
| 5272 | Ga0587101_063203 | |||
| 5273 | Ga0587109_053459 | |||
| 5274 | Ga0587109_111546 | |||
| 5275 | Ga0587115_027471 | |||
| 5276 | Ga0587115_028126 | |||
| 5277 | Ga0587115_049365 | |||
| 5278 | Ga0587115_053735 | |||
| 5279 | Ga0587128_021056 | |||
| 5280 | Ga0587128_051545 | |||
| 5281 | Ga0587128_060599 | |||
| 5282 | Ga0587128_061801 | |||
| 5283 | Ga0587128_156556 | |||
| 5284 | Ga0587062_022984 | |||
| 5285 | Ga0587062_029906 | |||
| 5286 | Ga0587062_051120 | |||
| 5287 | Ga0587062_057944 | |||
| 5288 | Ga0587068_045621 | |||
| 5289 | Ga0587068_055079 | |||
| 5290 | Ga0587068_077127 | |||
| 5291 | Ga0587072_020475 | |||
| 5292 | Ga0587072_110335 | |||
| 5293 | Ga0587072_174039 | |||
| 5294 | Ga0587075_050672 | |||
| 5295 | Ga0587076_042906 | |||
| 5296 | Ga0587076_070182 | |||
| 5297 | Ga0587076_074743 | |||
| 5298 | Ga0587076_091031 | |||
| 5299 | Ga0587078_006441 | |||
| 5300 | Ga0587078_021911 | |||
| 5301 | Ga0587078_038780 | |||
| 5302 | Ga0587100_005937 | |||
| 5303 | Ga0587100_017547 | |||
| 5304 | Ga0587100_018158 | |||
| 5305 | Ga0587104_011260 | |||
| 5306 | Ga0587107_069451 | |||
| 5307 | Ga0587107_094970 | |||
| 5308 | Ga0587107_129916 | |||
| 5309 | Ga0587108_008472 | |||
| 5310 | Ga0587110_028280 | |||
| 5311 | Ga0587110_062436 | |||
| 5312 | Ga0587114_033008 | |||
| 5313 | Ga0587114_080971 | |||
| 5314 | Ga0587119_039732 | |||
| 5315 | Ga0587124_009500 | |||
| 5316 | Ga0587124_017999 | |||
| 5317 | Ga0587124_029616 | |||
| 5318 | Ga0587071_087886 | |||
| 5319 | Ga0587071_180495 | |||
| 5320 | Ga0587111_0018494 | |||
| 5321 | Ga0587111_0085023 | |||
| 5322 | Ga0587111_0105828 | |||
| 5323 | Ga0587111_0113064 | |||
| 5324 | Ga0587111_0130291 | |||
| 5325 | Ga0587111_0234668 | |||
| 5326 | Ga0501082_0006851 | |||
| 5327 | Ga0501082_0011708 | |||
| 5328 | Ga0501082_0027632 | |||
| 5329 | Ga0501082_0062346 | |||
| 5330 | Ga0501082_0242864 | |||
| 5331 | Ga0501082_0400503 | |||
| 5332 | Ga0501082_0557627 | |||
| 5333 | Ga0501082_0680804 | |||
| 5334 | Ga0501082_1357103 | |||
| 5335 | Ga0501082_1389094 | |||
| 5336 | Ga0466962_0002938 | |||
| 5337 | Ga0466962_0359011 | |||
| 5338 | Ga0530510_0013825 | |||
| 5339 | Ga0530510_0233374 | |||
| 5340 | Ga0530510_0515857 | |||
| 5341 | 2511130605 | |||
| 5342 | 2512644639 | |||
| 5343 | 2523466826 | |||
| 5344 | 2535485560 | |||
| 5345 | 2643729395 | |||
| 5346 | 2643819107 | |||
| 5347 | 2643835024 | |||
| 5348 | 2643950964 | |||
| 5349 | 2644045871 | |||
| 5350 | 2644055951 | |||
| 5351 | 2644393448 | |||
| 5352 | 2671114049 | |||
| 5353 | 2738710655 | |||
| 5354 | 2738849080 | |||
| 5355 | 2738864809 | |||
| 5356 | 2739297327 | |||
| 5357 | 2739348732 | |||
| 5358 | 2739359005 | |||
| 5359 | 2739650577 | |||
| 5360 | 2740029050 | |||
| 5361 | 2753360572 | |||
| 5362 | 2758643012 | |||
| 5363 | 2778125516 | |||
| 5364 | 2809063343 | |||
| 5365 | 2809079221 | |||
| 5366 | 2809083405 | |||
| 5367 | 2819551281 | |||
| 5368 | 2830075727 | |||
| 5369 | 2838029685 | |||
| 5370 | 2842475885 | |||
| 5371 | 2842503213 | |||
| 5372 | 2842696171 | |||
| 5373 | 2848298627 | |||
| 5374 | 2852653613 | |||
| 5375 | 2852683110 | |||
| 5376 | 2854913761 | |||
| 5377 | 2880520613 | |||
| 5378 | 2882809453 | |||
| 5379 | 2895881213 | |||
| 5380 | 2896186028 | |||
| 5381 | 2896255969 | |||
| 5382 | 2917556263 | |||
| 5383 | 2919143208 | |||
| 5384 | 2919408408 | |||
| 5385 | 2919712071 | |||
| 5386 | 2928029438 | |||
| 5387 | 2928100756 | |||
| 5388 | 2928528094 | |||
| 5389 | 2928960819 | |||
| 5390 | 2929201313 | |||
| 5391 | 2946789913 | |||
| 5392 | 2984556636 | |||
| 5393 | 2984565191 | |||
| 5394 | 2990265818 | |||
| 5395 | 2993356267 | |||
| 5396 | 2993696391 | |||
| 5397 | 8045868605 | |||
| 5398 | 8054305463 | |||
| 5399 | 8055910080 | |||
| 5400 | 8057105458 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7pkt-assembly1.cif.gz_o | large subunit of the chlamydomonas reinhardtii mitoribosome | 0.9391 | 14 | 114 |
| 8apo-assembly1.cif.gz_Ao | structure of the mitochondrial ribosome from polytomella magna with trnas bound to the a and p sites | 0.9328 | 14 | 114 |
| 6z1p-assembly1.cif.gz_Au | structure of the mitochondrial ribosome from tetrahymena thermophila | 0.9205 | 15 | 115 |
| 6xyw-assembly1.cif.gz_Aq | structure of the plant mitochondrial ribosome | 0.9079 | 13 | 117 |
| 6xyw-assembly1.cif.gz_Aq | structure of the plant mitochondrial ribosome | 0.8921 | 13 | 117 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2ghjD02 | Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain | 0.9471 | 53 | 120 | 1.10.1900.20 |
| 2ghjD02 | Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain | 0.9206 | 53 | 120 | 1.10.1900.20 |
| 2ghjB02 | Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain | 0.9064 | 58 | 116 | 1.10.1900.20 |
| 3bjaA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8663 | 46 | 88 | 1.10.10.10 |
| 1gyzA00 | Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain | 0.86 | 61 | 120 | 1.10.1900.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2N8FNS0-F1-model_v4 | deleted | 0.9937 | 55 | 120 |
|
| AF-A0A432PU90-F1-model_v4 | Large ribosomal subunit protein bL20 (50S ribosomal protein L20) | 0.9918 | 56 | 116 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-X0Z215-F1-model_v4 | 50S ribosomal protein L20 | 0.9769 | 42 | 115 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A1Q7H6R6-F1-model_v4 | Large ribosomal subunit protein bL20 (50S ribosomal protein L20) | 0.9705 | 47 | 117 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A7Z9XIZ9-F1-model_v4 | Large ribosomal subunit protein bL20 (50S ribosomal protein L20) | 0.9698 | 53 | 118 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |