F497044

General Info

Members Datasets Scaffolds Average Seq Length
2755 861 2508 139

Family's Representative Sequence

Representative Sequence 3300048921|Ga0496118_0252113|Ga0496118_0252113_310_783
Length 157
Sequence MIMGIGSDLIDIRRVAKVIERHGERFLERVFTEAERAKAERRARNEKMVVATYAKRFAAKEACSKALGTGIRQGVWWRDMGVVNLPGGRPTMRLTGGALARLTALTPAGFEPRIDLSITDDWPLAQAFVIISAVSSGNPDPGGGGDSRKTKIHDLDQ

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
5 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
6 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
7 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
8 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
9 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
10 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
11 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
12 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
13 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
14 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
15 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
16 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
17 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
18 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
19 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
20 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
21 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
22 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
23 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
24 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
25 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
26 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
27 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
28 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
29 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
30 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
31 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
32 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
33 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
34 2643221651 Afipia sp. Root123D2 Isolate Unclassified
35 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
36 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
37 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
38 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
39 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
40 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
41 2791355199
42 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
43 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
44 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
45 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
46 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
47 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
48 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
49 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
50 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
51 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
52 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
53 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
54 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
55 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
56 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
57 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
58 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
59 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
60 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
61 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
62 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
63 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
64 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
65 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
66 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
67 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
68 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
69 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
70 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
71 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
72 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
73 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
74 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
75 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
76 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
77 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
78 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
79 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
80 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
81 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
82 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
83 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
84 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
85 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
86 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
87 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
88 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
89 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
90 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
91 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
92 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
93 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
94 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
95 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
96 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
97 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
98 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
99 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
100 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
101 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
102 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
103 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
104 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
105 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
106 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
107 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
108 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
109 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
110 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
111 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
112 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
113 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
114 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
115 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
116 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
117 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
118 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
119 2904699407
120 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
121 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
122 2906610324
123 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
124 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
125 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
126 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
127 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
128 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
129 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
130 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
131 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
132 2922368715
133 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
134 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
135 2922425934
136 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
137 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
138 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
139 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
140 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
141 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
142 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
143 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
144 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
145 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
146 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
147 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
148 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
149 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
150 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
151 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
152 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
153 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
154 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
155 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
156 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
157 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
158 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
159 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
160 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
161 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
162 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
163 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
164 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
165 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
166 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
167 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
168 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
169 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
170 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
171 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
172 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
173 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
174 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
175 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
176 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
177 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
178 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
179 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
180 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
181 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
182 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
183 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
184 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
185 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
186 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
187 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
188 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
189 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
190 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
191 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
192 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
193 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
194 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
195 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
196 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
197 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
198 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
199 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
200 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
201 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
202 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
203 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
204 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
205 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
206 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
207 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
208 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
209 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
210 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
211 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
212 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
213 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
214 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
215 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
216 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
217 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
218 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
219 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
220 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
221 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
222 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
223 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
224 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
225 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
226 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
227 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
228 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
229 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
230 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
231 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
232 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
233 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
234 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
235 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
236 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
237 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
238 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
239 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
240 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
241 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
242 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
243 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
244 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
245 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
246 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
247 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
248 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
249 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
250 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
251 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
252 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
253 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
254 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
255 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
256 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
257 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
258 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
259 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
260 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
261 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
262 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
263 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
264 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
265 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
266 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
267 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
268 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
269 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
270 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
271 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
272 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
273 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
274 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
275 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
276 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
277 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
278 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
279 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
280 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
281 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
282 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
283 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
284 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
285 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
286 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
287 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
288 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
289 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
290 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
291 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
292 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
293 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
294 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
295 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
296 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
297 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
298 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
299 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
300 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
301 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
302 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
303 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
304 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
305 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
306 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
307 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
308 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
309 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
310 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
311 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
312 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
313 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
314 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
315 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
316 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
317 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
318 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
319 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
320 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
321 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
322 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
323 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
324 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
325 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
326 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
327 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
328 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
329 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
330 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
331 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
332 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
333 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
334 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
335 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
336 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
337 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
338 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
339 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
340 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
341 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
342 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
343 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
344 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
345 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
346 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
347 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
348 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
349 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
350 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
351 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
352 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
353 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
354 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
355 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
356 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
357 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
358 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
359 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
360 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
361 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
362 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
363 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
364 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
365 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
366 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
367 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
368 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
369 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
370 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
371 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
372 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
373 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
374 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
375 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
376 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
377 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
378 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
379 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
380 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
381 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
382 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
383 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
384 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
385 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
386 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
387 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
388 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
389 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
390 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
391 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
392 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
393 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
394 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
395 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
396 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
397 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
398 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
399 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
400 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
401 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
402 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
403 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
404 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
405 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
406 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
407 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
408 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
409 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
410 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
411 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
412 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
413 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
414 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
415 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
416 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
417 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
418 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
419 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
420 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
421 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
422 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
423 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
424 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
425 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
426 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
427 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
428 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
429 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
430 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
431 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
432 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
433 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
434 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
435 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
436 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
437 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
438 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
439 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
440 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
441 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
442 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
443 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
444 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
445 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
446 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
447 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
448 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
449 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
450 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
451 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
452 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
453 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
454 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
455 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
456 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
457 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
458 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
459 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
460 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
461 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
462 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
463 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
464 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
465 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
466 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
467 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
468 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
469 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
470 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
471 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
472 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
473 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
474 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
475 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
476 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
477 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
478 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
479 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
480 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
481 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
482 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
483 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
484 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
485 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
486 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
487 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
488 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
489 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
490 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
491 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
492 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
493 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
494 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
495 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
496 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
497 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
498 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
499 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
500 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
501 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
502 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
503 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
504 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
505 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
506 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
507 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
508 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
509 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
510 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
511 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
512 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
513 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
514 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
515 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
516 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
517 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
518 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
519 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
520 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
521 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
522 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
523 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
524 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
525 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
526 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
527 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
528 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
529 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
530 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
531 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
532 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
533 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
534 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
535 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
536 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
537 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
538 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
539 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
540 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
541 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
542 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
543 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
544 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
545 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
546 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
547 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
548 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
549 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
550 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
551 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
552 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
553 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
554 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
555 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
556 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
557 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
558 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
559 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
560 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
561 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
562 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
563 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
564 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
565 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
566 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
567 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
568 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
569 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
570 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
571 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
572 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
573 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
574 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
575 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
576 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
577 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
578 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
579 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
580 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
581 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
582 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
583 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
584 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
585 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
586 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
587 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
588 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
589 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
590 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
591 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
592 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
593 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
594 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
595 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
596 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
597 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
598 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
599 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
600 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
601 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
602 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
603 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
604 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
605 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
606 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
607 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
608 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
609 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
610 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
611 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
612 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
613 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
614 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
615 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
616 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
617 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
618 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
619 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
620 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
621 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
622 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
623 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
624 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
625 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
626 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
627 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
628 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
629 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
630 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
631 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
632 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
633 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
634 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
635 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
636 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
637 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
638 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
639 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
640 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
641 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
642 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
643 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
644 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
645 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
646 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
647 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
648 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
649 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
650 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
651 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
652 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
653 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
654 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
655 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
656 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
657 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
658 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
659 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
660 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
661 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
662 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
663 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
664 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
665 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
666 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
667 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
668 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
669 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
670 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
671 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
672 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
673 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
674 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
675 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
676 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
677 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
678 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
679 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
680 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
681 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
682 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
683 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
684 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
685 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
686 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
687 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
688 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
689 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
690 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
691 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
692 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
693 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
694 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
695 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
696 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
697 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
698 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
699 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
700 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
701 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
702 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
703 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
704 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
705 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
706 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
707 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
708 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
709 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
710 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
711 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
712 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
713 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
714 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
715 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
716 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
717 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
718 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
719 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
720 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
721 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
722 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
723 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
724 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
725 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
726 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
727 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
728 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
729 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
730 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
731 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
732 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
733 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
734 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
735 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
736 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
737 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
738 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
739 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
740 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
741 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
742 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
743 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
744 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
745 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
746 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
747 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
748 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
749 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
750 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
751 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
752 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
753 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
754 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
755 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
756 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
757 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
758 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
759 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
760 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
761 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
762 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
763 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
764 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
765 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
766 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
767 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
768 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
769 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
770 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
771 3300053114 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere Metagenome Endosphere
772 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
773 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
774 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
775 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
776 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
777 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
778 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
779 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
780 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
781 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
782 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
783 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
784 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
785 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
786 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
787 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
788 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
789 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
790 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
791 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
792 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
793 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
794 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
795 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
796 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
797 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
798 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
799 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
800 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
801 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
802 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
803 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
804 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
805 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
806 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
807 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
808 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
809 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
810 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
811 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
812 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
813 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
814 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
815 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
816 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
817 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
818 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
819 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
820 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
821 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
822 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
823 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
824 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
825 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
826 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
827 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
828 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
829 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
830 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
831 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
832 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
833 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
834 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
835 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
836 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
837 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
838 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
839 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
840 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
841 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
842 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
843 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
844 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
845 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
846 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
847 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
848 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
849 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
850 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
851 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
852 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
853 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
854 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
855 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
856 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
857 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
858 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
859 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
860 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
861 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.09
Metatranscriptomes 0.11
Isolates 8.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.01
Nodule 6.86
Rhizoplane 5.44
Rhizosphere 66.75
Stem 0
Stem Tuber 0
Unclassified 8.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10007437 3300001979 Bacteria 4455
2 JGI24739J22299_10013706 3300001989 Bacteria 2955
3 JGI24737J22298_10002064 3300001990 Bacteria 7183
4 JGI24735J21928_10002565 3300002067 Bacteria 6284
5 JGI24750J21931_1013116 3300002070 Bacteria 1105
6 JGI24738J21930_10025285 3300002075 Bacteria 1221
7 JGI25406J46586_10000006 3300003203 Bacteria 114937
8 JGI25406J46586_10005846 3300003203 Bacteria 5691
9 JGI25165J46597_1010789 3300003214 Bacteria 1322
10 JGI25153J46596_10000510 3300003215 Bacteria 24510
11 JGI25153J46596_10007100 3300003215 Bacteria 5560
12 JGI25153J46596_10016687 3300003215 Bacteria 2927
13 JGI25153J46596_10027718 3300003215 Bacteria 1979
14 JGI25153J46596_10034203 3300003215 Bacteria 1665
15 JGI25153J46596_10047453 3300003215 Bacteria 1263
16 JGI25153J46596_10047482 3300003215 Bacteria 1263
17 JGI25160J50197_1004341 3300003354 Bacteria 6146
18 JGI25160J50197_1018879 3300003354 Bacteria 2134
19 JGI25404J52841_10000992 3300003659 Bacteria 4652
20 JGI25404J52841_10004569 3300003659 Bacteria 2813
21 JGI25404J52841_10027147 3300003659 Bacteria 1232
22 JGI25404J52841_10032072 3300003659 Bacteria 1121
23 JGI25404J52841_10059632 3300003659 Bacteria 800
24 JGI25404J52841_10088221 3300003659 Bacteria 648
25 Ga0055531_10011097 3300003794 Bacteria 4395
26 Ga0055531_10043389 3300003794 Bacteria 1273
27 Ga0055543_1002757 3300004625 Bacteria 5578
28 Ga0065165_1002461 3300005262 Bacteria 15609
29 Ga0065165_1009234 3300005262 Bacteria 4456
30 Ga0065165_1027172 3300005262 Bacteria 1870
31 Ga0070658_10149359 3300005327 Bacteria 1956
32 Ga0070658_10210403 3300005327 Bacteria 1643
33 Ga0070658_10286481 3300005327 Bacteria 1403
34 Ga0070658_10906256 3300005327 Bacteria 767
35 Ga0070676_10248752 3300005328 Bacteria 1185
36 Ga0070683_100204348 3300005329 Bacteria 1876
37 Ga0070683_100223631 3300005329 Bacteria 1789
38 Ga0070683_100398230 3300005329 Bacteria 1313
39 Ga0070683_101099875 3300005329 Bacteria 763
40 Ga0070670_100183475 3300005331 Bacteria 1817
41 Ga0070670_100298651 3300005331 Bacteria 1408
42 Ga0070670_100364772 3300005331 Bacteria 1271
43 Ga0068869_100033046 3300005334 Bacteria 3650
44 Ga0068869_100123461 3300005334 Bacteria 1983
45 Ga0068869_100419802 3300005334 Bacteria 1103
46 Ga0070666_10063159 3300005335 Bacteria 2510
47 Ga0070666_10204390 3300005335 Bacteria 1390
48 Ga0070680_100075697 3300005336 Bacteria 2771
49 Ga0070680_100112740 3300005336 Bacteria 2264
50 Ga0070680_100122249 3300005336 Bacteria 2173
51 Ga0070680_100158386 3300005336 Bacteria 1902
52 Ga0070680_100250123 3300005336 Bacteria 1498
53 Ga0070680_100938115 3300005336 Bacteria 747
54 Ga0070680_101444324 3300005336 Bacteria 596
55 Ga0070682_100175405 3300005337 Bacteria 1493
56 Ga0070682_100481000 3300005337 Bacteria 958
57 Ga0070682_101602459 3300005337 Bacteria 563
58 Ga0068868_100114731 3300005338 Bacteria 2192
59 Ga0068868_100605963 3300005338 Bacteria 971
60 Ga0068868_101747575 3300005338 Bacteria 587
61 Ga0070660_100007203 3300005339 Bacteria 7738
62 Ga0070660_100048937 3300005339 Bacteria 3248
63 Ga0070660_100217746 3300005339 Bacteria 1551
64 Ga0070660_100436656 3300005339 Bacteria 1085
65 Ga0070660_101235167 3300005339 Bacteria 634
66 Ga0070689_100773904 3300005340 Bacteria 842
67 Ga0070687_100239198 3300005343 Bacteria 1122
68 Ga0070661_100096947 3300005344 Bacteria 2189
69 Ga0070661_100504127 3300005344 Bacteria 969
70 Ga0070668_100131603 3300005347 Bacteria 2008
71 Ga0070668_100151203 3300005347 Bacteria 1877
72 Ga0070668_100524144 3300005347 Bacteria 1028
73 Ga0070668_100682666 3300005347 Bacteria 904
74 Ga0070668_100718099 3300005347 Bacteria 882
75 Ga0070668_101422706 3300005347 Bacteria 632
76 Ga0070669_100065476 3300005353 Bacteria 2677
77 Ga0070669_100207419 3300005353 Bacteria 1544
78 Ga0070675_100361154 3300005354 Bacteria 1289
79 Ga0070675_100847442 3300005354 Unclassified 836
80 Ga0070671_100041710 3300005355 Bacteria 3813
81 Ga0070671_100142821 3300005355 Bacteria 2020
82 Ga0070671_100244428 3300005355 Bacteria 1524
83 Ga0070671_100255490 3300005355 Bacteria 1489
84 Ga0070671_100907920 3300005355 Bacteria 770
85 Ga0070674_100141025 3300005356 Bacteria 1809
86 Ga0070674_100325546 3300005356 Bacteria 1233
87 Ga0070674_100634970 3300005356 Bacteria 906
88 Ga0070673_100725690 3300005364 Bacteria 914
89 Ga0070673_100760850 3300005364 Bacteria 892
90 Ga0070673_100876679 3300005364 Bacteria 831
91 Ga0070688_100352725 3300005365 Bacteria 1077
92 Ga0070659_100063866 3300005366 Bacteria 2913
93 Ga0070659_100122746 3300005366 Bacteria 2105
94 Ga0070659_100240154 3300005366 Bacteria 1499
95 Ga0070659_100254785 3300005366 Bacteria 1455
96 Ga0070659_100286131 3300005366 Bacteria 1372
97 Ga0070659_100650765 3300005366 Bacteria 909
98 Ga0070659_100987211 3300005366 Bacteria 739
99 Ga0070667_100071976 3300005367 Bacteria 2945
100 Ga0070667_100091359 3300005367 Bacteria 2618
101 Ga0070667_100578510 3300005367 Bacteria 1034
102 Ga0070667_100977338 3300005367 Bacteria 789
103 Ga0070709_10001628 3300005434 Bacteria 12149
104 Ga0070709_10003678 3300005434 Bacteria 8239
105 Ga0070709_10005420 3300005434 Bacteria 6910
106 Ga0070709_10182552 3300005434 Bacteria 1474
107 Ga0070709_10224189 3300005434 Bacteria 1342
108 Ga0070709_10472683 3300005434 Bacteria 948
109 Ga0070709_10541067 3300005434 Bacteria 890
110 Ga0070714_100002376 3300005435 Bacteria 13850
111 Ga0070714_100048174 3300005435 Bacteria 3624
112 Ga0070714_100093416 3300005435 Bacteria 2638
113 Ga0070714_100123273 3300005435 Bacteria 2308
114 Ga0070714_100170820 3300005435 Bacteria 1973
115 Ga0070714_100278620 3300005435 Bacteria 1553
116 Ga0070714_100353731 3300005435 Bacteria 1380
117 Ga0070713_100052364 3300005436 Bacteria 3380
118 Ga0070713_100058151 3300005436 Bacteria 3223
119 Ga0070713_100101855 3300005436 Bacteria 2489
120 Ga0070713_100151341 3300005436 Bacteria 2064
121 Ga0070713_100183853 3300005436 Bacteria 1880
122 Ga0070713_100277405 3300005436 Bacteria 1537
123 Ga0070710_10009467 3300005437 Bacteria 4766
124 Ga0070710_10011580 3300005437 Bacteria 4361
125 Ga0070710_10017128 3300005437 Bacteria 3703
126 Ga0070710_10037554 3300005437 Bacteria 2656
127 Ga0070710_10305953 3300005437 Bacteria 1039
128 Ga0070710_10525215 3300005437 Bacteria 814
129 Ga0070711_100008430 3300005439 Bacteria 6315
130 Ga0070711_100021977 3300005439 Bacteria 4130
131 Ga0070711_100027214 3300005439 Bacteria 3752
132 Ga0070711_100027696 3300005439 Bacteria 3723
133 Ga0070711_100047019 3300005439 Bacteria 2944
134 Ga0070711_100193186 3300005439 Bacteria 1566
135 Ga0070705_100097327 3300005440 Bacteria 1849
136 Ga0070700_100099116 3300005441 Bacteria 1916
137 Ga0070700_100557134 3300005441 Bacteria 891
138 Ga0070708_100147838 3300005445 Bacteria 2184
139 Ga0070663_100010854 3300005455 Bacteria 5691
140 Ga0070663_100037934 3300005455 Bacteria 3357
141 Ga0070663_100056235 3300005455 Bacteria 2818
142 Ga0070663_100064061 3300005455 Bacteria 2656
143 Ga0070663_100066376 3300005455 Bacteria 2614
144 Ga0070663_100083980 3300005455 Bacteria 2346
145 Ga0070663_100111419 3300005455 Bacteria 2057
146 Ga0070663_100309249 3300005455 Bacteria 1267
147 Ga0070663_100468178 3300005455 Bacteria 1041
148 Ga0070663_100518985 3300005455 Bacteria 992
149 Ga0070663_100630561 3300005455 Bacteria 904
150 Ga0070678_100209164 3300005456 Bacteria 1615
151 Ga0070662_100234417 3300005457 Bacteria 1470
152 Ga0070662_100380019 3300005457 Bacteria 1162
153 Ga0070662_100598247 3300005457 Bacteria 927
154 Ga0070681_10033348 3300005458 Bacteria 5169
155 Ga0070681_10094893 3300005458 Bacteria 2931
156 Ga0070681_10298395 3300005458 Bacteria 1521
157 Ga0070681_10300842 3300005458 Bacteria 1514
158 Ga0070681_10390542 3300005458 Bacteria 1302
159 Ga0068867_100164177 3300005459 Bacteria 1754
160 Ga0068867_100526079 3300005459 Bacteria 1020
161 Ga0068867_100973564 3300005459 Bacteria 768
162 Ga0070685_10349341 3300005466 Bacteria 1011
163 Ga0070685_10870649 3300005466 Bacteria 669
164 Ga0070685_11011426 3300005466 Bacteria 624
165 Ga0070706_100470186 3300005467 Bacteria 1170
166 Ga0070706_100795113 3300005467 Bacteria 876
167 Ga0070706_101024918 3300005467 Bacteria 761
168 Ga0070706_101290858 3300005467 Bacteria 670
169 Ga0070707_100163692 3300005468 Bacteria 2168
170 Ga0070698_100582717 3300005471 Bacteria 1059
171 Ga0070699_100430031 3300005518 Bacteria 1196
172 Ga0070679_100030530 3300005530 Bacteria 5320
173 Ga0070679_100073537 3300005530 Bacteria 3409
174 Ga0070679_100100999 3300005530 Bacteria 2871
175 Ga0070679_100189659 3300005530 Bacteria 2025
176 Ga0070679_100508480 3300005530 Bacteria 1148
177 Ga0070679_100629681 3300005530 Bacteria 1016
178 Ga0070684_100011426 3300005535 Bacteria 7076
179 Ga0070684_100148044 3300005535 Bacteria 2126
180 Ga0070684_100303438 3300005535 Bacteria 1465
181 Ga0070684_101028007 3300005535 Bacteria 773
182 Ga0070697_100073865 3300005536 Bacteria 2800
183 Ga0068853_100000691 3300005539 Bacteria 23287
184 Ga0068853_100018843 3300005539 Bacteria 5716
185 Ga0068853_100048529 3300005539 Bacteria 3647
186 Ga0068853_100063915 3300005539 Bacteria 3189
187 Ga0068853_100163391 3300005539 Bacteria 2010
188 Ga0068853_100185834 3300005539 Bacteria 1886
189 Ga0068853_100249716 3300005539 Bacteria 1627
190 Ga0068853_100352869 3300005539 Bacteria 1368
191 Ga0068853_100458941 3300005539 Bacteria 1199
192 Ga0068853_100485085 3300005539 Bacteria 1165
193 Ga0068853_100587840 3300005539 Bacteria 1057
194 Ga0068853_100681779 3300005539 Bacteria 979
195 Ga0068853_100823034 3300005539 Bacteria 890
196 Ga0070672_100107396 3300005543 Bacteria 2271
197 Ga0070672_100510431 3300005543 Bacteria 1041
198 Ga0070686_100465063 3300005544 Bacteria 975
199 Ga0070695_100016925 3300005545 Bacteria 4419
200 Ga0070695_100741487 3300005545 Bacteria 783
201 Ga0070695_100747637 3300005545 Bacteria 780
202 Ga0070696_100484306 3300005546 Bacteria 981
203 Ga0070693_100169909 3300005547 Bacteria 1395
204 Ga0070693_101058380 3300005547 Bacteria 617
205 Ga0070665_100017413 3300005548 Bacteria 7213
206 Ga0070665_100053516 3300005548 Bacteria 4048
207 Ga0070665_100066447 3300005548 Bacteria 3617
208 Ga0070665_100076421 3300005548 Bacteria 3355
209 Ga0070665_100112181 3300005548 Bacteria 2729
210 Ga0070665_100292106 3300005548 Bacteria 1632
211 Ga0070665_100319463 3300005548 Bacteria 1557
212 Ga0070665_100344343 3300005548 Bacteria 1496
213 Ga0070665_100362944 3300005548 Bacteria 1454
214 Ga0070665_100454487 3300005548 Bacteria 1291
215 Ga0070665_101532738 3300005548 Bacteria 675
216 Ga0070704_100384552 3300005549 Bacteria 1193
217 Ga0068855_100059355 3300005563 Bacteria 4476
218 Ga0068855_100066702 3300005563 Bacteria 4195
219 Ga0068855_100091347 3300005563 Bacteria 3512
220 Ga0068855_100100085 3300005563 Bacteria 3338
221 Ga0068855_100111386 3300005563 Bacteria 3142
222 Ga0068855_100224269 3300005563 Bacteria 2106
223 Ga0068855_100228514 3300005563 Bacteria 2084
224 Ga0068855_100278164 3300005563 Bacteria 1859
225 Ga0068855_100367250 3300005563 Bacteria 1582
226 Ga0068855_100653890 3300005563 Bacteria 1128
227 Ga0068855_101637070 3300005563 Bacteria 658
228 Ga0070664_100176423 3300005564 Bacteria 1897
229 Ga0070664_100308174 3300005564 Bacteria 1432
230 Ga0070664_100319895 3300005564 Bacteria 1405
231 Ga0070664_100424047 3300005564 Bacteria 1219
232 Ga0070664_100436886 3300005564 Bacteria 1200
233 Ga0068857_100017706 3300005577 Bacteria 6248
234 Ga0068857_100031001 3300005577 Bacteria 4725
235 Ga0068857_100074845 3300005577 Bacteria 3018
236 Ga0068857_100133470 3300005577 Bacteria 2240
237 Ga0068857_100141458 3300005577 Bacteria 2175
238 Ga0068857_100658468 3300005577 Bacteria 993
239 Ga0068854_100031070 3300005578 Bacteria 3709
240 Ga0068854_100051735 3300005578 Bacteria 2943
241 Ga0068854_100060438 3300005578 Bacteria 2742
242 Ga0068854_100517722 3300005578 Bacteria 1007
243 Ga0068854_100728036 3300005578 Bacteria 859
244 Ga0068854_100832004 3300005578 Bacteria 807
245 Ga0068854_100889695 3300005578 Bacteria 782
246 Ga0068854_101481571 3300005578 Bacteria 616
247 Ga0068854_101616092 3300005578 Bacteria 591
248 Ga0068856_100000322 3300005614 Bacteria 52603
249 Ga0068856_100042409 3300005614 Bacteria 4476
250 Ga0068856_100102908 3300005614 Bacteria 2849
251 Ga0068856_100120464 3300005614 Bacteria 2625
252 Ga0068856_100208034 3300005614 Bacteria 1971
253 Ga0068856_100461489 3300005614 Bacteria 1291
254 Ga0068856_100609502 3300005614 Bacteria 1113
255 Ga0068856_100678334 3300005614 Bacteria 1051
256 Ga0068856_100935443 3300005614 Bacteria 885
257 Ga0070702_100063288 3300005615 Bacteria 2159
258 Ga0070702_100306671 3300005615 Bacteria 1100
259 Ga0070702_100690433 3300005615 Bacteria 777
260 Ga0068852_100052259 3300005616 Bacteria 3511
261 Ga0068852_100086534 3300005616 Bacteria 2794
262 Ga0068852_100302572 3300005616 Bacteria 1548
263 Ga0068852_100540335 3300005616 Bacteria 1165
264 Ga0068852_100639338 3300005616 Bacteria 1071
265 Ga0068852_102582035 3300005616 Bacteria 528
266 Ga0068859_100136779 3300005617 Bacteria 2523
267 Ga0068859_100503025 3300005617 Bacteria 1307
268 Ga0068859_100903830 3300005617 Bacteria 967
269 Ga0068864_100191077 3300005618 Bacteria 1877
270 Ga0068864_100925040 3300005618 Bacteria 862
271 Ga0068864_101089600 3300005618 Bacteria 795
272 Ga0068866_10157907 3300005718 Bacteria 1320
273 Ga0068861_100058492 3300005719 Bacteria 2948
274 Ga0068861_100104434 3300005719 Bacteria 2260
275 Ga0068861_100645726 3300005719 Bacteria 977
276 Ga0068861_100873103 3300005719 Bacteria 850
277 Ga0068861_101290513 3300005719 Bacteria 709
278 Ga0068851_10000442 3300005834 Bacteria 18527
279 Ga0068851_10089654 3300005834 Bacteria 1618
280 Ga0068851_10596892 3300005834 Bacteria 672
281 Ga0068870_10164807 3300005840 Bacteria 1318
282 Ga0068863_100287211 3300005841 Bacteria 1594
283 Ga0068863_100303701 3300005841 Bacteria 1548
284 Ga0068863_100542636 3300005841 Bacteria 1147
285 Ga0068863_100729600 3300005841 Bacteria 986
286 Ga0068863_101101470 3300005841 Bacteria 799
287 Ga0068858_100301165 3300005842 Bacteria 1530
288 Ga0068858_100361880 3300005842 Bacteria 1390
289 Ga0068858_100385140 3300005842 Bacteria 1346
290 Ga0068858_100409453 3300005842 Bacteria 1303
291 Ga0068858_100447600 3300005842 Bacteria 1244
292 Ga0068858_101586827 3300005842 Bacteria 646
293 Ga0068860_100000268 3300005843 Bacteria 76328
294 Ga0068860_100107336 3300005843 Bacteria 2668
295 Ga0068860_100429259 3300005843 Bacteria 1311
296 Ga0068860_100444181 3300005843 Bacteria 1289
297 Ga0068860_101213471 3300005843 Bacteria 775
298 Ga0068860_101717236 3300005843 Bacteria 650
299 Ga0068862_100065219 3300005844 Bacteria 3136
300 Ga0068862_100166402 3300005844 Bacteria 1971
301 Ga0068862_100677437 3300005844 Bacteria 997
302 Ga0068862_102174558 3300005844 Bacteria 566
303 Ga0081455_10003262 3300005937 Bacteria 18776
304 Ga0081455_10005420 3300005937 Bacteria 13994
305 Ga0081455_10007456 3300005937 Bacteria 11518
306 Ga0081455_10021059 3300005937 Bacteria 6123
307 Ga0081455_10045886 3300005937 Bacteria 3798
308 Ga0081455_10298667 3300005937 Bacteria 1156
309 Ga0081455_10638320 3300005937 Bacteria 688
310 Ga0081455_10774494 3300005937 Bacteria 604
311 Ga0081455_10869135 3300005937 Bacteria 562
312 Ga0081538_10009598 3300005981 Bacteria 8053
313 Ga0081538_10024479 3300005981 Bacteria 4298
314 Ga0081538_10213169 3300005981 Bacteria 776
315 Ga0081540_1000078 3300005983 Bacteria 105731
316 Ga0081540_1000423 3300005983 Bacteria 41829
317 Ga0081540_1000977 3300005983 Bacteria 25775
318 Ga0081540_1009064 3300005983 Bacteria 6875
319 Ga0081540_1011671 3300005983 Bacteria 5855
320 Ga0081540_1014804 3300005983 Bacteria 4970
321 Ga0081540_1015232 3300005983 Bacteria 4876
322 Ga0081540_1015859 3300005983 Bacteria 4749
323 Ga0081540_1027847 3300005983 Bacteria 3191
324 Ga0081540_1079400 3300005983 Bacteria 1484
325 Ga0081539_10000176 3300005985 Bacteria 150292
326 Ga0081539_10000231 3300005985 Bacteria 131197
327 Ga0081539_10016162 3300005985 Bacteria 5357
328 Ga0081539_10045542 3300005985 Bacteria 2522
329 Ga0081539_10439945 3300005985 Bacteria 540
330 Ga0070717_10003338 3300006028 Bacteria 11463
331 Ga0070717_10192921 3300006028 Bacteria 1780
332 Ga0070717_10289645 3300006028 Bacteria 1454
333 Ga0070717_10612741 3300006028 Bacteria 987
334 Ga0075365_10024124 3300006038 Bacteria 3833
335 Ga0075365_10046897 3300006038 Bacteria 2839
336 Ga0075365_10073540 3300006038 Bacteria 2304
337 Ga0075365_10087942 3300006038 Bacteria 2113
338 Ga0075365_10115532 3300006038 Bacteria 1847
339 Ga0075365_10125820 3300006038 Bacteria 1771
340 Ga0075365_10163761 3300006038 Bacteria 1550
341 Ga0075365_10202239 3300006038 Bacteria 1391
342 Ga0075365_10250916 3300006038 Bacteria 1243
343 Ga0075365_10321705 3300006038 Bacteria 1089
344 Ga0075365_10650917 3300006038 Bacteria 745
345 Ga0075365_10746043 3300006038 Bacteria 691
346 Ga0075365_10916572 3300006038 Bacteria 618
347 Ga0075368_10011751 3300006042 Bacteria 3191
348 Ga0075368_10028979 3300006042 Bacteria 2140
349 Ga0075368_10047831 3300006042 Bacteria 1694
350 Ga0075368_10066295 3300006042 Bacteria 1451
351 Ga0075368_10111283 3300006042 Bacteria 1129
352 Ga0075363_100006687 3300006048 Bacteria 5261
353 Ga0075363_100068616 3300006048 Bacteria 1923
354 Ga0075363_100118359 3300006048 Bacteria 1477
355 Ga0075363_100192276 3300006048 Bacteria 1164
356 Ga0075363_100228236 3300006048 Bacteria 1068
357 Ga0075363_100231142 3300006048 Bacteria 1062
358 Ga0075363_100321772 3300006048 Bacteria 900
359 Ga0075364_10017856 3300006051 Bacteria 4436
360 Ga0075364_10018321 3300006051 Bacteria 4381
361 Ga0075364_10020918 3300006051 Bacteria 4119
362 Ga0075364_10839692 3300006051 Bacteria 626
363 Ga0075364_11009304 3300006051 Bacteria 566
364 Ga0075432_10270500 3300006058 Bacteria 696
365 Ga0070715_10000362 3300006163 Bacteria 11356
366 Ga0070715_10008899 3300006163 Bacteria 3519
367 Ga0070715_10059524 3300006163 Bacteria 1671
368 Ga0070715_10170288 3300006163 Bacteria 1084
369 Ga0070715_10561984 3300006163 Bacteria 663
370 Ga0070716_100002807 3300006173 Bacteria 8108
371 Ga0070716_100035143 3300006173 Bacteria 2754
372 Ga0070716_100161743 3300006173 Bacteria 1451
373 Ga0070716_100186742 3300006173 Bacteria 1366
374 Ga0070716_100271866 3300006173 Bacteria 1165
375 Ga0070716_100595436 3300006173 Bacteria 831
376 Ga0070712_100005919 3300006175 Bacteria 7568
377 Ga0070712_100012321 3300006175 Bacteria 5434
378 Ga0070712_100113057 3300006175 Bacteria 2030
379 Ga0070712_100148946 3300006175 Bacteria 1794
380 Ga0070712_100170121 3300006175 Bacteria 1690
381 Ga0070712_100797671 3300006175 Bacteria 810
382 Ga0075362_10037578 3300006177 Bacteria 2123
383 Ga0075362_10106448 3300006177 Bacteria 1316
384 Ga0075362_10185470 3300006177 Bacteria 1009
385 Ga0075362_10272864 3300006177 Bacteria 835
386 Ga0075367_10016210 3300006178 Bacteria 4068
387 Ga0075367_10053535 3300006178 Bacteria 2391
388 Ga0075367_10129759 3300006178 Bacteria 1558
389 Ga0075367_10137803 3300006178 Bacteria 1510
390 Ga0075367_10160142 3300006178 Bacteria 1399
391 Ga0075367_10168834 3300006178 Bacteria 1362
392 Ga0075367_10235856 3300006178 Bacteria 1146
393 Ga0075367_10263408 3300006178 Bacteria 1082
394 Ga0075367_10516402 3300006178 Bacteria 758
395 Ga0075369_10000537 3300006186 Bacteria 12003
396 Ga0075369_10026897 3300006186 Bacteria 2401
397 Ga0075369_10071587 3300006186 Bacteria 1526
398 Ga0075369_10079651 3300006186 Bacteria 1451
399 Ga0075369_10146950 3300006186 Bacteria 1076
400 Ga0075369_10211037 3300006186 Bacteria 897
401 Ga0075369_10254125 3300006186 Bacteria 816
402 Ga0075366_10219456 3300006195 Bacteria 1158
403 Ga0097621_100156960 3300006237 Bacteria 1953
404 Ga0097621_100353984 3300006237 Bacteria 1306
405 Ga0075370_10026912 3300006353 Bacteria 3188
406 Ga0075370_10085011 3300006353 Bacteria 1821
407 Ga0075370_10120102 3300006353 Bacteria 1530
408 Ga0075370_10128595 3300006353 Bacteria 1477
409 Ga0075370_10430981 3300006353 Bacteria 793
410 Ga0068871_100490245 3300006358 Bacteria 1106
411 Ga0068871_100954249 3300006358 Bacteria 797
412 Ga0075428_100013639 3300006844 Bacteria 9050
413 Ga0075428_100475981 3300006844 Bacteria 1337
414 Ga0075428_101702583 3300006844 Bacteria 658
415 Ga0075430_101017406 3300006846 Bacteria 683
416 Ga0075434_100017415 3300006871 Bacteria 6924
417 Ga0075434_100692436 3300006871 Bacteria 1037
418 Ga0075429_100111295 3300006880 Bacteria 2393
419 Ga0068865_100476974 3300006881 Bacteria 1036
420 Ga0068865_100545503 3300006881 Bacteria 973
421 Ga0075436_100483704 3300006914 Bacteria 904
422 Ga0075436_100910834 3300006914 Bacteria 658
423 Ga0097620_100136781 3300006931 Bacteria 2523
424 Ga0097620_100503006 3300006931 Bacteria 1307
425 Ga0097620_100903842 3300006931 Bacteria 967
426 Ga0099825_1047377 3300006941 Bacteria 1017
427 Ga0099824_1023470 3300006942 Bacteria 3819
428 Ga0099824_1024052 3300006942 Bacteria 3652
429 Ga0099822_1004035 3300006943 Bacteria 19017
430 Ga0099822_1061062 3300006943 Bacteria 1245
431 Ga0075435_100121979 3300007076 Bacteria 2175
432 Ga0075435_100523141 3300007076 Bacteria 1026
433 Ga0099794_10105410 3300007265 Bacteria 1410
434 Ga0099794_10118808 3300007265 Bacteria 1328
435 Ga0099794_10126035 3300007265 Bacteria 1291
436 Ga0099794_10249062 3300007265 Bacteria 916
437 Ga0099794_10323164 3300007265 Bacteria 801
438 Ga0099795_10062757 3300007788 Bacteria 1383
439 Ga0099795_10101774 3300007788 Bacteria 1128
440 Ga0099795_10179540 3300007788 Bacteria 883
441 Ga0099795_10511109 3300007788 Bacteria 561
442 Ga0105251_10480078 3300009011 Bacteria 579
443 Ga0105244_10379242 3300009036 Bacteria 651
444 Ga0105250_10057116 3300009092 Bacteria 1566
445 Ga0105240_10002409 3300009093 Bacteria 30057
446 Ga0105240_10007230 3300009093 Bacteria 16167
447 Ga0105240_10007574 3300009093 Bacteria 15726
448 Ga0105240_10088219 3300009093 Bacteria 3796
449 Ga0105240_10106446 3300009093 Bacteria 3401
450 Ga0105240_10123732 3300009093 Bacteria 3111
451 Ga0105240_10216279 3300009093 Bacteria 2236
452 Ga0105240_10220070 3300009093 Bacteria 2212
453 Ga0105240_10377194 3300009093 Bacteria 1602
454 Ga0105240_10480117 3300009093 Bacteria 1386
455 Ga0105240_10674983 3300009093 Bacteria 1130
456 Ga0105240_11426704 3300009093 Bacteria 727
457 Ga0111539_10276872 3300009094 Bacteria 1953
458 Ga0111539_10912201 3300009094 Bacteria 1022
459 Ga0111539_11391412 3300009094 Bacteria 814
460 Ga0105245_10017226 3300009098 Bacteria 6304
461 Ga0105245_10022894 3300009098 Bacteria 5481
462 Ga0105245_10290457 3300009098 Bacteria 1601
463 Ga0105245_10309253 3300009098 Bacteria 1553
464 Ga0105245_10326119 3300009098 Bacteria 1514
465 Ga0105245_10446925 3300009098 Bacteria 1300
466 Ga0105245_10720148 3300009098 Bacteria 1032
467 Ga0105245_11655894 3300009098 Bacteria 692
468 Ga0105247_10080861 3300009101 Bacteria 2048
469 Ga0105247_10412962 3300009101 Bacteria 965
470 Ga0114129_10416746 3300009147 Bacteria 1767
471 Ga0114129_10520875 3300009147 Bacteria 1550
472 Ga0105243_10172315 3300009148 Bacteria 1876
473 Ga0105243_10422290 3300009148 Bacteria 1244
474 Ga0105243_10501056 3300009148 Bacteria 1151
475 Ga0105243_10764918 3300009148 Bacteria 948
476 Ga0105243_11401990 3300009148 Bacteria 719
477 Ga0105243_11584202 3300009148 Bacteria 681
478 Ga0105241_10000269 3300009174 Bacteria 38808
479 Ga0105241_10081641 3300009174 Bacteria 2533
480 Ga0105241_10274194 3300009174 Bacteria 1438
481 Ga0105241_10400072 3300009174 Bacteria 1204
482 Ga0105241_10511986 3300009174 Bacteria 1072
483 Ga0105241_10789633 3300009174 Bacteria 874
484 Ga0105241_12013299 3300009174 Bacteria 569
485 Ga0105242_10745987 3300009176 Bacteria 963
486 Ga0105248_10296216 3300009177 Bacteria 1822
487 Ga0105248_10453900 3300009177 Bacteria 1444
488 Ga0105248_10760177 3300009177 Bacteria 1094
489 Ga0105248_10879007 3300009177 Bacteria 1012
490 Ga0105237_10025414 3300009545 Bacteria 6057
491 Ga0105237_10028752 3300009545 Bacteria 5657
492 Ga0105237_10037425 3300009545 Bacteria 4905
493 Ga0105237_10043519 3300009545 Bacteria 4523
494 Ga0105237_10063638 3300009545 Bacteria 3687
495 Ga0105237_10078129 3300009545 Bacteria 3299
496 Ga0105237_10078514 3300009545 Bacteria 3290
497 Ga0105237_10081130 3300009545 Bacteria 3234
498 Ga0105237_10116241 3300009545 Bacteria 2668
499 Ga0105237_10226669 3300009545 Bacteria 1869
500 Ga0105237_10295606 3300009545 Bacteria 1622
501 Ga0105237_10638350 3300009545 Bacteria 1072
502 Ga0105237_10767891 3300009545 Bacteria 971
503 Ga0105237_10901496 3300009545 Bacteria 891
504 Ga0105237_11162144 3300009545 Bacteria 778
505 Ga0105237_12419060 3300009545 Bacteria 535
506 Ga0105238_10002408 3300009551 Bacteria 18754
507 Ga0105238_10013773 3300009551 Bacteria 8173
508 Ga0105238_10047950 3300009551 Bacteria 4306
509 Ga0105238_10065158 3300009551 Bacteria 3644
510 Ga0105238_10095253 3300009551 Bacteria 2964
511 Ga0105238_10342361 3300009551 Bacteria 1484
512 Ga0105238_10415771 3300009551 Bacteria 1339
513 Ga0105238_10474043 3300009551 Bacteria 1250
514 Ga0105238_10479626 3300009551 Bacteria 1243
515 Ga0105238_10559161 3300009551 Bacteria 1149
516 Ga0105238_10939538 3300009551 Bacteria 884
517 Ga0105238_11008124 3300009551 Bacteria 854
518 Ga0105238_11471998 3300009551 Bacteria 709
519 Ga0105238_12370572 3300009551 Bacteria 566
520 Ga0105249_10115797 3300009553 Bacteria 2540
521 Ga0105249_10279250 3300009553 Bacteria 1667
522 Ga0105249_10628659 3300009553 Bacteria 1130
523 Ga0105249_10696990 3300009553 Bacteria 1075
524 Ga0099796_10015947 3300010159 Bacteria 2209
525 Ga0099796_10090567 3300010159 Bacteria 1136
526 Ga0105239_10006100 3300010375 Bacteria 14036
527 Ga0105239_10031935 3300010375 Bacteria 5786
528 Ga0105239_10168063 3300010375 Bacteria 2452
529 Ga0105239_10172205 3300010375 Bacteria 2421
530 Ga0105239_10221750 3300010375 Bacteria 2120
531 Ga0105239_10330268 3300010375 Bacteria 1720
532 Ga0105239_10478407 3300010375 Bacteria 1415
533 Ga0105239_10527736 3300010375 Bacteria 1343
534 Ga0105239_10647732 3300010375 Bacteria 1207
535 Ga0105239_10698646 3300010375 Bacteria 1160
536 Ga0105239_11025954 3300010375 Bacteria 949
537 Ga0105239_11454954 3300010375 Bacteria 791
538 Ga0105246_10006402 3300011119 Bacteria 7193
539 Ga0105246_10030804 3300011119 Bacteria 3546
540 Ga0105246_10283562 3300011119 Bacteria 1330
541 Ga0105246_10687252 3300011119 Bacteria 895
542 Ga0157320_1014240 3300012481 Bacteria 661
543 Ga0157326_1024051 3300012513 Bacteria 770
544 Ga0157373_10261026 3300013100 Bacteria 1226
545 Ga0157371_10110563 3300013102 Bacteria 1950
546 Ga0157371_10321376 3300013102 Bacteria 1123
547 Ga0157371_10521424 3300013102 Bacteria 879
548 Ga0157370_10039790 3300013104 Bacteria 4541
549 Ga0157370_10207346 3300013104 Bacteria 1817
550 Ga0157370_10517326 3300013104 Bacteria 1095
551 Ga0157370_10756670 3300013104 Bacteria 885
552 Ga0157370_11113987 3300013104 Bacteria 713
553 Ga0157370_11192541 3300013104 Bacteria 687
554 Ga0157370_12130440 3300013104 Bacteria 502
555 Ga0157369_10006662 3300013105 Bacteria 13349
556 Ga0157369_10023864 3300013105 Bacteria 6808
557 Ga0157369_10101671 3300013105 Bacteria 3063
558 Ga0157369_10360388 3300013105 Bacteria 1510
559 Ga0157369_10542646 3300013105 Bacteria 1202
560 Ga0157369_10718942 3300013105 Bacteria 1028
561 Ga0157374_10042515 3300013296 Bacteria 4192
562 Ga0157374_10166030 3300013296 Bacteria 2151
563 Ga0157374_10790789 3300013296 Bacteria 964
564 Ga0157374_10813179 3300013296 Bacteria 951
565 Ga0157374_10848902 3300013296 Bacteria 930
566 Ga0157378_10037027 3300013297 Bacteria 4320
567 Ga0157378_10613182 3300013297 Bacteria 1101
568 Ga0157378_11050691 3300013297 Bacteria 850
569 Ga0163162_10178723 3300013306 Bacteria 2248
570 Ga0163162_10271352 3300013306 Bacteria 1828
571 Ga0163162_10372101 3300013306 Bacteria 1562
572 Ga0163162_10394628 3300013306 Bacteria 1516
573 Ga0163162_11274751 3300013306 Bacteria 835
574 Ga0163162_11944205 3300013306 Bacteria 674
575 Ga0163162_12751088 3300013306 Bacteria 566
576 Ga0157372_10091799 3300013307 Bacteria 3454
577 Ga0157372_10132041 3300013307 Bacteria 2874
578 Ga0157372_10384920 3300013307 Bacteria 1634
579 Ga0157372_10531553 3300013307 Bacteria 1371
580 Ga0157372_10760480 3300013307 Bacteria 1126
581 Ga0157372_10920762 3300013307 Bacteria 1014
582 Ga0157375_10357037 3300013308 Bacteria 1627
583 Ga0157375_10626982 3300013308 Bacteria 1233
584 Ga0157375_10740684 3300013308 Bacteria 1135
585 Ga0157375_11219651 3300013308 Bacteria 883
586 Ga0157375_11365222 3300013308 Bacteria 834
587 Ga0157375_12587370 3300013308 Bacteria 606
588 Ga0163163_10001936 3300014325 Bacteria 17537
589 Ga0163163_10267943 3300014325 Bacteria 1759
590 Ga0157380_10058229 3300014326 Bacteria 3080
591 Ga0157380_10497453 3300014326 Bacteria 1183
592 Ga0157380_10858258 3300014326 Bacteria 930
593 Ga0157380_11283630 3300014326 Bacteria 779
594 Ga0157380_11381717 3300014326 Bacteria 754
595 Ga0182008_10190551 3300014497 Bacteria 1040
596 Ga0157379_10222343 3300014968 Bacteria 1711
597 Ga0157379_10499142 3300014968 Bacteria 1128
598 Ga0157376_10514984 3300014969 Bacteria 1178
599 Ga0157376_10629229 3300014969 Bacteria 1071
600 Ga0157376_10648852 3300014969 Bacteria 1056
601 Ga0157376_10874354 3300014969 Bacteria 915
602 Ga0157376_11059501 3300014969 Bacteria 835
603 Ga0182007_10074972 3300015262 Bacteria 1108
604 Ga0163161_10037048 3300017792 Bacteria 3495
605 Ga0163161_10089540 3300017792 Bacteria 2276
606 Ga0163161_10412598 3300017792 Bacteria 1085
607 Ga0163161_10738400 3300017792 Bacteria 822
608 Ga0206353_10973987 3300020082 Bacteria 1104
609 Ga0214544_1000009 3300021320 Bacteria 285865
610 Ga0214542_1000002 3300021321 Bacteria 720798
611 Ga0214545_1000002 3300021324 Bacteria 727485
612 Ga0214543_1000013 3300021327 Bacteria 329117
613 Ga0213873_10032982 3300021358 Bacteria 1297
614 Ga0213874_10002345 3300021377 Bacteria 4062
615 Ga0213874_10086622 3300021377 Bacteria 1023
616 Ga0213874_10323412 3300021377 Bacteria 585
617 Ga0213876_10002649 3300021384 Bacteria 10455
618 Ga0213876_10032050 3300021384 Bacteria 2773
619 Ga0213875_10325558 3300021388 Bacteria 728
620 Ga0213875_10352527 3300021388 Bacteria 699
621 Ga0213871_10002311 3300021441 Bacteria 3484
622 Ga0224712_10364799 3300022467 Bacteria 684
623 Ga0209563_101473 3300025230 Bacteria 6213
624 Ga0207425_1053625 3300025245 Bacteria 729
625 Ga0209677_101297 3300025253 Bacteria 11125
626 Ga0209677_109389 3300025253 Bacteria 1760
627 Ga0209148_1000779 3300025254 Bacteria 23713
628 Ga0209148_1007270 3300025254 Bacteria 2316
629 Ga0209148_1037776 3300025254 Bacteria 682
630 Ga0209233_1005770 3300025261 Bacteria 4071
631 Ga0209233_1007403 3300025261 Bacteria 3481
632 Ga0209233_1068597 3300025261 Bacteria 663
633 Ga0209455_1004376 3300025272 Bacteria 4652
634 Ga0209455_1007482 3300025272 Bacteria 3077
635 Ga0209455_1007672 3300025272 Bacteria 3014
636 Ga0209455_1029914 3300025272 Bacteria 933
637 Ga0209673_1016996 3300025273 Bacteria 2696
638 Ga0209130_1026383 3300025284 Bacteria 1247
639 Ga0209025_1145809 3300025294 Bacteria 662
640 Ga0209564_1001156 3300025295 Bacteria 30779
641 Ga0209564_1010970 3300025295 Bacteria 4112
642 Ga0209564_1018150 3300025295 Bacteria 2698
643 Ga0209758_1000100 3300025297 Bacteria 227948
644 Ga0209758_1000553 3300025297 Bacteria 59265
645 Ga0209758_1003040 3300025297 Bacteria 15973
646 Ga0209758_1003281 3300025297 Bacteria 14995
647 Ga0209758_1003616 3300025297 Bacteria 13830
648 Ga0209758_1003619 3300025297 Bacteria 13825
649 Ga0209758_1006718 3300025297 Bacteria 8109
650 Ga0209758_1012788 3300025297 Bacteria 4651
651 Ga0209256_1003151 3300025299 Bacteria 11994
652 Ga0209256_1024063 3300025299 Bacteria 1801
653 Ga0209256_1028975 3300025299 Bacteria 1551
654 Ga0207426_1000596 3300025302 Bacteria 47621
655 Ga0207426_1001063 3300025302 Bacteria 25997
656 Ga0207426_1008118 3300025302 Bacteria 4292
657 Ga0207426_1045336 3300025302 Bacteria 1338
658 Ga0209051_1052398 3300025303 Bacteria 1348
659 Ga0209257_1007882 3300025304 Bacteria 6265
660 Ga0209257_1053920 3300025304 Bacteria 1122
661 Ga0207697_10235564 3300025315 Bacteria 809
662 Ga0207656_10033764 3300025321 Bacteria 2133
663 Ga0207656_10052223 3300025321 Bacteria 1770
664 Ga0207656_10194438 3300025321 Bacteria 978
665 Ga0207696_1134650 3300025711 Bacteria 663
666 Ga0207692_10000237 3300025898 Bacteria 18663
667 Ga0207692_10005534 3300025898 Bacteria 5069
668 Ga0207692_10012281 3300025898 Bacteria 3674
669 Ga0207692_10403932 3300025898 Bacteria 852
670 Ga0207692_10746757 3300025898 Bacteria 637
671 Ga0207642_10722151 3300025899 Bacteria 629
672 Ga0207710_10066814 3300025900 Bacteria 1641
673 Ga0207710_10400099 3300025900 Bacteria 705
674 Ga0207688_10010406 3300025901 Bacteria 5062
675 Ga0207688_10079981 3300025901 Bacteria 1865
676 Ga0207680_10114205 3300025903 Bacteria 1757
677 Ga0207680_10173416 3300025903 Bacteria 1454
678 Ga0207647_10037887 3300025904 Bacteria 3053
679 Ga0207647_10149911 3300025904 Bacteria 1363
680 Ga0207647_10179477 3300025904 Bacteria 1230
681 Ga0207647_10245139 3300025904 Bacteria 1029
682 Ga0207647_10532198 3300025904 Bacteria 653
683 Ga0207685_10000461 3300025905 Bacteria 6826
684 Ga0207685_10028428 3300025905 Bacteria 1969
685 Ga0207685_10041205 3300025905 Bacteria 1726
686 Ga0207685_10074925 3300025905 Bacteria 1383
687 Ga0207699_10001151 3300025906 Bacteria 12501
688 Ga0207699_10001394 3300025906 Bacteria 11484
689 Ga0207699_10009254 3300025906 Bacteria 4897
690 Ga0207699_10010073 3300025906 Bacteria 4728
691 Ga0207699_10018400 3300025906 Bacteria 3701
692 Ga0207699_10153736 3300025906 Bacteria 1525
693 Ga0207699_10172818 3300025906 Bacteria 1447
694 Ga0207699_10545033 3300025906 Bacteria 841
695 Ga0207645_10068616 3300025907 Bacteria 2268
696 Ga0207705_10031420 3300025909 Bacteria 3791
697 Ga0207705_10035586 3300025909 Bacteria 3562
698 Ga0207705_10180424 3300025909 Bacteria 1593
699 Ga0207705_10213377 3300025909 Bacteria 1464
700 Ga0207705_10280032 3300025909 Bacteria 1276
701 Ga0207705_10333068 3300025909 Bacteria 1168
702 Ga0207705_10364550 3300025909 Bacteria 1115
703 Ga0207705_11206356 3300025909 Bacteria 580
704 Ga0207684_10114702 3300025910 Bacteria 2307
705 Ga0207654_10024931 3300025911 Bacteria 3221
706 Ga0207654_10027995 3300025911 Bacteria 3069
707 Ga0207654_10175318 3300025911 Bacteria 1395
708 Ga0207654_10525916 3300025911 Bacteria 838
709 Ga0207654_10594803 3300025911 Bacteria 789
710 Ga0207707_10003454 3300025912 Bacteria 14012
711 Ga0207707_10008660 3300025912 Bacteria 8827
712 Ga0207707_10018652 3300025912 Bacteria 6049
713 Ga0207707_10052808 3300025912 Bacteria 3537
714 Ga0207707_10117979 3300025912 Bacteria 2320
715 Ga0207707_10161272 3300025912 Bacteria 1960
716 Ga0207707_10212016 3300025912 Bacteria 1687
717 Ga0207707_10259033 3300025912 Bacteria 1509
718 Ga0207707_10289784 3300025912 Bacteria 1416
719 Ga0207695_10001107 3300025913 Bacteria 46846
720 Ga0207695_10002086 3300025913 Bacteria 30425
721 Ga0207695_10024535 3300025913 Bacteria 6779
722 Ga0207695_10046985 3300025913 Bacteria 4572
723 Ga0207695_10098500 3300025913 Bacteria 2923
724 Ga0207695_10148565 3300025913 Bacteria 2284
725 Ga0207695_10148768 3300025913 Bacteria 2283
726 Ga0207695_10283254 3300025913 Bacteria 1551
727 Ga0207695_10750369 3300025913 Bacteria 856
728 Ga0207695_11061287 3300025913 Bacteria 690
729 Ga0207695_11604880 3300025913 Bacteria 531
730 Ga0207671_10012893 3300025914 Bacteria 6692
731 Ga0207671_10045659 3300025914 Bacteria 3240
732 Ga0207671_10057398 3300025914 Bacteria 2885
733 Ga0207671_10071555 3300025914 Bacteria 2587
734 Ga0207671_10113900 3300025914 Bacteria 2061
735 Ga0207671_10152369 3300025914 Bacteria 1786
736 Ga0207671_10176824 3300025914 Bacteria 1659
737 Ga0207671_10224889 3300025914 Bacteria 1471
738 Ga0207671_10283534 3300025914 Bacteria 1307
739 Ga0207671_10373854 3300025914 Bacteria 1132
740 Ga0207671_10450867 3300025914 Bacteria 1025
741 Ga0207671_10642102 3300025914 Bacteria 845
742 Ga0207671_11103669 3300025914 Bacteria 623
743 Ga0207693_10000606 3300025915 Bacteria 32081
744 Ga0207693_10010745 3300025915 Bacteria 7433
745 Ga0207693_10012695 3300025915 Bacteria 6803
746 Ga0207693_10024075 3300025915 Bacteria 4834
747 Ga0207693_10088449 3300025915 Bacteria 2428
748 Ga0207693_10145653 3300025915 Bacteria 1862
749 Ga0207693_10184522 3300025915 Bacteria 1642
750 Ga0207663_10002175 3300025916 Bacteria 9361
751 Ga0207663_10005229 3300025916 Bacteria 6532
752 Ga0207663_10011998 3300025916 Bacteria 4671
753 Ga0207663_10026744 3300025916 Bacteria 3353
754 Ga0207663_10149157 3300025916 Bacteria 1638
755 Ga0207663_10451538 3300025916 Bacteria 991
756 Ga0207663_10469150 3300025916 Bacteria 973
757 Ga0207660_10018042 3300025917 Bacteria 4699
758 Ga0207660_10022461 3300025917 Bacteria 4251
759 Ga0207660_10089597 3300025917 Bacteria 2277
760 Ga0207660_10405456 3300025917 Bacteria 1098
761 Ga0207660_10821803 3300025917 Bacteria 758
762 Ga0207662_10070651 3300025918 Bacteria 2112
763 Ga0207657_10003447 3300025919 Bacteria 16877
764 Ga0207657_10013306 3300025919 Bacteria 8071
765 Ga0207657_10031713 3300025919 Bacteria 4782
766 Ga0207657_10036448 3300025919 Bacteria 4402
767 Ga0207657_10136291 3300025919 Bacteria 2008
768 Ga0207657_10177992 3300025919 Bacteria 1720
769 Ga0207657_10197947 3300025919 Bacteria 1618
770 Ga0207657_10397457 3300025919 Bacteria 1084
771 Ga0207649_10064511 3300025920 Bacteria 2316
772 Ga0207649_10118129 3300025920 Bacteria 1783
773 Ga0207649_10821628 3300025920 Bacteria 726
774 Ga0207649_10950855 3300025920 Bacteria 675
775 Ga0207649_11090594 3300025920 Bacteria 630
776 Ga0207649_11341592 3300025920 Bacteria 566
777 Ga0207652_10024131 3300025921 Bacteria 5043
778 Ga0207652_10246529 3300025921 Bacteria 1611
779 Ga0207652_10320770 3300025921 Bacteria 1399
780 Ga0207652_10386353 3300025921 Bacteria 1263
781 Ga0207652_10496350 3300025921 Bacteria 1099
782 Ga0207652_10917429 3300025921 Bacteria 773
783 Ga0207646_10125902 3300025922 Bacteria 2304
784 Ga0207681_10267451 3300025923 Bacteria 1341
785 Ga0207694_10006035 3300025924 Bacteria 9269
786 Ga0207694_10006048 3300025924 Bacteria 9261
787 Ga0207694_10065897 3300025924 Bacteria 2824
788 Ga0207694_10115817 3300025924 Bacteria 2136
789 Ga0207694_10327014 3300025924 Bacteria 1266
790 Ga0207694_10367448 3300025924 Bacteria 1193
791 Ga0207694_10368202 3300025924 Bacteria 1192
792 Ga0207694_10542815 3300025924 Bacteria 975
793 Ga0207694_10872541 3300025924 Bacteria 761
794 Ga0207650_10234440 3300025925 Bacteria 1481
795 Ga0207650_10235797 3300025925 Bacteria 1477
796 Ga0207650_11204282 3300025925 Bacteria 645
797 Ga0207659_11005560 3300025926 Unclassified 717
798 Ga0207687_10012230 3300025927 Bacteria 5613
799 Ga0207687_10021889 3300025927 Bacteria 4250
800 Ga0207687_10131674 3300025927 Bacteria 1886
801 Ga0207687_10217544 3300025927 Bacteria 1502
802 Ga0207700_10009751 3300025928 Bacteria 6020
803 Ga0207700_10011770 3300025928 Bacteria 5599
804 Ga0207700_10049679 3300025928 Bacteria 3121
805 Ga0207700_10051142 3300025928 Bacteria 3082
806 Ga0207700_10185656 3300025928 Bacteria 1744
807 Ga0207700_10241277 3300025928 Bacteria 1540
808 Ga0207700_10351058 3300025928 Bacteria 1284
809 Ga0207700_10597748 3300025928 Bacteria 982
810 Ga0207664_10007101 3300025929 Bacteria 7763
811 Ga0207664_10022677 3300025929 Bacteria 4693
812 Ga0207664_10087428 3300025929 Bacteria 2548
813 Ga0207664_10134624 3300025929 Bacteria 2084
814 Ga0207664_10149969 3300025929 Bacteria 1980
815 Ga0207664_10275552 3300025929 Bacteria 1475
816 Ga0207664_10544822 3300025929 Bacteria 1041
817 Ga0207664_10844575 3300025929 Bacteria 823
818 Ga0207644_10266846 3300025931 Bacteria 1370
819 Ga0207644_10272234 3300025931 Bacteria 1357
820 Ga0207644_10432159 3300025931 Bacteria 1080
821 Ga0207690_10064179 3300025932 Bacteria 2506
822 Ga0207690_10289804 3300025932 Bacteria 1277
823 Ga0207690_10345006 3300025932 Bacteria 1176
824 Ga0207690_10433927 3300025932 Bacteria 1053
825 Ga0207690_10773457 3300025932 Bacteria 792
826 Ga0207690_10912330 3300025932 Bacteria 729
827 Ga0207690_11300209 3300025932 Bacteria 608
828 Ga0207706_10153645 3300025933 Bacteria 2024
829 Ga0207706_10790909 3300025933 Bacteria 806
830 Ga0207706_10877776 3300025933 Bacteria 758
831 Ga0207686_10286450 3300025934 Bacteria 1218
832 Ga0207709_10030468 3300025935 Bacteria 3139
833 Ga0207709_10602408 3300025935 Bacteria 870
834 Ga0207669_10246991 3300025937 Bacteria 1326
835 Ga0207669_10446375 3300025937 Bacteria 1024
836 Ga0207704_10078146 3300025938 Bacteria 2127
837 Ga0207704_10291876 3300025938 Bacteria 1245
838 Ga0207704_10401256 3300025938 Bacteria 1082
839 Ga0207704_10656376 3300025938 Bacteria 864
840 Ga0207704_10852122 3300025938 Bacteria 764
841 Ga0207665_10000599 3300025939 Bacteria 24202
842 Ga0207665_10035625 3300025939 Bacteria 3304
843 Ga0207665_10046827 3300025939 Bacteria 2898
844 Ga0207665_10047020 3300025939 Bacteria 2892
845 Ga0207665_10068105 3300025939 Bacteria 2425
846 Ga0207665_10105549 3300025939 Bacteria 1973
847 Ga0207665_10111000 3300025939 Bacteria 1927
848 Ga0207665_10823572 3300025939 Bacteria 734
849 Ga0207691_10122520 3300025940 Bacteria 2303
850 Ga0207691_10177210 3300025940 Bacteria 1864
851 Ga0207691_10298676 3300025940 Bacteria 1384
852 Ga0207691_10623924 3300025940 Bacteria 912
853 Ga0207711_10346297 3300025941 Bacteria 1376
854 Ga0207711_10875131 3300025941 Bacteria 836
855 Ga0207689_10233154 3300025942 Bacteria 1521
856 Ga0207661_10002617 3300025944 Bacteria 12386
857 Ga0207661_10025600 3300025944 Bacteria 4487
858 Ga0207661_10130647 3300025944 Bacteria 2151
859 Ga0207661_10165352 3300025944 Bacteria 1922
860 Ga0207661_10599542 3300025944 Bacteria 1011
861 Ga0207661_10657016 3300025944 Bacteria 964
862 Ga0207661_10997057 3300025944 Bacteria 771
863 Ga0207679_10068954 3300025945 Bacteria 2659
864 Ga0207679_10100174 3300025945 Bacteria 2264
865 Ga0207679_10199990 3300025945 Bacteria 1668
866 Ga0207679_11352960 3300025945 Bacteria 653
867 Ga0207667_10014502 3300025949 Bacteria 8982
868 Ga0207667_10017009 3300025949 Bacteria 8203
869 Ga0207667_10029597 3300025949 Bacteria 5937
870 Ga0207667_10067337 3300025949 Bacteria 3731
871 Ga0207667_10073787 3300025949 Bacteria 3545
872 Ga0207667_10182115 3300025949 Bacteria 2157
873 Ga0207667_10676811 3300025949 Bacteria 1035
874 Ga0207667_11231075 3300025949 Bacteria 727
875 Ga0207667_12090430 3300025949 Bacteria 525
876 Ga0207651_10173282 3300025960 Bacteria 1704
877 Ga0207651_10203658 3300025960 Bacteria 1588
878 Ga0207651_11153172 3300025960 Bacteria 695
879 Ga0207712_10228663 3300025961 Bacteria 1492
880 Ga0207668_10015515 3300025972 Bacteria 4735
881 Ga0207668_10080550 3300025972 Bacteria 2359
882 Ga0207668_10198552 3300025972 Bacteria 1595
883 Ga0207668_10501633 3300025972 Bacteria 1044
884 Ga0207668_10732328 3300025972 Bacteria 871
885 Ga0207668_11314937 3300025972 Bacteria 651
886 Ga0207640_10029313 3300025981 Bacteria 3377
887 Ga0207640_10061609 3300025981 Bacteria 2486
888 Ga0207640_10109097 3300025981 Bacteria 1957
889 Ga0207640_10403724 3300025981 Bacteria 1113
890 Ga0207640_10739273 3300025981 Bacteria 847
891 Ga0207640_11210897 3300025981 Bacteria 672
892 Ga0207640_11475756 3300025981 Bacteria 611
893 Ga0207658_10513817 3300025986 Bacteria 1068
894 Ga0207658_10617486 3300025986 Bacteria 975
895 Ga0207658_11089795 3300025986 Bacteria 729
896 Ga0207677_10047819 3300026023 Bacteria 2875
897 Ga0207703_10198361 3300026035 Bacteria 1782
898 Ga0207703_10269403 3300026035 Bacteria 1542
899 Ga0207703_10297970 3300026035 Bacteria 1470
900 Ga0207703_10326111 3300026035 Bacteria 1407
901 Ga0207703_10442196 3300026035 Bacteria 1213
902 Ga0207703_10572128 3300026035 Bacteria 1067
903 Ga0207703_10626883 3300026035 Bacteria 1019
904 Ga0207703_11176248 3300026035 Bacteria 737
905 Ga0207639_10004901 3300026041 Bacteria 9019
906 Ga0207639_10024817 3300026041 Bacteria 4343
907 Ga0207639_10183748 3300026041 Bacteria 1780
908 Ga0207639_10186737 3300026041 Bacteria 1768
909 Ga0207639_10195779 3300026041 Bacteria 1730
910 Ga0207639_10208824 3300026041 Bacteria 1679
911 Ga0207639_10265470 3300026041 Bacteria 1503
912 Ga0207639_10294469 3300026041 Bacteria 1432
913 Ga0207639_10327360 3300026041 Bacteria 1362
914 Ga0207639_10373388 3300026041 Bacteria 1279
915 Ga0207639_10433935 3300026041 Bacteria 1190
916 Ga0207639_12082108 3300026041 Bacteria 529
917 Ga0207678_10012527 3300026067 Bacteria 7448
918 Ga0207678_10014132 3300026067 Bacteria 7021
919 Ga0207678_10032590 3300026067 Bacteria 4541
920 Ga0207678_10081013 3300026067 Bacteria 2779
921 Ga0207678_10083001 3300026067 Bacteria 2741
922 Ga0207678_10106353 3300026067 Bacteria 2394
923 Ga0207678_10117469 3300026067 Bacteria 2270
924 Ga0207678_10171515 3300026067 Bacteria 1852
925 Ga0207678_10185698 3300026067 Bacteria 1776
926 Ga0207678_10446778 3300026067 Bacteria 1123
927 Ga0207678_10456103 3300026067 Bacteria 1112
928 Ga0207678_10600305 3300026067 Bacteria 965
929 Ga0207678_11026518 3300026067 Bacteria 730
930 Ga0207678_11909813 3300026067 Bacteria 518
931 Ga0207708_10511768 3300026075 Bacteria 1007
932 Ga0207702_10000005 3300026078 Bacteria 420296
933 Ga0207702_10000178 3300026078 Bacteria 76683
934 Ga0207702_10036144 3300026078 Bacteria 4131
935 Ga0207702_10333491 3300026078 Bacteria 1447
936 Ga0207702_10510395 3300026078 Bacteria 1173
937 Ga0207702_10686072 3300026078 Bacteria 1009
938 Ga0207702_11075239 3300026078 Bacteria 798
939 Ga0207641_10227760 3300026088 Bacteria 1731
940 Ga0207641_10445629 3300026088 Bacteria 1250
941 Ga0207648_10077463 3300026089 Bacteria 2898
942 Ga0207648_10149673 3300026089 Bacteria 2059
943 Ga0207676_10262458 3300026095 Bacteria 1560
944 Ga0207676_10882846 3300026095 Bacteria 876
945 Ga0207676_12072790 3300026095 Bacteria 567
946 Ga0207674_10003061 3300026116 Bacteria 20686
947 Ga0207674_10003961 3300026116 Bacteria 18004
948 Ga0207674_10065228 3300026116 Bacteria 3671
949 Ga0207674_10076098 3300026116 Bacteria 3365
950 Ga0207674_10187603 3300026116 Bacteria 2018
951 Ga0207674_10261764 3300026116 Bacteria 1677
952 Ga0207674_10272814 3300026116 Bacteria 1639
953 Ga0207674_10865349 3300026116 Bacteria 871
954 Ga0207675_100101779 3300026118 Bacteria 2706
955 Ga0207675_100170360 3300026118 Bacteria 2081
956 Ga0207675_101703807 3300026118 Bacteria 650
957 Ga0207683_10652481 3300026121 Bacteria 975
958 Ga0207683_10677189 3300026121 Bacteria 956
959 Ga0207698_10058336 3300026142 Bacteria 2991
960 Ga0207698_10078822 3300026142 Bacteria 2647
961 Ga0207698_10121520 3300026142 Bacteria 2212
962 Ga0207698_10156621 3300026142 Bacteria 1986
963 Ga0207698_10217461 3300026142 Bacteria 1724
964 Ga0207698_10261825 3300026142 Bacteria 1589
965 Ga0207698_10400699 3300026142 Bacteria 1311
966 Ga0207698_10453763 3300026142 Bacteria 1238
967 Ga0207698_10622319 3300026142 Bacteria 1066
968 Ga0207698_10908281 3300026142 Bacteria 888
969 Ga0207698_11827463 3300026142 Bacteria 623
970 Ga0209389_1000068 3300027296 Bacteria 98954
971 Ga0209389_1000084 3300027296 Bacteria 85267
972 Ga0209589_1000023 3300027357 Bacteria 177856
973 Ga0209589_1000041 3300027357 Bacteria 125191
974 Ga0209489_100032 3300027361 Bacteria 177856
975 Ga0209489_100070 3300027361 Bacteria 138580
976 Ga0209489_112017 3300027361 Bacteria 8292
977 Ga0209700_100040 3300027363 Bacteria 177856
978 Ga0209700_100117 3300027363 Bacteria 115595
979 Ga0209588_1080778 3300027671 Bacteria 1050
980 Ga0209588_1117098 3300027671 Bacteria 854
981 Ga0209813_10027793 3300027866 Bacteria 1645
982 Ga0209813_10176852 3300027866 Bacteria 778
983 Ga0209813_10328433 3300027866 Bacteria 601
984 Ga0207428_10317948 3300027907 Bacteria 1150
985 Ga0268266_10001654 3300028379 Bacteria 25772
986 Ga0268266_10009378 3300028379 Bacteria 8623
987 Ga0268266_10024146 3300028379 Bacteria 5172
988 Ga0268266_10069646 3300028379 Bacteria 3048
989 Ga0268266_10138604 3300028379 Bacteria 2181
990 Ga0268266_10189384 3300028379 Bacteria 1877
991 Ga0268266_10413560 3300028379 Bacteria 1277
992 Ga0268266_10691801 3300028379 Bacteria 982
993 Ga0268266_11610586 3300028379 Bacteria 625
994 Ga0268265_10117782 3300028380 Bacteria 2182
995 Ga0268265_10376456 3300028380 Bacteria 1304
996 Ga0268265_10862766 3300028380 Bacteria 886
997 Ga0268264_10000084 3300028381 Bacteria 242128
998 Ga0268264_10234291 3300028381 Bacteria 1697
999 Ga0268264_10611746 3300028381 Bacteria 1075
1000 Ga0268264_11766342 3300028381 Bacteria 629
1001 Ga0265337_1021408 3300028556 Bacteria 2015
1002 Ga0265319_1000011 3300028563 Bacteria 184643
1003 Ga0265319_1003723 3300028563 Bacteria 7836
1004 Ga0265334_10032009 3300028573 Bacteria 2099
1005 Ga0265334_10043272 3300028573 Bacteria 1752
1006 Ga0265318_10000644 3300028577 Bacteria 24003
1007 Ga0265318_10005881 3300028577 Bacteria 5709
1008 Ga0265323_10000888 3300028653 Bacteria 15825
1009 Ga0265323_10071926 3300028653 Bacteria 1180
1010 Ga0265322_10034595 3300028654 Bacteria 1439
1011 Ga0307517_10002371 3300028786 Bacteria 30326
1012 Ga0307517_10146591 3300028786 Bacteria 1636
1013 Ga0307515_10034681 3300028794 Bacteria 8245
1014 Ga0307515_10058853 3300028794 Bacteria 5523
1015 Ga0307515_10279161 3300028794 Bacteria 1380
1016 Ga0265338_10000393 3300028800 Bacteria 78303
1017 Ga0265338_10104195 3300028800 Bacteria 2302
1018 Ga0307511_10055045 3300030521 Bacteria 3128
1019 Ga0307511_10121856 3300030521 Bacteria 1609
1020 Ga0265330_10014199 3300031235 Bacteria 3698
1021 Ga0265330_10149425 3300031235 Bacteria 993
1022 Ga0265330_10226731 3300031235 Bacteria 788
1023 Ga0265332_10028102 3300031238 Bacteria 2463
1024 Ga0265332_10045590 3300031238 Bacteria 1889
1025 Ga0265332_10074705 3300031238 Bacteria 1441
1026 Ga0265320_10002704 3300031240 Bacteria 12263
1027 Ga0265320_10089465 3300031240 Bacteria 1427
1028 Ga0265320_10168509 3300031240 Archaea 984
1029 Ga0265325_10006325 3300031241 Bacteria 7201
1030 Ga0265325_10049142 3300031241 Bacteria 2178
1031 Ga0265325_10075117 3300031241 Bacteria 1688
1032 Ga0265329_10262860 3300031242 Bacteria 577
1033 Ga0265340_10000375 3300031247 Bacteria 23722
1034 Ga0265340_10283764 3300031247 Bacteria 735
1035 Ga0265339_10013801 3300031249 Bacteria 4889
1036 Ga0265339_10021265 3300031249 Bacteria 3778
1037 Ga0265339_10024964 3300031249 Bacteria 3437
1038 Ga0265339_10151347 3300031249 Bacteria 1173
1039 Ga0265339_10188685 3300031249 Bacteria 1023
1040 Ga0265331_10011501 3300031250 Bacteria 4844
1041 Ga0265331_10044481 3300031250 Bacteria 2147
1042 Ga0265331_10045751 3300031250 Bacteria 2112
1043 Ga0265331_10131531 3300031250 Bacteria 1141
1044 Ga0265327_10000857 3300031251 Bacteria 45481
1045 Ga0265316_10042914 3300031344 Bacteria 3610
1046 Ga0265316_10198430 3300031344 Bacteria 1488
1047 Ga0265316_10832197 3300031344 Bacteria 646
1048 Ga0307513_10422181 3300031456 Bacteria 1063
1049 Ga0307513_10704884 3300031456 Bacteria 715
1050 Ga0307509_10063581 3300031507 Bacteria 3884
1051 Ga0307509_10067920 3300031507 Bacteria 3731
1052 Ga0307509_10229416 3300031507 Bacteria 1661
1053 Ga0307509_10681187 3300031507 Bacteria 695
1054 Ga0265313_10000981 3300031595 Bacteria 28118
1055 Ga0265313_10009741 3300031595 Bacteria 6193
1056 Ga0265313_10019957 3300031595 Bacteria 3712
1057 Ga0265313_10027023 3300031595 Bacteria 3011
1058 Ga0307508_10000010 3300031616 Bacteria 255747
1059 Ga0307508_10015791 3300031616 Bacteria 6879
1060 Ga0307508_10049041 3300031616 Bacteria 3761
1061 Ga0307508_10069397 3300031616 Bacteria 3096
1062 Ga0307508_10314859 3300031616 Bacteria 1157
1063 Ga0307508_10499013 3300031616 Bacteria 812
1064 Ga0265314_10001831 3300031711 Bacteria 22853
1065 Ga0265314_10022986 3300031711 Bacteria 4766
1066 Ga0265314_10033044 3300031711 Bacteria 3799
1067 Ga0265314_10076159 3300031711 Bacteria 2230
1068 Ga0265314_10325488 3300031711 Bacteria 854
1069 Ga0265314_10495211 3300031711 Bacteria 644
1070 Ga0265342_10085535 3300031712 Bacteria 1815
1071 Ga0265342_10102951 3300031712 Bacteria 1624
1072 Ga0265342_10142427 3300031712 Bacteria 1337
1073 Ga0265342_10192018 3300031712 Bacteria 1114
1074 Ga0265342_10195105 3300031712 Bacteria 1103
1075 Ga0265342_10203178 3300031712 Bacteria 1075
1076 Ga0307516_10029618 3300031730 Bacteria 5533
1077 Ga0307516_10062049 3300031730 Bacteria 3623
1078 Ga0307516_10067559 3300031730 Bacteria 3444
1079 Ga0307516_10237670 3300031730 Bacteria 1522
1080 Ga0307405_10222250 3300031731 Bacteria 1386
1081 Ga0307405_10290841 3300031731 Bacteria 1235
1082 Ga0307405_11624264 3300031731 Bacteria 571
1083 Ga0307413_10018209 3300031824 Bacteria 3678
1084 Ga0307413_10040611 3300031824 Bacteria 2716
1085 Ga0307410_10120038 3300031852 Bacteria 1916
1086 Ga0307406_10645453 3300031901 Bacteria 878
1087 Ga0307407_10179150 3300031903 Bacteria 1403
1088 Ga0307412_10059011 3300031911 Bacteria 2570
1089 Ga0307412_10134559 3300031911 Bacteria 1801
1090 Ga0307412_10361412 3300031911 Bacteria 1169
1091 Ga0307412_10416293 3300031911 Bacteria 1098
1092 Ga0307412_11074958 3300031911 Bacteria 715
1093 Ga0307409_100177343 3300031995 Bacteria 1882
1094 Ga0307416_100296414 3300032002 Bacteria 1604
1095 Ga0307416_100412886 3300032002 Bacteria 1391
1096 Ga0307414_10988994 3300032004 Bacteria 774
1097 Ga0307411_10019121 3300032005 Bacteria 3948
1098 Ga0307411_10595015 3300032005 Bacteria 950
1099 Ga0307415_100252660 3300032126 Bacteria 1433
1100 Ga0307507_10060806 3300033179 Bacteria 3523
1101 Ga0307507_10437126 3300033179 Bacteria 728
1102 Ga0307510_10021245 3300033180 Bacteria 7565
1103 Ga0307510_10021433 3300033180 Bacteria 7529
1104 Ga0307510_10039573 3300033180 Bacteria 5191
1105 Ga0307510_10302690 3300033180 Bacteria 1060
1106 Ga0307510_10316765 3300033180 Bacteria 1018
1107 Ga0307510_10476261 3300033180 Bacteria 690
1108 Ga0315911_1000029 3300033442 Bacteria 82350
1109 Ga0316215_1000403 3300033544 Bacteria 5173
1110 Ga0373948_0103886 3300034817 Bacteria 672
1111 Ga0373948_0156167 3300034817 Bacteria 573
1112 Ga0373959_0163611 3300034820 Bacteria 570
1113 Ga0373938_0101821 3300034957 Bacteria 722
1114 Ga0373926_0108193 3300035083 Bacteria 1043
1115 Ga0373926_0432178 3300035083 Bacteria 522
1116 Ga0373928_0146741 3300035084 Bacteria 650
1117 Ga0373934_0002259 3300035086 Bacteria 7082
1118 Ga0373934_0020962 3300035086 Bacteria 2516
1119 Ga0373923_0000561 3300035111 Bacteria 9120
1120 Ga0373923_0014792 3300035111 Bacteria 2937
1121 Ga0373923_0017215 3300035111 Bacteria 2761
1122 Ga0373923_0277172 3300035111 Bacteria 790
1123 Ga0373932_0009540 3300035112 Bacteria 2334
1124 Ga0373936_0029212 3300035113 Bacteria 2169
1125 Ga0373936_0104757 3300035113 Bacteria 1196
1126 Ga0373936_0174349 3300035113 Bacteria 941
1127 Ga0373936_0233136 3300035113 Bacteria 819
1128 Ga0373936_0429643 3300035113 Bacteria 609
1129 Ga0373936_0512463 3300035113 Bacteria 558
1130 Ga0373939_0509378 3300035114 Bacteria 515
1131 Ga0373941_0274847 3300035115 Bacteria 665
1132 Ga0373945_0014548 3300035116 Bacteria 2638
1133 Ga0373945_0044659 3300035116 Bacteria 1612
1134 Ga0373953_0000340 3300035117 Bacteria 12574
1135 Ga0373953_0014343 3300035117 Bacteria 2848
1136 Ga0373953_0025571 3300035117 Bacteria 2256
1137 Ga0373953_0128717 3300035117 Bacteria 1079
1138 Ga0373954_0000273 3300035118 Bacteria 18782
1139 Ga0373954_0022014 3300035118 Bacteria 2890
1140 Ga0373956_0004613 3300035119 Bacteria 5507
1141 Ga0373956_0061028 3300035119 Bacteria 1708
1142 Ga0373957_0000313 3300035120 Bacteria 12192
1143 Ga0373960_0150347 3300035121 Bacteria 795
1144 Ga0373943_0006607 3300035170 Bacteria 5199
1145 Ga0373943_0034556 3300035170 Bacteria 2412
1146 Ga0373943_0254303 3300035170 Bacteria 987
1147 Ga0373943_0351345 3300035170 Bacteria 845
1148 Ga0373946_0005143 3300035171 Bacteria 4716
1149 Ga0373946_0103307 3300035171 Bacteria 1280
1150 Ga0373946_0757409 3300035171 Bacteria 510
1151 Ga0373955_0004906 3300035172 Bacteria 5968
1152 Ga0373955_0025672 3300035172 Bacteria 3028
1153 Ga0373955_0039892 3300035172 Bacteria 2508
1154 Ga0373955_0074860 3300035172 Bacteria 1901
1155 Ga0373955_0336986 3300035172 Bacteria 912
1156 Ga0373924_0001394 3300035410 Bacteria 7816
1157 Ga0373924_0029309 3300035410 Bacteria 2199
1158 Ga0373931_0044474 3300035691 Bacteria 2342
1159 Ga0373931_0056831 3300035691 Bacteria 2097
1160 Ga0373931_0339246 3300035691 Bacteria 938
1161 Ga0373935_0011114 3300035692 Bacteria 5405
1162 Ga0373935_0024222 3300035692 Bacteria 3734
1163 Ga0373935_0285829 3300035692 Bacteria 1162
1164 Ga0373935_0522334 3300035692 Bacteria 863
1165 Ga0373935_0616997 3300035692 Bacteria 794
1166 Ga0373935_0874635 3300035692 Bacteria 665
1167 Ga0373927_0002786 3300035695 Bacteria 12762
1168 Ga0373927_0006180 3300035695 Bacteria 8182
1169 Ga0373927_0006968 3300035695 Bacteria 7672
1170 Ga0373927_0023230 3300035695 Bacteria 4062
1171 Ga0373927_0052838 3300035695 Bacteria 2627
1172 Ga0373927_0071356 3300035695 Bacteria 2248
1173 Ga0373927_0197082 3300035695 Bacteria 1321
1174 Ga0373933_0000233 3300035724 Bacteria 36745
1175 Ga0373933_0008689 3300035724 Bacteria 5538
1176 Ga0373933_0092097 3300035724 Bacteria 1872
1177 Ga0373933_0097269 3300035724 Bacteria 1823
1178 Ga0373933_0337220 3300035724 Bacteria 978
1179 Ga0373933_0611116 3300035724 Bacteria 716
1180 Ga0373933_0812037 3300035724 Bacteria 615
1181 Ga0373947_0000940 3300035725 Bacteria 17726
1182 Ga0373947_0024083 3300035725 Bacteria 3545
1183 Ga0373947_0089334 3300035725 Bacteria 1919
1184 Ga0373947_0135697 3300035725 Bacteria 1574
1185 Ga0373937_0006956 3300036401 Bacteria 9765
1186 Ga0373937_0015620 3300036401 Bacteria 6721
1187 Ga0373937_0131867 3300036401 Bacteria 2334
1188 Ga0373937_0359182 3300036401 Bacteria 1380
1189 Ga0373937_0393596 3300036401 Bacteria 1314
1190 Ga0373937_0444573 3300036401 Bacteria 1231
1191 Ga0373937_0599886 3300036401 Bacteria 1045
1192 Ga0373937_0672085 3300036401 Bacteria 982
1193 Ga0372808_015907 3300036459 Bacteria 1077
1194 Ga0373925_0001317 3300037068 Bacteria 21738
1195 Ga0373925_0011166 3300037068 Bacteria 6516
1196 Ga0373925_0113451 3300037068 Bacteria 2096
1197 Ga0373925_0160866 3300037068 Bacteria 1768
1198 Ga0373925_0164171 3300037068 Bacteria 1751
1199 Ga0373925_0900932 3300037068 Bacteria 729
1200 Ga0373925_0924050 3300037068 Bacteria 719
1201 Ga0373925_1116595 3300037068 Bacteria 648
1202 Ga0395899_0683153 3300037312 Bacteria 646
1203 Ga0395900_0004063 3300037418 Bacteria 15603
1204 Ga0395900_0244361 3300037418 Bacteria 1799
1205 Ga0395900_0624335 3300037418 Bacteria 1016
1206 Ga0395900_0691455 3300037418 Bacteria 954
1207 Ga0395900_0723865 3300037418 Bacteria 927
1208 Ga0395900_1391878 3300037418 Bacteria 614
1209 Ga0395898_0005719 3300037466 Bacteria 13397
1210 Ga0395898_0054033 3300037466 Bacteria 3921
1211 Ga0395898_0197051 3300037466 Bacteria 1924
1212 Ga0395898_0698736 3300037466 Bacteria 956
1213 Ga0395905_0002137 3300037471 Bacteria 22424
1214 Ga0395905_0066739 3300037471 Bacteria 3370
1215 Ga0395905_0087702 3300037471 Bacteria 2917
1216 Ga0395905_0990056 3300037471 Bacteria 744
1217 Ga0436364_0251389 3300037853 Bacteria 1741
1218 Ga0436364_0816631 3300037853 Bacteria 5219
1219 Ga0436364_1271423 3300037853 Bacteria 1495
1220 Ga0436364_1386416 3300037853 Bacteria 842
1221 Ga0395901_0004877 3300038443 Bacteria 13542
1222 Ga0395901_0044133 3300038443 Bacteria 4624
1223 Ga0395901_0055512 3300038443 Bacteria 4120
1224 Ga0395901_0212552 3300038443 Bacteria 2024
1225 Ga0395901_0282659 3300038443 Bacteria 1724
1226 Ga0395901_0288954 3300038443 Bacteria 1702
1227 Ga0395901_0291348 3300038443 Bacteria 1694
1228 Ga0395901_0316047 3300038443 Bacteria 1617
1229 Ga0395901_0660491 3300038443 Bacteria 1047
1230 Ga0436365_0053441 3300039437 Bacteria 13599
1231 Ga0436365_0366637 3300039437 Bacteria 1702
1232 Ga0436365_0477401 3300039437 Bacteria 1173
1233 Ga0436365_0617970 3300039437 Bacteria 628
1234 Ga0436365_0699064 3300039437 Bacteria 3405
1235 Ga0436365_0851748 3300039437 Bacteria 789
1236 Ga0436365_1032972 3300039437 Bacteria 638
1237 Ga0436365_1165754 3300039437 Bacteria 992
1238 Ga0436365_1228330 3300039437 Bacteria 4360
1239 Ga0436365_1426474 3300039437 Bacteria 736
1240 Ga0436365_1749876 3300039437 Bacteria 2193
1241 Ga0436365_1752018 3300039437 Bacteria 705
1242 Ga0436365_1820094 3300039437 Bacteria 1349
1243 Ga0436360_0408637 3300039438 Bacteria 2824
1244 Ga0436360_0572514 3300039438 Bacteria 586
1245 Ga0436360_0688532 3300039438 Bacteria 1056
1246 Ga0436360_0811273 3300039438 Bacteria 801
1247 Ga0436361_0171409 3300039447 Bacteria 978
1248 Ga0436361_1046058 3300039447 Bacteria 2976
1249 Ga0436363_0135174 3300039450 Bacteria 601
1250 Ga0436363_0217405 3300039450 Bacteria 797
1251 Ga0436363_0319835 3300039450 Bacteria 972
1252 Ga0436363_0746225 3300039450 Bacteria 4982
1253 Ga0436363_0875311 3300039450 Bacteria 746
1254 Ga0436363_0946020 3300039450 Bacteria 556
1255 Ga0436363_1074758 3300039450 Bacteria 891
1256 Ga0436363_1365439 3300039450 Bacteria 1524
1257 Ga0436363_1366742 3300039450 Bacteria 540
1258 Ga0436363_1611992 3300039450 Bacteria 17096
1259 Ga0436362_0544026 3300039453 Bacteria 2129
1260 Ga0436362_0548637 3300039453 Bacteria 2897
1261 Ga0436362_0790264 3300039453 Bacteria 2303
1262 Ga0436362_1262541 3300039453 Bacteria 783
1263 Ga0439465_0041673 3300041413 Bacteria 1487
1264 Ga0439465_0054760 3300041413 Bacteria 1312
1265 Ga0451789_0230772 3300041443 Bacteria 1331
1266 Ga0451789_0402674 3300041443 Bacteria 771
1267 Ga0451789_0611428 3300041443 Bacteria 534
1268 Ga0451791_1870027 3300041451 Bacteria 616
1269 Ga0451793_0668218 3300041452 Bacteria 1196
1270 Ga0451793_1536712 3300041452 Bacteria 538
1271 Ga0451793_1783197 3300041452 Bacteria 532
1272 Ga0451795_1029353 3300041456 Bacteria 1414
1273 Ga0451798_0803659 3300041458 Bacteria 1110
1274 Ga0451798_1034226 3300041458 Bacteria 617
1275 Ga0451800_0363129 3300041459 Bacteria 567
1276 Ga0451800_0740065 3300041459 Bacteria 939
1277 Ga0451800_1192641 3300041459 Bacteria 778
1278 Ga0451802_1259343 3300041460 Bacteria 727
1279 Ga0451833_0331726 3300041491 Bacteria 669
1280 Ga0451833_1352085 3300041491 Bacteria 752
1281 Ga0451837_0719031 3300041494 Bacteria 1058
1282 Ga0451841_1363010 3300041498 Bacteria 1025
1283 Ga0451843_1467134 3300041509 Bacteria 787
1284 Ga0451853_0930264 3300041512 Bacteria 591
1285 Ga0451853_3829445 3300041512 Bacteria 733
1286 Ga0439445_0089365 3300042004 Bacteria 867
1287 Ga0439446_0128271 3300042156 Bacteria 821
1288 Ga0439446_0254257 3300042156 Bacteria 607
1289 Ga0439458_0181150 3300042157 Bacteria 572
1290 Ga0451577_0220266 3300042876 Bacteria 1715
1291 Ga0439440_0227023 3300042993 Bacteria 562
1292 Ga0466969_0020776 3300044656 Bacteria 3398
1293 Ga0466969_0174098 3300044656 Bacteria 986
1294 Ga0466969_0445780 3300044656 Bacteria 589
1295 Ga0466972_0000076 3300044658 Bacteria 92672
1296 Ga0466972_0003652 3300044658 Bacteria 7646
1297 Ga0466972_0094783 3300044658 Bacteria 1414
1298 Ga0466965_0007555 3300044683 Bacteria 5000
1299 Ga0466965_0274675 3300044683 Bacteria 909
1300 Ga0466966_0001943 3300044684 Bacteria 13385
1301 Ga0466966_0237232 3300044684 Bacteria 1100
1302 Ga0466961_0000064 3300044693 Bacteria 63553
1303 Ga0466961_0105519 3300044693 Bacteria 1774
1304 Ga0466963_0061280 3300044694 Bacteria 2515
1305 Ga0466963_0156547 3300044694 Bacteria 1584
1306 Ga0466963_0240585 3300044694 Bacteria 1269
1307 Ga0466963_0372574 3300044694 Bacteria 1006
1308 Ga0466963_1140693 3300044694 Bacteria 548
1309 Ga0453684_0004396 3300044712 Bacteria 29816
1310 Ga0466971_0193676 3300044719 Bacteria 958
1311 Ga0466971_0203401 3300044719 Bacteria 935
1312 Ga0466968_0418709 3300044735 Bacteria 659
1313 Ga0466968_0461810 3300044735 Bacteria 629
1314 Ga0466968_0528593 3300044735 Bacteria 590
1315 Ga0466970_0160387 3300044765 Bacteria 1244
1316 Ga0466970_0362049 3300044765 Bacteria 824
1317 Ga0466970_0618678 3300044765 Bacteria 629
1318 Ga0466957_0087137 3300044842 Bacteria 1952
1319 Ga0466957_0166780 3300044842 Bacteria 1433
1320 Ga0466960_0004142 3300044901 Bacteria 5643
1321 Ga0466960_0593456 3300044901 Bacteria 657
1322 Ga0466959_0004743 3300045049 Bacteria 9159
1323 Ga0466959_0168948 3300045049 Bacteria 1534
1324 Ga0466959_0300152 3300045049 Bacteria 1100
1325 Ga0466959_0932456 3300045049 Bacteria 579
1326 Ga0451576_0097420 3300045051 Bacteria 3059
1327 Ga0451576_0831052 3300045051 Bacteria 970
1328 Ga0466967_0019942 3300045976 Bacteria 5405
1329 Ga0466967_0142729 3300045976 Bacteria 2232
1330 Ga0466967_0321436 3300045976 Bacteria 1492
1331 Ga0466967_0398794 3300045976 Bacteria 1338
1332 Ga0466967_0678945 3300045976 Bacteria 1019
1333 Ga0466967_1456838 3300045976 Bacteria 682
1334 Ga0495617_100574 3300046452 Bacteria 940
1335 Ga0495627_045554 3300046453 Bacteria 1336
1336 Ga0495592_0001404 3300046454 Bacteria 16709
1337 Ga0495592_0080349 3300046454 Bacteria 2359
1338 Ga0495592_0279332 3300046454 Bacteria 1093
1339 Ga0495592_0294120 3300046454 Bacteria 1058
1340 Ga0495592_0441911 3300046454 Bacteria 816
1341 Ga0495592_0677210 3300046454 Bacteria 622
1342 Ga0495603_0005350 3300046455 Bacteria 7655
1343 Ga0495603_0013115 3300046455 Bacteria 5008
1344 Ga0495603_0024150 3300046455 Bacteria 3676
1345 Ga0495603_0039990 3300046455 Bacteria 2808
1346 Ga0495603_0047309 3300046455 Bacteria 2562
1347 Ga0495603_0249264 3300046455 Bacteria 1022
1348 Ga0495603_0533656 3300046455 Bacteria 672
1349 Ga0495590_0059656 3300046457 Bacteria 1335
1350 Ga0495629_0000581 3300046459 Bacteria 29697
1351 Ga0495629_0004968 3300046459 Bacteria 9975
1352 Ga0495629_0009943 3300046459 Bacteria 6942
1353 Ga0495629_0036812 3300046459 Bacteria 3452
1354 Ga0495629_0283531 3300046459 Bacteria 1136
1355 Ga0495629_0583427 3300046459 Bacteria 749
1356 Ga0495638_0018446 3300046460 Bacteria 4633
1357 Ga0495638_0087360 3300046460 Bacteria 1883
1358 Ga0495638_0101550 3300046460 Bacteria 1719
1359 Ga0495638_0219165 3300046460 Bacteria 1064
1360 Ga0495638_0420549 3300046460 Bacteria 689
1361 Ga0495638_0480138 3300046460 Bacteria 630
1362 Ga0495641_0013094 3300046461 Bacteria 4584
1363 Ga0495641_0178369 3300046461 Bacteria 951
1364 Ga0495641_0263404 3300046461 Bacteria 776
1365 Ga0495651_0004932 3300046462 Bacteria 10203
1366 Ga0495651_0030346 3300046462 Bacteria 4216
1367 Ga0495651_0036001 3300046462 Bacteria 3852
1368 Ga0495651_0050639 3300046462 Bacteria 3203
1369 Ga0495651_0131193 3300046462 Bacteria 1829
1370 Ga0495651_0268148 3300046462 Bacteria 1159
1371 Ga0495653_0002259 3300046463 Bacteria 15242
1372 Ga0495653_0105748 3300046463 Bacteria 2031
1373 Ga0495653_0234789 3300046463 Bacteria 1225
1374 Ga0495653_0848284 3300046463 Bacteria 547
1375 Ga0495580_0007623 3300046472 Bacteria 8686
1376 Ga0495580_0092201 3300046472 Bacteria 2108
1377 Ga0495580_0105978 3300046472 Bacteria 1953
1378 Ga0495582_0000528 3300046473 Bacteria 21108
1379 Ga0495582_0068186 3300046473 Bacteria 1966
1380 Ga0495582_0181098 3300046473 Bacteria 1201
1381 Ga0495582_0288301 3300046473 Bacteria 943
1382 Ga0495605_0054016 3300046474 Bacteria 1947
1383 Ga0495605_0456981 3300046474 Bacteria 525
1384 Ga0495639_0000044 3300046475 Bacteria 55019
1385 Ga0495639_0076142 3300046475 Bacteria 1556
1386 Ga0495639_0118157 3300046475 Bacteria 1263
1387 Ga0495639_0284751 3300046475 Bacteria 822
1388 Ga0495639_0466547 3300046475 Bacteria 642
1389 Ga0495662_0001271 3300046476 Bacteria 12462
1390 Ga0495662_0032632 3300046476 Bacteria 2516
1391 Ga0495662_0118733 3300046476 Bacteria 1297
1392 Ga0495664_0019573 3300046477 Bacteria 3894
1393 Ga0495664_0047749 3300046477 Bacteria 2541
1394 Ga0495664_0179487 3300046477 Bacteria 1284
1395 Ga0495664_0263714 3300046477 Bacteria 1041
1396 Ga0495664_0550469 3300046477 Bacteria 687
1397 Ga0495664_0747938 3300046477 Bacteria 576
1398 Ga0495585_0039459 3300046492 Bacteria 2654
1399 Ga0495594_0000351 3300046499 Bacteria 23112
1400 Ga0495594_0183369 3300046499 Bacteria 1192
1401 Ga0495594_0512978 3300046499 Bacteria 681
1402 Ga0495594_0543995 3300046499 Bacteria 659
1403 Ga0495596_0095385 3300046500 Bacteria 1155
1404 Ga0495596_0304914 3300046500 Bacteria 619
1405 Ga0495607_0097614 3300046501 Bacteria 1579
1406 Ga0495607_0269178 3300046501 Bacteria 813
1407 Ga0495583_0039267 3300046506 Bacteria 2231
1408 Ga0495583_0097943 3300046506 Bacteria 1254
1409 Ga0495583_0159294 3300046506 Bacteria 932
1410 Ga0495606_0001746 3300046507 Bacteria 27897
1411 Ga0495606_0017947 3300046507 Bacteria 5324
1412 Ga0495606_0193825 3300046507 Bacteria 1163
1413 Ga0495606_0215647 3300046507 Bacteria 1084
1414 Ga0495608_0002317 3300046511 Bacteria 13740
1415 Ga0495608_0090284 3300046511 Bacteria 1982
1416 Ga0495608_0092481 3300046511 Bacteria 1955
1417 Ga0495608_0271112 3300046511 Bacteria 1055
1418 Ga0495610_0052636 3300046512 Bacteria 1975
1419 Ga0495610_0104961 3300046512 Bacteria 1260
1420 Ga0495610_0113739 3300046512 Bacteria 1195
1421 Ga0495616_0041788 3300046513 Bacteria 2337
1422 Ga0495616_0233405 3300046513 Bacteria 796
1423 Ga0495616_0247472 3300046513 Bacteria 767
1424 Ga0495616_0269433 3300046513 Bacteria 726
1425 Ga0495618_0022887 3300046514 Bacteria 3861
1426 Ga0495618_0279544 3300046514 Bacteria 1041
1427 Ga0495620_0019477 3300046515 Bacteria 3336
1428 Ga0495620_0045056 3300046515 Bacteria 1913
1429 Ga0495620_0186269 3300046515 Bacteria 801
1430 Ga0495620_0245605 3300046515 Bacteria 683
1431 Ga0495628_0033623 3300046516 Bacteria 4130
1432 Ga0495628_0035135 3300046516 Bacteria 4029
1433 Ga0495628_0054533 3300046516 Bacteria 3151
1434 Ga0495628_0064513 3300046516 Bacteria 2867
1435 Ga0495628_0367825 3300046516 Bacteria 1055
1436 Ga0495630_0002975 3300046517 Bacteria 11767
1437 Ga0495630_0011390 3300046517 Bacteria 6440
1438 Ga0495630_0136386 3300046517 Bacteria 1865
1439 Ga0495630_0183448 3300046517 Bacteria 1596
1440 Ga0495630_0572742 3300046517 Bacteria 866
1441 Ga0495631_0085720 3300046518 Bacteria 1357
1442 Ga0495631_0091271 3300046518 Bacteria 1311
1443 Ga0495631_0157297 3300046518 Bacteria 975
1444 Ga0495631_0373540 3300046518 Bacteria 607
1445 Ga0495632_0088332 3300046519 Bacteria 1472
1446 Ga0495632_0485613 3300046519 Bacteria 534
1447 Ga0495643_0006501 3300046522 Bacteria 7691
1448 Ga0495643_0103119 3300046522 Bacteria 1459
1449 Ga0495643_0104203 3300046522 Bacteria 1450
1450 Ga0495644_0128538 3300046523 Bacteria 965
1451 Ga0495648_0005365 3300046524 Bacteria 10672
1452 Ga0495648_0017254 3300046524 Bacteria 5169
1453 Ga0495648_0055186 3300046524 Bacteria 2396
1454 Ga0495648_0204222 3300046524 Bacteria 987
1455 Ga0495648_0308653 3300046524 Bacteria 738
1456 Ga0495648_0335660 3300046524 Bacteria 695
1457 Ga0495648_0486233 3300046524 Bacteria 532
1458 Ga0495666_0090815 3300046526 Bacteria 1441
1459 Ga0495652_0001396 3300046529 Bacteria 26842
1460 Ga0495652_0035090 3300046529 Bacteria 4366
1461 Ga0495652_0037634 3300046529 Bacteria 4196
1462 Ga0495652_0044737 3300046529 Bacteria 3811
1463 Ga0495652_0063781 3300046529 Bacteria 3101
1464 Ga0495652_0287341 3300046529 Bacteria 1201
1465 Ga0495654_0065122 3300046530 Bacteria 1740
1466 Ga0495665_0000397 3300046531 Bacteria 22124
1467 Ga0495665_0372349 3300046531 Bacteria 726
1468 Ga0495640_0006961 3300046533 Bacteria 8903
1469 Ga0495640_0010991 3300046533 Bacteria 6973
1470 Ga0495640_0033033 3300046533 Bacteria 3680
1471 Ga0495640_0123438 3300046533 Bacteria 1681
1472 Ga0495586_0060480 3300046535 Bacteria 2060
1473 Ga0495586_0352282 3300046535 Bacteria 846
1474 Ga0495586_0421669 3300046535 Bacteria 769
1475 Ga0495587_0007451 3300046536 Bacteria 7085
1476 Ga0495587_0019063 3300046536 Bacteria 4251
1477 Ga0495587_0490789 3300046536 Bacteria 679
1478 Ga0495587_0622639 3300046536 Bacteria 594
1479 Ga0495609_0089763 3300046538 Bacteria 1337
1480 Ga0495609_0281885 3300046538 Bacteria 679
1481 Ga0495597_0058413 3300046542 Bacteria 1686
1482 Ga0495597_0084209 3300046542 Bacteria 1356
1483 Ga0495645_0010661 3300046543 Bacteria 6452
1484 Ga0495645_0012981 3300046543 Bacteria 5881
1485 Ga0495645_0268523 3300046543 Bacteria 1126
1486 Ga0495645_0593043 3300046543 Bacteria 682
1487 Ga0495622_0002861 3300046557 Bacteria 8237
1488 Ga0495622_0029367 3300046557 Bacteria 2569
1489 Ga0495622_0039772 3300046557 Bacteria 2190
1490 Ga0495622_0197799 3300046557 Bacteria 897
1491 Ga0495633_0458469 3300046558 Bacteria 576
1492 Ga0495667_0000359 3300046559 Bacteria 28998
1493 Ga0495667_0012846 3300046559 Bacteria 5673
1494 Ga0495667_0016195 3300046559 Bacteria 5036
1495 Ga0495667_0027184 3300046559 Bacteria 3857
1496 Ga0495667_0034954 3300046559 Bacteria 3360
1497 Ga0495656_0276047 3300046615 Bacteria 855
1498 Ga0495656_0712694 3300046615 Bacteria 540
1499 Ga0495668_0140978 3300046616 Bacteria 1319
1500 Ga0495668_0203646 3300046616 Bacteria 1083
1501 Ga0495668_0237298 3300046616 Bacteria 998
1502 Ga0495668_0257622 3300046616 Bacteria 955
1503 Ga0495668_0311350 3300046616 Bacteria 863
1504 Ga0495634_0000252 3300046642 Bacteria 50709
1505 Ga0495634_0012038 3300046642 Bacteria 6271
1506 Ga0495634_0037255 3300046642 Bacteria 3324
1507 Ga0495634_0042724 3300046642 Bacteria 3074
1508 Ga0495634_0102185 3300046642 Bacteria 1851
1509 Ga0495634_0618341 3300046642 Bacteria 628
1510 Ga0495634_0690123 3300046642 Bacteria 588
1511 Ga0495611_0490251 3300046648 Bacteria 559
1512 Ga0495625_0044195 3300046660 Bacteria 3226
1513 Ga0495625_0065806 3300046660 Bacteria 2554
1514 Ga0495625_0138709 3300046660 Bacteria 1642
1515 Ga0495625_0181634 3300046660 Bacteria 1398
1516 Ga0495625_0229204 3300046660 Bacteria 1214
1517 Ga0495625_0262168 3300046660 Bacteria 1118
1518 Ga0495635_0000251 3300046663 Bacteria 34185
1519 Ga0495635_0001901 3300046663 Bacteria 14193
1520 Ga0495635_0008104 3300046663 Bacteria 7341
1521 Ga0495635_0071824 3300046663 Bacteria 2372
1522 Ga0495635_0266139 3300046663 Bacteria 1153
1523 Ga0495659_0103049 3300046664 Bacteria 1107
1524 Ga0495661_0118984 3300046665 Bacteria 1461
1525 Ga0495588_0014106 3300046674 Bacteria 3820
1526 Ga0495588_0071522 3300046674 Bacteria 1804
1527 Ga0495588_0075591 3300046674 Bacteria 1755
1528 Ga0495588_0176019 3300046674 Bacteria 1131
1529 Ga0495588_0180839 3300046674 Bacteria 1114
1530 Ga0495588_0184934 3300046674 Bacteria 1101
1531 Ga0495588_0253796 3300046674 Bacteria 927
1532 Ga0495657_0005246 3300046675 Bacteria 10258
1533 Ga0495657_0011549 3300046675 Bacteria 6599
1534 Ga0495657_0141317 3300046675 Bacteria 1500
1535 Ga0495657_0243013 3300046675 Bacteria 1086
1536 Ga0495657_0477862 3300046675 Bacteria 728
1537 Ga0495599_0000305 3300046678 Bacteria 29662
1538 Ga0495599_0037859 3300046678 Bacteria 3030
1539 Ga0495599_0068246 3300046678 Bacteria 2220
1540 Ga0495599_0093045 3300046678 Bacteria 1881
1541 Ga0495599_0143535 3300046678 Bacteria 1480
1542 Ga0495599_0214376 3300046678 Bacteria 1179
1543 Ga0495599_0317246 3300046678 Bacteria 939
1544 Ga0495623_0001012 3300046679 Bacteria 18985
1545 Ga0495623_0050596 3300046679 Bacteria 2631
1546 Ga0495623_0081382 3300046679 Bacteria 2002
1547 Ga0495623_0154631 3300046679 Bacteria 1353
1548 Ga0495623_0358806 3300046679 Bacteria 792
1549 Ga0495646_0003433 3300046680 Bacteria 9851
1550 Ga0495646_0042439 3300046680 Bacteria 2791
1551 Ga0495646_0251568 3300046680 Bacteria 946
1552 Ga0495646_0302609 3300046680 Bacteria 846
1553 Ga0495646_0408043 3300046680 Bacteria 705
1554 Ga0495647_0017212 3300046681 Bacteria 2554
1555 Ga0495647_0027991 3300046681 Bacteria 2075
1556 Ga0495647_0138053 3300046681 Bacteria 1038
1557 Ga0495647_0239070 3300046681 Bacteria 806
1558 Ga0495647_0601426 3300046681 Bacteria 516
1559 Ga0495658_0003848 3300046683 Bacteria 7430
1560 Ga0495658_0068777 3300046683 Bacteria 2051
1561 Ga0495658_0112430 3300046683 Bacteria 1639
1562 Ga0495658_0335494 3300046683 Bacteria 960
1563 Ga0495658_0385587 3300046683 Bacteria 893
1564 Ga0495669_0158637 3300046684 Bacteria 1073
1565 Ga0495669_0372963 3300046684 Bacteria 690
1566 Ga0495613_0002632 3300046689 Bacteria 13497
1567 Ga0495613_0013328 3300046689 Bacteria 6107
1568 Ga0495613_0044713 3300046689 Bacteria 3275
1569 Ga0495613_0048889 3300046689 Bacteria 3122
1570 Ga0495613_0103427 3300046689 Bacteria 2056
1571 Ga0495613_0754219 3300046689 Bacteria 638
1572 Ga0495613_0888606 3300046689 Bacteria 577
1573 Ga0495624_0002748 3300046690 Bacteria 13214
1574 Ga0495624_0076672 3300046690 Bacteria 2074
1575 Ga0495624_0194515 3300046690 Bacteria 1233
1576 Ga0495624_0204673 3300046690 Bacteria 1198
1577 Ga0495624_0529540 3300046690 Bacteria 704
1578 Ga0495624_0612518 3300046690 Bacteria 649
1579 Ga0495670_0014092 3300046691 Bacteria 3934
1580 Ga0495671_0103771 3300046692 Bacteria 1388
1581 Ga0495671_0126491 3300046692 Bacteria 1246
1582 Ga0495671_0223247 3300046692 Bacteria 912
1583 Ga0495671_0282819 3300046692 Bacteria 799
1584 Ga0495671_0353236 3300046692 Bacteria 705
1585 Ga0495671_0613874 3300046692 Bacteria 517
1586 Ga0495649_0009264 3300046694 Bacteria 5866
1587 Ga0495649_0103902 3300046694 Bacteria 1509
1588 Ga0495649_0446892 3300046694 Bacteria 646
1589 Ga0495589_0124133 3300046794 Bacteria 1242
1590 Ga0495589_0180443 3300046794 Bacteria 1001
1591 Ga0495589_0395049 3300046794 Bacteria 635
1592 Ga0495600_0001567 3300046809 Bacteria 12723
1593 Ga0495600_0008054 3300046809 Bacteria 6461
1594 Ga0495600_0012237 3300046809 Bacteria 5360
1595 Ga0495600_0018114 3300046809 Bacteria 4484
1596 Ga0495660_0041676 3300046810 Bacteria 2540
1597 Ga0495581_0049158 3300047315 Bacteria 2435
1598 Ga0495581_0061244 3300047315 Bacteria 2174
1599 Ga0495581_0115934 3300047315 Bacteria 1558
1600 Ga0495581_0409822 3300047315 Bacteria 790
1601 Ga0495581_0915924 3300047315 Bacteria 500
1602 Ga0495604_0033961 3300047317 Bacteria 4036
1603 Ga0495604_0090783 3300047317 Bacteria 2267
1604 Ga0495604_0102849 3300047317 Bacteria 2096
1605 Ga0495604_0161374 3300047317 Bacteria 1583
1606 Ga0495604_0216588 3300047317 Bacteria 1321
1607 Ga0495604_0257059 3300047317 Bacteria 1188
1608 Ga0495604_0950688 3300047317 Bacteria 534
1609 Ga0495636_0058055 3300047318 Bacteria 1631
1610 Ga0495636_0364651 3300047318 Bacteria 683
1611 Ga0495674_0003317 3300047319 Bacteria 15641
1612 Ga0495674_0007739 3300047319 Bacteria 10259
1613 Ga0495674_0012961 3300047319 Bacteria 7848
1614 Ga0495674_0044161 3300047319 Bacteria 3963
1615 Ga0495674_0886555 3300047319 Bacteria 689
1616 Ga0495674_1089561 3300047319 Bacteria 608
1617 Ga0495672_0014574 3300047320 Bacteria 5376
1618 Ga0495672_0066153 3300047320 Bacteria 2063
1619 Ga0495672_0165439 3300047320 Bacteria 1133
1620 Ga0495672_0192332 3300047320 Bacteria 1025
1621 Ga0495676_0039054 3300047321 Bacteria 3936
1622 Ga0495676_0068286 3300047321 Bacteria 2747
1623 Ga0495676_0076567 3300047321 Bacteria 2554
1624 Ga0495676_0262294 3300047321 Bacteria 1175
1625 Ga0495680_0004040 3300047322 Bacteria 14143
1626 Ga0495680_0019046 3300047322 Bacteria 5809
1627 Ga0495680_0106850 3300047322 Bacteria 2079
1628 Ga0495680_0240570 3300047322 Bacteria 1286
1629 Ga0495680_0636717 3300047322 Bacteria 710
1630 Ga0495680_0984395 3300047322 Bacteria 540
1631 Ga0495683_0058912 3300047323 Bacteria 1906
1632 Ga0495683_0132463 3300047323 Bacteria 1174
1633 Ga0495687_011607 3300047443 Bacteria 4722
1634 Ga0495675_0012888 3300047444 Bacteria 5267
1635 Ga0495675_0023093 3300047444 Bacteria 3963
1636 Ga0495675_0054292 3300047444 Bacteria 2542
1637 Ga0495675_0110399 3300047444 Bacteria 1717
1638 Ga0495677_0143480 3300047445 Bacteria 917
1639 Ga0495679_056665 3300047446 Bacteria 1161
1640 Ga0495685_130755 3300047447 Bacteria 821
1641 Ga0495685_185582 3300047447 Bacteria 669
1642 Ga0495685_225661 3300047447 Bacteria 597
1643 Ga0495673_0040488 3300047469 Bacteria 2105
1644 Ga0495673_0082019 3300047469 Bacteria 1334
1645 Ga0495681_0105938 3300047470 Bacteria 1223
1646 Ga0495681_0206626 3300047470 Bacteria 794
1647 Ga0495681_0400319 3300047470 Bacteria 513
1648 Ga0495684_0000297 3300047471 Bacteria 40486
1649 Ga0495684_0005953 3300047471 Bacteria 9473
1650 Ga0495684_0019572 3300047471 Bacteria 5215
1651 Ga0495686_0016003 3300047472 Bacteria 5098
1652 Ga0495686_0123271 3300047472 Bacteria 1542
1653 Ga0495686_0263820 3300047472 Bacteria 963
1654 Ga0495686_0285554 3300047472 Bacteria 916
1655 Ga0495686_0371961 3300047472 Bacteria 773
1656 Ga0495593_0000354 3300047673 Bacteria 25361
1657 Ga0495593_0043458 3300047673 Bacteria 2407
1658 Ga0495593_0087496 3300047673 Bacteria 1606
1659 Ga0495593_0162270 3300047673 Bacteria 1128
1660 Ga0495593_0363411 3300047673 Bacteria 723
1661 Ga0495602_0034391 3300048088 Bacteria 4741
1662 Ga0495602_0099152 3300048088 Bacteria 2395
1663 Ga0495602_0278813 3300048088 Bacteria 1232
1664 Ga0495602_0548042 3300048088 Bacteria 802
1665 Ga0495602_0666540 3300048088 Bacteria 709
1666 Ga0495602_0680201 3300048088 Unclassified 700
1667 Ga0495614_0139805 3300048089 Bacteria 1075
1668 Ga0495614_0256799 3300048089 Bacteria 800
1669 Ga0495615_0079493 3300048090 Bacteria 897
1670 Ga0495626_0041936 3300048091 Bacteria 2152
1671 Ga0495626_0216559 3300048091 Bacteria 779
1672 Ga0496100_0024657 3300048903 Bacteria 3671
1673 Ga0496100_0125463 3300048903 Bacteria 1801
1674 Ga0496100_0183902 3300048903 Bacteria 1513
1675 Ga0496100_0243243 3300048903 Bacteria 1328
1676 Ga0496100_0296491 3300048903 Bacteria 1209
1677 Ga0496100_0320746 3300048903 Bacteria 1164
1678 Ga0496100_0339595 3300048903 Bacteria 1132
1679 Ga0496100_0491981 3300048903 Bacteria 944
1680 Ga0496100_1314038 3300048903 Bacteria 571
1681 Ga0496101_0034221 3300048904 Bacteria 3587
1682 Ga0496101_0062627 3300048904 Bacteria 2705
1683 Ga0496101_0088887 3300048904 Bacteria 2295
1684 Ga0496101_0148200 3300048904 Bacteria 1793
1685 Ga0496101_0317974 3300048904 Bacteria 1221
1686 Ga0496101_0449725 3300048904 Bacteria 1016
1687 Ga0496101_0633784 3300048904 Bacteria 845
1688 Ga0496101_0924817 3300048904 Bacteria 686
1689 Ga0496102_0015262 3300048905 Bacteria 6688
1690 Ga0496102_0018941 3300048905 Bacteria 6056
1691 Ga0496102_0065085 3300048905 Bacteria 3340
1692 Ga0496102_0295647 3300048905 Bacteria 1526
1693 Ga0496102_0634664 3300048905 Bacteria 991
1694 Ga0496102_0684597 3300048905 Bacteria 948
1695 Ga0496102_1009165 3300048905 Bacteria 753
1696 Ga0496102_1063173 3300048905 Bacteria 729
1697 Ga0496102_1720094 3300048905 Bacteria 545
1698 Ga0496103_0002315 3300048906 Bacteria 12044
1699 Ga0496103_0170702 3300048906 Bacteria 1397
1700 Ga0496103_0288535 3300048906 Bacteria 1056
1701 Ga0496104_0006867 3300048907 Bacteria 10035
1702 Ga0496104_0007118 3300048907 Bacteria 9862
1703 Ga0496104_0017685 3300048907 Bacteria 6498
1704 Ga0496104_0205632 3300048907 Bacteria 1880
1705 Ga0496104_0451268 3300048907 Bacteria 1197
1706 Ga0496104_0479950 3300048907 Bacteria 1154
1707 Ga0496104_0571988 3300048907 Bacteria 1040
1708 Ga0496104_0611843 3300048907 Bacteria 999
1709 Ga0496104_0893202 3300048907 Bacteria 794
1710 Ga0496104_1871597 3300048907 Bacteria 502
1711 Ga0496105_0005048 3300048908 Bacteria 9996
1712 Ga0496105_0035621 3300048908 Bacteria 4096
1713 Ga0496105_0059676 3300048908 Bacteria 3147
1714 Ga0496105_0226762 3300048908 Bacteria 1519
1715 Ga0496105_0284591 3300048908 Bacteria 1332
1716 Ga0496105_0466985 3300048908 Bacteria 994
1717 Ga0496105_0980285 3300048908 Bacteria 633
1718 Ga0496106_0001788 3300048909 Bacteria 16065
1719 Ga0496106_0006956 3300048909 Bacteria 8364
1720 Ga0496106_0021810 3300048909 Bacteria 4757
1721 Ga0496106_0059758 3300048909 Bacteria 2888
1722 Ga0496106_0198337 3300048909 Bacteria 1597
1723 Ga0496106_0273578 3300048909 Bacteria 1352
1724 Ga0496106_1165003 3300048909 Bacteria 602
1725 Ga0496107_0007818 3300048910 Bacteria 7380
1726 Ga0496107_0014705 3300048910 Bacteria 5479
1727 Ga0496107_0069230 3300048910 Bacteria 2561
1728 Ga0496107_0272555 3300048910 Bacteria 1260
1729 Ga0496107_0285807 3300048910 Bacteria 1227
1730 Ga0496107_0368757 3300048910 Bacteria 1068
1731 Ga0496107_0383882 3300048910 Bacteria 1045
1732 Ga0496107_0581920 3300048910 Bacteria 828
1733 Ga0496107_0965468 3300048910 Bacteria 619
1734 Ga0496107_1055431 3300048910 Bacteria 588
1735 Ga0496108_0014372 3300048911 Bacteria 6463
1736 Ga0496108_0023799 3300048911 Bacteria 5040
1737 Ga0496108_0025706 3300048911 Bacteria 4854
1738 Ga0496108_0046000 3300048911 Bacteria 3645
1739 Ga0496108_0079832 3300048911 Bacteria 2770
1740 Ga0496108_0183242 3300048911 Bacteria 1814
1741 Ga0496108_0548077 3300048911 Bacteria 1009
1742 Ga0496108_0907035 3300048911 Bacteria 756
1743 Ga0496109_0047618 3300048912 Bacteria 3898
1744 Ga0496109_0064819 3300048912 Bacteria 3344
1745 Ga0496109_0195748 3300048912 Bacteria 1900
1746 Ga0496109_0303227 3300048912 Bacteria 1506
1747 Ga0496109_0592631 3300048912 Bacteria 1044
1748 Ga0496109_0964926 3300048912 Bacteria 790
1749 Ga0496109_1015591 3300048912 Bacteria 767
1750 Ga0496110_0116254 3300048913 Bacteria 2408
1751 Ga0496110_0138822 3300048913 Bacteria 2197
1752 Ga0496110_0139385 3300048913 Bacteria 2192
1753 Ga0496110_0144280 3300048913 Bacteria 2153
1754 Ga0496110_0217522 3300048913 Bacteria 1737
1755 Ga0496110_0221790 3300048913 Bacteria 1719
1756 Ga0496110_0540555 3300048913 Bacteria 1059
1757 Ga0496110_0625498 3300048913 Bacteria 975
1758 Ga0496110_0872393 3300048913 Bacteria 805
1759 Ga0496110_0972444 3300048913 Bacteria 756
1760 Ga0496111_0020492 3300048914 Bacteria 4604
1761 Ga0496111_0058598 3300048914 Bacteria 2788
1762 Ga0496111_0077814 3300048914 Bacteria 2418
1763 Ga0496111_0207524 3300048914 Bacteria 1456
1764 Ga0496112_0000004 3300048915 Bacteria 553294
1765 Ga0496112_0000992 3300048915 Bacteria 20760
1766 Ga0496112_0041288 3300048915 Bacteria 4513
1767 Ga0496112_0048767 3300048915 Bacteria 4150
1768 Ga0496112_0050431 3300048915 Bacteria 4081
1769 Ga0496112_0114958 3300048915 Bacteria 2661
1770 Ga0496112_0129416 3300048915 Bacteria 2495
1771 Ga0496112_0138016 3300048915 Bacteria 2408
1772 Ga0496112_0500186 3300048915 Bacteria 1151
1773 Ga0496112_0810952 3300048915 Bacteria 860
1774 Ga0496113_0008164 3300048916 Bacteria 6801
1775 Ga0496113_0032100 3300048916 Bacteria 3814
1776 Ga0496113_0044880 3300048916 Bacteria 3275
1777 Ga0496113_0055876 3300048916 Bacteria 2961
1778 Ga0496113_0141231 3300048916 Bacteria 1895
1779 Ga0496113_0502529 3300048916 Bacteria 973
1780 Ga0496113_0588593 3300048916 Bacteria 891
1781 Ga0496113_0621191 3300048916 Bacteria 865
1782 Ga0496113_1479201 3300048916 Bacteria 525
1783 Ga0496114_0040398 3300048917 Bacteria 3862
1784 Ga0496114_0330978 3300048917 Bacteria 1346
1785 Ga0496114_0677677 3300048917 Bacteria 905
1786 Ga0496114_0784311 3300048917 Bacteria 831
1787 Ga0496114_0843338 3300048917 Bacteria 796
1788 Ga0496115_0001685 3300048918 Bacteria 15874
1789 Ga0496115_0016380 3300048918 Bacteria 5645
1790 Ga0496115_0047825 3300048918 Bacteria 3421
1791 Ga0496115_0056000 3300048918 Bacteria 3169
1792 Ga0496115_0071610 3300048918 Bacteria 2811
1793 Ga0496115_0071698 3300048918 Bacteria 2810
1794 Ga0496115_0087102 3300048918 Bacteria 2548
1795 Ga0496115_0101329 3300048918 Bacteria 2361
1796 Ga0496115_0157677 3300048918 Bacteria 1875
1797 Ga0496115_0425881 3300048918 Bacteria 1075
1798 Ga0496115_0507683 3300048918 Bacteria 968
1799 Ga0496115_0558440 3300048918 Bacteria 914
1800 Ga0496115_0720370 3300048918 Bacteria 783
1801 Ga0496115_0841788 3300048918 Bacteria 711
1802 Ga0496115_1256248 3300048918 Bacteria 554
1803 Ga0496116_0036024 3300048919 Bacteria 3469
1804 Ga0496116_0075349 3300048919 Bacteria 2118
1805 Ga0496116_0465173 3300048919 Bacteria 537
1806 Ga0496117_0030328 3300048920 Bacteria 4152
1807 Ga0496117_0031757 3300048920 Bacteria 4026
1808 Ga0496117_0089360 3300048920 Bacteria 1990
1809 Ga0496117_0123006 3300048920 Bacteria 1590
1810 Ga0496117_0225583 3300048920 Bacteria 1039
1811 Ga0496117_0312738 3300048920 Bacteria 826
1812 Ga0496117_0324477 3300048920 Bacteria 805
1813 Ga0496117_0511523 3300048920 Bacteria 580
1814 Ga0496117_0605345 3300048920 Bacteria 512
1815 Ga0496118_0027350 3300048921 Bacteria 4829
1816 Ga0496118_0043767 3300048921 Bacteria 3514
1817 Ga0496118_0080928 3300048921 Bacteria 2283
1818 Ga0496118_0082546 3300048921 Bacteria 2251
1819 Ga0496118_0129210 3300048921 Bacteria 1626
1820 Ga0496118_0138934 3300048921 Bacteria 1544
1821 Ga0496118_0197664 3300048921 Bacteria 1195
1822 Ga0496118_0211418 3300048921 Bacteria 1138
1823 Ga0496118_0227677 3300048921 Bacteria 1079
1824 Ga0496118_0252113 3300048921 Bacteria 1002
1825 Ga0496119_0015494 3300048922 Bacteria 5863
1826 Ga0496119_0042832 3300048922 Bacteria 2867
1827 Ga0496119_0055458 3300048922 Bacteria 2407
1828 Ga0496119_0069227 3300048922 Bacteria 2074
1829 Ga0496119_0092306 3300048922 Bacteria 1718
1830 Ga0496119_0108816 3300048922 Bacteria 1542
1831 Ga0496119_0135917 3300048922 Bacteria 1333
1832 Ga0496119_0423108 3300048922 Bacteria 632
1833 Ga0496120_0014690 3300048923 Bacteria 5203
1834 Ga0496120_0041406 3300048923 Bacteria 2699
1835 Ga0496120_0054725 3300048923 Bacteria 2260
1836 Ga0496120_0112549 3300048923 Bacteria 1420
1837 Ga0496120_0144793 3300048923 Bacteria 1202
1838 Ga0496120_0266101 3300048923 Bacteria 798
1839 Ga0496121_0000398 3300048924 Bacteria 87272
1840 Ga0496121_0001547 3300048924 Bacteria 38497
1841 Ga0496121_0002399 3300048924 Bacteria 28716
1842 Ga0496121_0005904 3300048924 Bacteria 15495
1843 Ga0496121_0006918 3300048924 Bacteria 13826
1844 Ga0496121_0009741 3300048924 Bacteria 10988
1845 Ga0496121_0011691 3300048924 Bacteria 9694
1846 Ga0496121_0033107 3300048924 Bacteria 4684
1847 Ga0496121_0084631 3300048924 Bacteria 2499
1848 Ga0496121_0104201 3300048924 Bacteria 2180
1849 Ga0496121_0119583 3300048924 Bacteria 1992
1850 Ga0496121_0120139 3300048924 Bacteria 1986
1851 Ga0496121_0139999 3300048924 Bacteria 1797
1852 Ga0496121_0141466 3300048924 Bacteria 1784
1853 Ga0496121_0164267 3300048924 Bacteria 1620
1854 Ga0496121_0299067 3300048924 Bacteria 1093
1855 Ga0496121_0323603 3300048924 Bacteria 1037
1856 Ga0496121_0426589 3300048924 Bacteria 861
1857 Ga0496121_0435726 3300048924 Bacteria 849
1858 Ga0496121_0691051 3300048924 Bacteria 615
1859 Ga0496122_0048876 3300048925 Bacteria 3247
1860 Ga0496122_0077133 3300048925 Bacteria 2342
1861 Ga0496122_0078660 3300048925 Bacteria 2309
1862 Ga0496122_0223713 3300048925 Bacteria 1077
1863 Ga0496123_0013979 3300048926 Bacteria 6685
1864 Ga0496123_0118152 3300048926 Bacteria 1498
1865 Ga0496123_0318574 3300048926 Bacteria 735
1866 Ga0496124_0000524 3300048927 Bacteria 65208
1867 Ga0496124_0039487 3300048927 Bacteria 4092
1868 Ga0496124_0152547 3300048927 Bacteria 1810
1869 Ga0496124_0193225 3300048927 Bacteria 1555
1870 Ga0496124_0356325 3300048927 Bacteria 1033
1871 Ga0496124_0410233 3300048927 Bacteria 937
1872 Ga0496125_0001028 3300048928 Bacteria 43302
1873 Ga0496125_0004318 3300048928 Bacteria 16505
1874 Ga0496125_0007178 3300048928 Bacteria 11881
1875 Ga0496125_0010814 3300048928 Bacteria 9190
1876 Ga0496125_0091678 3300048928 Bacteria 2275
1877 Ga0496125_0104521 3300048928 Bacteria 2074
1878 Ga0496125_0361713 3300048928 Bacteria 862
1879 Ga0496126_0006093 3300048929 Bacteria 13526
1880 Ga0496126_0007920 3300048929 Bacteria 11553
1881 Ga0496126_0009181 3300048929 Bacteria 10548
1882 Ga0496126_0010766 3300048929 Bacteria 9550
1883 Ga0496126_0034444 3300048929 Bacteria 4756
1884 Ga0496126_0053384 3300048929 Bacteria 3667
1885 Ga0496126_0056433 3300048929 Bacteria 3550
1886 Ga0496126_0061416 3300048929 Bacteria 3375
1887 Ga0496126_0072078 3300048929 Bacteria 3073
1888 Ga0496126_0086405 3300048929 Bacteria 2764
1889 Ga0496126_0143805 3300048929 Bacteria 2050
1890 Ga0496126_0154975 3300048929 Bacteria 1961
1891 Ga0496126_0176293 3300048929 Bacteria 1818
1892 Ga0496126_0185427 3300048929 Bacteria 1764
1893 Ga0496126_0188457 3300048929 Bacteria 1748
1894 Ga0496126_0231536 3300048929 Bacteria 1548
1895 Ga0496126_0347793 3300048929 Bacteria 1213
1896 Ga0496126_0367944 3300048929 Bacteria 1173
1897 Ga0496126_0383151 3300048929 Bacteria 1144
1898 Ga0496126_0490743 3300048929 Bacteria 983
1899 Ga0496126_0523561 3300048929 Bacteria 944
1900 Ga0496126_0535644 3300048929 Bacteria 931
1901 Ga0496126_0654561 3300048929 Bacteria 821
1902 Ga0496126_0694918 3300048929 Bacteria 791
1903 Ga0496126_0815238 3300048929 Bacteria 715
1904 Ga0496126_1012297 3300048929 Bacteria 623
1905 Ga0496126_1383019 3300048929 Bacteria 509
1906 Ga0495682_0041499 3300049460 Bacteria 1686
1907 Ga0495682_0055320 3300049460 Bacteria 1439
1908 Ga0495682_0157234 3300049460 Bacteria 810
1909 Ga0501031_0000139 3300049568 Bacteria 40700
1910 Ga0501031_0004459 3300049568 Bacteria 9082
1911 Ga0501031_0006521 3300049568 Bacteria 7608
1912 Ga0501031_0020185 3300049568 Bacteria 4343
1913 Ga0501031_0038770 3300049568 Bacteria 3109
1914 Ga0501031_0054272 3300049568 Bacteria 2611
1915 Ga0501031_0107443 3300049568 Bacteria 1822
1916 Ga0501031_0285234 3300049568 Bacteria 1071
1917 Ga0501031_0371472 3300049568 Bacteria 925
1918 Ga0501031_0688364 3300049568 Bacteria 656
1919 Ga0501032_0000087 3300049569 Bacteria 79948
1920 Ga0501032_0009703 3300049569 Bacteria 6970
1921 Ga0501032_0010319 3300049569 Bacteria 6738
1922 Ga0501032_0013590 3300049569 Bacteria 5784
1923 Ga0501032_0025970 3300049569 Bacteria 4034
1924 Ga0501032_0043131 3300049569 Bacteria 3056
1925 Ga0501032_0050092 3300049569 Bacteria 2816
1926 Ga0501032_0063322 3300049569 Bacteria 2476
1927 Ga0501032_0110902 3300049569 Bacteria 1815
1928 Ga0501032_0133684 3300049569 Bacteria 1635
1929 Ga0501032_0138774 3300049569 Bacteria 1601
1930 Ga0501032_0175928 3300049569 Bacteria 1402
1931 Ga0501032_0268157 3300049569 Bacteria 1106
1932 Ga0501033_0001881 3300049570 Bacteria 18266
1933 Ga0501033_0002982 3300049570 Bacteria 14135
1934 Ga0501033_0005214 3300049570 Bacteria 10319
1935 Ga0501033_0012118 3300049570 Bacteria 6582
1936 Ga0501033_0029483 3300049570 Bacteria 4123
1937 Ga0501033_0039576 3300049570 Bacteria 3521
1938 Ga0501033_0105341 3300049570 Bacteria 2055
1939 Ga0501033_0183871 3300049570 Bacteria 1497
1940 Ga0501033_0208230 3300049570 Bacteria 1395
1941 Ga0501033_0318378 3300049570 Bacteria 1093
1942 Ga0501033_0433195 3300049570 Bacteria 915
1943 Ga0501033_0544981 3300049570 Bacteria 799
1944 Ga0501033_0756575 3300049570 Bacteria 659
1945 Ga0501034_0000021 3300049571 Bacteria 266023
1946 Ga0501034_0000097 3300049571 Bacteria 161027
1947 Ga0501034_0002259 3300049571 Bacteria 23638
1948 Ga0501034_0011972 3300049571 Bacteria 8965
1949 Ga0501034_0030030 3300049571 Bacteria 5525
1950 Ga0501034_0079578 3300049571 Bacteria 3281
1951 Ga0501034_0094880 3300049571 Bacteria 2979
1952 Ga0501034_0103040 3300049571 Bacteria 2847
1953 Ga0501034_0170662 3300049571 Bacteria 2142
1954 Ga0501034_0284082 3300049571 Bacteria 1594
1955 Ga0501034_0303932 3300049571 Bacteria 1531
1956 Ga0501034_0339070 3300049571 Bacteria 1433
1957 Ga0501034_0341973 3300049571 Bacteria 1426
1958 Ga0501034_0467738 3300049571 Bacteria 1177
1959 Ga0501034_0566404 3300049571 Bacteria 1044
1960 Ga0501034_0883476 3300049571 Bacteria 782
1961 Ga0501036_0000055 3300049572 Bacteria 73738
1962 Ga0501036_0000954 3300049572 Bacteria 21767
1963 Ga0501036_0004827 3300049572 Bacteria 10895
1964 Ga0501036_0022035 3300049572 Bacteria 5358
1965 Ga0501036_0095395 3300049572 Bacteria 2514
1966 Ga0501036_0096182 3300049572 Bacteria 2503
1967 Ga0501036_0106639 3300049572 Bacteria 2369
1968 Ga0501036_0121404 3300049572 Bacteria 2206
1969 Ga0501036_0130765 3300049572 Bacteria 2119
1970 Ga0501036_0298905 3300049572 Bacteria 1346
1971 Ga0501036_0328279 3300049572 Bacteria 1278
1972 Ga0501036_0445011 3300049572 Bacteria 1080
1973 Ga0501036_0484640 3300049572 Bacteria 1029
1974 Ga0501036_0596282 3300049572 Bacteria 917
1975 Ga0501036_0856612 3300049572 Bacteria 747
1976 Ga0501036_1175653 3300049572 Bacteria 625
1977 Ga0501037_0001009 3300049573 Bacteria 20836
1978 Ga0501037_0003385 3300049573 Bacteria 11593
1979 Ga0501037_0008984 3300049573 Bacteria 7319
1980 Ga0501037_0017513 3300049573 Bacteria 5272
1981 Ga0501037_0022801 3300049573 Bacteria 4629
1982 Ga0501037_0045267 3300049573 Bacteria 3230
1983 Ga0501037_0049221 3300049573 Bacteria 3086
1984 Ga0501037_0066672 3300049573 Bacteria 2621
1985 Ga0501037_0087850 3300049573 Bacteria 2250
1986 Ga0501037_0227384 3300049573 Bacteria 1310
1987 Ga0501037_0489104 3300049573 Bacteria 836
1988 Ga0501037_0517932 3300049573 Bacteria 807
1989 Ga0501037_0717570 3300049573 Bacteria 664
1990 Ga0501037_0725167 3300049573 Bacteria 660
1991 Ga0501038_0000213 3300049574 Bacteria 49756
1992 Ga0501038_0007678 3300049574 Bacteria 9944
1993 Ga0501038_0020877 3300049574 Bacteria 5886
1994 Ga0501038_0022218 3300049574 Bacteria 5686
1995 Ga0501038_0029924 3300049574 Bacteria 4821
1996 Ga0501038_0032078 3300049574 Bacteria 4637
1997 Ga0501038_0033722 3300049574 Bacteria 4507
1998 Ga0501038_0064065 3300049574 Bacteria 3135
1999 Ga0501038_0108578 3300049574 Bacteria 2300
2000 Ga0501038_0249903 3300049574 Bacteria 1405
2001 Ga0501038_0275531 3300049574 Bacteria 1325
2002 Ga0501038_0362768 3300049574 Bacteria 1126
2003 Ga0501038_0562569 3300049574 Bacteria 866
2004 Ga0501038_0688979 3300049574 Bacteria 766
2005 Ga0501039_0000179 3300049575 Bacteria 45148
2006 Ga0501039_0023041 3300049575 Bacteria 4776
2007 Ga0501039_0055365 3300049575 Bacteria 3071
2008 Ga0501039_0097192 3300049575 Bacteria 2296
2009 Ga0501039_0102258 3300049575 Bacteria 2236
2010 Ga0501039_0138652 3300049575 Bacteria 1910
2011 Ga0501039_0189896 3300049575 Bacteria 1615
2012 Ga0501039_0262837 3300049575 Bacteria 1356
2013 Ga0501039_0501024 3300049575 Bacteria 953
2014 Ga0501039_0509026 3300049575 Bacteria 945
2015 Ga0501039_0596926 3300049575 Bacteria 865
2016 Ga0501039_0644395 3300049575 Bacteria 830
2017 Ga0501040_0018290 3300049576 Bacteria 4651
2018 Ga0501040_0042271 3300049576 Bacteria 3104
2019 Ga0501040_0633248 3300049576 Bacteria 773
2020 Ga0501041_0092053 3300049577 Bacteria 1872
2021 Ga0501041_0349236 3300049577 Bacteria 935
2022 Ga0501042_0009399 3300049578 Bacteria 6513
2023 Ga0501042_0048874 3300049578 Bacteria 3016
2024 Ga0501042_0056752 3300049578 Bacteria 2794
2025 Ga0501042_0210951 3300049578 Bacteria 1401
2026 Ga0501042_0265675 3300049578 Bacteria 1239
2027 Ga0501042_1007805 3300049578 Bacteria 607
2028 Ga0501043_0000033 3300049579 Bacteria 139500
2029 Ga0501043_0003445 3300049579 Bacteria 12996
2030 Ga0501043_0018962 3300049579 Bacteria 5399
2031 Ga0501043_0028919 3300049579 Bacteria 4350
2032 Ga0501043_0034403 3300049579 Bacteria 3985
2033 Ga0501043_0037149 3300049579 Bacteria 3831
2034 Ga0501043_0073829 3300049579 Bacteria 2679
2035 Ga0501043_0088362 3300049579 Bacteria 2436
2036 Ga0501043_0249203 3300049579 Bacteria 1368
2037 Ga0501043_0634020 3300049579 Bacteria 786
2038 Ga0501043_1090816 3300049579 Bacteria 564
2039 Ga0501046_0002671 3300049580 Bacteria 16625
2040 Ga0501046_0002675 3300049580 Bacteria 16619
2041 Ga0501046_0010169 3300049580 Bacteria 8095
2042 Ga0501046_0021031 3300049580 Bacteria 5388
2043 Ga0501046_0060874 3300049580 Bacteria 2953
2044 Ga0501046_0088873 3300049580 Bacteria 2379
2045 Ga0501046_0092898 3300049580 Bacteria 2319
2046 Ga0501046_0143708 3300049580 Bacteria 1803
2047 Ga0501046_0194669 3300049580 Bacteria 1511
2048 Ga0501046_0378066 3300049580 Bacteria 1025
2049 Ga0501046_0748669 3300049580 Bacteria 686
2050 Ga0501046_1157416 3300049580 Bacteria 533
2051 Ga0501046_1216839 3300049580 Bacteria 517
2052 Ga0501047_0000218 3300049581 Bacteria 68952
2053 Ga0501047_0001106 3300049581 Bacteria 26767
2054 Ga0501047_0003809 3300049581 Bacteria 14175
2055 Ga0501047_0006069 3300049581 Bacteria 11358
2056 Ga0501047_0020544 3300049581 Bacteria 6340
2057 Ga0501047_0048456 3300049581 Bacteria 4103
2058 Ga0501047_0054886 3300049581 Bacteria 3853
2059 Ga0501047_0059014 3300049581 Bacteria 3705
2060 Ga0501047_0094640 3300049581 Bacteria 2866
2061 Ga0501047_0111031 3300049581 Bacteria 2624
2062 Ga0501047_0185537 3300049581 Bacteria 1945
2063 Ga0501047_0227262 3300049581 Bacteria 1720
2064 Ga0501047_0242497 3300049581 Bacteria 1652
2065 Ga0501047_0370245 3300049581 Bacteria 1268
2066 Ga0501047_0383633 3300049581 Bacteria 1239
2067 Ga0501047_0428500 3300049581 Bacteria 1154
2068 Ga0501047_0471488 3300049581 Bacteria 1083
2069 Ga0501047_0488234 3300049581 Bacteria 1059
2070 Ga0501048_0000313 3300049582 Bacteria 33165
2071 Ga0501048_0001236 3300049582 Bacteria 19364
2072 Ga0501048_0010967 3300049582 Bacteria 6760
2073 Ga0501048_0011472 3300049582 Bacteria 6610
2074 Ga0501048_0054533 3300049582 Bacteria 2840
2075 Ga0501048_0082165 3300049582 Bacteria 2272
2076 Ga0501048_0243712 3300049582 Bacteria 1275
2077 Ga0501048_0261350 3300049582 Bacteria 1230
2078 Ga0501067_0002888 3300049583 Bacteria 9455
2079 Ga0501067_0012576 3300049583 Bacteria 4697
2080 Ga0501067_0045185 3300049583 Bacteria 2446
2081 Ga0501067_0071581 3300049583 Bacteria 1920
2082 Ga0501067_0125880 3300049583 Bacteria 1426
2083 Ga0501067_0196510 3300049583 Bacteria 1123
2084 Ga0501067_0484678 3300049583 Bacteria 691
2085 Ga0501067_0847536 3300049583 Bacteria 515
2086 Ga0501068_0000366 3300049584 Bacteria 22710
2087 Ga0501068_0002842 3300049584 Bacteria 9208
2088 Ga0501068_0003767 3300049584 Bacteria 8211
2089 Ga0501068_0061742 3300049584 Bacteria 2277
2090 Ga0501068_0136585 3300049584 Bacteria 1535
2091 Ga0501068_0267365 3300049584 Bacteria 1091
2092 Ga0501068_0349875 3300049584 Bacteria 949
2093 Ga0501069_0004074 3300049585 Bacteria 7542
2094 Ga0501069_0007967 3300049585 Bacteria 5562
2095 Ga0501069_0018962 3300049585 Bacteria 3715
2096 Ga0501069_0048119 3300049585 Bacteria 2367
2097 Ga0501069_0073126 3300049585 Bacteria 1922
2098 Ga0501069_0104471 3300049585 Bacteria 1610
2099 Ga0501069_0160001 3300049585 Bacteria 1296
2100 Ga0501069_0187422 3300049585 Bacteria 1196
2101 Ga0501069_0196109 3300049585 Bacteria 1169
2102 Ga0501069_0438940 3300049585 Bacteria 775
2103 Ga0501069_0629195 3300049585 Bacteria 645
2104 Ga0501070_0008769 3300049586 Bacteria 8550
2105 Ga0501070_0009143 3300049586 Bacteria 8380
2106 Ga0501070_0013530 3300049586 Bacteria 6878
2107 Ga0501070_0020750 3300049586 Bacteria 5511
2108 Ga0501070_0021014 3300049586 Bacteria 5476
2109 Ga0501070_0025640 3300049586 Bacteria 4945
2110 Ga0501070_0032964 3300049586 Bacteria 4332
2111 Ga0501070_0035106 3300049586 Bacteria 4190
2112 Ga0501070_0046130 3300049586 Bacteria 3624
2113 Ga0501070_0055066 3300049586 Bacteria 3297
2114 Ga0501070_0068468 3300049586 Bacteria 2938
2115 Ga0501070_0076488 3300049586 Bacteria 2771
2116 Ga0501070_0084575 3300049586 Bacteria 2626
2117 Ga0501070_0177264 3300049586 Bacteria 1754
2118 Ga0501070_0243756 3300049586 Bacteria 1471
2119 Ga0501070_0386462 3300049586 Bacteria 1133
2120 Ga0501071_0041923 3300049587 Bacteria 3278
2121 Ga0501071_0072184 3300049587 Bacteria 2517
2122 Ga0501071_0099564 3300049587 Bacteria 2142
2123 Ga0501071_0273989 3300049587 Bacteria 1276
2124 Ga0501071_0496344 3300049587 Bacteria 936
2125 Ga0501071_0802076 3300049587 Bacteria 726
2126 Ga0501071_0944651 3300049587 Bacteria 666
2127 Ga0501071_0945003 3300049587 Bacteria 665
2128 Ga0501071_1122490 3300049587 Bacteria 607
2129 Ga0501072_0002141 3300049588 Bacteria 14728
2130 Ga0501072_0006733 3300049588 Bacteria 8734
2131 Ga0501072_0013187 3300049588 Bacteria 6329
2132 Ga0501072_0023371 3300049588 Bacteria 4801
2133 Ga0501072_0057296 3300049588 Bacteria 3070
2134 Ga0501072_0158998 3300049588 Bacteria 1802
2135 Ga0501072_0162840 3300049588 Bacteria 1780
2136 Ga0501073_0000064 3300049589 Bacteria 65843
2137 Ga0501073_0016576 3300049589 Bacteria 5339
2138 Ga0501073_0021034 3300049589 Bacteria 4706
2139 Ga0501073_0082659 3300049589 Bacteria 2234
2140 Ga0501073_0104811 3300049589 Bacteria 1962
2141 Ga0501073_0129211 3300049589 Bacteria 1751
2142 Ga0501073_0138400 3300049589 Bacteria 1687
2143 Ga0501073_0175624 3300049589 Bacteria 1482
2144 Ga0501073_0246470 3300049589 Bacteria 1233
2145 Ga0501073_1092508 3300049589 Bacteria 548
2146 Ga0501074_0000044 3300049590 Bacteria 58944
2147 Ga0501074_0002413 3300049590 Bacteria 13023
2148 Ga0501074_0013275 3300049590 Bacteria 5989
2149 Ga0501074_0025868 3300049590 Bacteria 4258
2150 Ga0501074_0027394 3300049590 Bacteria 4132
2151 Ga0501074_0045139 3300049590 Bacteria 3188
2152 Ga0501074_0056947 3300049590 Bacteria 2816
2153 Ga0501074_0204812 3300049590 Bacteria 1406
2154 Ga0501074_0666700 3300049590 Bacteria 734
2155 Ga0501075_0736763 3300049591 Bacteria 750
2156 Ga0501076_0037600 3300049592 Bacteria 3797
2157 Ga0501076_0085615 3300049592 Bacteria 2533
2158 Ga0501076_0451479 3300049592 Bacteria 1058
2159 Ga0501076_0899176 3300049592 Bacteria 730
2160 Ga0501079_0001843 3300049741 Bacteria 15173
2161 Ga0501079_0012351 3300049741 Bacteria 6517
2162 Ga0501079_0039781 3300049741 Bacteria 3627
2163 Ga0501079_0206684 3300049741 Bacteria 1534
2164 Ga0501079_0928685 3300049741 Bacteria 685
2165 Ga0501080_0000072 3300049742 Bacteria 67367
2166 Ga0501080_0001471 3300049742 Bacteria 19833
2167 Ga0501080_0003614 3300049742 Bacteria 13622
2168 Ga0501080_0008596 3300049742 Bacteria 9263
2169 Ga0501080_0018387 3300049742 Bacteria 6469
2170 Ga0501080_0028798 3300049742 Bacteria 5170
2171 Ga0501080_0039183 3300049742 Bacteria 4423
2172 Ga0501080_0077303 3300049742 Bacteria 3095
2173 Ga0501080_0197294 3300049742 Bacteria 1848
2174 Ga0501080_0211419 3300049742 Bacteria 1777
2175 Ga0501080_0212108 3300049742 Bacteria 1774
2176 Ga0501080_0268775 3300049742 Bacteria 1552
2177 Ga0501080_0296180 3300049742 Bacteria 1468
2178 Ga0501080_0355340 3300049742 Bacteria 1322
2179 Ga0501080_0409909 3300049742 Bacteria 1218
2180 Ga0501080_0454229 3300049742 Bacteria 1148
2181 Ga0501080_0659087 3300049742 Bacteria 926
2182 Ga0501080_0742687 3300049742 Bacteria 863
2183 Ga0501080_0846646 3300049742 Bacteria 800
2184 Ga0501080_1478101 3300049742 Bacteria 578
2185 Ga0501081_0203071 3300049743 Bacteria 1438
2186 Ga0501081_0719049 3300049743 Bacteria 750
2187 Ga0501083_0000538 3300049744 Bacteria 24206
2188 Ga0501083_0001547 3300049744 Bacteria 15730
2189 Ga0501083_0010964 3300049744 Bacteria 6372
2190 Ga0501083_0029676 3300049744 Bacteria 3759
2191 Ga0501083_0035874 3300049744 Bacteria 3386
2192 Ga0501083_0056240 3300049744 Bacteria 2636
2193 Ga0501083_0169687 3300049744 Bacteria 1426
2194 Ga0501083_0226201 3300049744 Bacteria 1218
2195 Ga0501083_0597051 3300049744 Bacteria 718
2196 Ga0501083_0937034 3300049744 Bacteria 563
2197 Ga0501035_0000241 3300049822 Bacteria 65546
2198 Ga0501035_0003213 3300049822 Bacteria 15661
2199 Ga0501035_0003871 3300049822 Bacteria 14283
2200 Ga0501035_0004162 3300049822 Bacteria 13750
2201 Ga0501035_0005536 3300049822 Bacteria 11935
2202 Ga0501035_0025637 3300049822 Bacteria 5404
2203 Ga0501035_0029403 3300049822 Bacteria 5011
2204 Ga0501035_0031432 3300049822 Bacteria 4835
2205 Ga0501035_0083734 3300049822 Bacteria 2814
2206 Ga0501035_0115864 3300049822 Bacteria 2345
2207 Ga0501035_0143910 3300049822 Bacteria 2071
2208 Ga0501035_0155874 3300049822 Bacteria 1979
2209 Ga0501035_0237985 3300049822 Bacteria 1549
2210 Ga0501035_0252302 3300049822 Bacteria 1498
2211 Ga0501035_0278045 3300049822 Bacteria 1416
2212 Ga0501035_0344231 3300049822 Bacteria 1249
2213 Ga0501035_0359862 3300049822 Bacteria 1216
2214 Ga0501035_0505473 3300049822 Bacteria 994
2215 Ga0501035_0515160 3300049822 Bacteria 983
2216 Ga0501035_1285651 3300049822 Bacteria 564
2217 Ga0501044_0000181 3300049823 Bacteria 78075
2218 Ga0501044_0003277 3300049823 Bacteria 18223
2219 Ga0501044_0017378 3300049823 Bacteria 7715
2220 Ga0501044_0019057 3300049823 Bacteria 7346
2221 Ga0501044_0027500 3300049823 Bacteria 6009
2222 Ga0501044_0028283 3300049823 Bacteria 5917
2223 Ga0501044_0028487 3300049823 Bacteria 5895
2224 Ga0501044_0046702 3300049823 Bacteria 4482
2225 Ga0501044_0060110 3300049823 Bacteria 3892
2226 Ga0501044_0095667 3300049823 Bacteria 2992
2227 Ga0501044_0106557 3300049823 Bacteria 2815
2228 Ga0501044_0139007 3300049823 Bacteria 2418
2229 Ga0501044_0197284 3300049823 Bacteria 1972
2230 Ga0501044_0206136 3300049823 Bacteria 1922
2231 Ga0501044_0218409 3300049823 Bacteria 1857
2232 Ga0501044_0225064 3300049823 Bacteria 1825
2233 Ga0501044_0309092 3300049823 Bacteria 1508
2234 Ga0501044_0337868 3300049823 Bacteria 1427
2235 Ga0501044_0734962 3300049823 Bacteria 870
2236 Ga0501044_0965123 3300049823 Bacteria 725
2237 Ga0501044_1004829 3300049823 Bacteria 706
2238 Ga0501044_1124990 3300049823 Bacteria 654
2239 Ga0501044_1164190 3300049823 Bacteria 639
2240 Ga0501044_1519894 3300049823 Bacteria 534
2241 Ga0501045_0003511 3300049824 Bacteria 10738
2242 Ga0501045_0009819 3300049824 Bacteria 6697
2243 Ga0501045_0433304 3300049824 Bacteria 978
2244 nmdc:mga03683_109368_c1 3300050489 Bacteria 1221
2245 nmdc:mga03683_30442_c1 3300050489 Bacteria 2159
2246 nmdc:mga03683_452063_c1 3300050489 Bacteria 618
2247 nmdc:mga03n38_111450_c1 3300050490 Bacteria 1333
2248 nmdc:mga03n38_115_c1 3300050490 Bacteria 17430
2249 nmdc:mga03n38_199039_c1 3300050490 Bacteria 1036
2250 nmdc:mga03n38_90892_c1 3300050490 Bacteria 1453
2251 nmdc:mga00v17_11090_c1 3300050491 Bacteria 4943
2252 nmdc:mga00v17_124536_c1 3300050491 Bacteria 1644
2253 nmdc:mga00v17_129304_c1 3300050491 Bacteria 1613
2254 nmdc:mga00v17_313425_c1 3300050491 Bacteria 1019
2255 nmdc:mga00v17_355349_c1 3300050491 Bacteria 953
2256 nmdc:mga00v17_50570_c1 3300050491 Bacteria 2526
2257 nmdc:mga00v17_861541_c1 3300050491 Bacteria 575
2258 nmdc:mga0yw44_111747_c1 3300050492 Bacteria 1752
2259 nmdc:mga0yw44_121392_c1 3300050492 Bacteria 1683
2260 nmdc:mga0yw44_22836_c1 3300050492 Bacteria 3515
2261 nmdc:mga0yw44_278979_c1 3300050492 Bacteria 1117
2262 nmdc:mga0yw44_28731_c1 3300050492 Bacteria 3203
2263 nmdc:mga0yw44_82552_c1 3300050492 Bacteria 2017
2264 nmdc:mga0yw44_98284_c1 3300050492 Bacteria 1861
2265 nmdc:mga0k408_30953_c1 3300050493 Bacteria 3053
2266 nmdc:mga0k408_366023_c1 3300050493 Bacteria 859
2267 nmdc:mga0k408_631410_c1 3300050493 Bacteria 631
2268 nmdc:mga06z11_133888_c1 3300050494 Bacteria 1395
2269 nmdc:mga06z11_18389_c1 3300050494 Bacteria 3191
2270 nmdc:mga06z11_240449_c1 3300050494 Bacteria 1063
2271 nmdc:mga06z11_5772_c1 3300050494 Bacteria 4990
2272 nmdc:mga06z11_7502_c2 3300050494 Bacteria 3511
2273 nmdc:mga04h51_123542_c1 3300050495 Bacteria 967
2274 nmdc:mga04h51_124053_c1 3300050495 Bacteria 965
2275 nmdc:mga04h51_195357_c1 3300050495 Bacteria 793
2276 nmdc:mga04h51_206411_c1 3300050495 Bacteria 774
2277 nmdc:mga04h51_376016_c1 3300050495 Bacteria 591
2278 nmdc:mga04h51_43633_c1 3300050495 Bacteria 1476
2279 nmdc:mga04h51_91557_c1 3300050495 Bacteria 1095
2280 nmdc:mga07m45_268352_c1 3300050496 Bacteria 993
2281 nmdc:mga07m45_6927_c1 3300050496 Bacteria 5765
2282 nmdc:mga07m45_71218_c1 3300050496 Bacteria 1978
2283 nmdc:mga07m45_715701_c1 3300050496 Bacteria 575
2284 nmdc:mga07m45_799204_c1 3300050496 Bacteria 541
2285 nmdc:mga07m45_88155_c1 3300050496 Bacteria 1776
2286 nmdc:mga05p37_116152_c1 3300050507 Bacteria 3289
2287 nmdc:mga09592_111209_c1 3300050508 Bacteria 2350
2288 nmdc:mga0qj67_202285_c1 3300050509 Bacteria 1613
2289 nmdc:mga08y16_124523_c1 3300050511 Bacteria 2681
2290 nmdc:mga08y16_602172_c1 3300050511 Bacteria 1108
2291 nmdc:mga0n895_5831_c1 3300050512 Bacteria 10352
2292 nmdc:mga0rr50_35624_c1 3300050513 Bacteria 3576
2293 nmdc:mga0rr50_399170_c1 3300050513 Bacteria 1161
2294 nmdc:mga08x19_221779_c1 3300050514 Bacteria 1299
2295 nmdc:mga08x19_259727_c1 3300050514 Bacteria 1200
2296 nmdc:mga08x19_525328_c1 3300050514 Bacteria 836
2297 nmdc:mga0a205_225085_c1 3300050515 Bacteria 1760
2298 nmdc:mga0sz30_203574_c1 3300050516 Bacteria 879
2299 nmdc:mga0sz30_448496_c1 3300050516 Bacteria 579
2300 nmdc:mga0sz30_63078_c1 3300050516 Bacteria 1586
2301 nmdc:mga0sz30_757_c1 3300050516 Bacteria 11811
2302 Ga0495601_0008893 3300053077 Bacteria 5926
2303 Ga0495601_0132995 3300053077 Bacteria 1621
2304 Ga0495601_0154169 3300053077 Bacteria 1500
2305 Ga0495601_0201521 3300053077 Bacteria 1300
2306 Ga0495601_0446976 3300053077 Bacteria 836
2307 Ga0495601_0656161 3300053077 Bacteria 671
2308 Ga0495612_0016666 3300053078 Bacteria 2944
2309 Ga0495612_0034112 3300053078 Bacteria 2060
2310 Ga0495612_0040196 3300053078 Bacteria 1904
2311 Ga0495612_0117342 3300053078 Bacteria 1143
2312 Ga0500635_0012002 3300053080 Bacteria 2477
2313 Ga0500635_0048269 3300053080 Bacteria 1449
2314 Ga0500635_0117012 3300053080 Bacteria 995
2315 Ga0500635_0123918 3300053080 Bacteria 969
2316 Ga0500635_0246158 3300053080 Bacteria 701
2317 Ga0495655_0015417 3300053083 Bacteria 1624
2318 Ga0495655_0142608 3300053083 Bacteria 747
2319 Ga0495595_0001211 3300053084 Bacteria 10032
2320 Ga0495595_0132918 3300053084 Bacteria 1217
2321 Ga0495595_0457344 3300053084 Bacteria 649
2322 Ga0495619_0001922 3300053085 Bacteria 13848
2323 Ga0495619_0028185 3300053085 Bacteria 3622
2324 Ga0495619_0085096 3300053085 Bacteria 2135
2325 Ga0495619_0407464 3300053085 Bacteria 939
2326 Ga0495619_0722173 3300053085 Bacteria 677
2327 Ga0500578_0041734 3300053086 Bacteria 2946
2328 Ga0500578_0209327 3300053086 Bacteria 1190
2329 Ga0500578_0746543 3300053086 Bacteria 522
2330 Ga0500643_000025 3300053087 Bacteria 259605
2331 Ga0500643_023121 3300053087 Bacteria 1990
2332 Ga0500643_024371 3300053087 Bacteria 1921
2333 Ga0500644_0019855 3300053088 Bacteria 1989
2334 Ga0500644_0375083 3300053088 Bacteria 618
2335 Ga0500581_012769 3300053089 Bacteria 4152
2336 Ga0500646_0015483 3300053090 Bacteria 1986
2337 Ga0500647_0018514 3300053091 Bacteria 3226
2338 Ga0500647_0024751 3300053091 Bacteria 2825
2339 Ga0500583_0047291 3300053092 Bacteria 1982
2340 Ga0500583_0120039 3300053092 Bacteria 1300
2341 Ga0500651_0002618 3300053093 Bacteria 9560
2342 Ga0500651_0003810 3300053093 Bacteria 8328
2343 Ga0500651_0197133 3300053093 Bacteria 1189
2344 Ga0500651_0314195 3300053093 Bacteria 896
2345 Ga0500651_0468764 3300053093 Bacteria 698
2346 Ga0500566_0000085 3300053094 Bacteria 46377
2347 Ga0500566_0000135 3300053094 Bacteria 37782
2348 Ga0500566_0000171 3300053094 Bacteria 32979
2349 Ga0500566_0005591 3300053094 Bacteria 7467
2350 Ga0500566_0044895 3300053094 Bacteria 2545
2351 Ga0500566_0085703 3300053094 Bacteria 1747
2352 Ga0500566_0320426 3300053094 Bacteria 722
2353 Ga0500640_000153 3300053095 Bacteria 13659
2354 Ga0500640_076221 3300053095 Bacteria 1430
2355 Ga0500641_0005251 3300053096 Bacteria 4588
2356 Ga0500641_0013077 3300053096 Bacteria 3045
2357 Ga0500641_0080061 3300053096 Bacteria 1385
2358 Ga0500641_0140822 3300053096 Bacteria 1042
2359 Ga0500648_035970 3300053097 Bacteria 2803
2360 Ga0500650_0038362 3300053098 Bacteria 2204
2361 Ga0500650_0088965 3300053098 Bacteria 1445
2362 Ga0500554_008577 3300053102 Bacteria 2409
2363 Ga0500554_014649 3300053102 Bacteria 2029
2364 Ga0500555_003285 3300053103 Bacteria 4609
2365 Ga0500555_047982 3300053103 Bacteria 1174
2366 Ga0500556_0000030 3300053104 Bacteria 165098
2367 Ga0500556_0004337 3300053104 Bacteria 4042
2368 Ga0500557_000001 3300053105 Bacteria 241298
2369 Ga0500558_192740 3300053106 Bacteria 717
2370 Ga0500562_030856 3300053108 Bacteria 1413
2371 Ga0500562_032742 3300053108 Bacteria 1372
2372 Ga0500569_003594 3300053109 Bacteria 3185
2373 Ga0500572_000290 3300053111 Bacteria 18127
2374 Ga0500572_002256 3300053111 Bacteria 4694
2375 Ga0500582_212015 3300053114 Bacteria 645
2376 Ga0500592_001050 3300053116 Bacteria 4517
2377 Ga0500592_016647 3300053116 Bacteria 1180
2378 Ga0500594_0053250 3300053118 Bacteria 1146
2379 Ga0500595_001194 3300053119 Bacteria 14348
2380 Ga0500595_001941 3300053119 Bacteria 10645
2381 Ga0500595_005296 3300053119 Bacteria 5652
2382 Ga0500595_006964 3300053119 Bacteria 4742
2383 Ga0500595_012466 3300053119 Bacteria 3287
2384 Ga0500595_026646 3300053119 Bacteria 1989
2385 Ga0500595_074562 3300053119 Bacteria 1002
2386 Ga0500597_109931 3300053120 Bacteria 1197
2387 Ga0500607_074119 3300053121 Bacteria 1750
2388 Ga0500608_024006 3300053122 Bacteria 2843
2389 Ga0500608_140473 3300053122 Bacteria 1071
2390 Ga0500614_006035 3300053123 Bacteria 2547
2391 Ga0500614_059888 3300053123 Bacteria 1021
2392 Ga0500614_230207 3300053123 Bacteria 575
2393 Ga0500618_009591 3300053125 Bacteria 2635
2394 Ga0500642_0000028 3300053130 Bacteria 117281
2395 Ga0500642_0000170 3300053130 Bacteria 26891
2396 Ga0500642_0024071 3300053130 Bacteria 2454
2397 Ga0500652_001552 3300053131 Bacteria 7015
2398 Ga0500652_050850 3300053131 Bacteria 1692
2399 Ga0500655_006730 3300053133 Bacteria 2069
2400 Ga0500655_008271 3300053133 Bacteria 1872
2401 Ga0500658_0046714 3300053134 Bacteria 1754
2402 Ga0500658_0539680 3300053134 Bacteria 525
2403 Ga0500658_0571879 3300053134 Bacteria 507
2404 Ga0500559_0000204 3300053136 Bacteria 47160
2405 Ga0500559_0000274 3300053136 Bacteria 39917
2406 Ga0500559_0018601 3300053136 Bacteria 2935
2407 Ga0500559_0044979 3300053136 Bacteria 1931
2408 Ga0500559_0075829 3300053136 Bacteria 1521
2409 Ga0500564_087271 3300053138 Bacteria 1392
2410 Ga0500568_0003086 3300053139 Bacteria 9509
2411 Ga0500568_0004032 3300053139 Bacteria 7958
2412 Ga0500568_0010482 3300053139 Bacteria 4339
2413 Ga0500568_0037878 3300053139 Bacteria 1954
2414 Ga0500568_0042366 3300053139 Bacteria 1824
2415 Ga0500568_0196269 3300053139 Bacteria 740
2416 Ga0500573_0011302 3300053140 Bacteria 4994
2417 Ga0500573_0446682 3300053140 Bacteria 599
2418 Ga0500577_0000057 3300053142 Bacteria 25322
2419 Ga0500577_0162606 3300053142 Bacteria 951
2420 Ga0500586_001133 3300053145 Bacteria 5519
2421 Ga0500589_135834 3300053147 Bacteria 1020
2422 Ga0500590_049297 3300053148 Bacteria 2144
2423 Ga0500590_101092 3300053148 Bacteria 1384
2424 Ga0500590_109601 3300053148 Bacteria 1312
2425 Ga0500590_158617 3300053148 Bacteria 1011
2426 Ga0500590_215225 3300053148 Bacteria 798
2427 Ga0500603_000308 3300053150 Bacteria 12822
2428 Ga0500603_001676 3300053150 Bacteria 4992
2429 Ga0500603_007701 3300053150 Bacteria 2372
2430 Ga0500603_032151 3300053150 Bacteria 1359
2431 Ga0500603_048348 3300053150 Bacteria 1157
2432 Ga0500603_077671 3300053150 Bacteria 957
2433 Ga0500604_0002688 3300053151 Bacteria 4835
2434 Ga0500604_0016640 3300053151 Bacteria 2028
2435 Ga0500604_0151194 3300053151 Bacteria 788
2436 Ga0500616_0000252 3300053153 Bacteria 83060
2437 Ga0500616_0012430 3300053153 Bacteria 4980
2438 Ga0500619_016674 3300053154 Bacteria 2026
2439 Ga0500620_002178 3300053155 Bacteria 3866
2440 Ga0500622_0009714 3300053156 Bacteria 5316
2441 Ga0500622_0011125 3300053156 Bacteria 4913
2442 Ga0500622_0042715 3300053156 Bacteria 2354
2443 Ga0500622_0048292 3300053156 Bacteria 2196
2444 Ga0500622_0116709 3300053156 Bacteria 1298
2445 Ga0500624_025651 3300053157 Bacteria 982
2446 Ga0500627_0015399 3300053158 Bacteria 2955
2447 Ga0500627_0089471 3300053158 Bacteria 1377
2448 Ga0500627_0356167 3300053158 Bacteria 630
2449 Ga0500630_000105 3300053159 Bacteria 27352
2450 Ga0500633_0163615 3300053160 Bacteria 835
2451 Ga0500634_0025182 3300053161 Bacteria 3238
2452 Ga0500634_0043802 3300053161 Bacteria 2424
2453 Ga0500638_003053 3300053162 Bacteria 6084
2454 Ga0500638_004764 3300053162 Bacteria 5298
2455 Ga0500638_034990 3300053162 Bacteria 2432
2456 Ga0500638_099082 3300053162 Bacteria 1362
2457 Ga0500638_105906 3300053162 Bacteria 1305
2458 Ga0500639_000004 3300053163 Bacteria 216921
2459 Ga0500639_196501 3300053163 Bacteria 872
2460 Ga0500636_0000427 3300053177 Bacteria 23188
2461 Ga0500636_0003830 3300053177 Bacteria 8501
2462 Ga0500636_0015879 3300053177 Bacteria 4436
2463 Ga0500636_0207425 3300053177 Bacteria 1031
2464 Ga0500636_0208448 3300053177 Bacteria 1028
2465 Ga0500636_0270270 3300053177 Bacteria 855
2466 Ga0500636_0391545 3300053177 Bacteria 648
2467 Ga0500636_0517949 3300053177 Bacteria 523
2468 Ga0500637_0000160 3300053178 Bacteria 24797
2469 Ga0500637_0005675 3300053178 Bacteria 6066
2470 Ga0500637_0018190 3300053178 Bacteria 3772
2471 Ga0500637_0111190 3300053178 Bacteria 1589
2472 Ga0500637_0163923 3300053178 Bacteria 1280
2473 Ga0500637_0212915 3300053178 Bacteria 1095
2474 Ga0500637_0235201 3300053178 Bacteria 1030
2475 Ga0500649_119316 3300053722 Bacteria 1008
2476 Ga0500570_101130 3300053724 Bacteria 1210
2477 Ga0500657_171211 3300053728 Bacteria 769
2478 Ga0500645_013896 3300053730 Bacteria 2575
2479 Ga0500645_024769 3300053730 Bacteria 1833
2480 Ga0500645_040357 3300053730 Bacteria 1380
2481 Ga0500645_093525 3300053730 Bacteria 852
2482 Ga0500609_009091 3300053731 Bacteria 1341
2483 Ga0500609_014378 3300053731 Bacteria 1072
2484 Ga0500552_013023 3300053733 Bacteria 1074
2485 Ga0500596_001009 3300053735 Bacteria 5642
2486 Ga0500596_007150 3300053735 Bacteria 1842
2487 Ga0500596_009861 3300053735 Bacteria 1483
2488 Ga0500596_015194 3300053735 Bacteria 1157
2489 Ga0500599_001271 3300053736 Bacteria 2885
2490 Ga0500601_001440 3300053737 Bacteria 2612
2491 Ga0500601_002757 3300053737 Bacteria 1893
2492 Ga0500601_003868 3300053737 Bacteria 1627
2493 Ga0501084_0004597 3300054114 Bacteria 11281
2494 Ga0501084_0038974 3300054114 Bacteria 3974
2495 Ga0501084_0067377 3300054114 Bacteria 2996
2496 Ga0501084_0689267 3300054114 Bacteria 862
2497 Ga0500661_000910 3300055283 Bacteria 5546
2498 Ga0501082_0006657 3300060353 Bacteria 9998
2499 Ga0501082_0011044 3300060353 Bacteria 7765
2500 Ga0501082_0014057 3300060353 Bacteria 6885
2501 Ga0501082_0091620 3300060353 Bacteria 2625
2502 Ga0501082_0142783 3300060353 Bacteria 2078
2503 Ga0501082_0183156 3300060353 Bacteria 1822
2504 Ga0501082_0364978 3300060353 Bacteria 1259
2505 Ga0501082_0424803 3300060353 Bacteria 1161
2506 Ga0501082_1924510 3300060353 Bacteria 516
2507 Ga0466962_0081983 3300061719 Bacteria 1543
2508 Ga0530510_0023248 3300061734 Bacteria 4415

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045051 Ga0451576_0097420 Ga0451576_0097420_1113_1520 112
2 3300035724 Ga0373933_0611116 Ga0373933_0611116_67_489 116
3 3300031242 Ga0265329_10262860 Ga0265329_102628601 118
4 3300031249 Ga0265339_10188685 Ga0265339_101886851 118
5 3300049581 Ga0501047_0094640 Ga0501047_0094640_1238_1663 119
6 3300049583 Ga0501067_0196510 Ga0501067_0196510_285_710 119
7 3300049585 Ga0501069_0048119 Ga0501069_0048119_1918_2343 119
8 3300049586 Ga0501070_0068468 Ga0501070_0068468_1399_1824 119
9 3300049587 Ga0501071_0802076 Ga0501071_0802076_287_712 119
10 3300049588 Ga0501072_0057296 Ga0501072_0057296_1713_2138 119
11 3300049590 Ga0501074_0666700 Ga0501074_0666700_246_671 119
12 3300049741 Ga0501079_0206684 Ga0501079_0206684_503_928 119
13 3300049742 Ga0501080_0742687 Ga0501080_0742687_85_510 119
14 3300049744 Ga0501083_0597051 Ga0501083_0597051_124_549 119
15 3300049823 Ga0501044_0139007 Ga0501044_0139007_1859_2284 119
16 3300005354 Ga0070675_100847442 Ga0070675_1008474421 121
17 3300025926 Ga0207659_11005560 Ga0207659_110055601 121
18 3300049569 Ga0501032_0063322 Ga0501032_0063322_24_431 123
19 3300049570 Ga0501033_0005214 Ga0501033_0005214_3955_4362 123
20 3300049579 Ga0501043_0073829 Ga0501043_0073829_1766_2173 123
21 3300049580 Ga0501046_0002675 Ga0501046_0002675_13912_14319 123
22 3300049581 Ga0501047_0048456 Ga0501047_0048456_572_979 123
23 3300049581 Ga0501047_0059014 Ga0501047_0059014_698_1105 123
24 3300049582 Ga0501048_0261350 Ga0501048_0261350_121_528 123
25 3300049742 Ga0501080_0039183 Ga0501080_0039183_1650_2057 123
26 3300049822 Ga0501035_0029403 Ga0501035_0029403_4558_4965 123
27 3300049823 Ga0501044_0019057 Ga0501044_0019057_2610_3017 123
28 3300028563 Ga0265319_1000011 Ga0265319_100001175 124
29 3300028577 Ga0265318_10000644 Ga0265318_1000064413 124
30 3300031240 Ga0265320_10002704 Ga0265320_100027045 124
31 3300031240 Ga0265320_10168509 Ga0265320_101685092 124
32 3300031251 Ga0265327_10000857 Ga0265327_1000085735 124
33 3300031595 Ga0265313_10027023 Ga0265313_100270234 124
34 3300031711 Ga0265314_10001831 Ga0265314_1000183114 124
35 3300041452 Ga0451793_0668218 Ga0451793_0668218_477_887 124
36 3300041491 Ga0451833_1352085 Ga0451833_1352085_279_689 124
37 3300044712 Ga0453684_0004396 Ga0453684_0004396_8612_9022 124
38 3300053139 Ga0500568_0004032 Ga0500568_0004032_114_524 124
39 3300053156 Ga0500622_0048292 Ga0500622_0048292_1241_1651 124
40 iso_pu_bacteria 2551306092 2551732611 124
41 3300014968 Ga0157379_10222343 Ga0157379_102223432 125
42 3300049588 Ga0501072_0006733 Ga0501072_0006733_5392_5796 125
43 3300049744 Ga0501083_0226201 Ga0501083_0226201_744_1148 125
44 3300054114 Ga0501084_0067377 Ga0501084_0067377_1199_1603 125
45 iso_pu_bacteria 2891048133 2891052084 125
46 3300028653 Ga0265323_10071926 Ga0265323_100719262 126
47 3300028654 Ga0265322_10034595 Ga0265322_100345952 126
48 3300031235 Ga0265330_10149425 Ga0265330_101494252 126
49 3300031344 Ga0265316_10042914 Ga0265316_100429142 126
50 3300031711 Ga0265314_10325488 Ga0265314_103254882 126
51 3300031712 Ga0265342_10192018 Ga0265342_101920182 126
52 iso_pu_bacteria 8018150411 8018152190 126
53 3300049568 Ga0501031_0688364 Ga0501031_0688364_86_499 127
54 3300049569 Ga0501032_0050092 Ga0501032_0050092_100_513 127
55 3300049569 Ga0501032_0133684 Ga0501032_0133684_12_425 127
56 3300049571 Ga0501034_0094880 Ga0501034_0094880_1902_2315 127
57 3300049572 Ga0501036_0445011 Ga0501036_0445011_103_516 127
58 3300049574 Ga0501038_0064065 Ga0501038_0064065_2562_2975 127
59 3300049575 Ga0501039_0501024 Ga0501039_0501024_380_793 127
60 3300049579 Ga0501043_1090816 Ga0501043_1090816_105_518 127
61 3300049580 Ga0501046_0748669 Ga0501046_0748669_104_517 127
62 3300049582 Ga0501048_0243712 Ga0501048_0243712_71_484 127
63 3300049742 Ga0501080_0077303 Ga0501080_0077303_660_1073 127
64 3300049744 Ga0501083_0029676 Ga0501083_0029676_194_607 127
65 3300049822 Ga0501035_1285651 Ga0501035_1285651_105_518 127
66 3300049823 Ga0501044_0337868 Ga0501044_0337868_227_640 127
67 iso_pu_bacteria 2551306091 2551731085 128
68 iso_pu_bacteria 2821123053 2821124204 128
69 iso_pu_bacteria 2838736955 2838741306 128
70 iso_pu_bacteria 2841840854 2841844797 128
71 iso_pu_bacteria 2842140634 2842144519 128
72 iso_pu_bacteria 2854896431 2854898830 128
73 iso_pu_bacteria 2854916844 2854918279 128
74 iso_pu_bacteria 2857531043 2857531783 128
75 3300009098 Ga0105245_10022894 Ga0105245_100228942 129
76 3300025927 Ga0207687_10012230 Ga0207687_100122302 129
77 3300049571 Ga0501034_0341973 Ga0501034_0341973_907_1296 129
78 3300049822 Ga0501035_0083734 Ga0501035_0083734_738_1127 129
79 iso_pu_bacteria 2599185236 2599723136 129
80 iso_pu_bacteria 2600254933 2600375212 129
81 3300028381 Ga0268264_11766342 Ga0268264_117663421 131
82 3300039438 Ga0436360_0572514 Ga0436360_0572514_67_465 131
83 3300049568 Ga0501031_0004459 Ga0501031_0004459_793_1191 131
84 3300049569 Ga0501032_0010319 Ga0501032_0010319_1123_1521 131
85 3300049570 Ga0501033_0105341 Ga0501033_0105341_924_1322 131
86 3300049571 Ga0501034_0303932 Ga0501034_0303932_885_1283 131
87 3300049572 Ga0501036_0298905 Ga0501036_0298905_282_680 131
88 3300049573 Ga0501037_0008984 Ga0501037_0008984_5702_6100 131
89 3300049575 Ga0501039_0262837 Ga0501039_0262837_410_808 131
90 3300049579 Ga0501043_0037149 Ga0501043_0037149_1636_2034 131
91 3300049580 Ga0501046_0010169 Ga0501046_0010169_4805_5203 131
92 3300049581 Ga0501047_0227262 Ga0501047_0227262_525_923 131
93 3300049582 Ga0501048_0082165 Ga0501048_0082165_956_1354 131
94 3300049583 Ga0501067_0071581 Ga0501067_0071581_463_861 131
95 3300049585 Ga0501069_0073126 Ga0501069_0073126_549_947 131
96 3300049586 Ga0501070_0084575 Ga0501070_0084575_1012_1410 131
97 3300049589 Ga0501073_0104811 Ga0501073_0104811_1186_1584 131
98 3300049590 Ga0501074_0002413 Ga0501074_0002413_11259_11657 131
99 3300049741 Ga0501079_0039781 Ga0501079_0039781_2007_2405 131
100 3300049742 Ga0501080_0197294 Ga0501080_0197294_781_1179 131
101 3300049744 Ga0501083_0169687 Ga0501083_0169687_632_1030 131
102 3300049822 Ga0501035_0143910 Ga0501035_0143910_910_1308 131
103 3300049823 Ga0501044_0206136 Ga0501044_0206136_474_872 131
104 3300053139 Ga0500568_0196269 Ga0500568_0196269_148_546 131
105 3300054114 Ga0501084_0004597 Ga0501084_0004597_10060_10458 131
106 3300060353 Ga0501082_0011044 Ga0501082_0011044_1511_1909 131
107 iso_pu_bacteria 2599185156 2599333852 131
108 iso_pu_bacteria 2842922631 2842924710 131
109 3300005458 Ga0070681_10033348 Ga0070681_100333485 132
110 3300005466 Ga0070685_11011426 Ga0070685_110114261 132
111 3300009094 Ga0111539_11391412 Ga0111539_113914121 132
112 3300025912 Ga0207707_10018652 Ga0207707_100186523 132
113 3300025916 Ga0207663_10451538 Ga0207663_104515382 132
114 3300035113 Ga0373936_0233136 Ga0373936_0233136_312_731 132
115 3300039437 Ga0436365_1032972 Ga0436365_1032972_194_592 132
116 3300045051 Ga0451576_0831052 Ga0451576_0831052_115_513 132
117 3300048913 Ga0496110_0116254 Ga0496110_0116254_11_415 132
118 3300048914 Ga0496111_0207524 Ga0496111_0207524_485_889 132
119 3300049568 Ga0501031_0054272 Ga0501031_0054272_565_969 132
120 3300049568 Ga0501031_0285234 Ga0501031_0285234_106_510 132
121 3300049569 Ga0501032_0013590 Ga0501032_0013590_3362_3766 132
122 3300049569 Ga0501032_0043131 Ga0501032_0043131_906_1310 132
123 3300049569 Ga0501032_0268157 Ga0501032_0268157_618_1022 132
124 3300049570 Ga0501033_0012118 Ga0501033_0012118_4246_4650 132
125 3300049570 Ga0501033_0029483 Ga0501033_0029483_3584_3988 132
126 3300049570 Ga0501033_0544981 Ga0501033_0544981_178_582 132
127 3300049571 Ga0501034_0011972 Ga0501034_0011972_822_1226 132
128 3300049571 Ga0501034_0170662 Ga0501034_0170662_30_434 132
129 3300049571 Ga0501034_0883476 Ga0501034_0883476_275_679 132
130 3300049572 Ga0501036_0004827 Ga0501036_0004827_3038_3442 132
131 3300049572 Ga0501036_0022035 Ga0501036_0022035_508_912 132
132 3300049572 Ga0501036_0121404 Ga0501036_0121404_991_1395 132
133 3300049573 Ga0501037_0003385 Ga0501037_0003385_3285_3689 132
134 3300049573 Ga0501037_0066672 Ga0501037_0066672_509_913 132
135 3300049573 Ga0501037_0227384 Ga0501037_0227384_95_499 132
136 3300049573 Ga0501037_0517932 Ga0501037_0517932_157_561 132
137 3300049574 Ga0501038_0032078 Ga0501038_0032078_872_1276 132
138 3300049574 Ga0501038_0033722 Ga0501038_0033722_3364_3768 132
139 3300049574 Ga0501038_0275531 Ga0501038_0275531_812_1216 132
140 3300049574 Ga0501038_0688979 Ga0501038_0688979_110_514 132
141 3300049575 Ga0501039_0055365 Ga0501039_0055365_1856_2260 132
142 3300049575 Ga0501039_0102258 Ga0501039_0102258_1176_1580 132
143 3300049576 Ga0501040_0042271 Ga0501040_0042271_1278_1682 132
144 3300049578 Ga0501042_0210951 Ga0501042_0210951_447_851 132
145 3300049578 Ga0501042_1007805 Ga0501042_1007805_171_575 132
146 3300049579 Ga0501043_0003445 Ga0501043_0003445_4990_5394 132
147 3300049579 Ga0501043_0018962 Ga0501043_0018962_605_1009 132
148 3300049580 Ga0501046_0021031 Ga0501046_0021031_4909_5313 132
149 3300049580 Ga0501046_0143708 Ga0501046_0143708_879_1283 132
150 3300049580 Ga0501046_0378066 Ga0501046_0378066_486_890 132
151 3300049580 Ga0501046_1216839 Ga0501046_1216839_57_461 132
152 3300049581 Ga0501047_0003809 Ga0501047_0003809_5107_5511 132
153 3300049581 Ga0501047_0111031 Ga0501047_0111031_1725_2129 132
154 3300049581 Ga0501047_0242497 Ga0501047_0242497_477_881 132
155 3300049582 Ga0501048_0010967 Ga0501048_0010967_1169_1573 132
156 3300049582 Ga0501048_0054533 Ga0501048_0054533_1666_2070 132
157 3300049583 Ga0501067_0045185 Ga0501067_0045185_847_1251 132
158 3300049583 Ga0501067_0484678 Ga0501067_0484678_206_610 132
159 3300049584 Ga0501068_0002842 Ga0501068_0002842_1770_2174 132
160 3300049584 Ga0501068_0061742 Ga0501068_0061742_1740_2144 132
161 3300049584 Ga0501068_0136585 Ga0501068_0136585_812_1216 132
162 3300049584 Ga0501068_0349875 Ga0501068_0349875_352_756 132
163 3300049585 Ga0501069_0187422 Ga0501069_0187422_109_513 132
164 3300049585 Ga0501069_0196109 Ga0501069_0196109_277_681 132
165 3300049586 Ga0501070_0025640 Ga0501070_0025640_1146_1550 132
166 3300049586 Ga0501070_0032964 Ga0501070_0032964_1506_1910 132
167 3300049586 Ga0501070_0035106 Ga0501070_0035106_2572_2976 132
168 3300049586 Ga0501070_0177264 Ga0501070_0177264_204_608 132
169 3300049587 Ga0501071_0072184 Ga0501071_0072184_300_704 132
170 3300049587 Ga0501071_0273989 Ga0501071_0273989_382_786 132
171 3300049587 Ga0501071_0945003 Ga0501071_0945003_100_504 132
172 3300049588 Ga0501072_0023371 Ga0501072_0023371_2852_3256 132
173 3300049588 Ga0501072_0158998 Ga0501072_0158998_874_1278 132
174 3300049589 Ga0501073_0082659 Ga0501073_0082659_913_1317 132
175 3300049589 Ga0501073_0175624 Ga0501073_0175624_937_1341 132
176 3300049589 Ga0501073_0246470 Ga0501073_0246470_472_876 132
177 3300049590 Ga0501074_0027394 Ga0501074_0027394_3364_3768 132
178 3300049590 Ga0501074_0056947 Ga0501074_0056947_1747_2151 132
179 3300049592 Ga0501076_0451479 Ga0501076_0451479_428_832 132
180 3300049592 Ga0501076_0899176 Ga0501076_0899176_98_502 132
181 3300049741 Ga0501079_0012351 Ga0501079_0012351_1871_2275 132
182 3300049742 Ga0501080_0008596 Ga0501080_0008596_571_975 132
183 3300049742 Ga0501080_0028798 Ga0501080_0028798_1378_1782 132
184 3300049742 Ga0501080_0211419 Ga0501080_0211419_812_1216 132
185 3300049742 Ga0501080_0212108 Ga0501080_0212108_1184_1588 132
186 3300049742 Ga0501080_0355340 Ga0501080_0355340_812_1216 132
187 3300049744 Ga0501083_0035874 Ga0501083_0035874_1920_2324 132
188 3300049744 Ga0501083_0056240 Ga0501083_0056240_1911_2315 132
189 3300049744 Ga0501083_0937034 Ga0501083_0937034_92_496 132
190 3300049822 Ga0501035_0004162 Ga0501035_0004162_710_1114 132
191 3300049822 Ga0501035_0031432 Ga0501035_0031432_1881_2285 132
192 3300049822 Ga0501035_0155874 Ga0501035_0155874_705_1109 132
193 3300049822 Ga0501035_0237985 Ga0501035_0237985_940_1344 132
194 3300049823 Ga0501044_0028283 Ga0501044_0028283_822_1226 132
195 3300049823 Ga0501044_0028487 Ga0501044_0028487_2151_2555 132
196 3300049823 Ga0501044_0225064 Ga0501044_0225064_704_1108 132
197 3300049823 Ga0501044_1519894 Ga0501044_1519894_69_473 132
198 3300060353 Ga0501082_0091620 Ga0501082_0091620_2029_2433 132
199 3300060353 Ga0501082_0364978 Ga0501082_0364978_311_715 132
200 3300005545 Ga0070695_100016925 Ga0070695_1000169254 133
201 3300005549 Ga0070704_100384552 Ga0070704_1003845522 133
202 3300005564 Ga0070664_100424047 Ga0070664_1004240472 133
203 3300005844 Ga0068862_102174558 Ga0068862_1021745581 133
204 3300005983 Ga0081540_1011671 Ga0081540_10116713 133
205 3300009147 Ga0114129_10520875 Ga0114129_105208752 133
206 3300028800 Ga0265338_10104195 Ga0265338_101041953 133
207 3300035084 Ga0373928_0146741 Ga0373928_0146741_108_515 133
208 3300042876 Ga0451577_0220266 Ga0451577_0220266_960_1367 133
209 3300046692 Ga0495671_0282819 Ga0495671_0282819_347_748 133
210 3300049571 Ga0501034_0566404 Ga0501034_0566404_562_966 133
211 3300049572 Ga0501036_0856612 Ga0501036_0856612_170_574 133
212 3300049586 Ga0501070_0386462 Ga0501070_0386462_20_424 133
213 3300049589 Ga0501073_0021034 Ga0501073_0021034_2636_3040 133
214 3300049742 Ga0501080_0268775 Ga0501080_0268775_488_892 133
215 3300060353 Ga0501082_0424803 Ga0501082_0424803_742_1146 133
216 3300006038 Ga0075365_10650917 Ga0075365_106509172 134
217 3300031731 Ga0307405_10290841 Ga0307405_102908412 134
218 3300031911 Ga0307412_11074958 Ga0307412_110749582 134
219 3300032005 Ga0307411_10595015 Ga0307411_105950151 134
220 3300049589 Ga0501073_1092508 Ga0501073_1092508_85_495 134
221 iso_pu_bacteria 2513237096 2513656529 134
222 iso_pu_bacteria 2513237137 2513859587 134
223 iso_pu_bacteria 2513237145 2513917714 134
224 iso_pu_bacteria 2517572143 2517893213 134
225 iso_pu_bacteria 2524023228 2524537233 134
226 iso_pu_bacteria 2667528175 2671117849 134
227 iso_pu_bacteria 2728368998 2728754551 134
228 iso_pu_bacteria 2791355197 2793069920 134
229 iso_pu_bacteria 2885374607 2885374804 134
230 iso_pu_bacteria 2903748898 2903755677 134
231 iso_pu_bacteria 2904690495 2904696426 134
232 iso_pu_bacteria 2904699407 2904704182 134
233 iso_pu_bacteria 2906610324 2906617583 134
234 iso_pu_bacteria 2906635258 2906635782 134
235 iso_pu_bacteria 2906660503 2906667914 134
236 iso_pu_bacteria 2908739725 2908743606 134
237 iso_pu_bacteria 2908756301 2908760277 134
238 iso_pu_bacteria 2922425934 2922429270 134
239 iso_pu_bacteria 2935630451 2935634150 134
240 iso_pu_bacteria 2941507105 2941511041 134
241 iso_pu_bacteria 2941515067 2941518425 134
242 iso_pu_bacteria 2941523033 2941527312 134
243 iso_pu_bacteria 3005474847 3005479434 134
244 iso_pu_bacteria 8006933436 8006941719 134
245 iso_pu_bacteria 8006973647 8006981433 134
246 iso_pu_bacteria 8019555841 8019557620 134
247 iso_pu_bacteria 8019565922 8019567678 134
248 iso_pu_bacteria 8056689827 8056690290 134
249 3300005327 Ga0070658_10286481 Ga0070658_102864812 135
250 3300005338 Ga0068868_100605963 Ga0068868_1006059632 135
251 3300005366 Ga0070659_100254785 Ga0070659_1002547852 135
252 3300005458 Ga0070681_10300842 Ga0070681_103008422 135
253 3300005544 Ga0070686_100465063 Ga0070686_1004650631 135
254 3300005563 Ga0068855_100066702 Ga0068855_1000667026 135
255 3300009093 Ga0105240_11426704 Ga0105240_114267042 135
256 3300009551 Ga0105238_12370572 Ga0105238_123705721 135
257 3300013307 Ga0157372_10920762 Ga0157372_109207622 135
258 3300025909 Ga0207705_10364550 Ga0207705_103645502 135
259 3300025912 Ga0207707_10289784 Ga0207707_102897842 135
260 3300025913 Ga0207695_11061287 Ga0207695_110612872 135
261 3300025920 Ga0207649_11341592 Ga0207649_113415921 135
262 3300025949 Ga0207667_10073787 Ga0207667_100737873 135
263 3300037312 Ga0395899_0683153 Ga0395899_0683153_211_618 135
264 3300037418 Ga0395900_0244361 Ga0395900_0244361_106_513 135
265 3300038443 Ga0395901_0055512 Ga0395901_0055512_1760_2167 135
266 3300041459 Ga0451800_0740065 Ga0451800_0740065_292_699 135
267 3300044735 Ga0466968_0461810 Ga0466968_0461810_181_591 135
268 3300048088 Ga0495602_0680201 Ga0495602_0680201_269_676 135
269 3300049569 Ga0501032_0025970 Ga0501032_0025970_744_1157 135
270 3300049571 Ga0501034_0002259 Ga0501034_0002259_15101_15514 135
271 3300049571 Ga0501034_0339070 Ga0501034_0339070_215_628 135
272 3300049572 Ga0501036_0000954 Ga0501036_0000954_4286_4699 135
273 3300049573 Ga0501037_0022801 Ga0501037_0022801_3240_3653 135
274 3300049574 Ga0501038_0249903 Ga0501038_0249903_781_1194 135
275 3300049575 Ga0501039_0644395 Ga0501039_0644395_392_805 135
276 3300049576 Ga0501040_0633248 Ga0501040_0633248_50_463 135
277 3300049579 Ga0501043_0249203 Ga0501043_0249203_298_711 135
278 3300049580 Ga0501046_1157416 Ga0501046_1157416_44_475 135
279 3300049581 Ga0501047_0000218 Ga0501047_0000218_45735_46148 135
280 3300049581 Ga0501047_0428500 Ga0501047_0428500_99_512 135
281 3300049582 Ga0501048_0000313 Ga0501048_0000313_23065_23478 135
282 3300049585 Ga0501069_0004074 Ga0501069_0004074_3466_3879 135
283 3300049585 Ga0501069_0104471 Ga0501069_0104471_1151_1564 135
284 3300049585 Ga0501069_0160001 Ga0501069_0160001_194_607 135
285 3300049586 Ga0501070_0008769 Ga0501070_0008769_4356_4769 135
286 3300049586 Ga0501070_0013530 Ga0501070_0013530_4836_5249 135
287 3300049586 Ga0501070_0020750 Ga0501070_0020750_4523_4936 135
288 3300049586 Ga0501070_0243756 Ga0501070_0243756_220_633 135
289 3300049589 Ga0501073_0129211 Ga0501073_0129211_628_1041 135
290 3300049590 Ga0501074_0025868 Ga0501074_0025868_1897_2310 135
291 3300049742 Ga0501080_0001471 Ga0501080_0001471_14989_15402 135
292 3300049742 Ga0501080_1478101 Ga0501080_1478101_26_439 135
293 3300049744 Ga0501083_0001547 Ga0501083_0001547_5174_5587 135
294 3300049822 Ga0501035_0003871 Ga0501035_0003871_5290_5703 135
295 3300049822 Ga0501035_0278045 Ga0501035_0278045_515_928 135
296 3300049823 Ga0501044_0003277 Ga0501044_0003277_10418_10831 135
297 3300049823 Ga0501044_0046702 Ga0501044_0046702_595_1008 135
298 3300049823 Ga0501044_0734962 Ga0501044_0734962_117_530 135
299 3300060353 Ga0501082_0142783 Ga0501082_0142783_729_1142 135
300 3300060353 Ga0501082_1924510 Ga0501082_1924510_26_433 135
301 iso_pu_bacteria 2507262055 2507509482 135
302 iso_pu_bacteria 2508501009 2508543527 135
303 iso_pu_bacteria 2508501042 2508698695 135
304 iso_pu_bacteria 2508501128 2509153569 135
305 iso_pu_bacteria 2511231028 2511395146 135
306 iso_pu_bacteria 2513237092 2513624688 135
307 iso_pu_bacteria 2513237094 2513638049 135
308 iso_pu_bacteria 2513237095 2513646502 135
309 iso_pu_bacteria 2513237098 2513676796 135
310 iso_pu_bacteria 2513237101 2513691698 135
311 iso_pu_bacteria 2513237102 2513703084 135
312 iso_pu_bacteria 2513237104 2513717571 135
313 iso_pu_bacteria 2513237139 2513880217 135
314 iso_pu_bacteria 2513237141 2513889324 135
315 iso_pu_bacteria 2513237161 2514010655 135
316 iso_pu_bacteria 2515154112 2515631312 135
317 iso_pu_bacteria 2517093001 2517106642 135
318 iso_pu_bacteria 2524023205 2524439753 135
319 iso_pu_bacteria 2524023210 2524469856 135
320 iso_pu_bacteria 2528768022 2528853497 135
321 iso_pu_bacteria 2602042107 2603859721 135
322 iso_pu_bacteria 2617270735 2617354245 135
323 iso_pu_bacteria 2617270741 2617376604 135
324 iso_pu_bacteria 2643221651 2644288180 135
325 iso_pu_bacteria 2721755755 2723845889 135
326 iso_pu_bacteria 2744054633 2745078941 135
327 iso_pu_bacteria 2791355196 2793064762 135
328 iso_pu_bacteria 2791355199 2793081808 135
329 iso_pu_bacteria 2802429603 2805920222 135
330 iso_pu_bacteria 2816332527 2818240303 135
331 iso_pu_bacteria 2824600985 2824604149 135
332 iso_pu_bacteria 2824609381 2824613138 135
333 iso_pu_bacteria 2824617872 2824622944 135
334 iso_pu_bacteria 2824626560 2824630750 135
335 iso_pu_bacteria 2824635225 2824639536 135
336 iso_pu_bacteria 2824644064 2824647696 135
337 iso_pu_bacteria 2824653114 2824655858 135
338 iso_pu_bacteria 2824661429 2824666269 135
339 iso_pu_bacteria 2824671348 2824676924 135
340 iso_pu_bacteria 2824679649 2824684257 135
341 iso_pu_bacteria 2824687955 2824693778 135
342 iso_pu_bacteria 2824696289 2824699310 135
343 iso_pu_bacteria 2824704595 2824709542 135
344 iso_pu_bacteria 2824714736 2824719325 135
345 iso_pu_bacteria 2824723954 2824729746 135
346 iso_pu_bacteria 2824732956 2824738632 135
347 iso_pu_bacteria 2824746037 2824750705 135
348 iso_pu_bacteria 2824753945 2824756613 135
349 iso_pu_bacteria 2824763712 2824767256 135
350 iso_pu_bacteria 2824773399 2824779250 135
351 iso_pu_bacteria 2838122688 2838128645 135
352 iso_pu_bacteria 2841941048 2841948828 135
353 iso_pu_bacteria 2841949485 2841950792 135
354 iso_pu_bacteria 2841957949 2841964468 135
355 iso_pu_bacteria 2841966195 2841967104 135
356 iso_pu_bacteria 2841974524 2841975852 135
357 iso_pu_bacteria 2841983080 2841989974 135
358 iso_pu_bacteria 2842038055 2842039897 135
359 iso_pu_bacteria 2842045827 2842047158 135
360 iso_pu_bacteria 2844315083 2844318253 135
361 iso_pu_bacteria 2847930680 2847935124 135
362 iso_pu_bacteria 2847939898 2847945688 135
363 iso_pu_bacteria 2849076700 2849080140 135
364 iso_pu_bacteria 2857509624 2857510478 135
365 iso_pu_bacteria 2857524615 2857530692 135
366 iso_pu_bacteria 2874590934 2874591561 135
367 iso_pu_bacteria 2874604998 2874609465 135
368 iso_pu_bacteria 2874612657 2874612709 135
369 iso_pu_bacteria 2874620515 2874627031 135
370 iso_pu_bacteria 2874628541 2874636400 135
371 iso_pu_bacteria 2874645413 2874646266 135
372 iso_pu_bacteria 2876761206 2876770875 135
373 iso_pu_bacteria 2876771140 2876771696 135
374 iso_pu_bacteria 2876808645 2876808910 135
375 iso_pu_bacteria 2876818435 2876819004 135
376 iso_pu_bacteria 2879074833 2879075483 135
377 iso_pu_bacteria 2879083081 2879083495 135
378 iso_pu_bacteria 2879099564 2879102226 135
379 iso_pu_bacteria 2879110137 2879110298 135
380 iso_pu_bacteria 2879127579 2879134628 135
381 iso_pu_bacteria 2879142872 2879149837 135
382 iso_pu_bacteria 2881364244 2881366578 135
383 iso_pu_bacteria 2881665667 2881673127 135
384 iso_pu_bacteria 2885366525 2885373372 135
385 iso_pu_bacteria 2885409591 2885412676 135
386 iso_pu_bacteria 2888378607 2888383117 135
387 iso_pu_bacteria 2888388044 2888394719 135
388 iso_pu_bacteria 2888419890 2888423566 135
389 iso_pu_bacteria 2889033259 2889040732 135
390 iso_pu_bacteria 2893066018 2893070317 135
391 iso_pu_bacteria 2903727486 2903729200 135
392 iso_pu_bacteria 2903768456 2903775513 135
393 iso_pu_bacteria 2904666416 2904669732 135
394 iso_pu_bacteria 2904711408 2904717027 135
395 iso_pu_bacteria 2906602504 2906605146 135
396 iso_pu_bacteria 2906626472 2906627946 135
397 iso_pu_bacteria 2906643746 2906651097 135
398 iso_pu_bacteria 2908775508 2908779290 135
399 iso_pu_bacteria 2919073203 2919076269 135
400 iso_pu_bacteria 2922361189 2922367831 135
401 iso_pu_bacteria 2922368715 2922373313 135
402 iso_pu_bacteria 2922386360 2922392268 135
403 iso_pu_bacteria 2922393267 2922395504 135
404 iso_pu_bacteria 2929615660 2929617101 135
405 iso_pu_bacteria 2929624759 2929626787 135
406 iso_pu_bacteria 2932784394 2932791902 135
407 iso_pu_bacteria 2932794094 2932796369 135
408 iso_pu_bacteria 2932801729 2932804324 135
409 iso_pu_bacteria 2932809354 2932815642 135
410 iso_pu_bacteria 2932818245 2932819278 135
411 iso_pu_bacteria 2932828146 2932835975 135
412 iso_pu_bacteria 2933577622 2933579058 135
413 iso_pu_bacteria 2935608549 2935611637 135
414 iso_pu_bacteria 2935616580 2935624304 135
415 iso_pu_bacteria 2935638405 2935647291 135
416 iso_pu_bacteria 2935648319 2935651702 135
417 iso_pu_bacteria 2935656913 2935660512 135
418 iso_pu_bacteria 2935665750 2935674403 135
419 iso_pu_bacteria 2935675223 2935678310 135
420 iso_pu_bacteria 2935684952 2935688264 135
421 iso_pu_bacteria 2935694250 2935698929 135
422 iso_pu_bacteria 2935703347 2935708547 135
423 iso_pu_bacteria 2935713505 2935715283 135
424 iso_pu_bacteria 2935722832 2935726152 135
425 iso_pu_bacteria 2935732158 2935734102 135
426 iso_pu_bacteria 2935741537 2935743481 135
427 iso_pu_bacteria 2935750917 2935754481 135
428 iso_pu_bacteria 2935760218 2935768251 135
429 iso_pu_bacteria 2935769743 2935775868 135
430 iso_pu_bacteria 2935777560 2935780706 135
431 iso_pu_bacteria 2935785616 2935791395 135
432 iso_pu_bacteria 2935793552 2935799729 135
433 iso_pu_bacteria 2935801545 2935809381 135
434 iso_pu_bacteria 2935810662 2935818948 135
435 iso_pu_bacteria 2935819856 2935821114 135
436 iso_pu_bacteria 2935827899 2935836678 135
437 iso_pu_bacteria 2935837841 2935846467 135
438 iso_pu_bacteria 2935847175 2935850626 135
439 iso_pu_bacteria 2935855204 2935862662 135
440 iso_pu_bacteria 2935864058 2935871739 135
441 iso_pu_bacteria 2935873716 2935881894 135
442 iso_pu_bacteria 2935883170 2935888737 135
443 iso_pu_bacteria 2935908558 2935915497 135
444 iso_pu_bacteria 2935916978 2935921401 135
445 iso_pu_bacteria 2935926038 2935932904 135
446 iso_pu_bacteria 2935934488 2935941485 135
447 iso_pu_bacteria 2935942939 2935949678 135
448 iso_pu_bacteria 2935951376 2935958373 135
449 iso_pu_bacteria 2935959822 2935964447 135
450 iso_pu_bacteria 2935967501 2935974457 135
451 iso_pu_bacteria 2935975950 2935980829 135
452 iso_pu_bacteria 2935984226 2935990313 135
453 iso_pu_bacteria 2935992306 2935998837 135
454 iso_pu_bacteria 2936002035 2936007392 135
455 iso_pu_bacteria 2936011229 2936014568 135
456 iso_pu_bacteria 2936019824 2936023636 135
457 iso_pu_bacteria 2936028420 2936032664 135
458 iso_pu_bacteria 2936037263 2936045662 135
459 iso_pu_bacteria 2936046547 2936050309 135
460 iso_pu_bacteria 2936055302 2936059199 135
461 iso_pu_bacteria 2940556831 2940560142 135
462 iso_pu_bacteria 2941531003 2941534011 135
463 iso_pu_bacteria 2941538514 2941546886 135
464 iso_pu_bacteria 3005483717 3005489330 135
465 iso_pu_bacteria 3005506211 3005511751 135
466 iso_pu_bacteria 3005587118 3005590878 135
467 iso_pu_bacteria 3005594810 3005598326 135
468 iso_pu_bacteria 3005710791 3005714035 135
469 iso_pu_bacteria 3005718088 3005721488 135
470 iso_pu_bacteria 8006926726 8006929550 135
471 iso_pu_bacteria 8006964411 8006968671 135
472 iso_pu_bacteria 8006984368 8006991202 135
473 iso_pu_bacteria 8006994254 8006996347 135
474 iso_pu_bacteria 8016511872 8016514423 135
475 iso_pu_bacteria 8016522445 8016530524 135
476 iso_pu_bacteria 8016530956 8016535801 135
477 iso_pu_bacteria 8016539877 8016540082 135
478 iso_pu_bacteria 8016548790 8016553149 135
479 iso_pu_bacteria 8016575299 8016578252 135
480 iso_pu_bacteria 8016583857 8016592943 135
481 iso_pu_bacteria 8016595262 8016599375 135
482 iso_pu_bacteria 8016603502 8016611663 135
483 iso_pu_bacteria 8016613128 8016622136 135
484 iso_pu_bacteria 8016622563 8016627711 135
485 iso_pu_bacteria 8016630954 8016631998 135
486 iso_pu_bacteria 8017057580 8017062002 135
487 iso_pu_bacteria 8019530166 8019535529 135
488 iso_pu_bacteria 8019538911 8019543951 135
489 iso_pu_bacteria 8019547302 8019554818 135
490 iso_pu_bacteria 8019576017 8019581542 135
491 iso_pu_bacteria 8019586578 8019589173 135
492 iso_pu_bacteria 8019597564 8019602060 135
493 iso_pu_bacteria 8019608314 8019616496 135
494 iso_pu_bacteria 8019619141 8019627177 135
495 iso_pu_bacteria 8019629233 8019635372 135
496 iso_pu_bacteria 8019638758 8019644332 135
497 iso_pu_bacteria 8019648815 8019657383 135
498 iso_pu_bacteria 8019668869 8019672805 135
499 iso_pu_bacteria 8019678201 8019683334 135
500 iso_pu_bacteria 8019687851 8019689043 135
501 iso_pu_bacteria 8055742211 8055747304 135
502 iso_pu_bacteria 8056673599 8056678081 135
503 iso_pu_bacteria 8056681323 8056688653 135
504 iso_pu_bacteria 8056967851 8056972608 135
505 3300003659 JGI25404J52841_10000992 JGI25404J52841_100009923 136
506 3300005719 Ga0068861_100645726 Ga0068861_1006457262 136
507 3300005983 Ga0081540_1000078 Ga0081540_100007811 136
508 3300006038 Ga0075365_10073540 Ga0075365_100735401 136
509 3300006042 Ga0075368_10028979 Ga0075368_100289793 136
510 3300006048 Ga0075363_100192276 Ga0075363_1001922762 136
511 3300006051 Ga0075364_10017856 Ga0075364_100178562 136
512 3300006177 Ga0075362_10185470 Ga0075362_101854702 136
513 3300006178 Ga0075367_10016210 Ga0075367_100162103 136
514 3300006186 Ga0075369_10026897 Ga0075369_100268973 136
515 3300027866 Ga0209813_10027793 Ga0209813_100277932 136
516 3300030521 Ga0307511_10055045 Ga0307511_100550452 136
517 3300031241 Ga0265325_10006325 Ga0265325_100063256 136
518 3300031241 Ga0265325_10049142 Ga0265325_100491422 136
519 3300031595 Ga0265313_10000981 Ga0265313_1000098114 136
520 3300031595 Ga0265313_10019957 Ga0265313_100199573 136
521 3300039453 Ga0436362_1262541 Ga0436362_1262541_344_757 136
522 3300041491 Ga0451833_0331726 Ga0451833_0331726_116_529 136
523 3300049571 Ga0501034_0000097 Ga0501034_0000097_16098_16514 136
524 3300049579 Ga0501043_0088362 Ga0501043_0088362_129_548 136
525 3300049823 Ga0501044_0309092 Ga0501044_0309092_102_521 136
526 3300050489 nmdc:mga03683_452063_c1 nmdc:mga03683_452063_c1_106_516 136
527 3300050490 nmdc:mga03n38_90892_c1 nmdc:mga03n38_90892_c1_579_989 136
528 3300050491 nmdc:mga00v17_355349_c1 nmdc:mga00v17_355349_c1_390_800 136
529 3300050494 nmdc:mga06z11_7502_c2 nmdc:mga06z11_7502_c2_229_639 136
530 3300050495 nmdc:mga04h51_43633_c1 nmdc:mga04h51_43633_c1_287_697 136
531 3300053090 Ga0500646_0015483 Ga0500646_0015483_34_447 136
532 3300005327 Ga0070658_10149359 Ga0070658_101493591 137
533 3300005327 Ga0070658_10906256 Ga0070658_109062561 137
534 3300005335 Ga0070666_10204390 Ga0070666_102043902 137
535 3300005336 Ga0070680_100938115 Ga0070680_1009381152 137
536 3300005336 Ga0070680_101444324 Ga0070680_1014443241 137
537 3300005337 Ga0070682_101602459 Ga0070682_1016024591 137
538 3300005339 Ga0070660_100048937 Ga0070660_1000489373 137
539 3300005530 Ga0070679_100030530 Ga0070679_1000305304 137
540 3300005539 Ga0068853_100352869 Ga0068853_1003528692 137
541 3300005548 Ga0070665_100066447 Ga0070665_1000664474 137
542 3300006028 Ga0070717_10289645 Ga0070717_102896452 137
543 3300006038 Ga0075365_10916572 Ga0075365_109165722 137
544 3300009551 Ga0105238_10415771 Ga0105238_104157712 137
545 3300025295 Ga0209564_1001156 Ga0209564_100115628 137
546 3300025903 Ga0207680_10173416 Ga0207680_101734162 137
547 3300025909 Ga0207705_10280032 Ga0207705_102800322 137
548 3300025909 Ga0207705_11206356 Ga0207705_112063562 137
549 3300025914 Ga0207671_10642102 Ga0207671_106421021 137
550 3300025917 Ga0207660_10821803 Ga0207660_108218031 137
551 3300025919 Ga0207657_10036448 Ga0207657_100364485 137
552 3300025921 Ga0207652_10496350 Ga0207652_104963502 137
553 3300025924 Ga0207694_10368202 Ga0207694_103682022 137
554 3300025949 Ga0207667_12090430 Ga0207667_120904301 137
555 3300026041 Ga0207639_10186737 Ga0207639_101867373 137
556 3300028379 Ga0268266_10691801 Ga0268266_106918012 137
557 3300033544 Ga0316215_1000403 Ga0316215_10004036 137
558 3300035170 Ga0373943_0351345 Ga0373943_0351345_328_741 137
559 3300035692 Ga0373935_0874635 Ga0373935_0874635_67_480 137
560 3300036459 Ga0372808_015907 Ga0372808_015907_401_814 137
561 3300037466 Ga0395898_0698736 Ga0395898_0698736_212_625 137
562 3300038443 Ga0395901_0004877 Ga0395901_0004877_1865_2278 137
563 3300039450 Ga0436363_0875311 Ga0436363_0875311_167_580 137
564 3300041512 Ga0451853_0930264 Ga0451853_0930264_19_432 137
565 3300047470 Ga0495681_0206626 Ga0495681_0206626_42_455 137
566 3300048923 Ga0496120_0266101 Ga0496120_0266101_342_758 137
567 3300048925 Ga0496122_0077133 Ga0496122_0077133_1050_1463 137
568 3300048926 Ga0496123_0013979 Ga0496123_0013979_1570_1983 137
569 3300053080 Ga0500635_0117012 Ga0500635_0117012_46_459 137
570 3300053177 Ga0500636_0391545 Ga0500636_0391545_38_451 137
571 3300005355 Ga0070671_100255490 Ga0070671_1002554902 138
572 3300005367 Ga0070667_100071976 Ga0070667_1000719763 138
573 3300005539 Ga0068853_100163391 Ga0068853_1001633913 138
574 3300006051 Ga0075364_10839692 Ga0075364_108396922 138
575 3300006941 Ga0099825_1047377 Ga0099825_10473771 138
576 3300006942 Ga0099824_1023470 Ga0099824_10234702 138
577 3300006943 Ga0099822_1004035 Ga0099822_10040357 138
578 3300009098 Ga0105245_10720148 Ga0105245_107201482 138
579 3300009176 Ga0105242_10745987 Ga0105242_107459872 138
580 3300009545 Ga0105237_11162144 Ga0105237_111621441 138
581 3300009551 Ga0105238_10474043 Ga0105238_104740432 138
582 3300013308 Ga0157375_10357037 Ga0157375_103570371 138
583 3300025261 Ga0209233_1005770 Ga0209233_10057703 138
584 3300025904 Ga0207647_10149911 Ga0207647_101499112 138
585 3300025906 Ga0207699_10545033 Ga0207699_105450331 138
586 3300025914 Ga0207671_10152369 Ga0207671_101523692 138
587 3300025931 Ga0207644_10272234 Ga0207644_102722342 138
588 3300025932 Ga0207690_11300209 Ga0207690_113002091 138
589 3300025986 Ga0207658_10617486 Ga0207658_106174862 138
590 3300026041 Ga0207639_10265470 Ga0207639_102654702 138
591 3300026041 Ga0207639_12082108 Ga0207639_120821081 138
592 3300026116 Ga0207674_10272814 Ga0207674_102728142 138
593 3300027357 Ga0209589_1000023 Ga0209589_1000023121 138
594 3300027361 Ga0209489_100032 Ga0209489_100032121 138
595 3300027363 Ga0209700_100040 Ga0209700_100040121 138
596 3300028577 Ga0265318_10005881 Ga0265318_100058813 138
597 3300028786 Ga0307517_10146591 Ga0307517_101465912 138
598 3300031238 Ga0265332_10028102 Ga0265332_100281022 138
599 3300031240 Ga0265320_10089465 Ga0265320_100894652 138
600 3300031250 Ga0265331_10011501 Ga0265331_100115013 138
601 3300031595 Ga0265313_10009741 Ga0265313_100097416 138
602 3300031616 Ga0307508_10049041 Ga0307508_100490413 138
603 3300031711 Ga0265314_10022986 Ga0265314_100229863 138
604 3300031730 Ga0307516_10062049 Ga0307516_100620494 138
605 3300031730 Ga0307516_10067559 Ga0307516_100675593 138
606 3300033180 Ga0307510_10021433 Ga0307510_100214332 138
607 3300033180 Ga0307510_10476261 Ga0307510_104762612 138
608 3300033442 Ga0315911_1000029 Ga0315911_100002980 138
609 3300035695 Ga0373927_0071356 Ga0373927_0071356_841_1257 138
610 3300035725 Ga0373947_0089334 Ga0373947_0089334_507_923 138
611 3300037418 Ga0395900_1391878 Ga0395900_1391878_166_582 138
612 3300044694 Ga0466963_0372574 Ga0466963_0372574_565_984 138
613 3300045976 Ga0466967_0321436 Ga0466967_0321436_790_1209 138
614 3300046473 Ga0495582_0068186 Ga0495582_0068186_504_920 138
615 3300046477 Ga0495664_0179487 Ga0495664_0179487_445_861 138
616 3300046499 Ga0495594_0183369 Ga0495594_0183369_737_1153 138
617 3300046500 Ga0495596_0304914 Ga0495596_0304914_162_599 138
618 3300046517 Ga0495630_0183448 Ga0495630_0183448_961_1377 138
619 3300046683 Ga0495658_0112430 Ga0495658_0112430_199_615 138
620 3300046689 Ga0495613_0754219 Ga0495613_0754219_212_628 138
621 3300046694 Ga0495649_0103902 Ga0495649_0103902_988_1425 138
622 3300047315 Ga0495581_0115934 Ga0495581_0115934_1027_1443 138
623 3300048909 Ga0496106_0198337 Ga0496106_0198337_1083_1499 138
624 3300048910 Ga0496107_0368757 Ga0496107_0368757_583_999 138
625 3300048924 Ga0496121_0299067 Ga0496121_0299067_649_1068 138
626 3300048924 Ga0496121_0426589 Ga0496121_0426589_218_634 138
627 3300048924 Ga0496121_0691051 Ga0496121_0691051_91_507 138
628 3300048929 Ga0496126_0490743 Ga0496126_0490743_36_455 138
629 3300049460 Ga0495682_0055320 Ga0495682_0055320_57_473 138
630 3300049569 Ga0501032_0175928 Ga0501032_0175928_398_814 138
631 3300049570 Ga0501033_0208230 Ga0501033_0208230_131_547 138
632 3300049570 Ga0501033_0433195 Ga0501033_0433195_343_759 138
633 3300049572 Ga0501036_0095395 Ga0501036_0095395_970_1386 138
634 3300049573 Ga0501037_0087850 Ga0501037_0087850_912_1328 138
635 3300049573 Ga0501037_0489104 Ga0501037_0489104_85_501 138
636 3300049574 Ga0501038_0022218 Ga0501038_0022218_2258_2674 138
637 3300049579 Ga0501043_0028919 Ga0501043_0028919_2878_3294 138
638 3300049581 Ga0501047_0020544 Ga0501047_0020544_4582_4998 138
639 3300049583 Ga0501067_0847536 Ga0501067_0847536_38_454 138
640 3300049822 Ga0501035_0115864 Ga0501035_0115864_1027_1443 138
641 3300049822 Ga0501035_0344231 Ga0501035_0344231_422_838 138
642 3300049823 Ga0501044_0060110 Ga0501044_0060110_1416_1832 138
643 3300049823 Ga0501044_1124990 Ga0501044_1124990_92_526 138
644 3300050491 nmdc:mga00v17_861541_c1 nmdc:mga00v17_861541_c1_39_461 138
645 3300050496 nmdc:mga07m45_715701_c1 nmdc:mga07m45_715701_c1_11_433 138
646 3300053085 Ga0495619_0028185 Ga0495619_0028185_2083_2499 138
647 3300053094 Ga0500566_0320426 Ga0500566_0320426_73_489 138
648 3300053123 Ga0500614_230207 Ga0500614_230207_38_454 138
649 3300053178 Ga0500637_0235201 Ga0500637_0235201_558_977 138
650 3300002070 JGI24750J21931_1013116 JGI24750J21931_10131162 139
651 3300002075 JGI24738J21930_10025285 JGI24738J21930_100252852 139
652 3300003203 JGI25406J46586_10000006 JGI25406J46586_1000000645 139
653 3300003203 JGI25406J46586_10005846 JGI25406J46586_100058466 139
654 3300003214 JGI25165J46597_1010789 JGI25165J46597_10107892 139
655 3300003215 JGI25153J46596_10000510 JGI25153J46596_1000051015 139
656 3300003215 JGI25153J46596_10007100 JGI25153J46596_100071003 139
657 3300003215 JGI25153J46596_10016687 JGI25153J46596_100166873 139
658 3300003215 JGI25153J46596_10027718 JGI25153J46596_100277182 139
659 3300003215 JGI25153J46596_10034203 JGI25153J46596_100342032 139
660 3300003215 JGI25153J46596_10047453 JGI25153J46596_100474531 139
661 3300003215 JGI25153J46596_10047482 JGI25153J46596_100474821 139
662 3300003354 JGI25160J50197_1004341 JGI25160J50197_10043413 139
663 3300003354 JGI25160J50197_1018879 JGI25160J50197_10188792 139
664 3300003659 JGI25404J52841_10004569 JGI25404J52841_100045692 139
665 3300003659 JGI25404J52841_10027147 JGI25404J52841_100271472 139
666 3300003659 JGI25404J52841_10032072 JGI25404J52841_100320722 139
667 3300003659 JGI25404J52841_10059632 JGI25404J52841_100596322 139
668 3300003659 JGI25404J52841_10088221 JGI25404J52841_100882212 139
669 3300003794 Ga0055531_10011097 Ga0055531_100110976 139
670 3300003794 Ga0055531_10043389 Ga0055531_100433892 139
671 3300004625 Ga0055543_1002757 Ga0055543_10027573 139
672 3300005262 Ga0065165_1002461 Ga0065165_10024612 139
673 3300005262 Ga0065165_1009234 Ga0065165_10092342 139
674 3300005262 Ga0065165_1027172 Ga0065165_10271723 139
675 3300005327 Ga0070658_10210403 Ga0070658_102104032 139
676 3300005328 Ga0070676_10248752 Ga0070676_102487522 139
677 3300005329 Ga0070683_100204348 Ga0070683_1002043483 139
678 3300005329 Ga0070683_100223631 Ga0070683_1002236312 139
679 3300005329 Ga0070683_100398230 Ga0070683_1003982302 139
680 3300005329 Ga0070683_101099875 Ga0070683_1010998751 139
681 3300005331 Ga0070670_100183475 Ga0070670_1001834751 139
682 3300005331 Ga0070670_100298651 Ga0070670_1002986512 139
683 3300005331 Ga0070670_100364772 Ga0070670_1003647722 139
684 3300005334 Ga0068869_100033046 Ga0068869_1000330461 139
685 3300005334 Ga0068869_100123461 Ga0068869_1001234612 139
686 3300005334 Ga0068869_100419802 Ga0068869_1004198021 139
687 3300005335 Ga0070666_10063159 Ga0070666_100631592 139
688 3300005336 Ga0070680_100075697 Ga0070680_1000756973 139
689 3300005336 Ga0070680_100112740 Ga0070680_1001127403 139
690 3300005336 Ga0070680_100122249 Ga0070680_1001222493 139
691 3300005336 Ga0070680_100158386 Ga0070680_1001583862 139
692 3300005336 Ga0070680_100250123 Ga0070680_1002501231 139
693 3300005337 Ga0070682_100175405 Ga0070682_1001754052 139
694 3300005337 Ga0070682_100481000 Ga0070682_1004810002 139
695 3300005338 Ga0068868_100114731 Ga0068868_1001147313 139
696 3300005338 Ga0068868_101747575 Ga0068868_1017475751 139
697 3300005339 Ga0070660_100007203 Ga0070660_1000072039 139
698 3300005339 Ga0070660_100217746 Ga0070660_1002177462 139
699 3300005339 Ga0070660_101235167 Ga0070660_1012351671 139
700 3300005340 Ga0070689_100773904 Ga0070689_1007739042 139
701 3300005343 Ga0070687_100239198 Ga0070687_1002391982 139
702 3300005344 Ga0070661_100096947 Ga0070661_1000969473 139
703 3300005344 Ga0070661_100504127 Ga0070661_1005041272 139
704 3300005347 Ga0070668_100131603 Ga0070668_1001316032 139
705 3300005347 Ga0070668_100151203 Ga0070668_1001512032 139
706 3300005347 Ga0070668_100524144 Ga0070668_1005241442 139
707 3300005347 Ga0070668_100682666 Ga0070668_1006826661 139
708 3300005347 Ga0070668_100718099 Ga0070668_1007180991 139
709 3300005347 Ga0070668_101422706 Ga0070668_1014227061 139
710 3300005353 Ga0070669_100065476 Ga0070669_1000654763 139
711 3300005353 Ga0070669_100207419 Ga0070669_1002074192 139
712 3300005354 Ga0070675_100361154 Ga0070675_1003611542 139
713 3300005355 Ga0070671_100041710 Ga0070671_1000417103 139
714 3300005355 Ga0070671_100142821 Ga0070671_1001428213 139
715 3300005355 Ga0070671_100244428 Ga0070671_1002444282 139
716 3300005355 Ga0070671_100907920 Ga0070671_1009079202 139
717 3300005356 Ga0070674_100141025 Ga0070674_1001410251 139
718 3300005356 Ga0070674_100325546 Ga0070674_1003255462 139
719 3300005356 Ga0070674_100634970 Ga0070674_1006349702 139
720 3300005364 Ga0070673_100725690 Ga0070673_1007256901 139
721 3300005364 Ga0070673_100760850 Ga0070673_1007608501 139
722 3300005364 Ga0070673_100876679 Ga0070673_1008766791 139
723 3300005365 Ga0070688_100352725 Ga0070688_1003527252 139
724 3300005366 Ga0070659_100122746 Ga0070659_1001227462 139
725 3300005366 Ga0070659_100240154 Ga0070659_1002401542 139
726 3300005366 Ga0070659_100286131 Ga0070659_1002861311 139
727 3300005366 Ga0070659_100650765 Ga0070659_1006507651 139
728 3300005366 Ga0070659_100987211 Ga0070659_1009872111 139
729 3300005367 Ga0070667_100091359 Ga0070667_1000913592 139
730 3300005367 Ga0070667_100578510 Ga0070667_1005785101 139
731 3300005367 Ga0070667_100977338 Ga0070667_1009773382 139
732 3300005434 Ga0070709_10001628 Ga0070709_100016284 139
733 3300005434 Ga0070709_10003678 Ga0070709_100036789 139
734 3300005434 Ga0070709_10005420 Ga0070709_100054207 139
735 3300005434 Ga0070709_10182552 Ga0070709_101825522 139
736 3300005434 Ga0070709_10224189 Ga0070709_102241892 139
737 3300005434 Ga0070709_10472683 Ga0070709_104726831 139
738 3300005434 Ga0070709_10541067 Ga0070709_105410671 139
739 3300005435 Ga0070714_100002376 Ga0070714_1000023764 139
740 3300005435 Ga0070714_100048174 Ga0070714_1000481743 139
741 3300005435 Ga0070714_100123273 Ga0070714_1001232732 139
742 3300005435 Ga0070714_100170820 Ga0070714_1001708203 139
743 3300005435 Ga0070714_100278620 Ga0070714_1002786201 139
744 3300005435 Ga0070714_100353731 Ga0070714_1003537312 139
745 3300005436 Ga0070713_100052364 Ga0070713_1000523643 139
746 3300005436 Ga0070713_100058151 Ga0070713_1000581514 139
747 3300005436 Ga0070713_100101855 Ga0070713_1001018553 139
748 3300005436 Ga0070713_100151341 Ga0070713_1001513412 139
749 3300005436 Ga0070713_100183853 Ga0070713_1001838532 139
750 3300005436 Ga0070713_100277405 Ga0070713_1002774051 139
751 3300005437 Ga0070710_10009467 Ga0070710_100094672 139
752 3300005437 Ga0070710_10011580 Ga0070710_100115802 139
753 3300005437 Ga0070710_10017128 Ga0070710_100171283 139
754 3300005437 Ga0070710_10037554 Ga0070710_100375543 139
755 3300005437 Ga0070710_10305953 Ga0070710_103059532 139
756 3300005437 Ga0070710_10525215 Ga0070710_105252151 139
757 3300005439 Ga0070711_100008430 Ga0070711_1000084306 139
758 3300005439 Ga0070711_100021977 Ga0070711_1000219773 139
759 3300005439 Ga0070711_100027214 Ga0070711_1000272144 139
760 3300005439 Ga0070711_100027696 Ga0070711_1000276963 139
761 3300005439 Ga0070711_100047019 Ga0070711_1000470191 139
762 3300005439 Ga0070711_100193186 Ga0070711_1001931862 139
763 3300005440 Ga0070705_100097327 Ga0070705_1000973271 139
764 3300005441 Ga0070700_100099116 Ga0070700_1000991162 139
765 3300005441 Ga0070700_100557134 Ga0070700_1005571341 139
766 3300005445 Ga0070708_100147838 Ga0070708_1001478382 139
767 3300005455 Ga0070663_100037934 Ga0070663_1000379344 139
768 3300005455 Ga0070663_100056235 Ga0070663_1000562353 139
769 3300005455 Ga0070663_100064061 Ga0070663_1000640612 139
770 3300005455 Ga0070663_100066376 Ga0070663_1000663763 139
771 3300005455 Ga0070663_100083980 Ga0070663_1000839803 139
772 3300005455 Ga0070663_100111419 Ga0070663_1001114192 139
773 3300005455 Ga0070663_100309249 Ga0070663_1003092492 139
774 3300005455 Ga0070663_100468178 Ga0070663_1004681782 139
775 3300005455 Ga0070663_100518985 Ga0070663_1005189851 139
776 3300005455 Ga0070663_100630561 Ga0070663_1006305611 139
777 3300005456 Ga0070678_100209164 Ga0070678_1002091642 139
778 3300005457 Ga0070662_100234417 Ga0070662_1002344172 139
779 3300005457 Ga0070662_100380019 Ga0070662_1003800192 139
780 3300005457 Ga0070662_100598247 Ga0070662_1005982472 139
781 3300005458 Ga0070681_10298395 Ga0070681_102983952 139
782 3300005458 Ga0070681_10390542 Ga0070681_103905423 139
783 3300005459 Ga0068867_100164177 Ga0068867_1001641772 139
784 3300005459 Ga0068867_100526079 Ga0068867_1005260792 139
785 3300005459 Ga0068867_100973564 Ga0068867_1009735642 139
786 3300005466 Ga0070685_10349341 Ga0070685_103493411 139
787 3300005466 Ga0070685_10870649 Ga0070685_108706491 139
788 3300005467 Ga0070706_100470186 Ga0070706_1004701862 139
789 3300005467 Ga0070706_100795113 Ga0070706_1007951132 139
790 3300005467 Ga0070706_101024918 Ga0070706_1010249181 139
791 3300005467 Ga0070706_101290858 Ga0070706_1012908581 139
792 3300005468 Ga0070707_100163692 Ga0070707_1001636923 139
793 3300005471 Ga0070698_100582717 Ga0070698_1005827171 139
794 3300005518 Ga0070699_100430031 Ga0070699_1004300312 139
795 3300005530 Ga0070679_100073537 Ga0070679_1000735373 139
796 3300005530 Ga0070679_100100999 Ga0070679_1001009993 139
797 3300005530 Ga0070679_100189659 Ga0070679_1001896592 139
798 3300005530 Ga0070679_100508480 Ga0070679_1005084802 139
799 3300005530 Ga0070679_100629681 Ga0070679_1006296812 139
800 3300005535 Ga0070684_100011426 Ga0070684_1000114262 139
801 3300005535 Ga0070684_100148044 Ga0070684_1001480442 139
802 3300005535 Ga0070684_100303438 Ga0070684_1003034382 139
803 3300005535 Ga0070684_101028007 Ga0070684_1010280072 139
804 3300005536 Ga0070697_100073865 Ga0070697_1000738653 139
805 3300005539 Ga0068853_100048529 Ga0068853_1000485294 139
806 3300005539 Ga0068853_100063915 Ga0068853_1000639153 139
807 3300005539 Ga0068853_100185834 Ga0068853_1001858343 139
808 3300005539 Ga0068853_100249716 Ga0068853_1002497162 139
809 3300005539 Ga0068853_100458941 Ga0068853_1004589412 139
810 3300005539 Ga0068853_100485085 Ga0068853_1004850851 139
811 3300005539 Ga0068853_100587840 Ga0068853_1005878402 139
812 3300005539 Ga0068853_100681779 Ga0068853_1006817791 139
813 3300005539 Ga0068853_100823034 Ga0068853_1008230341 139
814 3300005543 Ga0070672_100107396 Ga0070672_1001073962 139
815 3300005543 Ga0070672_100510431 Ga0070672_1005104312 139
816 3300005545 Ga0070695_100747637 Ga0070695_1007476372 139
817 3300005546 Ga0070696_100484306 Ga0070696_1004843062 139
818 3300005547 Ga0070693_100169909 Ga0070693_1001699092 139
819 3300005547 Ga0070693_101058380 Ga0070693_1010583801 139
820 3300005548 Ga0070665_100017413 Ga0070665_1000174134 139
821 3300005548 Ga0070665_100053516 Ga0070665_1000535162 139
822 3300005548 Ga0070665_100076421 Ga0070665_1000764213 139
823 3300005548 Ga0070665_100112181 Ga0070665_1001121814 139
824 3300005548 Ga0070665_100292106 Ga0070665_1002921062 139
825 3300005548 Ga0070665_100319463 Ga0070665_1003194632 139
826 3300005548 Ga0070665_100344343 Ga0070665_1003443432 139
827 3300005548 Ga0070665_100362944 Ga0070665_1003629441 139
828 3300005548 Ga0070665_100454487 Ga0070665_1004544872 139
829 3300005548 Ga0070665_101532738 Ga0070665_1015327382 139
830 3300005563 Ga0068855_100091347 Ga0068855_1000913474 139
831 3300005563 Ga0068855_100111386 Ga0068855_1001113865 139
832 3300005563 Ga0068855_100224269 Ga0068855_1002242692 139
833 3300005563 Ga0068855_100228514 Ga0068855_1002285142 139
834 3300005563 Ga0068855_100278164 Ga0068855_1002781642 139
835 3300005563 Ga0068855_100367250 Ga0068855_1003672502 139
836 3300005563 Ga0068855_101637070 Ga0068855_1016370701 139
837 3300005564 Ga0070664_100176423 Ga0070664_1001764233 139
838 3300005564 Ga0070664_100319895 Ga0070664_1003198952 139
839 3300005564 Ga0070664_100436886 Ga0070664_1004368862 139
840 3300005577 Ga0068857_100074845 Ga0068857_1000748452 139
841 3300005577 Ga0068857_100133470 Ga0068857_1001334703 139
842 3300005577 Ga0068857_100141458 Ga0068857_1001414582 139
843 3300005577 Ga0068857_100658468 Ga0068857_1006584682 139
844 3300005578 Ga0068854_100051735 Ga0068854_1000517352 139
845 3300005578 Ga0068854_100517722 Ga0068854_1005177222 139
846 3300005578 Ga0068854_100728036 Ga0068854_1007280361 139
847 3300005578 Ga0068854_100832004 Ga0068854_1008320042 139
848 3300005578 Ga0068854_100889695 Ga0068854_1008896951 139
849 3300005578 Ga0068854_101481571 Ga0068854_1014815712 139
850 3300005578 Ga0068854_101616092 Ga0068854_1016160921 139
851 3300005614 Ga0068856_100000322 Ga0068856_10000032219 139
852 3300005614 Ga0068856_100102908 Ga0068856_1001029082 139
853 3300005614 Ga0068856_100208034 Ga0068856_1002080342 139
854 3300005614 Ga0068856_100461489 Ga0068856_1004614892 139
855 3300005614 Ga0068856_100609502 Ga0068856_1006095022 139
856 3300005614 Ga0068856_100678334 Ga0068856_1006783342 139
857 3300005614 Ga0068856_100935443 Ga0068856_1009354432 139
858 3300005615 Ga0070702_100063288 Ga0070702_1000632881 139
859 3300005615 Ga0070702_100306671 Ga0070702_1003066712 139
860 3300005615 Ga0070702_100690433 Ga0070702_1006904332 139
861 3300005616 Ga0068852_100052259 Ga0068852_1000522592 139
862 3300005616 Ga0068852_100086534 Ga0068852_1000865344 139
863 3300005616 Ga0068852_100302572 Ga0068852_1003025723 139
864 3300005616 Ga0068852_100540335 Ga0068852_1005403352 139
865 3300005617 Ga0068859_100136779 Ga0068859_1001367794 139
866 3300005617 Ga0068859_100503025 Ga0068859_1005030252 139
867 3300005617 Ga0068859_100903830 Ga0068859_1009038302 139
868 3300005618 Ga0068864_100925040 Ga0068864_1009250402 139
869 3300005618 Ga0068864_101089600 Ga0068864_1010896001 139
870 3300005718 Ga0068866_10157907 Ga0068866_101579072 139
871 3300005719 Ga0068861_100058492 Ga0068861_1000584922 139
872 3300005719 Ga0068861_100104434 Ga0068861_1001044343 139
873 3300005719 Ga0068861_100873103 Ga0068861_1008731032 139
874 3300005719 Ga0068861_101290513 Ga0068861_1012905132 139
875 3300005834 Ga0068851_10596892 Ga0068851_105968922 139
876 3300005840 Ga0068870_10164807 Ga0068870_101648072 139
877 3300005841 Ga0068863_100287211 Ga0068863_1002872112 139
878 3300005841 Ga0068863_100303701 Ga0068863_1003037012 139
879 3300005841 Ga0068863_100542636 Ga0068863_1005426361 139
880 3300005841 Ga0068863_100729600 Ga0068863_1007296002 139
881 3300005841 Ga0068863_101101470 Ga0068863_1011014702 139
882 3300005842 Ga0068858_100301165 Ga0068858_1003011652 139
883 3300005842 Ga0068858_100385140 Ga0068858_1003851403 139
884 3300005842 Ga0068858_100409453 Ga0068858_1004094532 139
885 3300005842 Ga0068858_100447600 Ga0068858_1004476002 139
886 3300005842 Ga0068858_101586827 Ga0068858_1015868271 139
887 3300005843 Ga0068860_100000268 Ga0068860_10000026821 139
888 3300005843 Ga0068860_100107336 Ga0068860_1001073362 139
889 3300005843 Ga0068860_100444181 Ga0068860_1004441812 139
890 3300005843 Ga0068860_101213471 Ga0068860_1012134711 139
891 3300005843 Ga0068860_101717236 Ga0068860_1017172361 139
892 3300005844 Ga0068862_100065219 Ga0068862_1000652193 139
893 3300005844 Ga0068862_100166402 Ga0068862_1001664022 139
894 3300005844 Ga0068862_100677437 Ga0068862_1006774372 139
895 3300005937 Ga0081455_10005420 Ga0081455_1000542010 139
896 3300005937 Ga0081455_10007456 Ga0081455_100074563 139
897 3300005937 Ga0081455_10021059 Ga0081455_100210597 139
898 3300005937 Ga0081455_10045886 Ga0081455_100458862 139
899 3300005937 Ga0081455_10638320 Ga0081455_106383202 139
900 3300005937 Ga0081455_10774494 Ga0081455_107744941 139
901 3300005937 Ga0081455_10869135 Ga0081455_108691351 139
902 3300005981 Ga0081538_10009598 Ga0081538_100095987 139
903 3300005981 Ga0081538_10024479 Ga0081538_100244793 139
904 3300005981 Ga0081538_10213169 Ga0081538_102131692 139
905 3300005983 Ga0081540_1000423 Ga0081540_100042343 139
906 3300005983 Ga0081540_1000977 Ga0081540_100097724 139
907 3300005983 Ga0081540_1009064 Ga0081540_10090647 139
908 3300005983 Ga0081540_1014804 Ga0081540_10148045 139
909 3300005983 Ga0081540_1015232 Ga0081540_10152325 139
910 3300005983 Ga0081540_1015859 Ga0081540_10158593 139
911 3300005983 Ga0081540_1027847 Ga0081540_10278472 139
912 3300005983 Ga0081540_1079400 Ga0081540_10794002 139
913 3300005985 Ga0081539_10000176 Ga0081539_1000017677 139
914 3300005985 Ga0081539_10000231 Ga0081539_1000023176 139
915 3300005985 Ga0081539_10016162 Ga0081539_100161623 139
916 3300005985 Ga0081539_10045542 Ga0081539_100455423 139
917 3300006028 Ga0070717_10003338 Ga0070717_100033382 139
918 3300006028 Ga0070717_10192921 Ga0070717_101929212 139
919 3300006028 Ga0070717_10612741 Ga0070717_106127411 139
920 3300006038 Ga0075365_10024124 Ga0075365_100241241 139
921 3300006038 Ga0075365_10046897 Ga0075365_100468973 139
922 3300006038 Ga0075365_10087942 Ga0075365_100879422 139
923 3300006038 Ga0075365_10115532 Ga0075365_101155323 139
924 3300006038 Ga0075365_10125820 Ga0075365_101258203 139
925 3300006038 Ga0075365_10163761 Ga0075365_101637613 139
926 3300006038 Ga0075365_10202239 Ga0075365_102022391 139
927 3300006038 Ga0075365_10250916 Ga0075365_102509161 139
928 3300006038 Ga0075365_10321705 Ga0075365_103217052 139
929 3300006038 Ga0075365_10746043 Ga0075365_107460431 139
930 3300006042 Ga0075368_10011751 Ga0075368_100117513 139
931 3300006042 Ga0075368_10047831 Ga0075368_100478313 139
932 3300006042 Ga0075368_10066295 Ga0075368_100662952 139
933 3300006042 Ga0075368_10111283 Ga0075368_101112832 139
934 3300006048 Ga0075363_100006687 Ga0075363_1000066874 139
935 3300006048 Ga0075363_100068616 Ga0075363_1000686161 139
936 3300006048 Ga0075363_100118359 Ga0075363_1001183592 139
937 3300006048 Ga0075363_100228236 Ga0075363_1002282362 139
938 3300006048 Ga0075363_100231142 Ga0075363_1002311422 139
939 3300006048 Ga0075363_100321772 Ga0075363_1003217721 139
940 3300006051 Ga0075364_10018321 Ga0075364_100183214 139
941 3300006051 Ga0075364_10020918 Ga0075364_100209183 139
942 3300006051 Ga0075364_11009304 Ga0075364_110093041 139
943 3300006058 Ga0075432_10270500 Ga0075432_102705001 139
944 3300006163 Ga0070715_10000362 Ga0070715_100003627 139
945 3300006163 Ga0070715_10008899 Ga0070715_100088993 139
946 3300006163 Ga0070715_10059524 Ga0070715_100595242 139
947 3300006163 Ga0070715_10170288 Ga0070715_101702881 139
948 3300006163 Ga0070715_10561984 Ga0070715_105619841 139
949 3300006173 Ga0070716_100002807 Ga0070716_1000028077 139
950 3300006173 Ga0070716_100035143 Ga0070716_1000351432 139
951 3300006173 Ga0070716_100161743 Ga0070716_1001617432 139
952 3300006173 Ga0070716_100186742 Ga0070716_1001867422 139
953 3300006173 Ga0070716_100271866 Ga0070716_1002718662 139
954 3300006173 Ga0070716_100595436 Ga0070716_1005954361 139
955 3300006175 Ga0070712_100005919 Ga0070712_1000059193 139
956 3300006175 Ga0070712_100012321 Ga0070712_1000123212 139
957 3300006175 Ga0070712_100113057 Ga0070712_1001130572 139
958 3300006175 Ga0070712_100148946 Ga0070712_1001489463 139
959 3300006175 Ga0070712_100170121 Ga0070712_1001701212 139
960 3300006175 Ga0070712_100797671 Ga0070712_1007976711 139
961 3300006177 Ga0075362_10037578 Ga0075362_100375782 139
962 3300006177 Ga0075362_10106448 Ga0075362_101064482 139
963 3300006177 Ga0075362_10272864 Ga0075362_102728642 139
964 3300006178 Ga0075367_10053535 Ga0075367_100535352 139
965 3300006178 Ga0075367_10129759 Ga0075367_101297593 139
966 3300006178 Ga0075367_10137803 Ga0075367_101378032 139
967 3300006178 Ga0075367_10160142 Ga0075367_101601422 139
968 3300006178 Ga0075367_10168834 Ga0075367_101688342 139
969 3300006178 Ga0075367_10235856 Ga0075367_102358562 139
970 3300006178 Ga0075367_10263408 Ga0075367_102634082 139
971 3300006186 Ga0075369_10071587 Ga0075369_100715872 139
972 3300006186 Ga0075369_10079651 Ga0075369_100796512 139
973 3300006186 Ga0075369_10146950 Ga0075369_101469502 139
974 3300006186 Ga0075369_10211037 Ga0075369_102110371 139
975 3300006186 Ga0075369_10254125 Ga0075369_102541252 139
976 3300006195 Ga0075366_10219456 Ga0075366_102194561 139
977 3300006237 Ga0097621_100156960 Ga0097621_1001569604 139
978 3300006237 Ga0097621_100353984 Ga0097621_1003539842 139
979 3300006353 Ga0075370_10026912 Ga0075370_100269123 139
980 3300006353 Ga0075370_10085011 Ga0075370_100850112 139
981 3300006353 Ga0075370_10120102 Ga0075370_101201022 139
982 3300006353 Ga0075370_10128595 Ga0075370_101285951 139
983 3300006353 Ga0075370_10430981 Ga0075370_104309811 139
984 3300006358 Ga0068871_100490245 Ga0068871_1004902452 139
985 3300006358 Ga0068871_100954249 Ga0068871_1009542492 139
986 3300006844 Ga0075428_100013639 Ga0075428_1000136396 139
987 3300006844 Ga0075428_100475981 Ga0075428_1004759812 139
988 3300006844 Ga0075428_101702583 Ga0075428_1017025831 139
989 3300006846 Ga0075430_101017406 Ga0075430_1010174062 139
990 3300006871 Ga0075434_100017415 Ga0075434_1000174155 139
991 3300006871 Ga0075434_100692436 Ga0075434_1006924362 139
992 3300006880 Ga0075429_100111295 Ga0075429_1001112952 139
993 3300006881 Ga0068865_100545503 Ga0068865_1005455031 139
994 3300006914 Ga0075436_100483704 Ga0075436_1004837042 139
995 3300006914 Ga0075436_100910834 Ga0075436_1009108342 139
996 3300006931 Ga0097620_100136781 Ga0097620_1001367812 139
997 3300006931 Ga0097620_100503006 Ga0097620_1005030062 139
998 3300006931 Ga0097620_100903842 Ga0097620_1009038422 139
999 3300006942 Ga0099824_1024052 Ga0099824_10240522 139
1000 3300006943 Ga0099822_1061062 Ga0099822_10610622 139
1001 3300007076 Ga0075435_100121979 Ga0075435_1001219792 139
1002 3300007076 Ga0075435_100523141 Ga0075435_1005231412 139
1003 3300007265 Ga0099794_10105410 Ga0099794_101054102 139
1004 3300007265 Ga0099794_10118808 Ga0099794_101188082 139
1005 3300007265 Ga0099794_10126035 Ga0099794_101260352 139
1006 3300007265 Ga0099794_10249062 Ga0099794_102490621 139
1007 3300007265 Ga0099794_10323164 Ga0099794_103231641 139
1008 3300007788 Ga0099795_10062757 Ga0099795_100627571 139
1009 3300007788 Ga0099795_10101774 Ga0099795_101017742 139
1010 3300007788 Ga0099795_10179540 Ga0099795_101795401 139
1011 3300007788 Ga0099795_10511109 Ga0099795_105111091 139
1012 3300009011 Ga0105251_10480078 Ga0105251_104800781 139
1013 3300009036 Ga0105244_10379242 Ga0105244_103792421 139
1014 3300009092 Ga0105250_10057116 Ga0105250_100571162 139
1015 3300009093 Ga0105240_10007230 Ga0105240_1000723010 139
1016 3300009093 Ga0105240_10007574 Ga0105240_100075742 139
1017 3300009093 Ga0105240_10106446 Ga0105240_101064464 139
1018 3300009093 Ga0105240_10123732 Ga0105240_101237323 139
1019 3300009093 Ga0105240_10216279 Ga0105240_102162794 139
1020 3300009093 Ga0105240_10220070 Ga0105240_102200701 139
1021 3300009093 Ga0105240_10377194 Ga0105240_103771942 139
1022 3300009093 Ga0105240_10480117 Ga0105240_104801172 139
1023 3300009093 Ga0105240_10674983 Ga0105240_106749832 139
1024 3300009094 Ga0111539_10276872 Ga0111539_102768722 139
1025 3300009094 Ga0111539_10912201 Ga0111539_109122012 139
1026 3300009098 Ga0105245_10017226 Ga0105245_100172267 139
1027 3300009098 Ga0105245_10290457 Ga0105245_102904572 139
1028 3300009098 Ga0105245_10309253 Ga0105245_103092532 139
1029 3300009098 Ga0105245_10326119 Ga0105245_103261192 139
1030 3300009098 Ga0105245_10446925 Ga0105245_104469252 139
1031 3300009098 Ga0105245_11655894 Ga0105245_116558942 139
1032 3300009101 Ga0105247_10080861 Ga0105247_100808612 139
1033 3300009147 Ga0114129_10416746 Ga0114129_104167462 139
1034 3300009148 Ga0105243_10172315 Ga0105243_101723151 139
1035 3300009148 Ga0105243_10422290 Ga0105243_104222902 139
1036 3300009148 Ga0105243_10501056 Ga0105243_105010562 139
1037 3300009148 Ga0105243_10764918 Ga0105243_107649182 139
1038 3300009148 Ga0105243_11401990 Ga0105243_114019901 139
1039 3300009148 Ga0105243_11584202 Ga0105243_115842022 139
1040 3300009174 Ga0105241_10081641 Ga0105241_100816413 139
1041 3300009174 Ga0105241_10400072 Ga0105241_104000722 139
1042 3300009174 Ga0105241_10511986 Ga0105241_105119861 139
1043 3300009174 Ga0105241_10789633 Ga0105241_107896332 139
1044 3300009174 Ga0105241_12013299 Ga0105241_120132991 139
1045 3300009177 Ga0105248_10296216 Ga0105248_102962163 139
1046 3300009177 Ga0105248_10453900 Ga0105248_104539002 139
1047 3300009177 Ga0105248_10879007 Ga0105248_108790072 139
1048 3300009545 Ga0105237_10025414 Ga0105237_100254142 139
1049 3300009545 Ga0105237_10028752 Ga0105237_100287526 139
1050 3300009545 Ga0105237_10037425 Ga0105237_100374253 139
1051 3300009545 Ga0105237_10063638 Ga0105237_100636383 139
1052 3300009545 Ga0105237_10078129 Ga0105237_100781292 139
1053 3300009545 Ga0105237_10078514 Ga0105237_100785143 139
1054 3300009545 Ga0105237_10081130 Ga0105237_100811301 139
1055 3300009545 Ga0105237_10116241 Ga0105237_101162413 139
1056 3300009545 Ga0105237_10295606 Ga0105237_102956062 139
1057 3300009545 Ga0105237_10901496 Ga0105237_109014961 139
1058 3300009545 Ga0105237_12419060 Ga0105237_124190601 139
1059 3300009551 Ga0105238_10013773 Ga0105238_100137732 139
1060 3300009551 Ga0105238_10047950 Ga0105238_100479504 139
1061 3300009551 Ga0105238_10342361 Ga0105238_103423612 139
1062 3300009551 Ga0105238_10479626 Ga0105238_104796262 139
1063 3300009551 Ga0105238_10559161 Ga0105238_105591612 139
1064 3300009551 Ga0105238_10939538 Ga0105238_109395382 139
1065 3300009551 Ga0105238_11008124 Ga0105238_110081242 139
1066 3300009551 Ga0105238_11471998 Ga0105238_114719981 139
1067 3300009553 Ga0105249_10115797 Ga0105249_101157974 139
1068 3300009553 Ga0105249_10279250 Ga0105249_102792502 139
1069 3300009553 Ga0105249_10628659 Ga0105249_106286591 139
1070 3300010159 Ga0099796_10015947 Ga0099796_100159473 139
1071 3300010159 Ga0099796_10090567 Ga0099796_100905672 139
1072 3300010375 Ga0105239_10031935 Ga0105239_100319357 139
1073 3300010375 Ga0105239_10172205 Ga0105239_101722051 139
1074 3300010375 Ga0105239_10221750 Ga0105239_102217502 139
1075 3300010375 Ga0105239_10330268 Ga0105239_103302682 139
1076 3300010375 Ga0105239_10478407 Ga0105239_104784072 139
1077 3300010375 Ga0105239_10527736 Ga0105239_105277362 139
1078 3300010375 Ga0105239_10647732 Ga0105239_106477322 139
1079 3300010375 Ga0105239_10698646 Ga0105239_106986462 139
1080 3300010375 Ga0105239_11025954 Ga0105239_110259542 139
1081 3300010375 Ga0105239_11454954 Ga0105239_114549541 139
1082 3300011119 Ga0105246_10006402 Ga0105246_100064027 139
1083 3300011119 Ga0105246_10030804 Ga0105246_100308043 139
1084 3300011119 Ga0105246_10283562 Ga0105246_102835621 139
1085 3300011119 Ga0105246_10687252 Ga0105246_106872521 139
1086 3300012481 Ga0157320_1014240 Ga0157320_10142401 139
1087 3300012513 Ga0157326_1024051 Ga0157326_10240512 139
1088 3300013100 Ga0157373_10261026 Ga0157373_102610262 139
1089 3300013102 Ga0157371_10110563 Ga0157371_101105633 139
1090 3300013102 Ga0157371_10521424 Ga0157371_105214241 139
1091 3300013104 Ga0157370_10039790 Ga0157370_100397902 139
1092 3300013104 Ga0157370_10207346 Ga0157370_102073463 139
1093 3300013104 Ga0157370_10756670 Ga0157370_107566701 139
1094 3300013104 Ga0157370_11113987 Ga0157370_111139872 139
1095 3300013104 Ga0157370_11192541 Ga0157370_111925411 139
1096 3300013104 Ga0157370_12130440 Ga0157370_121304401 139
1097 3300013105 Ga0157369_10023864 Ga0157369_1002386411 139
1098 3300013105 Ga0157369_10101671 Ga0157369_101016713 139
1099 3300013105 Ga0157369_10360388 Ga0157369_103603882 139
1100 3300013105 Ga0157369_10542646 Ga0157369_105426463 139
1101 3300013105 Ga0157369_10718942 Ga0157369_107189422 139
1102 3300013296 Ga0157374_10042515 Ga0157374_100425153 139
1103 3300013296 Ga0157374_10166030 Ga0157374_101660303 139
1104 3300013296 Ga0157374_10790789 Ga0157374_107907892 139
1105 3300013296 Ga0157374_10813179 Ga0157374_108131791 139
1106 3300013296 Ga0157374_10848902 Ga0157374_108489022 139
1107 3300013297 Ga0157378_10037027 Ga0157378_100370274 139
1108 3300013297 Ga0157378_10613182 Ga0157378_106131822 139
1109 3300013297 Ga0157378_11050691 Ga0157378_110506912 139
1110 3300013306 Ga0163162_10178723 Ga0163162_101787233 139
1111 3300013306 Ga0163162_10271352 Ga0163162_102713523 139
1112 3300013306 Ga0163162_10372101 Ga0163162_103721012 139
1113 3300013306 Ga0163162_10394628 Ga0163162_103946282 139
1114 3300013306 Ga0163162_11944205 Ga0163162_119442052 139
1115 3300013306 Ga0163162_12751088 Ga0163162_127510881 139
1116 3300013307 Ga0157372_10091799 Ga0157372_100917993 139
1117 3300013307 Ga0157372_10132041 Ga0157372_101320413 139
1118 3300013307 Ga0157372_10384920 Ga0157372_103849202 139
1119 3300013307 Ga0157372_10531553 Ga0157372_105315532 139
1120 3300013307 Ga0157372_10760480 Ga0157372_107604801 139
1121 3300013308 Ga0157375_10626982 Ga0157375_106269821 139
1122 3300013308 Ga0157375_10740684 Ga0157375_107406842 139
1123 3300013308 Ga0157375_11219651 Ga0157375_112196512 139
1124 3300013308 Ga0157375_11365222 Ga0157375_113652221 139
1125 3300013308 Ga0157375_12587370 Ga0157375_125873701 139
1126 3300014325 Ga0163163_10267943 Ga0163163_102679432 139
1127 3300014326 Ga0157380_10058229 Ga0157380_100582292 139
1128 3300014326 Ga0157380_10497453 Ga0157380_104974532 139
1129 3300014326 Ga0157380_10858258 Ga0157380_108582582 139
1130 3300014326 Ga0157380_11283630 Ga0157380_112836302 139
1131 3300014326 Ga0157380_11381717 Ga0157380_113817171 139
1132 3300014497 Ga0182008_10190551 Ga0182008_101905511 139
1133 3300014968 Ga0157379_10499142 Ga0157379_104991422 139
1134 3300014969 Ga0157376_10514984 Ga0157376_105149842 139
1135 3300014969 Ga0157376_10629229 Ga0157376_106292292 139
1136 3300014969 Ga0157376_10648852 Ga0157376_106488521 139
1137 3300014969 Ga0157376_10874354 Ga0157376_108743542 139
1138 3300014969 Ga0157376_11059501 Ga0157376_110595012 139
1139 3300015262 Ga0182007_10074972 Ga0182007_100749721 139
1140 3300017792 Ga0163161_10037048 Ga0163161_100370483 139
1141 3300017792 Ga0163161_10089540 Ga0163161_100895402 139
1142 3300017792 Ga0163161_10412598 Ga0163161_104125981 139
1143 3300017792 Ga0163161_10738400 Ga0163161_107384001 139
1144 3300021320 Ga0214544_1000009 Ga0214544_100000966 139
1145 3300021321 Ga0214542_1000002 Ga0214542_1000002508 139
1146 3300021324 Ga0214545_1000002 Ga0214545_1000002212 139
1147 3300021327 Ga0214543_1000013 Ga0214543_1000013110 139
1148 3300021358 Ga0213873_10032982 Ga0213873_100329822 139
1149 3300021377 Ga0213874_10002345 Ga0213874_100023453 139
1150 3300021377 Ga0213874_10086622 Ga0213874_100866222 139
1151 3300021377 Ga0213874_10323412 Ga0213874_103234121 139
1152 3300021384 Ga0213876_10002649 Ga0213876_100026493 139
1153 3300021384 Ga0213876_10032050 Ga0213876_100320502 139
1154 3300021388 Ga0213875_10325558 Ga0213875_103255582 139
1155 3300021388 Ga0213875_10352527 Ga0213875_103525272 139
1156 3300021441 Ga0213871_10002311 Ga0213871_100023113 139
1157 3300022467 Ga0224712_10364799 Ga0224712_103647992 139
1158 3300025230 Ga0209563_101473 Ga0209563_1014732 139
1159 3300025245 Ga0207425_1053625 Ga0207425_10536252 139
1160 3300025253 Ga0209677_101297 Ga0209677_10129711 139
1161 3300025253 Ga0209677_109389 Ga0209677_1093892 139
1162 3300025254 Ga0209148_1000779 Ga0209148_100077911 139
1163 3300025254 Ga0209148_1007270 Ga0209148_10072703 139
1164 3300025254 Ga0209148_1037776 Ga0209148_10377762 139
1165 3300025261 Ga0209233_1007403 Ga0209233_10074033 139
1166 3300025261 Ga0209233_1068597 Ga0209233_10685971 139
1167 3300025272 Ga0209455_1004376 Ga0209455_10043763 139
1168 3300025272 Ga0209455_1007482 Ga0209455_10074824 139
1169 3300025272 Ga0209455_1007672 Ga0209455_10076722 139
1170 3300025272 Ga0209455_1029914 Ga0209455_10299142 139
1171 3300025273 Ga0209673_1016996 Ga0209673_10169963 139
1172 3300025284 Ga0209130_1026383 Ga0209130_10263833 139
1173 3300025294 Ga0209025_1145809 Ga0209025_11458091 139
1174 3300025295 Ga0209564_1010970 Ga0209564_10109703 139
1175 3300025295 Ga0209564_1018150 Ga0209564_10181503 139
1176 3300025297 Ga0209758_1000100 Ga0209758_1000100110 139
1177 3300025297 Ga0209758_1000553 Ga0209758_100055316 139
1178 3300025297 Ga0209758_1003040 Ga0209758_10030409 139
1179 3300025297 Ga0209758_1003281 Ga0209758_100328113 139
1180 3300025297 Ga0209758_1003616 Ga0209758_10036164 139
1181 3300025297 Ga0209758_1003619 Ga0209758_10036195 139
1182 3300025297 Ga0209758_1006718 Ga0209758_10067187 139
1183 3300025297 Ga0209758_1012788 Ga0209758_10127883 139
1184 3300025299 Ga0209256_1003151 Ga0209256_10031514 139
1185 3300025299 Ga0209256_1024063 Ga0209256_10240632 139
1186 3300025299 Ga0209256_1028975 Ga0209256_10289752 139
1187 3300025302 Ga0207426_1000596 Ga0207426_100059631 139
1188 3300025302 Ga0207426_1001063 Ga0207426_100106314 139
1189 3300025302 Ga0207426_1008118 Ga0207426_10081184 139
1190 3300025302 Ga0207426_1045336 Ga0207426_10453363 139
1191 3300025303 Ga0209051_1052398 Ga0209051_10523982 139
1192 3300025304 Ga0209257_1007882 Ga0209257_10078823 139
1193 3300025304 Ga0209257_1053920 Ga0209257_10539202 139
1194 3300025315 Ga0207697_10235564 Ga0207697_102355642 139
1195 3300025321 Ga0207656_10052223 Ga0207656_100522233 139
1196 3300025711 Ga0207696_1134650 Ga0207696_11346501 139
1197 3300025898 Ga0207692_10000237 Ga0207692_1000023717 139
1198 3300025898 Ga0207692_10005534 Ga0207692_100055344 139
1199 3300025898 Ga0207692_10012281 Ga0207692_100122813 139
1200 3300025898 Ga0207692_10403932 Ga0207692_104039321 139
1201 3300025898 Ga0207692_10746757 Ga0207692_107467572 139
1202 3300025899 Ga0207642_10722151 Ga0207642_107221511 139
1203 3300025900 Ga0207710_10066814 Ga0207710_100668142 139
1204 3300025900 Ga0207710_10400099 Ga0207710_104000991 139
1205 3300025901 Ga0207688_10010406 Ga0207688_100104064 139
1206 3300025901 Ga0207688_10079981 Ga0207688_100799812 139
1207 3300025903 Ga0207680_10114205 Ga0207680_101142053 139
1208 3300025904 Ga0207647_10179477 Ga0207647_101794772 139
1209 3300025904 Ga0207647_10245139 Ga0207647_102451393 139
1210 3300025904 Ga0207647_10532198 Ga0207647_105321981 139
1211 3300025905 Ga0207685_10000461 Ga0207685_100004614 139
1212 3300025905 Ga0207685_10028428 Ga0207685_100284283 139
1213 3300025905 Ga0207685_10041205 Ga0207685_100412052 139
1214 3300025905 Ga0207685_10074925 Ga0207685_100749252 139
1215 3300025906 Ga0207699_10001151 Ga0207699_100011514 139
1216 3300025906 Ga0207699_10001394 Ga0207699_100013943 139
1217 3300025906 Ga0207699_10009254 Ga0207699_100092543 139
1218 3300025906 Ga0207699_10010073 Ga0207699_100100733 139
1219 3300025906 Ga0207699_10018400 Ga0207699_100184004 139
1220 3300025907 Ga0207645_10068616 Ga0207645_100686162 139
1221 3300025909 Ga0207705_10035586 Ga0207705_100355862 139
1222 3300025909 Ga0207705_10213377 Ga0207705_102133771 139
1223 3300025909 Ga0207705_10333068 Ga0207705_103330682 139
1224 3300025910 Ga0207684_10114702 Ga0207684_101147022 139
1225 3300025911 Ga0207654_10024931 Ga0207654_100249313 139
1226 3300025911 Ga0207654_10027995 Ga0207654_100279953 139
1227 3300025911 Ga0207654_10175318 Ga0207654_101753182 139
1228 3300025911 Ga0207654_10594803 Ga0207654_105948031 139
1229 3300025912 Ga0207707_10003454 Ga0207707_1000345416 139
1230 3300025912 Ga0207707_10008660 Ga0207707_1000866010 139
1231 3300025912 Ga0207707_10052808 Ga0207707_100528082 139
1232 3300025912 Ga0207707_10212016 Ga0207707_102120162 139
1233 3300025912 Ga0207707_10259033 Ga0207707_102590331 139
1234 3300025913 Ga0207695_10001107 Ga0207695_1000110729 139
1235 3300025913 Ga0207695_10024535 Ga0207695_100245359 139
1236 3300025913 Ga0207695_10046985 Ga0207695_100469855 139
1237 3300025913 Ga0207695_10098500 Ga0207695_100985002 139
1238 3300025913 Ga0207695_10148565 Ga0207695_101485652 139
1239 3300025913 Ga0207695_10283254 Ga0207695_102832542 139
1240 3300025913 Ga0207695_10750369 Ga0207695_107503691 139
1241 3300025913 Ga0207695_11604880 Ga0207695_116048802 139
1242 3300025914 Ga0207671_10012893 Ga0207671_100128933 139
1243 3300025914 Ga0207671_10045659 Ga0207671_100456593 139
1244 3300025914 Ga0207671_10057398 Ga0207671_100573983 139
1245 3300025914 Ga0207671_10071555 Ga0207671_100715552 139
1246 3300025914 Ga0207671_10176824 Ga0207671_101768242 139
1247 3300025914 Ga0207671_10283534 Ga0207671_102835341 139
1248 3300025914 Ga0207671_10373854 Ga0207671_103738541 139
1249 3300025914 Ga0207671_10450867 Ga0207671_104508671 139
1250 3300025915 Ga0207693_10000606 Ga0207693_1000060621 139
1251 3300025915 Ga0207693_10010745 Ga0207693_100107456 139
1252 3300025915 Ga0207693_10012695 Ga0207693_100126956 139
1253 3300025915 Ga0207693_10024075 Ga0207693_100240753 139
1254 3300025915 Ga0207693_10088449 Ga0207693_100884493 139
1255 3300025915 Ga0207693_10145653 Ga0207693_101456533 139
1256 3300025915 Ga0207693_10184522 Ga0207693_101845222 139
1257 3300025916 Ga0207663_10002175 Ga0207663_100021756 139
1258 3300025916 Ga0207663_10005229 Ga0207663_1000522910 139
1259 3300025916 Ga0207663_10011998 Ga0207663_100119985 139
1260 3300025916 Ga0207663_10026744 Ga0207663_100267442 139
1261 3300025916 Ga0207663_10149157 Ga0207663_101491572 139
1262 3300025916 Ga0207663_10469150 Ga0207663_104691501 139
1263 3300025917 Ga0207660_10018042 Ga0207660_100180423 139
1264 3300025917 Ga0207660_10022461 Ga0207660_100224613 139
1265 3300025917 Ga0207660_10089597 Ga0207660_100895971 139
1266 3300025917 Ga0207660_10405456 Ga0207660_104054562 139
1267 3300025918 Ga0207662_10070651 Ga0207662_100706513 139
1268 3300025919 Ga0207657_10013306 Ga0207657_100133063 139
1269 3300025919 Ga0207657_10031713 Ga0207657_100317133 139
1270 3300025919 Ga0207657_10136291 Ga0207657_101362913 139
1271 3300025919 Ga0207657_10177992 Ga0207657_101779922 139
1272 3300025919 Ga0207657_10197947 Ga0207657_101979473 139
1273 3300025920 Ga0207649_10064511 Ga0207649_100645112 139
1274 3300025920 Ga0207649_10118129 Ga0207649_101181293 139
1275 3300025920 Ga0207649_10821628 Ga0207649_108216281 139
1276 3300025920 Ga0207649_10950855 Ga0207649_109508552 139
1277 3300025920 Ga0207649_11090594 Ga0207649_110905941 139
1278 3300025921 Ga0207652_10246529 Ga0207652_102465292 139
1279 3300025921 Ga0207652_10320770 Ga0207652_103207702 139
1280 3300025921 Ga0207652_10386353 Ga0207652_103863531 139
1281 3300025921 Ga0207652_10917429 Ga0207652_109174292 139
1282 3300025922 Ga0207646_10125902 Ga0207646_101259022 139
1283 3300025923 Ga0207681_10267451 Ga0207681_102674512 139
1284 3300025924 Ga0207694_10006048 Ga0207694_100060486 139
1285 3300025924 Ga0207694_10065897 Ga0207694_100658973 139
1286 3300025924 Ga0207694_10115817 Ga0207694_101158173 139
1287 3300025924 Ga0207694_10327014 Ga0207694_103270142 139
1288 3300025924 Ga0207694_10367448 Ga0207694_103674481 139
1289 3300025924 Ga0207694_10542815 Ga0207694_105428152 139
1290 3300025924 Ga0207694_10872541 Ga0207694_108725412 139
1291 3300025925 Ga0207650_10234440 Ga0207650_102344402 139
1292 3300025925 Ga0207650_10235797 Ga0207650_102357972 139
1293 3300025925 Ga0207650_11204282 Ga0207650_112042822 139
1294 3300025927 Ga0207687_10021889 Ga0207687_100218892 139
1295 3300025927 Ga0207687_10131674 Ga0207687_101316743 139
1296 3300025927 Ga0207687_10217544 Ga0207687_102175442 139
1297 3300025928 Ga0207700_10009751 Ga0207700_100097516 139
1298 3300025928 Ga0207700_10011770 Ga0207700_100117702 139
1299 3300025928 Ga0207700_10049679 Ga0207700_100496793 139
1300 3300025928 Ga0207700_10051142 Ga0207700_100511423 139
1301 3300025928 Ga0207700_10185656 Ga0207700_101856561 139
1302 3300025928 Ga0207700_10241277 Ga0207700_102412772 139
1303 3300025928 Ga0207700_10351058 Ga0207700_103510581 139
1304 3300025928 Ga0207700_10597748 Ga0207700_105977482 139
1305 3300025929 Ga0207664_10007101 Ga0207664_100071014 139
1306 3300025929 Ga0207664_10022677 Ga0207664_100226772 139
1307 3300025929 Ga0207664_10087428 Ga0207664_100874283 139
1308 3300025929 Ga0207664_10149969 Ga0207664_101499692 139
1309 3300025929 Ga0207664_10275552 Ga0207664_102755522 139
1310 3300025929 Ga0207664_10544822 Ga0207664_105448222 139
1311 3300025929 Ga0207664_10844575 Ga0207664_108445751 139
1312 3300025931 Ga0207644_10266846 Ga0207644_102668462 139
1313 3300025931 Ga0207644_10432159 Ga0207644_104321592 139
1314 3300025932 Ga0207690_10064179 Ga0207690_100641792 139
1315 3300025932 Ga0207690_10289804 Ga0207690_102898041 139
1316 3300025932 Ga0207690_10345006 Ga0207690_103450062 139
1317 3300025932 Ga0207690_10773457 Ga0207690_107734572 139
1318 3300025932 Ga0207690_10912330 Ga0207690_109123302 139
1319 3300025933 Ga0207706_10790909 Ga0207706_107909092 139
1320 3300025933 Ga0207706_10877776 Ga0207706_108777762 139
1321 3300025934 Ga0207686_10286450 Ga0207686_102864502 139
1322 3300025935 Ga0207709_10030468 Ga0207709_100304683 139
1323 3300025935 Ga0207709_10602408 Ga0207709_106024082 139
1324 3300025937 Ga0207669_10246991 Ga0207669_102469912 139
1325 3300025937 Ga0207669_10446375 Ga0207669_104463752 139
1326 3300025938 Ga0207704_10078146 Ga0207704_100781462 139
1327 3300025938 Ga0207704_10291876 Ga0207704_102918761 139
1328 3300025938 Ga0207704_10401256 Ga0207704_104012562 139
1329 3300025938 Ga0207704_10656376 Ga0207704_106563762 139
1330 3300025939 Ga0207665_10000599 Ga0207665_1000059912 139
1331 3300025939 Ga0207665_10035625 Ga0207665_100356254 139
1332 3300025939 Ga0207665_10046827 Ga0207665_100468273 139
1333 3300025939 Ga0207665_10047020 Ga0207665_100470202 139
1334 3300025939 Ga0207665_10068105 Ga0207665_100681053 139
1335 3300025939 Ga0207665_10105549 Ga0207665_101055493 139
1336 3300025939 Ga0207665_10111000 Ga0207665_101110003 139
1337 3300025939 Ga0207665_10823572 Ga0207665_108235722 139
1338 3300025940 Ga0207691_10122520 Ga0207691_101225202 139
1339 3300025940 Ga0207691_10177210 Ga0207691_101772102 139
1340 3300025940 Ga0207691_10298676 Ga0207691_102986762 139
1341 3300025940 Ga0207691_10623924 Ga0207691_106239242 139
1342 3300025941 Ga0207711_10346297 Ga0207711_103462972 139
1343 3300025942 Ga0207689_10233154 Ga0207689_102331543 139
1344 3300025944 Ga0207661_10002617 Ga0207661_100026171 139
1345 3300025944 Ga0207661_10130647 Ga0207661_101306472 139
1346 3300025944 Ga0207661_10165352 Ga0207661_101653522 139
1347 3300025944 Ga0207661_10599542 Ga0207661_105995421 139
1348 3300025944 Ga0207661_10657016 Ga0207661_106570161 139
1349 3300025944 Ga0207661_10997057 Ga0207661_109970571 139
1350 3300025945 Ga0207679_10068954 Ga0207679_100689542 139
1351 3300025945 Ga0207679_10100174 Ga0207679_101001742 139
1352 3300025945 Ga0207679_10199990 Ga0207679_101999902 139
1353 3300025945 Ga0207679_11352960 Ga0207679_113529602 139
1354 3300025949 Ga0207667_10029597 Ga0207667_100295976 139
1355 3300025949 Ga0207667_10067337 Ga0207667_100673373 139
1356 3300025949 Ga0207667_10182115 Ga0207667_101821152 139
1357 3300025949 Ga0207667_10676811 Ga0207667_106768111 139
1358 3300025949 Ga0207667_11231075 Ga0207667_112310752 139
1359 3300025960 Ga0207651_10173282 Ga0207651_101732822 139
1360 3300025960 Ga0207651_10203658 Ga0207651_102036582 139
1361 3300025960 Ga0207651_11153172 Ga0207651_111531721 139
1362 3300025961 Ga0207712_10228663 Ga0207712_102286632 139
1363 3300025972 Ga0207668_10015515 Ga0207668_100155153 139
1364 3300025972 Ga0207668_10080550 Ga0207668_100805503 139
1365 3300025972 Ga0207668_10198552 Ga0207668_101985521 139
1366 3300025972 Ga0207668_10501633 Ga0207668_105016332 139
1367 3300025972 Ga0207668_10732328 Ga0207668_107323282 139
1368 3300025972 Ga0207668_11314937 Ga0207668_113149371 139
1369 3300025981 Ga0207640_10061609 Ga0207640_100616093 139
1370 3300025981 Ga0207640_10403724 Ga0207640_104037242 139
1371 3300025981 Ga0207640_10739273 Ga0207640_107392731 139
1372 3300025981 Ga0207640_11210897 Ga0207640_112108972 139
1373 3300025981 Ga0207640_11475756 Ga0207640_114757562 139
1374 3300025986 Ga0207658_10513817 Ga0207658_105138172 139
1375 3300025986 Ga0207658_11089795 Ga0207658_110897951 139
1376 3300026023 Ga0207677_10047819 Ga0207677_100478192 139
1377 3300026035 Ga0207703_10198361 Ga0207703_101983613 139
1378 3300026035 Ga0207703_10269403 Ga0207703_102694032 139
1379 3300026035 Ga0207703_10326111 Ga0207703_103261112 139
1380 3300026035 Ga0207703_10442196 Ga0207703_104421962 139
1381 3300026035 Ga0207703_10572128 Ga0207703_105721282 139
1382 3300026035 Ga0207703_10626883 Ga0207703_106268832 139
1383 3300026035 Ga0207703_11176248 Ga0207703_111762482 139
1384 3300026041 Ga0207639_10024817 Ga0207639_100248173 139
1385 3300026041 Ga0207639_10183748 Ga0207639_101837482 139
1386 3300026041 Ga0207639_10195779 Ga0207639_101957791 139
1387 3300026041 Ga0207639_10294469 Ga0207639_102944692 139
1388 3300026041 Ga0207639_10327360 Ga0207639_103273601 139
1389 3300026041 Ga0207639_10373388 Ga0207639_103733882 139
1390 3300026041 Ga0207639_10433935 Ga0207639_104339352 139
1391 3300026067 Ga0207678_10012527 Ga0207678_100125274 139
1392 3300026067 Ga0207678_10014132 Ga0207678_100141327 139
1393 3300026067 Ga0207678_10081013 Ga0207678_100810133 139
1394 3300026067 Ga0207678_10083001 Ga0207678_100830012 139
1395 3300026067 Ga0207678_10106353 Ga0207678_101063532 139
1396 3300026067 Ga0207678_10117469 Ga0207678_101174693 139
1397 3300026067 Ga0207678_10171515 Ga0207678_101715152 139
1398 3300026067 Ga0207678_10185698 Ga0207678_101856982 139
1399 3300026067 Ga0207678_10446778 Ga0207678_104467782 139
1400 3300026067 Ga0207678_10456103 Ga0207678_104561032 139
1401 3300026067 Ga0207678_10600305 Ga0207678_106003051 139
1402 3300026067 Ga0207678_11026518 Ga0207678_110265182 139
1403 3300026067 Ga0207678_11909813 Ga0207678_119098131 139
1404 3300026075 Ga0207708_10511768 Ga0207708_105117682 139
1405 3300026078 Ga0207702_10000178 Ga0207702_1000017878 139
1406 3300026078 Ga0207702_10036144 Ga0207702_100361442 139
1407 3300026078 Ga0207702_10333491 Ga0207702_103334912 139
1408 3300026078 Ga0207702_10510395 Ga0207702_105103953 139
1409 3300026078 Ga0207702_10686072 Ga0207702_106860722 139
1410 3300026078 Ga0207702_11075239 Ga0207702_110752392 139
1411 3300026088 Ga0207641_10227760 Ga0207641_102277602 139
1412 3300026088 Ga0207641_10445629 Ga0207641_104456292 139
1413 3300026089 Ga0207648_10077463 Ga0207648_100774634 139
1414 3300026089 Ga0207648_10149673 Ga0207648_101496733 139
1415 3300026095 Ga0207676_10882846 Ga0207676_108828461 139
1416 3300026095 Ga0207676_12072790 Ga0207676_120727901 139
1417 3300026116 Ga0207674_10065228 Ga0207674_100652284 139
1418 3300026116 Ga0207674_10076098 Ga0207674_100760983 139
1419 3300026116 Ga0207674_10187603 Ga0207674_101876032 139
1420 3300026116 Ga0207674_10261764 Ga0207674_102617641 139
1421 3300026116 Ga0207674_10865349 Ga0207674_108653491 139
1422 3300026118 Ga0207675_100101779 Ga0207675_1001017793 139
1423 3300026118 Ga0207675_100170360 Ga0207675_1001703601 139
1424 3300026118 Ga0207675_101703807 Ga0207675_1017038071 139
1425 3300026121 Ga0207683_10652481 Ga0207683_106524812 139
1426 3300026121 Ga0207683_10677189 Ga0207683_106771892 139
1427 3300026142 Ga0207698_10078822 Ga0207698_100788221 139
1428 3300026142 Ga0207698_10121520 Ga0207698_101215203 139
1429 3300026142 Ga0207698_10156621 Ga0207698_101566212 139
1430 3300026142 Ga0207698_10217461 Ga0207698_102174611 139
1431 3300026142 Ga0207698_10261825 Ga0207698_102618252 139
1432 3300026142 Ga0207698_10400699 Ga0207698_104006992 139
1433 3300026142 Ga0207698_10453763 Ga0207698_104537632 139
1434 3300026142 Ga0207698_10622319 Ga0207698_106223191 139
1435 3300026142 Ga0207698_10908281 Ga0207698_109082811 139
1436 3300027296 Ga0209389_1000068 Ga0209389_100006879 139
1437 3300027296 Ga0209389_1000084 Ga0209389_100008478 139
1438 3300027357 Ga0209589_1000041 Ga0209589_1000041117 139
1439 3300027361 Ga0209489_100070 Ga0209489_10007011 139
1440 3300027361 Ga0209489_112017 Ga0209489_1120174 139
1441 3300027363 Ga0209700_100117 Ga0209700_10011722 139
1442 3300027671 Ga0209588_1080778 Ga0209588_10807782 139
1443 3300027671 Ga0209588_1117098 Ga0209588_11170981 139
1444 3300027866 Ga0209813_10176852 Ga0209813_101768522 139
1445 3300027866 Ga0209813_10328433 Ga0209813_103284331 139
1446 3300027907 Ga0207428_10317948 Ga0207428_103179482 139
1447 3300028379 Ga0268266_10001654 Ga0268266_1000165423 139
1448 3300028379 Ga0268266_10009378 Ga0268266_100093784 139
1449 3300028379 Ga0268266_10024146 Ga0268266_100241462 139
1450 3300028379 Ga0268266_10138604 Ga0268266_101386042 139
1451 3300028379 Ga0268266_10189384 Ga0268266_101893843 139
1452 3300028379 Ga0268266_10413560 Ga0268266_104135602 139
1453 3300028379 Ga0268266_11610586 Ga0268266_116105862 139
1454 3300028380 Ga0268265_10117782 Ga0268265_101177823 139
1455 3300028380 Ga0268265_10376456 Ga0268265_103764562 139
1456 3300028380 Ga0268265_10862766 Ga0268265_108627662 139
1457 3300028381 Ga0268264_10000084 Ga0268264_10000084219 139
1458 3300028381 Ga0268264_10234291 Ga0268264_102342912 139
1459 3300028381 Ga0268264_10611746 Ga0268264_106117462 139
1460 3300028556 Ga0265337_1021408 Ga0265337_10214082 139
1461 3300028563 Ga0265319_1003723 Ga0265319_10037239 139
1462 3300028573 Ga0265334_10032009 Ga0265334_100320092 139
1463 3300028573 Ga0265334_10043272 Ga0265334_100432722 139
1464 3300028653 Ga0265323_10000888 Ga0265323_100008889 139
1465 3300028786 Ga0307517_10002371 Ga0307517_100023719 139
1466 3300028794 Ga0307515_10034681 Ga0307515_100346816 139
1467 3300028794 Ga0307515_10058853 Ga0307515_100588532 139
1468 3300028794 Ga0307515_10279161 Ga0307515_102791612 139
1469 3300028800 Ga0265338_10000393 Ga0265338_1000039346 139
1470 3300030521 Ga0307511_10121856 Ga0307511_101218562 139
1471 3300031235 Ga0265330_10014199 Ga0265330_100141992 139
1472 3300031235 Ga0265330_10226731 Ga0265330_102267311 139
1473 3300031238 Ga0265332_10045590 Ga0265332_100455902 139
1474 3300031238 Ga0265332_10074705 Ga0265332_100747051 139
1475 3300031241 Ga0265325_10075117 Ga0265325_100751172 139
1476 3300031247 Ga0265340_10000375 Ga0265340_100003754 139
1477 3300031247 Ga0265340_10283764 Ga0265340_102837641 139
1478 3300031249 Ga0265339_10013801 Ga0265339_100138014 139
1479 3300031249 Ga0265339_10021265 Ga0265339_100212654 139
1480 3300031249 Ga0265339_10024964 Ga0265339_100249643 139
1481 3300031249 Ga0265339_10151347 Ga0265339_101513472 139
1482 3300031250 Ga0265331_10044481 Ga0265331_100444812 139
1483 3300031250 Ga0265331_10045751 Ga0265331_100457513 139
1484 3300031250 Ga0265331_10131531 Ga0265331_101315312 139
1485 3300031344 Ga0265316_10198430 Ga0265316_101984302 139
1486 3300031344 Ga0265316_10832197 Ga0265316_108321972 139
1487 3300031456 Ga0307513_10422181 Ga0307513_104221811 139
1488 3300031456 Ga0307513_10704884 Ga0307513_107048841 139
1489 3300031507 Ga0307509_10063581 Ga0307509_100635814 139
1490 3300031507 Ga0307509_10067920 Ga0307509_100679202 139
1491 3300031507 Ga0307509_10229416 Ga0307509_102294161 139
1492 3300031507 Ga0307509_10681187 Ga0307509_106811872 139
1493 3300031616 Ga0307508_10000010 Ga0307508_10000010193 139
1494 3300031616 Ga0307508_10015791 Ga0307508_100157914 139
1495 3300031616 Ga0307508_10069397 Ga0307508_100693974 139
1496 3300031616 Ga0307508_10314859 Ga0307508_103148592 139
1497 3300031616 Ga0307508_10499013 Ga0307508_104990131 139
1498 3300031711 Ga0265314_10033044 Ga0265314_100330443 139
1499 3300031711 Ga0265314_10076159 Ga0265314_100761593 139
1500 3300031711 Ga0265314_10495211 Ga0265314_104952112 139
1501 3300031712 Ga0265342_10085535 Ga0265342_100855353 139
1502 3300031712 Ga0265342_10102951 Ga0265342_101029512 139
1503 3300031712 Ga0265342_10142427 Ga0265342_101424272 139
1504 3300031712 Ga0265342_10195105 Ga0265342_101951051 139
1505 3300031712 Ga0265342_10203178 Ga0265342_102031781 139
1506 3300031730 Ga0307516_10029618 Ga0307516_100296187 139
1507 3300031730 Ga0307516_10237670 Ga0307516_102376702 139
1508 3300031731 Ga0307405_10222250 Ga0307405_102222502 139
1509 3300031731 Ga0307405_11624264 Ga0307405_116242642 139
1510 3300031824 Ga0307413_10018209 Ga0307413_100182095 139
1511 3300031824 Ga0307413_10040611 Ga0307413_100406112 139
1512 3300031852 Ga0307410_10120038 Ga0307410_101200382 139
1513 3300031901 Ga0307406_10645453 Ga0307406_106454532 139
1514 3300031903 Ga0307407_10179150 Ga0307407_101791502 139
1515 3300031911 Ga0307412_10059011 Ga0307412_100590112 139
1516 3300031911 Ga0307412_10134559 Ga0307412_101345592 139
1517 3300031911 Ga0307412_10361412 Ga0307412_103614122 139
1518 3300031911 Ga0307412_10416293 Ga0307412_104162932 139
1519 3300031995 Ga0307409_100177343 Ga0307409_1001773431 139
1520 3300032002 Ga0307416_100296414 Ga0307416_1002964142 139
1521 3300032002 Ga0307416_100412886 Ga0307416_1004128862 139
1522 3300032004 Ga0307414_10988994 Ga0307414_109889941 139
1523 3300032005 Ga0307411_10019121 Ga0307411_100191212 139
1524 3300032126 Ga0307415_100252660 Ga0307415_1002526601 139
1525 3300033179 Ga0307507_10060806 Ga0307507_100608064 139
1526 3300033179 Ga0307507_10437126 Ga0307507_104371261 139
1527 3300033180 Ga0307510_10021245 Ga0307510_100212454 139
1528 3300033180 Ga0307510_10039573 Ga0307510_100395733 139
1529 3300033180 Ga0307510_10302690 Ga0307510_103026902 139
1530 3300033180 Ga0307510_10316765 Ga0307510_103167651 139
1531 3300034817 Ga0373948_0103886 Ga0373948_0103886_179_598 139
1532 3300034817 Ga0373948_0156167 Ga0373948_0156167_39_458 139
1533 3300034820 Ga0373959_0163611 Ga0373959_0163611_38_457 139
1534 3300034957 Ga0373938_0101821 Ga0373938_0101821_145_564 139
1535 3300035083 Ga0373926_0108193 Ga0373926_0108193_510_929 139
1536 3300035083 Ga0373926_0432178 Ga0373926_0432178_77_496 139
1537 3300035086 Ga0373934_0002259 Ga0373934_0002259_3897_4316 139
1538 3300035086 Ga0373934_0020962 Ga0373934_0020962_1477_1896 139
1539 3300035111 Ga0373923_0000561 Ga0373923_0000561_3748_4167 139
1540 3300035111 Ga0373923_0017215 Ga0373923_0017215_1165_1584 139
1541 3300035111 Ga0373923_0277172 Ga0373923_0277172_18_437 139
1542 3300035112 Ga0373932_0009540 Ga0373932_0009540_1760_2179 139
1543 3300035113 Ga0373936_0029212 Ga0373936_0029212_814_1233 139
1544 3300035113 Ga0373936_0104757 Ga0373936_0104757_427_846 139
1545 3300035113 Ga0373936_0174349 Ga0373936_0174349_195_614 139
1546 3300035113 Ga0373936_0429643 Ga0373936_0429643_69_488 139
1547 3300035114 Ga0373939_0509378 Ga0373939_0509378_55_474 139
1548 3300035115 Ga0373941_0274847 Ga0373941_0274847_49_468 139
1549 3300035116 Ga0373945_0044659 Ga0373945_0044659_246_665 139
1550 3300035117 Ga0373953_0000340 Ga0373953_0000340_10057_10476 139
1551 3300035117 Ga0373953_0025571 Ga0373953_0025571_1787_2206 139
1552 3300035117 Ga0373953_0128717 Ga0373953_0128717_631_1050 139
1553 3300035118 Ga0373954_0000273 Ga0373954_0000273_3392_3811 139
1554 3300035119 Ga0373956_0004613 Ga0373956_0004613_1271_1690 139
1555 3300035120 Ga0373957_0000313 Ga0373957_0000313_11133_11552 139
1556 3300035121 Ga0373960_0150347 Ga0373960_0150347_265_684 139
1557 3300035170 Ga0373943_0034556 Ga0373943_0034556_756_1175 139
1558 3300035170 Ga0373943_0254303 Ga0373943_0254303_402_821 139
1559 3300035171 Ga0373946_0005143 Ga0373946_0005143_1592_2011 139
1560 3300035171 Ga0373946_0757409 Ga0373946_0757409_62_481 139
1561 3300035172 Ga0373955_0004906 Ga0373955_0004906_1773_2192 139
1562 3300035172 Ga0373955_0025672 Ga0373955_0025672_2392_2811 139
1563 3300035172 Ga0373955_0074860 Ga0373955_0074860_17_436 139
1564 3300035410 Ga0373924_0001394 Ga0373924_0001394_1760_2179 139
1565 3300035410 Ga0373924_0029309 Ga0373924_0029309_1730_2149 139
1566 3300035691 Ga0373931_0044474 Ga0373931_0044474_87_506 139
1567 3300035691 Ga0373931_0056831 Ga0373931_0056831_406_825 139
1568 3300035691 Ga0373931_0339246 Ga0373931_0339246_38_457 139
1569 3300035692 Ga0373935_0024222 Ga0373935_0024222_2576_2995 139
1570 3300035692 Ga0373935_0285829 Ga0373935_0285829_50_469 139
1571 3300035692 Ga0373935_0522334 Ga0373935_0522334_152_571 139
1572 3300035692 Ga0373935_0616997 Ga0373935_0616997_264_683 139
1573 3300035695 Ga0373927_0002786 Ga0373927_0002786_12121_12540 139
1574 3300035695 Ga0373927_0006180 Ga0373927_0006180_3653_4072 139
1575 3300035695 Ga0373927_0006968 Ga0373927_0006968_3282_3701 139
1576 3300035695 Ga0373927_0023230 Ga0373927_0023230_1003_1422 139
1577 3300035695 Ga0373927_0052838 Ga0373927_0052838_1962_2381 139
1578 3300035695 Ga0373927_0197082 Ga0373927_0197082_107_526 139
1579 3300035724 Ga0373933_0000233 Ga0373933_0000233_29848_30267 139
1580 3300035724 Ga0373933_0008689 Ga0373933_0008689_1654_2073 139
1581 3300035724 Ga0373933_0092097 Ga0373933_0092097_524_943 139
1582 3300035724 Ga0373933_0097269 Ga0373933_0097269_115_534 139
1583 3300035724 Ga0373933_0337220 Ga0373933_0337220_386_805 139
1584 3300035725 Ga0373947_0000940 Ga0373947_0000940_15347_15766 139
1585 3300035725 Ga0373947_0024083 Ga0373947_0024083_1814_2233 139
1586 3300035725 Ga0373947_0135697 Ga0373947_0135697_335_754 139
1587 3300036401 Ga0373937_0006956 Ga0373937_0006956_2897_3316 139
1588 3300036401 Ga0373937_0131867 Ga0373937_0131867_993_1412 139
1589 3300036401 Ga0373937_0359182 Ga0373937_0359182_325_744 139
1590 3300036401 Ga0373937_0393596 Ga0373937_0393596_799_1218 139
1591 3300036401 Ga0373937_0444573 Ga0373937_0444573_359_778 139
1592 3300036401 Ga0373937_0599886 Ga0373937_0599886_87_506 139
1593 3300036401 Ga0373937_0672085 Ga0373937_0672085_132_563 139
1594 3300037068 Ga0373925_0001317 Ga0373925_0001317_4480_4899 139
1595 3300037068 Ga0373925_0011166 Ga0373925_0011166_1930_2349 139
1596 3300037068 Ga0373925_0113451 Ga0373925_0113451_38_457 139
1597 3300037068 Ga0373925_0160866 Ga0373925_0160866_802_1221 139
1598 3300037068 Ga0373925_0164171 Ga0373925_0164171_295_714 139
1599 3300037068 Ga0373925_0900932 Ga0373925_0900932_274_693 139
1600 3300037068 Ga0373925_0924050 Ga0373925_0924050_248_667 139
1601 3300037418 Ga0395900_0004063 Ga0395900_0004063_11670_12089 139
1602 3300037418 Ga0395900_0624335 Ga0395900_0624335_334_753 139
1603 3300037418 Ga0395900_0691455 Ga0395900_0691455_203_622 139
1604 3300037418 Ga0395900_0723865 Ga0395900_0723865_68_487 139
1605 3300037466 Ga0395898_0005719 Ga0395898_0005719_3499_3918 139
1606 3300037466 Ga0395898_0054033 Ga0395898_0054033_3046_3465 139
1607 3300037466 Ga0395898_0197051 Ga0395898_0197051_853_1272 139
1608 3300037471 Ga0395905_0002137 Ga0395905_0002137_10945_11364 139
1609 3300037471 Ga0395905_0066739 Ga0395905_0066739_2799_3218 139
1610 3300037471 Ga0395905_0087702 Ga0395905_0087702_1319_1738 139
1611 3300037471 Ga0395905_0990056 Ga0395905_0990056_100_519 139
1612 3300037853 Ga0436364_0251389 Ga0436364_0251389_1219_1638 139
1613 3300037853 Ga0436364_0816631 Ga0436364_0816631_765_1184 139
1614 3300037853 Ga0436364_1271423 Ga0436364_1271423_453_872 139
1615 3300037853 Ga0436364_1386416 Ga0436364_1386416_239_658 139
1616 3300038443 Ga0395901_0044133 Ga0395901_0044133_3144_3563 139
1617 3300038443 Ga0395901_0212552 Ga0395901_0212552_1346_1765 139
1618 3300038443 Ga0395901_0282659 Ga0395901_0282659_871_1290 139
1619 3300038443 Ga0395901_0288954 Ga0395901_0288954_12_431 139
1620 3300038443 Ga0395901_0291348 Ga0395901_0291348_533_952 139
1621 3300038443 Ga0395901_0316047 Ga0395901_0316047_78_497 139
1622 3300038443 Ga0395901_0660491 Ga0395901_0660491_395_814 139
1623 3300039437 Ga0436365_0053441 Ga0436365_0053441_6955_7374 139
1624 3300039437 Ga0436365_0366637 Ga0436365_0366637_156_575 139
1625 3300039437 Ga0436365_0477401 Ga0436365_0477401_622_1041 139
1626 3300039437 Ga0436365_0617970 Ga0436365_0617970_152_571 139
1627 3300039437 Ga0436365_0699064 Ga0436365_0699064_2307_2726 139
1628 3300039437 Ga0436365_0851748 Ga0436365_0851748_69_488 139
1629 3300039437 Ga0436365_1165754 Ga0436365_1165754_266_685 139
1630 3300039437 Ga0436365_1228330 Ga0436365_1228330_637_1056 139
1631 3300039437 Ga0436365_1426474 Ga0436365_1426474_266_685 139
1632 3300039437 Ga0436365_1749876 Ga0436365_1749876_1705_2124 139
1633 3300039437 Ga0436365_1752018 Ga0436365_1752018_257_676 139
1634 3300039437 Ga0436365_1820094 Ga0436365_1820094_759_1178 139
1635 3300039438 Ga0436360_0408637 Ga0436360_0408637_1018_1437 139
1636 3300039438 Ga0436360_0688532 Ga0436360_0688532_209_628 139
1637 3300039438 Ga0436360_0811273 Ga0436360_0811273_47_466 139
1638 3300039447 Ga0436361_1046058 Ga0436361_1046058_2216_2635 139
1639 3300039450 Ga0436363_0135174 Ga0436363_0135174_107_526 139
1640 3300039450 Ga0436363_0217405 Ga0436363_0217405_250_669 139
1641 3300039450 Ga0436363_0319835 Ga0436363_0319835_391_810 139
1642 3300039450 Ga0436363_0746225 Ga0436363_0746225_3097_3516 139
1643 3300039450 Ga0436363_0946020 Ga0436363_0946020_17_436 139
1644 3300039450 Ga0436363_1074758 Ga0436363_1074758_380_799 139
1645 3300039450 Ga0436363_1365439 Ga0436363_1365439_966_1385 139
1646 3300039450 Ga0436363_1366742 Ga0436363_1366742_43_462 139
1647 3300039450 Ga0436363_1611992 Ga0436363_1611992_5075_5494 139
1648 3300039453 Ga0436362_0544026 Ga0436362_0544026_309_728 139
1649 3300039453 Ga0436362_0548637 Ga0436362_0548637_2182_2601 139
1650 3300039453 Ga0436362_0790264 Ga0436362_0790264_1807_2226 139
1651 3300041413 Ga0439465_0041673 Ga0439465_0041673_1008_1427 139
1652 3300041413 Ga0439465_0054760 Ga0439465_0054760_613_1032 139
1653 3300041443 Ga0451789_0230772 Ga0451789_0230772_72_491 139
1654 3300041443 Ga0451789_0402674 Ga0451789_0402674_166_585 139
1655 3300041443 Ga0451789_0611428 Ga0451789_0611428_66_485 139
1656 3300041451 Ga0451791_1870027 Ga0451791_1870027_187_606 139
1657 3300041452 Ga0451793_1536712 Ga0451793_1536712_12_431 139
1658 3300041452 Ga0451793_1783197 Ga0451793_1783197_33_452 139
1659 3300041456 Ga0451795_1029353 Ga0451795_1029353_806_1225 139
1660 3300041458 Ga0451798_0803659 Ga0451798_0803659_87_506 139
1661 3300041458 Ga0451798_1034226 Ga0451798_1034226_18_437 139
1662 3300041459 Ga0451800_0363129 Ga0451800_0363129_124_543 139
1663 3300041459 Ga0451800_1192641 Ga0451800_1192641_117_536 139
1664 3300041494 Ga0451837_0719031 Ga0451837_0719031_528_947 139
1665 3300041498 Ga0451841_1363010 Ga0451841_1363010_559_978 139
1666 3300041509 Ga0451843_1467134 Ga0451843_1467134_119_538 139
1667 3300041512 Ga0451853_3829445 Ga0451853_3829445_240_659 139
1668 3300042004 Ga0439445_0089365 Ga0439445_0089365_417_836 139
1669 3300042156 Ga0439446_0128271 Ga0439446_0128271_101_520 139
1670 3300042156 Ga0439446_0254257 Ga0439446_0254257_167_586 139
1671 3300042157 Ga0439458_0181150 Ga0439458_0181150_82_501 139
1672 3300042993 Ga0439440_0227023 Ga0439440_0227023_71_490 139
1673 3300044656 Ga0466969_0020776 Ga0466969_0020776_15_434 139
1674 3300044656 Ga0466969_0174098 Ga0466969_0174098_445_864 139
1675 3300044656 Ga0466969_0445780 Ga0466969_0445780_41_460 139
1676 3300044658 Ga0466972_0000076 Ga0466972_0000076_27289_27708 139
1677 3300044658 Ga0466972_0003652 Ga0466972_0003652_2686_3105 139
1678 3300044658 Ga0466972_0094783 Ga0466972_0094783_422_841 139
1679 3300044683 Ga0466965_0007555 Ga0466965_0007555_250_669 139
1680 3300044683 Ga0466965_0274675 Ga0466965_0274675_329_748 139
1681 3300044684 Ga0466966_0001943 Ga0466966_0001943_2592_3011 139
1682 3300044684 Ga0466966_0237232 Ga0466966_0237232_637_1056 139
1683 3300044693 Ga0466961_0000064 Ga0466961_0000064_50572_50991 139
1684 3300044693 Ga0466961_0105519 Ga0466961_0105519_1035_1454 139
1685 3300044694 Ga0466963_0061280 Ga0466963_0061280_1482_1901 139
1686 3300044694 Ga0466963_0156547 Ga0466963_0156547_800_1219 139
1687 3300044694 Ga0466963_0240585 Ga0466963_0240585_261_680 139
1688 3300044694 Ga0466963_1140693 Ga0466963_1140693_35_454 139
1689 3300044719 Ga0466971_0193676 Ga0466971_0193676_13_432 139
1690 3300044719 Ga0466971_0203401 Ga0466971_0203401_370_789 139
1691 3300044735 Ga0466968_0418709 Ga0466968_0418709_221_640 139
1692 3300044735 Ga0466968_0528593 Ga0466968_0528593_154_573 139
1693 3300044765 Ga0466970_0160387 Ga0466970_0160387_516_935 139
1694 3300044765 Ga0466970_0362049 Ga0466970_0362049_253_672 139
1695 3300044765 Ga0466970_0618678 Ga0466970_0618678_45_464 139
1696 3300044842 Ga0466957_0087137 Ga0466957_0087137_538_957 139
1697 3300044842 Ga0466957_0166780 Ga0466957_0166780_214_633 139
1698 3300044901 Ga0466960_0004142 Ga0466960_0004142_2800_3219 139
1699 3300044901 Ga0466960_0593456 Ga0466960_0593456_162_581 139
1700 3300045049 Ga0466959_0004743 Ga0466959_0004743_3771_4190 139
1701 3300045049 Ga0466959_0168948 Ga0466959_0168948_819_1238 139
1702 3300045049 Ga0466959_0300152 Ga0466959_0300152_71_490 139
1703 3300045049 Ga0466959_0932456 Ga0466959_0932456_14_433 139
1704 3300045976 Ga0466967_0019942 Ga0466967_0019942_1402_1821 139
1705 3300045976 Ga0466967_0142729 Ga0466967_0142729_1169_1588 139
1706 3300045976 Ga0466967_0398794 Ga0466967_0398794_375_794 139
1707 3300045976 Ga0466967_0678945 Ga0466967_0678945_223_642 139
1708 3300045976 Ga0466967_1456838 Ga0466967_1456838_195_614 139
1709 3300046452 Ga0495617_100574 Ga0495617_100574_13_432 139
1710 3300046453 Ga0495627_045554 Ga0495627_045554_841_1260 139
1711 3300046454 Ga0495592_0001404 Ga0495592_0001404_1312_1731 139
1712 3300046454 Ga0495592_0080349 Ga0495592_0080349_295_714 139
1713 3300046454 Ga0495592_0279332 Ga0495592_0279332_120_539 139
1714 3300046454 Ga0495592_0294120 Ga0495592_0294120_527_946 139
1715 3300046454 Ga0495592_0441911 Ga0495592_0441911_187_606 139
1716 3300046455 Ga0495603_0005350 Ga0495603_0005350_3871_4290 139
1717 3300046455 Ga0495603_0013115 Ga0495603_0013115_406_825 139
1718 3300046455 Ga0495603_0024150 Ga0495603_0024150_603_1022 139
1719 3300046455 Ga0495603_0047309 Ga0495603_0047309_1523_1942 139
1720 3300046455 Ga0495603_0249264 Ga0495603_0249264_248_667 139
1721 3300046455 Ga0495603_0533656 Ga0495603_0533656_99_518 139
1722 3300046457 Ga0495590_0059656 Ga0495590_0059656_140_559 139
1723 3300046459 Ga0495629_0000581 Ga0495629_0000581_15198_15617 139
1724 3300046459 Ga0495629_0004968 Ga0495629_0004968_8948_9367 139
1725 3300046459 Ga0495629_0009943 Ga0495629_0009943_1253_1672 139
1726 3300046459 Ga0495629_0036812 Ga0495629_0036812_2312_2731 139
1727 3300046459 Ga0495629_0283531 Ga0495629_0283531_526_945 139
1728 3300046459 Ga0495629_0583427 Ga0495629_0583427_48_467 139
1729 3300046460 Ga0495638_0018446 Ga0495638_0018446_137_556 139
1730 3300046460 Ga0495638_0087360 Ga0495638_0087360_1194_1613 139
1731 3300046460 Ga0495638_0101550 Ga0495638_0101550_1164_1583 139
1732 3300046460 Ga0495638_0219165 Ga0495638_0219165_547_966 139
1733 3300046460 Ga0495638_0420549 Ga0495638_0420549_210_629 139
1734 3300046460 Ga0495638_0480138 Ga0495638_0480138_84_503 139
1735 3300046461 Ga0495641_0013094 Ga0495641_0013094_3572_3991 139
1736 3300046461 Ga0495641_0178369 Ga0495641_0178369_177_596 139
1737 3300046462 Ga0495651_0004932 Ga0495651_0004932_3284_3703 139
1738 3300046462 Ga0495651_0030346 Ga0495651_0030346_499_918 139
1739 3300046462 Ga0495651_0036001 Ga0495651_0036001_537_956 139
1740 3300046462 Ga0495651_0050639 Ga0495651_0050639_2025_2444 139
1741 3300046462 Ga0495651_0131193 Ga0495651_0131193_531_950 139
1742 3300046462 Ga0495651_0268148 Ga0495651_0268148_618_1037 139
1743 3300046463 Ga0495653_0002259 Ga0495653_0002259_8800_9219 139
1744 3300046463 Ga0495653_0105748 Ga0495653_0105748_229_648 139
1745 3300046463 Ga0495653_0234789 Ga0495653_0234789_672_1091 139
1746 3300046463 Ga0495653_0848284 Ga0495653_0848284_80_499 139
1747 3300046472 Ga0495580_0007623 Ga0495580_0007623_5555_5974 139
1748 3300046472 Ga0495580_0105978 Ga0495580_0105978_758_1177 139
1749 3300046473 Ga0495582_0000528 Ga0495582_0000528_16819_17238 139
1750 3300046473 Ga0495582_0181098 Ga0495582_0181098_52_471 139
1751 3300046473 Ga0495582_0288301 Ga0495582_0288301_489_908 139
1752 3300046474 Ga0495605_0054016 Ga0495605_0054016_1451_1870 139
1753 3300046474 Ga0495605_0456981 Ga0495605_0456981_64_483 139
1754 3300046475 Ga0495639_0000044 Ga0495639_0000044_34923_35342 139
1755 3300046475 Ga0495639_0076142 Ga0495639_0076142_1083_1502 139
1756 3300046475 Ga0495639_0118157 Ga0495639_0118157_825_1244 139
1757 3300046475 Ga0495639_0284751 Ga0495639_0284751_110_529 139
1758 3300046475 Ga0495639_0466547 Ga0495639_0466547_170_589 139
1759 3300046476 Ga0495662_0001271 Ga0495662_0001271_3366_3785 139
1760 3300046476 Ga0495662_0032632 Ga0495662_0032632_1477_1896 139
1761 3300046477 Ga0495664_0019573 Ga0495664_0019573_2778_3197 139
1762 3300046477 Ga0495664_0047749 Ga0495664_0047749_1889_2308 139
1763 3300046477 Ga0495664_0263714 Ga0495664_0263714_132_551 139
1764 3300046477 Ga0495664_0747938 Ga0495664_0747938_40_459 139
1765 3300046492 Ga0495585_0039459 Ga0495585_0039459_1298_1717 139
1766 3300046499 Ga0495594_0000351 Ga0495594_0000351_17690_18109 139
1767 3300046499 Ga0495594_0512978 Ga0495594_0512978_104_523 139
1768 3300046499 Ga0495594_0543995 Ga0495594_0543995_66_485 139
1769 3300046500 Ga0495596_0095385 Ga0495596_0095385_96_515 139
1770 3300046501 Ga0495607_0097614 Ga0495607_0097614_1105_1524 139
1771 3300046501 Ga0495607_0269178 Ga0495607_0269178_172_591 139
1772 3300046506 Ga0495583_0039267 Ga0495583_0039267_389_808 139
1773 3300046506 Ga0495583_0097943 Ga0495583_0097943_641_1060 139
1774 3300046506 Ga0495583_0159294 Ga0495583_0159294_421_840 139
1775 3300046507 Ga0495606_0001746 Ga0495606_0001746_4228_4647 139
1776 3300046507 Ga0495606_0017947 Ga0495606_0017947_1542_1961 139
1777 3300046507 Ga0495606_0193825 Ga0495606_0193825_577_996 139
1778 3300046507 Ga0495606_0215647 Ga0495606_0215647_322_741 139
1779 3300046511 Ga0495608_0002317 Ga0495608_0002317_537_956 139
1780 3300046511 Ga0495608_0090284 Ga0495608_0090284_1347_1766 139
1781 3300046511 Ga0495608_0092481 Ga0495608_0092481_813_1232 139
1782 3300046511 Ga0495608_0271112 Ga0495608_0271112_487_906 139
1783 3300046512 Ga0495610_0052636 Ga0495610_0052636_964_1383 139
1784 3300046512 Ga0495610_0104961 Ga0495610_0104961_531_950 139
1785 3300046512 Ga0495610_0113739 Ga0495610_0113739_217_636 139
1786 3300046513 Ga0495616_0041788 Ga0495616_0041788_579_998 139
1787 3300046513 Ga0495616_0233405 Ga0495616_0233405_119_538 139
1788 3300046513 Ga0495616_0247472 Ga0495616_0247472_207_626 139
1789 3300046513 Ga0495616_0269433 Ga0495616_0269433_62_481 139
1790 3300046514 Ga0495618_0022887 Ga0495618_0022887_2278_2697 139
1791 3300046514 Ga0495618_0279544 Ga0495618_0279544_534_953 139
1792 3300046515 Ga0495620_0019477 Ga0495620_0019477_2651_3070 139
1793 3300046515 Ga0495620_0045056 Ga0495620_0045056_533_952 139
1794 3300046515 Ga0495620_0186269 Ga0495620_0186269_174_593 139
1795 3300046515 Ga0495620_0245605 Ga0495620_0245605_209_628 139
1796 3300046516 Ga0495628_0033623 Ga0495628_0033623_549_968 139
1797 3300046516 Ga0495628_0035135 Ga0495628_0035135_1955_2374 139
1798 3300046516 Ga0495628_0054533 Ga0495628_0054533_2300_2719 139
1799 3300046516 Ga0495628_0064513 Ga0495628_0064513_755_1174 139
1800 3300046516 Ga0495628_0367825 Ga0495628_0367825_33_452 139
1801 3300046517 Ga0495630_0002975 Ga0495630_0002975_1674_2093 139
1802 3300046517 Ga0495630_0136386 Ga0495630_0136386_496_915 139
1803 3300046517 Ga0495630_0572742 Ga0495630_0572742_336_755 139
1804 3300046518 Ga0495631_0085720 Ga0495631_0085720_137_556 139
1805 3300046518 Ga0495631_0091271 Ga0495631_0091271_506_925 139
1806 3300046518 Ga0495631_0157297 Ga0495631_0157297_466_885 139
1807 3300046518 Ga0495631_0373540 Ga0495631_0373540_32_451 139
1808 3300046519 Ga0495632_0088332 Ga0495632_0088332_839_1258 139
1809 3300046519 Ga0495632_0485613 Ga0495632_0485613_56_475 139
1810 3300046522 Ga0495643_0006501 Ga0495643_0006501_1873_2292 139
1811 3300046522 Ga0495643_0103119 Ga0495643_0103119_478_897 139
1812 3300046522 Ga0495643_0104203 Ga0495643_0104203_42_461 139
1813 3300046523 Ga0495644_0128538 Ga0495644_0128538_405_824 139
1814 3300046524 Ga0495648_0005365 Ga0495648_0005365_6396_6815 139
1815 3300046524 Ga0495648_0017254 Ga0495648_0017254_1623_2042 139
1816 3300046524 Ga0495648_0055186 Ga0495648_0055186_959_1378 139
1817 3300046524 Ga0495648_0204222 Ga0495648_0204222_47_466 139
1818 3300046524 Ga0495648_0308653 Ga0495648_0308653_274_693 139
1819 3300046524 Ga0495648_0335660 Ga0495648_0335660_64_483 139
1820 3300046524 Ga0495648_0486233 Ga0495648_0486233_82_501 139
1821 3300046526 Ga0495666_0090815 Ga0495666_0090815_757_1176 139
1822 3300046529 Ga0495652_0001396 Ga0495652_0001396_25820_26239 139
1823 3300046529 Ga0495652_0035090 Ga0495652_0035090_3822_4241 139
1824 3300046529 Ga0495652_0044737 Ga0495652_0044737_81_500 139
1825 3300046529 Ga0495652_0063781 Ga0495652_0063781_841_1260 139
1826 3300046529 Ga0495652_0287341 Ga0495652_0287341_377_796 139
1827 3300046530 Ga0495654_0065122 Ga0495654_0065122_218_637 139
1828 3300046531 Ga0495665_0000397 Ga0495665_0000397_4873_5292 139
1829 3300046531 Ga0495665_0372349 Ga0495665_0372349_230_649 139
1830 3300046533 Ga0495640_0006961 Ga0495640_0006961_4094_4513 139
1831 3300046533 Ga0495640_0010991 Ga0495640_0010991_5851_6270 139
1832 3300046533 Ga0495640_0123438 Ga0495640_0123438_855_1274 139
1833 3300046535 Ga0495586_0352282 Ga0495586_0352282_340_759 139
1834 3300046535 Ga0495586_0421669 Ga0495586_0421669_104_523 139
1835 3300046536 Ga0495587_0007451 Ga0495587_0007451_3026_3445 139
1836 3300046536 Ga0495587_0019063 Ga0495587_0019063_3380_3799 139
1837 3300046536 Ga0495587_0490789 Ga0495587_0490789_243_662 139
1838 3300046536 Ga0495587_0622639 Ga0495587_0622639_21_440 139
1839 3300046538 Ga0495609_0089763 Ga0495609_0089763_781_1200 139
1840 3300046538 Ga0495609_0281885 Ga0495609_0281885_89_508 139
1841 3300046542 Ga0495597_0058413 Ga0495597_0058413_98_517 139
1842 3300046542 Ga0495597_0084209 Ga0495597_0084209_456_875 139
1843 3300046543 Ga0495645_0010661 Ga0495645_0010661_1819_2238 139
1844 3300046543 Ga0495645_0012981 Ga0495645_0012981_1169_1588 139
1845 3300046543 Ga0495645_0268523 Ga0495645_0268523_61_480 139
1846 3300046543 Ga0495645_0593043 Ga0495645_0593043_55_474 139
1847 3300046557 Ga0495622_0002861 Ga0495622_0002861_577_996 139
1848 3300046557 Ga0495622_0029367 Ga0495622_0029367_882_1301 139
1849 3300046557 Ga0495622_0039772 Ga0495622_0039772_604_1023 139
1850 3300046557 Ga0495622_0197799 Ga0495622_0197799_157_576 139
1851 3300046558 Ga0495633_0458469 Ga0495633_0458469_84_503 139
1852 3300046559 Ga0495667_0000359 Ga0495667_0000359_3394_3813 139
1853 3300046559 Ga0495667_0012846 Ga0495667_0012846_3277_3696 139
1854 3300046559 Ga0495667_0016195 Ga0495667_0016195_1982_2401 139
1855 3300046559 Ga0495667_0034954 Ga0495667_0034954_554_973 139
1856 3300046615 Ga0495656_0276047 Ga0495656_0276047_418_837 139
1857 3300046615 Ga0495656_0712694 Ga0495656_0712694_69_488 139
1858 3300046616 Ga0495668_0140978 Ga0495668_0140978_13_432 139
1859 3300046616 Ga0495668_0203646 Ga0495668_0203646_229_648 139
1860 3300046616 Ga0495668_0237298 Ga0495668_0237298_464_883 139
1861 3300046616 Ga0495668_0257622 Ga0495668_0257622_475_894 139
1862 3300046616 Ga0495668_0311350 Ga0495668_0311350_184_603 139
1863 3300046642 Ga0495634_0000252 Ga0495634_0000252_30478_30897 139
1864 3300046642 Ga0495634_0012038 Ga0495634_0012038_4441_4860 139
1865 3300046642 Ga0495634_0037255 Ga0495634_0037255_2477_2896 139
1866 3300046642 Ga0495634_0042724 Ga0495634_0042724_594_1013 139
1867 3300046642 Ga0495634_0618341 Ga0495634_0618341_79_498 139
1868 3300046642 Ga0495634_0690123 Ga0495634_0690123_59_478 139
1869 3300046648 Ga0495611_0490251 Ga0495611_0490251_73_492 139
1870 3300046660 Ga0495625_0044195 Ga0495625_0044195_1882_2301 139
1871 3300046660 Ga0495625_0065806 Ga0495625_0065806_1268_1687 139
1872 3300046660 Ga0495625_0138709 Ga0495625_0138709_395_814 139
1873 3300046660 Ga0495625_0181634 Ga0495625_0181634_345_764 139
1874 3300046660 Ga0495625_0229204 Ga0495625_0229204_34_453 139
1875 3300046660 Ga0495625_0262168 Ga0495625_0262168_471_890 139
1876 3300046663 Ga0495635_0000251 Ga0495635_0000251_14145_14564 139
1877 3300046663 Ga0495635_0001901 Ga0495635_0001901_11813_12232 139
1878 3300046663 Ga0495635_0008104 Ga0495635_0008104_1383_1802 139
1879 3300046663 Ga0495635_0071824 Ga0495635_0071824_1088_1507 139
1880 3300046664 Ga0495659_0103049 Ga0495659_0103049_444_863 139
1881 3300046665 Ga0495661_0118984 Ga0495661_0118984_347_766 139
1882 3300046674 Ga0495588_0014106 Ga0495588_0014106_1984_2403 139
1883 3300046674 Ga0495588_0071522 Ga0495588_0071522_410_829 139
1884 3300046674 Ga0495588_0075591 Ga0495588_0075591_1045_1464 139
1885 3300046674 Ga0495588_0176019 Ga0495588_0176019_475_894 139
1886 3300046674 Ga0495588_0180839 Ga0495588_0180839_493_912 139
1887 3300046674 Ga0495588_0184934 Ga0495588_0184934_593_1012 139
1888 3300046674 Ga0495588_0253796 Ga0495588_0253796_469_888 139
1889 3300046675 Ga0495657_0005246 Ga0495657_0005246_8836_9255 139
1890 3300046675 Ga0495657_0011549 Ga0495657_0011549_5850_6269 139
1891 3300046675 Ga0495657_0141317 Ga0495657_0141317_570_989 139
1892 3300046675 Ga0495657_0243013 Ga0495657_0243013_142_561 139
1893 3300046675 Ga0495657_0477862 Ga0495657_0477862_26_445 139
1894 3300046678 Ga0495599_0000305 Ga0495599_0000305_24899_25318 139
1895 3300046678 Ga0495599_0037859 Ga0495599_0037859_350_769 139
1896 3300046678 Ga0495599_0093045 Ga0495599_0093045_1420_1839 139
1897 3300046678 Ga0495599_0143535 Ga0495599_0143535_1009_1428 139
1898 3300046678 Ga0495599_0214376 Ga0495599_0214376_359_778 139
1899 3300046678 Ga0495599_0317246 Ga0495599_0317246_202_621 139
1900 3300046679 Ga0495623_0001012 Ga0495623_0001012_6837_7256 139
1901 3300046679 Ga0495623_0050596 Ga0495623_0050596_583_1002 139
1902 3300046679 Ga0495623_0081382 Ga0495623_0081382_1544_1963 139
1903 3300046679 Ga0495623_0154631 Ga0495623_0154631_221_640 139
1904 3300046679 Ga0495623_0358806 Ga0495623_0358806_148_567 139
1905 3300046680 Ga0495646_0003433 Ga0495646_0003433_7447_7866 139
1906 3300046680 Ga0495646_0042439 Ga0495646_0042439_775_1194 139
1907 3300046680 Ga0495646_0251568 Ga0495646_0251568_52_471 139
1908 3300046680 Ga0495646_0302609 Ga0495646_0302609_29_448 139
1909 3300046680 Ga0495646_0408043 Ga0495646_0408043_74_493 139
1910 3300046681 Ga0495647_0027991 Ga0495647_0027991_1005_1424 139
1911 3300046681 Ga0495647_0138053 Ga0495647_0138053_159_578 139
1912 3300046681 Ga0495647_0239070 Ga0495647_0239070_336_755 139
1913 3300046681 Ga0495647_0601426 Ga0495647_0601426_51_470 139
1914 3300046683 Ga0495658_0003848 Ga0495658_0003848_1951_2370 139
1915 3300046683 Ga0495658_0335494 Ga0495658_0335494_505_924 139
1916 3300046683 Ga0495658_0385587 Ga0495658_0385587_271_690 139
1917 3300046684 Ga0495669_0158637 Ga0495669_0158637_13_432 139
1918 3300046684 Ga0495669_0372963 Ga0495669_0372963_207_626 139
1919 3300046689 Ga0495613_0002632 Ga0495613_0002632_1166_1585 139
1920 3300046689 Ga0495613_0013328 Ga0495613_0013328_204_623 139
1921 3300046689 Ga0495613_0044713 Ga0495613_0044713_1215_1634 139
1922 3300046689 Ga0495613_0103427 Ga0495613_0103427_430_849 139
1923 3300046689 Ga0495613_0888606 Ga0495613_0888606_83_502 139
1924 3300046690 Ga0495624_0002748 Ga0495624_0002748_1869_2288 139
1925 3300046690 Ga0495624_0076672 Ga0495624_0076672_935_1354 139
1926 3300046690 Ga0495624_0194515 Ga0495624_0194515_320_739 139
1927 3300046690 Ga0495624_0204673 Ga0495624_0204673_466_885 139
1928 3300046690 Ga0495624_0529540 Ga0495624_0529540_197_616 139
1929 3300046690 Ga0495624_0612518 Ga0495624_0612518_186_605 139
1930 3300046691 Ga0495670_0014092 Ga0495670_0014092_166_585 139
1931 3300046692 Ga0495671_0103771 Ga0495671_0103771_142_561 139
1932 3300046692 Ga0495671_0126491 Ga0495671_0126491_630_1049 139
1933 3300046692 Ga0495671_0223247 Ga0495671_0223247_254_673 139
1934 3300046692 Ga0495671_0353236 Ga0495671_0353236_194_613 139
1935 3300046692 Ga0495671_0613874 Ga0495671_0613874_62_481 139
1936 3300046694 Ga0495649_0009264 Ga0495649_0009264_1179_1598 139
1937 3300046694 Ga0495649_0446892 Ga0495649_0446892_205_624 139
1938 3300046794 Ga0495589_0124133 Ga0495589_0124133_170_589 139
1939 3300046794 Ga0495589_0180443 Ga0495589_0180443_199_618 139
1940 3300046794 Ga0495589_0395049 Ga0495589_0395049_163_582 139
1941 3300046809 Ga0495600_0001567 Ga0495600_0001567_665_1084 139
1942 3300046809 Ga0495600_0008054 Ga0495600_0008054_1805_2224 139
1943 3300046809 Ga0495600_0012237 Ga0495600_0012237_2841_3260 139
1944 3300046809 Ga0495600_0018114 Ga0495600_0018114_3271_3690 139
1945 3300046810 Ga0495660_0041676 Ga0495660_0041676_975_1394 139
1946 3300047315 Ga0495581_0049158 Ga0495581_0049158_252_671 139
1947 3300047315 Ga0495581_0409822 Ga0495581_0409822_88_507 139
1948 3300047315 Ga0495581_0915924 Ga0495581_0915924_44_463 139
1949 3300047317 Ga0495604_0033961 Ga0495604_0033961_1916_2335 139
1950 3300047317 Ga0495604_0090783 Ga0495604_0090783_537_956 139
1951 3300047317 Ga0495604_0102849 Ga0495604_0102849_1207_1626 139
1952 3300047317 Ga0495604_0216588 Ga0495604_0216588_712_1131 139
1953 3300047317 Ga0495604_0257059 Ga0495604_0257059_490_909 139
1954 3300047317 Ga0495604_0950688 Ga0495604_0950688_91_510 139
1955 3300047318 Ga0495636_0058055 Ga0495636_0058055_1139_1558 139
1956 3300047318 Ga0495636_0364651 Ga0495636_0364651_93_512 139
1957 3300047319 Ga0495674_0003317 Ga0495674_0003317_1951_2370 139
1958 3300047319 Ga0495674_0012961 Ga0495674_0012961_4248_4667 139
1959 3300047319 Ga0495674_0044161 Ga0495674_0044161_2169_2588 139
1960 3300047319 Ga0495674_0886555 Ga0495674_0886555_174_593 139
1961 3300047319 Ga0495674_1089561 Ga0495674_1089561_148_567 139
1962 3300047320 Ga0495672_0014574 Ga0495672_0014574_2135_2554 139
1963 3300047320 Ga0495672_0066153 Ga0495672_0066153_1615_2034 139
1964 3300047320 Ga0495672_0165439 Ga0495672_0165439_13_432 139
1965 3300047320 Ga0495672_0192332 Ga0495672_0192332_340_759 139
1966 3300047321 Ga0495676_0039054 Ga0495676_0039054_772_1191 139
1967 3300047321 Ga0495676_0068286 Ga0495676_0068286_261_680 139
1968 3300047321 Ga0495676_0076567 Ga0495676_0076567_1022_1441 139
1969 3300047321 Ga0495676_0262294 Ga0495676_0262294_656_1075 139
1970 3300047322 Ga0495680_0004040 Ga0495680_0004040_665_1084 139
1971 3300047322 Ga0495680_0019046 Ga0495680_0019046_671_1090 139
1972 3300047322 Ga0495680_0106850 Ga0495680_0106850_1644_2063 139
1973 3300047322 Ga0495680_0240570 Ga0495680_0240570_495_914 139
1974 3300047322 Ga0495680_0984395 Ga0495680_0984395_16_435 139
1975 3300047323 Ga0495683_0058912 Ga0495683_0058912_85_504 139
1976 3300047323 Ga0495683_0132463 Ga0495683_0132463_646_1065 139
1977 3300047443 Ga0495687_011607 Ga0495687_011607_1184_1603 139
1978 3300047444 Ga0495675_0012888 Ga0495675_0012888_4184_4603 139
1979 3300047444 Ga0495675_0023093 Ga0495675_0023093_3257_3676 139
1980 3300047444 Ga0495675_0054292 Ga0495675_0054292_595_1014 139
1981 3300047445 Ga0495677_0143480 Ga0495677_0143480_383_802 139
1982 3300047446 Ga0495679_056665 Ga0495679_056665_687_1106 139
1983 3300047447 Ga0495685_130755 Ga0495685_130755_202_621 139
1984 3300047447 Ga0495685_185582 Ga0495685_185582_24_443 139
1985 3300047447 Ga0495685_225661 Ga0495685_225661_75_494 139
1986 3300047469 Ga0495673_0040488 Ga0495673_0040488_553_972 139
1987 3300047469 Ga0495673_0082019 Ga0495673_0082019_588_1007 139
1988 3300047470 Ga0495681_0105938 Ga0495681_0105938_216_635 139
1989 3300047470 Ga0495681_0400319 Ga0495681_0400319_70_489 139
1990 3300047471 Ga0495684_0000297 Ga0495684_0000297_30596_31015 139
1991 3300047471 Ga0495684_0019572 Ga0495684_0019572_1370_1789 139
1992 3300047472 Ga0495686_0016003 Ga0495686_0016003_1493_1912 139
1993 3300047472 Ga0495686_0123271 Ga0495686_0123271_697_1116 139
1994 3300047472 Ga0495686_0263820 Ga0495686_0263820_21_440 139
1995 3300047472 Ga0495686_0285554 Ga0495686_0285554_105_524 139
1996 3300047472 Ga0495686_0371961 Ga0495686_0371961_71_490 139
1997 3300047673 Ga0495593_0000354 Ga0495593_0000354_7652_8071 139
1998 3300047673 Ga0495593_0043458 Ga0495593_0043458_247_666 139
1999 3300047673 Ga0495593_0162270 Ga0495593_0162270_162_581 139
2000 3300047673 Ga0495593_0363411 Ga0495593_0363411_183_602 139
2001 3300048088 Ga0495602_0034391 Ga0495602_0034391_1108_1527 139
2002 3300048088 Ga0495602_0099152 Ga0495602_0099152_537_956 139
2003 3300048088 Ga0495602_0278813 Ga0495602_0278813_78_497 139
2004 3300048088 Ga0495602_0548042 Ga0495602_0548042_271_690 139
2005 3300048088 Ga0495602_0666540 Ga0495602_0666540_142_561 139
2006 3300048089 Ga0495614_0139805 Ga0495614_0139805_636_1055 139
2007 3300048089 Ga0495614_0256799 Ga0495614_0256799_211_630 139
2008 3300048090 Ga0495615_0079493 Ga0495615_0079493_450_869 139
2009 3300048091 Ga0495626_0041936 Ga0495626_0041936_675_1094 139
2010 3300048091 Ga0495626_0216559 Ga0495626_0216559_274_693 139
2011 3300048903 Ga0496100_0024657 Ga0496100_0024657_79_498 139
2012 3300048903 Ga0496100_0125463 Ga0496100_0125463_407_826 139
2013 3300048903 Ga0496100_0183902 Ga0496100_0183902_364_783 139
2014 3300048903 Ga0496100_0243243 Ga0496100_0243243_402_821 139
2015 3300048903 Ga0496100_0296491 Ga0496100_0296491_395_814 139
2016 3300048903 Ga0496100_0320746 Ga0496100_0320746_664_1083 139
2017 3300048903 Ga0496100_0339595 Ga0496100_0339595_664_1083 139
2018 3300048903 Ga0496100_0491981 Ga0496100_0491981_403_822 139
2019 3300048903 Ga0496100_1314038 Ga0496100_1314038_129_548 139
2020 3300048904 Ga0496101_0034221 Ga0496101_0034221_2879_3298 139
2021 3300048904 Ga0496101_0062627 Ga0496101_0062627_1684_2103 139
2022 3300048904 Ga0496101_0088887 Ga0496101_0088887_606_1025 139
2023 3300048904 Ga0496101_0148200 Ga0496101_0148200_985_1404 139
2024 3300048904 Ga0496101_0317974 Ga0496101_0317974_344_763 139
2025 3300048904 Ga0496101_0633784 Ga0496101_0633784_106_525 139
2026 3300048904 Ga0496101_0924817 Ga0496101_0924817_73_492 139
2027 3300048905 Ga0496102_0015262 Ga0496102_0015262_4863_5282 139
2028 3300048905 Ga0496102_0018941 Ga0496102_0018941_4538_4957 139
2029 3300048905 Ga0496102_0065085 Ga0496102_0065085_454_873 139
2030 3300048905 Ga0496102_0295647 Ga0496102_0295647_597_1016 139
2031 3300048905 Ga0496102_0634664 Ga0496102_0634664_87_506 139
2032 3300048905 Ga0496102_0684597 Ga0496102_0684597_477_896 139
2033 3300048905 Ga0496102_1009165 Ga0496102_1009165_244_663 139
2034 3300048905 Ga0496102_1063173 Ga0496102_1063173_47_466 139
2035 3300048905 Ga0496102_1720094 Ga0496102_1720094_109_528 139
2036 3300048906 Ga0496103_0002315 Ga0496103_0002315_9336_9755 139
2037 3300048906 Ga0496103_0170702 Ga0496103_0170702_945_1364 139
2038 3300048906 Ga0496103_0288535 Ga0496103_0288535_189_608 139
2039 3300048907 Ga0496104_0007118 Ga0496104_0007118_1474_1893 139
2040 3300048907 Ga0496104_0017685 Ga0496104_0017685_1890_2309 139
2041 3300048907 Ga0496104_0205632 Ga0496104_0205632_534_953 139
2042 3300048907 Ga0496104_0451268 Ga0496104_0451268_205_624 139
2043 3300048907 Ga0496104_0479950 Ga0496104_0479950_18_437 139
2044 3300048907 Ga0496104_0571988 Ga0496104_0571988_16_435 139
2045 3300048907 Ga0496104_0611843 Ga0496104_0611843_57_476 139
2046 3300048907 Ga0496104_0893202 Ga0496104_0893202_110_529 139
2047 3300048907 Ga0496104_1871597 Ga0496104_1871597_31_450 139
2048 3300048908 Ga0496105_0005048 Ga0496105_0005048_4123_4542 139
2049 3300048908 Ga0496105_0035621 Ga0496105_0035621_3624_4043 139
2050 3300048908 Ga0496105_0059676 Ga0496105_0059676_1049_1468 139
2051 3300048908 Ga0496105_0226762 Ga0496105_0226762_404_823 139
2052 3300048908 Ga0496105_0284591 Ga0496105_0284591_43_462 139
2053 3300048908 Ga0496105_0466985 Ga0496105_0466985_211_630 139
2054 3300048909 Ga0496106_0001788 Ga0496106_0001788_7837_8256 139
2055 3300048909 Ga0496106_0021810 Ga0496106_0021810_2323_2742 139
2056 3300048909 Ga0496106_0059758 Ga0496106_0059758_1174_1593 139
2057 3300048909 Ga0496106_0273578 Ga0496106_0273578_124_543 139
2058 3300048909 Ga0496106_1165003 Ga0496106_1165003_122_541 139
2059 3300048910 Ga0496107_0007818 Ga0496107_0007818_3595_4014 139
2060 3300048910 Ga0496107_0014705 Ga0496107_0014705_70_489 139
2061 3300048910 Ga0496107_0272555 Ga0496107_0272555_725_1144 139
2062 3300048910 Ga0496107_0383882 Ga0496107_0383882_278_697 139
2063 3300048910 Ga0496107_0581920 Ga0496107_0581920_369_788 139
2064 3300048910 Ga0496107_0965468 Ga0496107_0965468_169_588 139
2065 3300048910 Ga0496107_1055431 Ga0496107_1055431_69_488 139
2066 3300048911 Ga0496108_0014372 Ga0496108_0014372_5709_6128 139
2067 3300048911 Ga0496108_0023799 Ga0496108_0023799_1670_2089 139
2068 3300048911 Ga0496108_0025706 Ga0496108_0025706_511_930 139
2069 3300048911 Ga0496108_0046000 Ga0496108_0046000_1416_1835 139
2070 3300048911 Ga0496108_0183242 Ga0496108_0183242_597_1016 139
2071 3300048911 Ga0496108_0548077 Ga0496108_0548077_579_998 139
2072 3300048911 Ga0496108_0907035 Ga0496108_0907035_10_429 139
2073 3300048912 Ga0496109_0047618 Ga0496109_0047618_556_975 139
2074 3300048912 Ga0496109_0195748 Ga0496109_0195748_613_1032 139
2075 3300048912 Ga0496109_0303227 Ga0496109_0303227_329_748 139
2076 3300048912 Ga0496109_0592631 Ga0496109_0592631_583_1002 139
2077 3300048912 Ga0496109_0964926 Ga0496109_0964926_74_493 139
2078 3300048912 Ga0496109_1015591 Ga0496109_1015591_195_614 139
2079 3300048913 Ga0496110_0138822 Ga0496110_0138822_1727_2146 139
2080 3300048913 Ga0496110_0139385 Ga0496110_0139385_1690_2109 139
2081 3300048913 Ga0496110_0144280 Ga0496110_0144280_1556_1975 139
2082 3300048913 Ga0496110_0217522 Ga0496110_0217522_1113_1532 139
2083 3300048913 Ga0496110_0221790 Ga0496110_0221790_718_1137 139
2084 3300048913 Ga0496110_0540555 Ga0496110_0540555_370_789 139
2085 3300048913 Ga0496110_0625498 Ga0496110_0625498_465_884 139
2086 3300048913 Ga0496110_0872393 Ga0496110_0872393_31_450 139
2087 3300048913 Ga0496110_0972444 Ga0496110_0972444_206_625 139
2088 3300048914 Ga0496111_0058598 Ga0496111_0058598_1383_1802 139
2089 3300048914 Ga0496111_0077814 Ga0496111_0077814_261_680 139
2090 3300048915 Ga0496112_0000004 Ga0496112_0000004_32217_32636 139
2091 3300048915 Ga0496112_0041288 Ga0496112_0041288_2687_3106 139
2092 3300048915 Ga0496112_0048767 Ga0496112_0048767_706_1125 139
2093 3300048915 Ga0496112_0050431 Ga0496112_0050431_2760_3179 139
2094 3300048915 Ga0496112_0114958 Ga0496112_0114958_547_966 139
2095 3300048915 Ga0496112_0129416 Ga0496112_0129416_360_779 139
2096 3300048915 Ga0496112_0138016 Ga0496112_0138016_1030_1449 139
2097 3300048915 Ga0496112_0500186 Ga0496112_0500186_38_457 139
2098 3300048915 Ga0496112_0810952 Ga0496112_0810952_399_818 139
2099 3300048916 Ga0496113_0008164 Ga0496113_0008164_1816_2235 139
2100 3300048916 Ga0496113_0032100 Ga0496113_0032100_669_1088 139
2101 3300048916 Ga0496113_0044880 Ga0496113_0044880_2193_2612 139
2102 3300048916 Ga0496113_0141231 Ga0496113_0141231_1136_1555 139
2103 3300048916 Ga0496113_0502529 Ga0496113_0502529_243_662 139
2104 3300048916 Ga0496113_0588593 Ga0496113_0588593_190_609 139
2105 3300048916 Ga0496113_0621191 Ga0496113_0621191_336_755 139
2106 3300048916 Ga0496113_1479201 Ga0496113_1479201_91_510 139
2107 3300048917 Ga0496114_0040398 Ga0496114_0040398_2556_2975 139
2108 3300048917 Ga0496114_0330978 Ga0496114_0330978_152_571 139
2109 3300048917 Ga0496114_0677677 Ga0496114_0677677_405_824 139
2110 3300048917 Ga0496114_0784311 Ga0496114_0784311_166_585 139
2111 3300048917 Ga0496114_0843338 Ga0496114_0843338_171_590 139
2112 3300048918 Ga0496115_0001685 Ga0496115_0001685_14530_14949 139
2113 3300048918 Ga0496115_0047825 Ga0496115_0047825_1076_1495 139
2114 3300048918 Ga0496115_0056000 Ga0496115_0056000_1825_2244 139
2115 3300048918 Ga0496115_0071610 Ga0496115_0071610_539_958 139
2116 3300048918 Ga0496115_0071698 Ga0496115_0071698_1042_1461 139
2117 3300048918 Ga0496115_0087102 Ga0496115_0087102_1601_2020 139
2118 3300048918 Ga0496115_0101329 Ga0496115_0101329_1571_1990 139
2119 3300048918 Ga0496115_0157677 Ga0496115_0157677_1375_1794 139
2120 3300048918 Ga0496115_0425881 Ga0496115_0425881_418_837 139
2121 3300048918 Ga0496115_0507683 Ga0496115_0507683_380_799 139
2122 3300048918 Ga0496115_0558440 Ga0496115_0558440_53_472 139
2123 3300048918 Ga0496115_0720370 Ga0496115_0720370_30_449 139
2124 3300048918 Ga0496115_0841788 Ga0496115_0841788_57_476 139
2125 3300048918 Ga0496115_1256248 Ga0496115_1256248_48_467 139
2126 3300048919 Ga0496116_0036024 Ga0496116_0036024_39_458 139
2127 3300048919 Ga0496116_0075349 Ga0496116_0075349_232_651 139
2128 3300048919 Ga0496116_0465173 Ga0496116_0465173_104_523 139
2129 3300048920 Ga0496117_0030328 Ga0496117_0030328_1211_1630 139
2130 3300048920 Ga0496117_0031757 Ga0496117_0031757_243_662 139
2131 3300048920 Ga0496117_0089360 Ga0496117_0089360_54_473 139
2132 3300048920 Ga0496117_0123006 Ga0496117_0123006_191_610 139
2133 3300048920 Ga0496117_0225583 Ga0496117_0225583_408_827 139
2134 3300048920 Ga0496117_0312738 Ga0496117_0312738_219_638 139
2135 3300048920 Ga0496117_0324477 Ga0496117_0324477_54_473 139
2136 3300048920 Ga0496117_0511523 Ga0496117_0511523_75_494 139
2137 3300048920 Ga0496117_0605345 Ga0496117_0605345_75_494 139
2138 3300048921 Ga0496118_0027350 Ga0496118_0027350_2844_3263 139
2139 3300048921 Ga0496118_0043767 Ga0496118_0043767_1209_1628 139
2140 3300048921 Ga0496118_0080928 Ga0496118_0080928_1578_1997 139
2141 3300048921 Ga0496118_0082546 Ga0496118_0082546_1234_1653 139
2142 3300048921 Ga0496118_0129210 Ga0496118_0129210_1022_1441 139
2143 3300048921 Ga0496118_0138934 Ga0496118_0138934_789_1208 139
2144 3300048921 Ga0496118_0197664 Ga0496118_0197664_722_1141 139
2145 3300048921 Ga0496118_0211418 Ga0496118_0211418_331_750 139
2146 3300048921 Ga0496118_0227677 Ga0496118_0227677_118_537 139
2147 3300048922 Ga0496119_0015494 Ga0496119_0015494_1434_1853 139
2148 3300048922 Ga0496119_0042832 Ga0496119_0042832_914_1333 139
2149 3300048922 Ga0496119_0055458 Ga0496119_0055458_385_804 139
2150 3300048922 Ga0496119_0069227 Ga0496119_0069227_498_917 139
2151 3300048922 Ga0496119_0092306 Ga0496119_0092306_1265_1684 139
2152 3300048922 Ga0496119_0108816 Ga0496119_0108816_1092_1511 139
2153 3300048922 Ga0496119_0135917 Ga0496119_0135917_742_1161 139
2154 3300048922 Ga0496119_0423108 Ga0496119_0423108_202_621 139
2155 3300048923 Ga0496120_0014690 Ga0496120_0014690_3388_3807 139
2156 3300048923 Ga0496120_0041406 Ga0496120_0041406_1324_1743 139
2157 3300048923 Ga0496120_0054725 Ga0496120_0054725_879_1298 139
2158 3300048923 Ga0496120_0112549 Ga0496120_0112549_158_577 139
2159 3300048923 Ga0496120_0144793 Ga0496120_0144793_107_526 139
2160 3300048924 Ga0496121_0000398 Ga0496121_0000398_43940_44359 139
2161 3300048924 Ga0496121_0002399 Ga0496121_0002399_6291_6710 139
2162 3300048924 Ga0496121_0005904 Ga0496121_0005904_14896_15315 139
2163 3300048924 Ga0496121_0006918 Ga0496121_0006918_12453_12872 139
2164 3300048924 Ga0496121_0009741 Ga0496121_0009741_7979_8398 139
2165 3300048924 Ga0496121_0011691 Ga0496121_0011691_3750_4169 139
2166 3300048924 Ga0496121_0033107 Ga0496121_0033107_1969_2388 139
2167 3300048924 Ga0496121_0084631 Ga0496121_0084631_1827_2246 139
2168 3300048924 Ga0496121_0104201 Ga0496121_0104201_1177_1596 139
2169 3300048924 Ga0496121_0119583 Ga0496121_0119583_1103_1522 139
2170 3300048924 Ga0496121_0120139 Ga0496121_0120139_1005_1424 139
2171 3300048924 Ga0496121_0139999 Ga0496121_0139999_730_1149 139
2172 3300048924 Ga0496121_0164267 Ga0496121_0164267_217_636 139
2173 3300048924 Ga0496121_0323603 Ga0496121_0323603_142_561 139
2174 3300048924 Ga0496121_0435726 Ga0496121_0435726_243_662 139
2175 3300048925 Ga0496122_0048876 Ga0496122_0048876_2130_2549 139
2176 3300048925 Ga0496122_0078660 Ga0496122_0078660_1765_2184 139
2177 3300048925 Ga0496122_0223713 Ga0496122_0223713_318_737 139
2178 3300048926 Ga0496123_0118152 Ga0496123_0118152_851_1270 139
2179 3300048926 Ga0496123_0318574 Ga0496123_0318574_176_595 139
2180 3300048927 Ga0496124_0000524 Ga0496124_0000524_21729_22148 139
2181 3300048927 Ga0496124_0039487 Ga0496124_0039487_3358_3777 139
2182 3300048927 Ga0496124_0152547 Ga0496124_0152547_858_1277 139
2183 3300048927 Ga0496124_0193225 Ga0496124_0193225_184_603 139
2184 3300048927 Ga0496124_0356325 Ga0496124_0356325_38_457 139
2185 3300048927 Ga0496124_0410233 Ga0496124_0410233_31_450 139
2186 3300048928 Ga0496125_0001028 Ga0496125_0001028_13748_14167 139
2187 3300048928 Ga0496125_0004318 Ga0496125_0004318_12338_12757 139
2188 3300048928 Ga0496125_0007178 Ga0496125_0007178_2639_3058 139
2189 3300048928 Ga0496125_0010814 Ga0496125_0010814_4210_4629 139
2190 3300048928 Ga0496125_0091678 Ga0496125_0091678_41_460 139
2191 3300048928 Ga0496125_0104521 Ga0496125_0104521_1479_1898 139
2192 3300048928 Ga0496125_0361713 Ga0496125_0361713_428_847 139
2193 3300048929 Ga0496126_0006093 Ga0496126_0006093_5568_5987 139
2194 3300048929 Ga0496126_0007920 Ga0496126_0007920_5328_5747 139
2195 3300048929 Ga0496126_0010766 Ga0496126_0010766_6499_6918 139
2196 3300048929 Ga0496126_0034444 Ga0496126_0034444_1852_2271 139
2197 3300048929 Ga0496126_0053384 Ga0496126_0053384_873_1292 139
2198 3300048929 Ga0496126_0056433 Ga0496126_0056433_1585_2004 139
2199 3300048929 Ga0496126_0061416 Ga0496126_0061416_262_681 139
2200 3300048929 Ga0496126_0072078 Ga0496126_0072078_1004_1423 139
2201 3300048929 Ga0496126_0086405 Ga0496126_0086405_1110_1529 139
2202 3300048929 Ga0496126_0143805 Ga0496126_0143805_1034_1453 139
2203 3300048929 Ga0496126_0154975 Ga0496126_0154975_1013_1432 139
2204 3300048929 Ga0496126_0176293 Ga0496126_0176293_1231_1650 139
2205 3300048929 Ga0496126_0185427 Ga0496126_0185427_1131_1550 139
2206 3300048929 Ga0496126_0188457 Ga0496126_0188457_502_921 139
2207 3300048929 Ga0496126_0231536 Ga0496126_0231536_771_1190 139
2208 3300048929 Ga0496126_0347793 Ga0496126_0347793_698_1117 139
2209 3300048929 Ga0496126_0383151 Ga0496126_0383151_690_1109 139
2210 3300048929 Ga0496126_0523561 Ga0496126_0523561_36_455 139
2211 3300048929 Ga0496126_0535644 Ga0496126_0535644_121_540 139
2212 3300048929 Ga0496126_0654561 Ga0496126_0654561_51_470 139
2213 3300048929 Ga0496126_0694918 Ga0496126_0694918_207_626 139
2214 3300048929 Ga0496126_0815238 Ga0496126_0815238_122_541 139
2215 3300048929 Ga0496126_1012297 Ga0496126_1012297_96_515 139
2216 3300048929 Ga0496126_1383019 Ga0496126_1383019_32_451 139
2217 3300049460 Ga0495682_0041499 Ga0495682_0041499_40_459 139
2218 3300049460 Ga0495682_0157234 Ga0495682_0157234_71_490 139
2219 3300049568 Ga0501031_0000139 Ga0501031_0000139_14876_15295 139
2220 3300049568 Ga0501031_0006521 Ga0501031_0006521_3442_3861 139
2221 3300049568 Ga0501031_0020185 Ga0501031_0020185_2287_2706 139
2222 3300049568 Ga0501031_0038770 Ga0501031_0038770_54_473 139
2223 3300049568 Ga0501031_0371472 Ga0501031_0371472_378_797 139
2224 3300049569 Ga0501032_0000087 Ga0501032_0000087_20713_21132 139
2225 3300049569 Ga0501032_0009703 Ga0501032_0009703_1631_2050 139
2226 3300049569 Ga0501032_0110902 Ga0501032_0110902_1332_1751 139
2227 3300049569 Ga0501032_0138774 Ga0501032_0138774_153_572 139
2228 3300049570 Ga0501033_0001881 Ga0501033_0001881_13024_13443 139
2229 3300049570 Ga0501033_0002982 Ga0501033_0002982_9763_10182 139
2230 3300049570 Ga0501033_0039576 Ga0501033_0039576_419_838 139
2231 3300049570 Ga0501033_0318378 Ga0501033_0318378_511_930 139
2232 3300049570 Ga0501033_0756575 Ga0501033_0756575_41_460 139
2233 3300049571 Ga0501034_0000021 Ga0501034_0000021_158318_158737 139
2234 3300049571 Ga0501034_0030030 Ga0501034_0030030_3160_3579 139
2235 3300049571 Ga0501034_0103040 Ga0501034_0103040_2397_2816 139
2236 3300049571 Ga0501034_0284082 Ga0501034_0284082_483_902 139
2237 3300049571 Ga0501034_0467738 Ga0501034_0467738_85_504 139
2238 3300049572 Ga0501036_0000055 Ga0501036_0000055_49059_49478 139
2239 3300049572 Ga0501036_0096182 Ga0501036_0096182_138_557 139
2240 3300049572 Ga0501036_0130765 Ga0501036_0130765_503_922 139
2241 3300049572 Ga0501036_0328279 Ga0501036_0328279_216_635 139
2242 3300049572 Ga0501036_0484640 Ga0501036_0484640_73_492 139
2243 3300049572 Ga0501036_0596282 Ga0501036_0596282_152_571 139
2244 3300049572 Ga0501036_1175653 Ga0501036_1175653_59_478 139
2245 3300049573 Ga0501037_0001009 Ga0501037_0001009_3315_3734 139
2246 3300049573 Ga0501037_0017513 Ga0501037_0017513_2907_3326 139
2247 3300049573 Ga0501037_0045267 Ga0501037_0045267_1366_1785 139
2248 3300049573 Ga0501037_0049221 Ga0501037_0049221_1291_1710 139
2249 3300049573 Ga0501037_0717570 Ga0501037_0717570_228_647 139
2250 3300049573 Ga0501037_0725167 Ga0501037_0725167_104_523 139
2251 3300049574 Ga0501038_0000213 Ga0501038_0000213_7926_8345 139
2252 3300049574 Ga0501038_0007678 Ga0501038_0007678_1638_2057 139
2253 3300049574 Ga0501038_0020877 Ga0501038_0020877_2291_2710 139
2254 3300049574 Ga0501038_0029924 Ga0501038_0029924_1591_2010 139
2255 3300049574 Ga0501038_0108578 Ga0501038_0108578_1589_2008 139
2256 3300049574 Ga0501038_0362768 Ga0501038_0362768_468_887 139
2257 3300049574 Ga0501038_0562569 Ga0501038_0562569_384_803 139
2258 3300049575 Ga0501039_0000179 Ga0501039_0000179_3298_3717 139
2259 3300049575 Ga0501039_0023041 Ga0501039_0023041_1589_2008 139
2260 3300049575 Ga0501039_0097192 Ga0501039_0097192_1591_2010 139
2261 3300049575 Ga0501039_0189896 Ga0501039_0189896_25_444 139
2262 3300049575 Ga0501039_0596926 Ga0501039_0596926_385_804 139
2263 3300049576 Ga0501040_0018290 Ga0501040_0018290_208_627 139
2264 3300049577 Ga0501041_0092053 Ga0501041_0092053_1108_1527 139
2265 3300049577 Ga0501041_0349236 Ga0501041_0349236_94_513 139
2266 3300049578 Ga0501042_0009399 Ga0501042_0009399_2690_3109 139
2267 3300049578 Ga0501042_0048874 Ga0501042_0048874_2251_2670 139
2268 3300049578 Ga0501042_0056752 Ga0501042_0056752_1111_1530 139
2269 3300049578 Ga0501042_0265675 Ga0501042_0265675_418_837 139
2270 3300049579 Ga0501043_0000033 Ga0501043_0000033_77441_77860 139
2271 3300049579 Ga0501043_0034403 Ga0501043_0034403_85_504 139
2272 3300049579 Ga0501043_0634020 Ga0501043_0634020_193_612 139
2273 3300049580 Ga0501046_0002671 Ga0501046_0002671_7471_7890 139
2274 3300049580 Ga0501046_0060874 Ga0501046_0060874_1947_2366 139
2275 3300049580 Ga0501046_0088873 Ga0501046_0088873_549_968 139
2276 3300049580 Ga0501046_0092898 Ga0501046_0092898_289_708 139
2277 3300049581 Ga0501047_0001106 Ga0501047_0001106_25100_25519 139
2278 3300049581 Ga0501047_0006069 Ga0501047_0006069_2762_3181 139
2279 3300049581 Ga0501047_0054886 Ga0501047_0054886_2058_2477 139
2280 3300049581 Ga0501047_0185537 Ga0501047_0185537_1076_1495 139
2281 3300049581 Ga0501047_0370245 Ga0501047_0370245_654_1073 139
2282 3300049581 Ga0501047_0471488 Ga0501047_0471488_612_1031 139
2283 3300049581 Ga0501047_0488234 Ga0501047_0488234_348_767 139
2284 3300049582 Ga0501048_0001236 Ga0501048_0001236_16037_16456 139
2285 3300049582 Ga0501048_0011472 Ga0501048_0011472_3507_3926 139
2286 3300049583 Ga0501067_0002888 Ga0501067_0002888_8619_9038 139
2287 3300049583 Ga0501067_0012576 Ga0501067_0012576_1036_1455 139
2288 3300049583 Ga0501067_0125880 Ga0501067_0125880_684_1103 139
2289 3300049584 Ga0501068_0000366 Ga0501068_0000366_11031_11450 139
2290 3300049584 Ga0501068_0003767 Ga0501068_0003767_2161_2580 139
2291 3300049585 Ga0501069_0007967 Ga0501069_0007967_3508_3927 139
2292 3300049585 Ga0501069_0018962 Ga0501069_0018962_3174_3593 139
2293 3300049585 Ga0501069_0438940 Ga0501069_0438940_273_692 139
2294 3300049586 Ga0501070_0009143 Ga0501070_0009143_4924_5343 139
2295 3300049586 Ga0501070_0021014 Ga0501070_0021014_1384_1803 139
2296 3300049586 Ga0501070_0055066 Ga0501070_0055066_2506_2925 139
2297 3300049586 Ga0501070_0076488 Ga0501070_0076488_1637_2056 139
2298 3300049587 Ga0501071_0041923 Ga0501071_0041923_2026_2445 139
2299 3300049587 Ga0501071_0099564 Ga0501071_0099564_473_892 139
2300 3300049587 Ga0501071_0496344 Ga0501071_0496344_60_479 139
2301 3300049587 Ga0501071_0944651 Ga0501071_0944651_231_650 139
2302 3300049587 Ga0501071_1122490 Ga0501071_1122490_60_479 139
2303 3300049588 Ga0501072_0002141 Ga0501072_0002141_7080_7499 139
2304 3300049588 Ga0501072_0013187 Ga0501072_0013187_2859_3278 139
2305 3300049589 Ga0501073_0000064 Ga0501073_0000064_24918_25337 139
2306 3300049589 Ga0501073_0016576 Ga0501073_0016576_3155_3574 139
2307 3300049589 Ga0501073_0138400 Ga0501073_0138400_361_780 139
2308 3300049590 Ga0501074_0000044 Ga0501074_0000044_25887_26306 139
2309 3300049590 Ga0501074_0013275 Ga0501074_0013275_407_826 139
2310 3300049590 Ga0501074_0045139 Ga0501074_0045139_588_1007 139
2311 3300049591 Ga0501075_0736763 Ga0501075_0736763_164_583 139
2312 3300049592 Ga0501076_0037600 Ga0501076_0037600_2543_2962 139
2313 3300049592 Ga0501076_0085615 Ga0501076_0085615_1268_1687 139
2314 3300049741 Ga0501079_0001843 Ga0501079_0001843_6028_6447 139
2315 3300049741 Ga0501079_0928685 Ga0501079_0928685_41_460 139
2316 3300049742 Ga0501080_0000072 Ga0501080_0000072_34231_34650 139
2317 3300049742 Ga0501080_0003614 Ga0501080_0003614_2686_3105 139
2318 3300049742 Ga0501080_0018387 Ga0501080_0018387_5557_5976 139
2319 3300049742 Ga0501080_0296180 Ga0501080_0296180_619_1038 139
2320 3300049742 Ga0501080_0409909 Ga0501080_0409909_713_1132 139
2321 3300049742 Ga0501080_0454229 Ga0501080_0454229_597_1016 139
2322 3300049742 Ga0501080_0659087 Ga0501080_0659087_426_857 139
2323 3300049743 Ga0501081_0203071 Ga0501081_0203071_585_1004 139
2324 3300049743 Ga0501081_0719049 Ga0501081_0719049_150_569 139
2325 3300049744 Ga0501083_0000538 Ga0501083_0000538_3168_3587 139
2326 3300049744 Ga0501083_0010964 Ga0501083_0010964_272_691 139
2327 3300049822 Ga0501035_0000241 Ga0501035_0000241_63969_64388 139
2328 3300049822 Ga0501035_0003213 Ga0501035_0003213_7896_8315 139
2329 3300049822 Ga0501035_0005536 Ga0501035_0005536_1455_1874 139
2330 3300049822 Ga0501035_0025637 Ga0501035_0025637_3225_3644 139
2331 3300049822 Ga0501035_0359862 Ga0501035_0359862_546_965 139
2332 3300049822 Ga0501035_0505473 Ga0501035_0505473_70_489 139
2333 3300049822 Ga0501035_0515160 Ga0501035_0515160_304_723 139
2334 3300049823 Ga0501044_0000181 Ga0501044_0000181_9887_10306 139
2335 3300049823 Ga0501044_0017378 Ga0501044_0017378_4699_5118 139
2336 3300049823 Ga0501044_0027500 Ga0501044_0027500_4506_4925 139
2337 3300049823 Ga0501044_0095667 Ga0501044_0095667_627_1046 139
2338 3300049823 Ga0501044_0106557 Ga0501044_0106557_2003_2422 139
2339 3300049823 Ga0501044_0197284 Ga0501044_0197284_265_684 139
2340 3300049823 Ga0501044_0965123 Ga0501044_0965123_18_437 139
2341 3300049823 Ga0501044_1004829 Ga0501044_1004829_52_471 139
2342 3300049823 Ga0501044_1164190 Ga0501044_1164190_77_496 139
2343 3300049824 Ga0501045_0003511 Ga0501045_0003511_3395_3814 139
2344 3300049824 Ga0501045_0009819 Ga0501045_0009819_2325_2744 139
2345 3300049824 Ga0501045_0433304 Ga0501045_0433304_140_559 139
2346 3300050489 nmdc:mga03683_109368_c1 nmdc:mga03683_109368_c1_720_1139 139
2347 3300050489 nmdc:mga03683_30442_c1 nmdc:mga03683_30442_c1_909_1328 139
2348 3300050490 nmdc:mga03n38_111450_c1 nmdc:mga03n38_111450_c1_844_1263 139
2349 3300050490 nmdc:mga03n38_115_c1 nmdc:mga03n38_115_c1_2855_3274 139
2350 3300050490 nmdc:mga03n38_199039_c1 nmdc:mga03n38_199039_c1_189_608 139
2351 3300050491 nmdc:mga00v17_11090_c1 nmdc:mga00v17_11090_c1_828_1247 139
2352 3300050491 nmdc:mga00v17_124536_c1 nmdc:mga00v17_124536_c1_424_843 139
2353 3300050491 nmdc:mga00v17_129304_c1 nmdc:mga00v17_129304_c1_718_1137 139
2354 3300050491 nmdc:mga00v17_313425_c1 nmdc:mga00v17_313425_c1_456_875 139
2355 3300050491 nmdc:mga00v17_50570_c1 nmdc:mga00v17_50570_c1_1707_2126 139
2356 3300050492 nmdc:mga0yw44_111747_c1 nmdc:mga0yw44_111747_c1_1138_1557 139
2357 3300050492 nmdc:mga0yw44_121392_c1 nmdc:mga0yw44_121392_c1_184_603 139
2358 3300050492 nmdc:mga0yw44_22836_c1 nmdc:mga0yw44_22836_c1_759_1178 139
2359 3300050492 nmdc:mga0yw44_278979_c1 nmdc:mga0yw44_278979_c1_669_1088 139
2360 3300050492 nmdc:mga0yw44_28731_c1 nmdc:mga0yw44_28731_c1_837_1256 139
2361 3300050492 nmdc:mga0yw44_82552_c1 nmdc:mga0yw44_82552_c1_660_1079 139
2362 3300050492 nmdc:mga0yw44_98284_c1 nmdc:mga0yw44_98284_c1_1337_1756 139
2363 3300050493 nmdc:mga0k408_30953_c1 nmdc:mga0k408_30953_c1_674_1093 139
2364 3300050493 nmdc:mga0k408_366023_c1 nmdc:mga0k408_366023_c1_151_570 139
2365 3300050493 nmdc:mga0k408_631410_c1 nmdc:mga0k408_631410_c1_198_617 139
2366 3300050494 nmdc:mga06z11_133888_c1 nmdc:mga06z11_133888_c1_15_434 139
2367 3300050494 nmdc:mga06z11_18389_c1 nmdc:mga06z11_18389_c1_1825_2244 139
2368 3300050494 nmdc:mga06z11_240449_c1 nmdc:mga06z11_240449_c1_455_874 139
2369 3300050494 nmdc:mga06z11_5772_c1 nmdc:mga06z11_5772_c1_1490_1909 139
2370 3300050495 nmdc:mga04h51_123542_c1 nmdc:mga04h51_123542_c1_291_710 139
2371 3300050495 nmdc:mga04h51_124053_c1 nmdc:mga04h51_124053_c1_72_491 139
2372 3300050495 nmdc:mga04h51_195357_c1 nmdc:mga04h51_195357_c1_274_693 139
2373 3300050495 nmdc:mga04h51_206411_c1 nmdc:mga04h51_206411_c1_232_651 139
2374 3300050495 nmdc:mga04h51_91557_c1 nmdc:mga04h51_91557_c1_459_878 139
2375 3300050496 nmdc:mga07m45_268352_c1 nmdc:mga07m45_268352_c1_445_864 139
2376 3300050496 nmdc:mga07m45_6927_c1 nmdc:mga07m45_6927_c1_1223_1642 139
2377 3300050496 nmdc:mga07m45_799204_c1 nmdc:mga07m45_799204_c1_85_504 139
2378 3300050496 nmdc:mga07m45_88155_c1 nmdc:mga07m45_88155_c1_1038_1457 139
2379 3300050507 nmdc:mga05p37_116152_c1 nmdc:mga05p37_116152_c1_861_1280 139
2380 3300050508 nmdc:mga09592_111209_c1 nmdc:mga09592_111209_c1_1600_2019 139
2381 3300050509 nmdc:mga0qj67_202285_c1 nmdc:mga0qj67_202285_c1_542_961 139
2382 3300050511 nmdc:mga08y16_124523_c1 nmdc:mga08y16_124523_c1_375_794 139
2383 3300050511 nmdc:mga08y16_602172_c1 nmdc:mga08y16_602172_c1_193_612 139
2384 3300050512 nmdc:mga0n895_5831_c1 nmdc:mga0n895_5831_c1_5498_5917 139
2385 3300050513 nmdc:mga0rr50_35624_c1 nmdc:mga0rr50_35624_c1_1439_1858 139
2386 3300050513 nmdc:mga0rr50_399170_c1 nmdc:mga0rr50_399170_c1_396_815 139
2387 3300050514 nmdc:mga08x19_221779_c1 nmdc:mga08x19_221779_c1_657_1076 139
2388 3300050514 nmdc:mga08x19_259727_c1 nmdc:mga08x19_259727_c1_32_451 139
2389 3300050514 nmdc:mga08x19_525328_c1 nmdc:mga08x19_525328_c1_381_800 139
2390 3300050515 nmdc:mga0a205_225085_c1 nmdc:mga0a205_225085_c1_840_1259 139
2391 3300050516 nmdc:mga0sz30_203574_c1 nmdc:mga0sz30_203574_c1_435_854 139
2392 3300050516 nmdc:mga0sz30_448496_c1 nmdc:mga0sz30_448496_c1_109_528 139
2393 3300050516 nmdc:mga0sz30_63078_c1 nmdc:mga0sz30_63078_c1_125_544 139
2394 3300053077 Ga0495601_0008893 Ga0495601_0008893_3180_3599 139
2395 3300053077 Ga0495601_0132995 Ga0495601_0132995_777_1196 139
2396 3300053077 Ga0495601_0154169 Ga0495601_0154169_632_1051 139
2397 3300053077 Ga0495601_0201521 Ga0495601_0201521_23_442 139
2398 3300053077 Ga0495601_0446976 Ga0495601_0446976_31_450 139
2399 3300053077 Ga0495601_0656161 Ga0495601_0656161_180_599 139
2400 3300053078 Ga0495612_0034112 Ga0495612_0034112_755_1174 139
2401 3300053078 Ga0495612_0040196 Ga0495612_0040196_1437_1856 139
2402 3300053078 Ga0495612_0117342 Ga0495612_0117342_178_597 139
2403 3300053080 Ga0500635_0012002 Ga0500635_0012002_1394_1813 139
2404 3300053080 Ga0500635_0048269 Ga0500635_0048269_853_1272 139
2405 3300053080 Ga0500635_0123918 Ga0500635_0123918_460_879 139
2406 3300053080 Ga0500635_0246158 Ga0500635_0246158_271_690 139
2407 3300053083 Ga0495655_0015417 Ga0495655_0015417_472_891 139
2408 3300053083 Ga0495655_0142608 Ga0495655_0142608_190_609 139
2409 3300053084 Ga0495595_0001211 Ga0495595_0001211_3274_3693 139
2410 3300053084 Ga0495595_0132918 Ga0495595_0132918_710_1129 139
2411 3300053084 Ga0495595_0457344 Ga0495595_0457344_192_611 139
2412 3300053085 Ga0495619_0001922 Ga0495619_0001922_12765_13184 139
2413 3300053085 Ga0495619_0085096 Ga0495619_0085096_1033_1452 139
2414 3300053085 Ga0495619_0407464 Ga0495619_0407464_68_487 139
2415 3300053085 Ga0495619_0722173 Ga0495619_0722173_101_520 139
2416 3300053086 Ga0500578_0041734 Ga0500578_0041734_2366_2785 139
2417 3300053086 Ga0500578_0209327 Ga0500578_0209327_559_978 139
2418 3300053086 Ga0500578_0746543 Ga0500578_0746543_76_495 139
2419 3300053087 Ga0500643_000025 Ga0500643_000025_105237_105656 139
2420 3300053087 Ga0500643_023121 Ga0500643_023121_1443_1862 139
2421 3300053087 Ga0500643_024371 Ga0500643_024371_1105_1524 139
2422 3300053088 Ga0500644_0019855 Ga0500644_0019855_881_1300 139
2423 3300053088 Ga0500644_0375083 Ga0500644_0375083_44_463 139
2424 3300053089 Ga0500581_012769 Ga0500581_012769_3446_3865 139
2425 3300053091 Ga0500647_0018514 Ga0500647_0018514_2515_2934 139
2426 3300053091 Ga0500647_0024751 Ga0500647_0024751_1071_1490 139
2427 3300053092 Ga0500583_0047291 Ga0500583_0047291_16_435 139
2428 3300053092 Ga0500583_0120039 Ga0500583_0120039_252_671 139
2429 3300053093 Ga0500651_0002618 Ga0500651_0002618_6575_6994 139
2430 3300053093 Ga0500651_0003810 Ga0500651_0003810_1924_2343 139
2431 3300053093 Ga0500651_0197133 Ga0500651_0197133_751_1170 139
2432 3300053093 Ga0500651_0314195 Ga0500651_0314195_142_561 139
2433 3300053093 Ga0500651_0468764 Ga0500651_0468764_111_530 139
2434 3300053094 Ga0500566_0000085 Ga0500566_0000085_28222_28641 139
2435 3300053094 Ga0500566_0000135 Ga0500566_0000135_12559_12978 139
2436 3300053094 Ga0500566_0000171 Ga0500566_0000171_28680_29099 139
2437 3300053094 Ga0500566_0005591 Ga0500566_0005591_5420_5839 139
2438 3300053094 Ga0500566_0044895 Ga0500566_0044895_172_591 139
2439 3300053094 Ga0500566_0085703 Ga0500566_0085703_1018_1437 139
2440 3300053095 Ga0500640_000153 Ga0500640_000153_1998_2417 139
2441 3300053095 Ga0500640_076221 Ga0500640_076221_508_927 139
2442 3300053096 Ga0500641_0005251 Ga0500641_0005251_2579_2998 139
2443 3300053096 Ga0500641_0013077 Ga0500641_0013077_1636_2055 139
2444 3300053096 Ga0500641_0080061 Ga0500641_0080061_900_1319 139
2445 3300053096 Ga0500641_0140822 Ga0500641_0140822_502_921 139
2446 3300053097 Ga0500648_035970 Ga0500648_035970_105_524 139
2447 3300053098 Ga0500650_0038362 Ga0500650_0038362_1538_1957 139
2448 3300053098 Ga0500650_0088965 Ga0500650_0088965_617_1036 139
2449 3300053102 Ga0500554_008577 Ga0500554_008577_1528_1947 139
2450 3300053102 Ga0500554_014649 Ga0500554_014649_519_938 139
2451 3300053103 Ga0500555_003285 Ga0500555_003285_3010_3429 139
2452 3300053103 Ga0500555_047982 Ga0500555_047982_411_830 139
2453 3300053104 Ga0500556_0000030 Ga0500556_0000030_72724_73143 139
2454 3300053104 Ga0500556_0004337 Ga0500556_0004337_2132_2551 139
2455 3300053105 Ga0500557_000001 Ga0500557_000001_87054_87473 139
2456 3300053106 Ga0500558_192740 Ga0500558_192740_210_629 139
2457 3300053108 Ga0500562_030856 Ga0500562_030856_923_1342 139
2458 3300053108 Ga0500562_032742 Ga0500562_032742_137_556 139
2459 3300053109 Ga0500569_003594 Ga0500569_003594_1562_1981 139
2460 3300053111 Ga0500572_000290 Ga0500572_000290_14152_14583 139
2461 3300053111 Ga0500572_002256 Ga0500572_002256_2038_2457 139
2462 3300053114 Ga0500582_212015 Ga0500582_212015_43_462 139
2463 3300053116 Ga0500592_001050 Ga0500592_001050_1718_2137 139
2464 3300053116 Ga0500592_016647 Ga0500592_016647_735_1154 139
2465 3300053118 Ga0500594_0053250 Ga0500594_0053250_714_1133 139
2466 3300053119 Ga0500595_001194 Ga0500595_001194_9576_9995 139
2467 3300053119 Ga0500595_001941 Ga0500595_001941_4608_5027 139
2468 3300053119 Ga0500595_005296 Ga0500595_005296_62_481 139
2469 3300053119 Ga0500595_006964 Ga0500595_006964_3045_3464 139
2470 3300053119 Ga0500595_012466 Ga0500595_012466_1066_1485 139
2471 3300053119 Ga0500595_026646 Ga0500595_026646_901_1320 139
2472 3300053119 Ga0500595_074562 Ga0500595_074562_359_778 139
2473 3300053120 Ga0500597_109931 Ga0500597_109931_26_445 139
2474 3300053121 Ga0500607_074119 Ga0500607_074119_187_606 139
2475 3300053122 Ga0500608_024006 Ga0500608_024006_81_500 139
2476 3300053122 Ga0500608_140473 Ga0500608_140473_215_634 139
2477 3300053123 Ga0500614_006035 Ga0500614_006035_1246_1665 139
2478 3300053123 Ga0500614_059888 Ga0500614_059888_375_794 139
2479 3300053125 Ga0500618_009591 Ga0500618_009591_2133_2552 139
2480 3300053130 Ga0500642_0000028 Ga0500642_0000028_71870_72289 139
2481 3300053130 Ga0500642_0000170 Ga0500642_0000170_16215_16634 139
2482 3300053130 Ga0500642_0024071 Ga0500642_0024071_577_996 139
2483 3300053131 Ga0500652_001552 Ga0500652_001552_4097_4516 139
2484 3300053131 Ga0500652_050850 Ga0500652_050850_212_631 139
2485 3300053133 Ga0500655_006730 Ga0500655_006730_1201_1620 139
2486 3300053133 Ga0500655_008271 Ga0500655_008271_1109_1528 139
2487 3300053134 Ga0500658_0046714 Ga0500658_0046714_84_503 139
2488 3300053134 Ga0500658_0539680 Ga0500658_0539680_86_505 139
2489 3300053134 Ga0500658_0571879 Ga0500658_0571879_62_481 139
2490 3300053136 Ga0500559_0000204 Ga0500559_0000204_37639_38058 139
2491 3300053136 Ga0500559_0000274 Ga0500559_0000274_5562_5993 139
2492 3300053136 Ga0500559_0018601 Ga0500559_0018601_457_876 139
2493 3300053136 Ga0500559_0044979 Ga0500559_0044979_465_884 139
2494 3300053136 Ga0500559_0075829 Ga0500559_0075829_539_958 139
2495 3300053138 Ga0500564_087271 Ga0500564_087271_490_909 139
2496 3300053139 Ga0500568_0003086 Ga0500568_0003086_7417_7836 139
2497 3300053139 Ga0500568_0010482 Ga0500568_0010482_2518_2937 139
2498 3300053139 Ga0500568_0037878 Ga0500568_0037878_384_803 139
2499 3300053139 Ga0500568_0042366 Ga0500568_0042366_1362_1781 139
2500 3300053140 Ga0500573_0011302 Ga0500573_0011302_507_926 139
2501 3300053140 Ga0500573_0446682 Ga0500573_0446682_118_537 139
2502 3300053142 Ga0500577_0000057 Ga0500577_0000057_10968_11387 139
2503 3300053142 Ga0500577_0162606 Ga0500577_0162606_407_826 139
2504 3300053145 Ga0500586_001133 Ga0500586_001133_1626_2045 139
2505 3300053147 Ga0500589_135834 Ga0500589_135834_453_872 139
2506 3300053148 Ga0500590_049297 Ga0500590_049297_1131_1550 139
2507 3300053148 Ga0500590_101092 Ga0500590_101092_456_875 139
2508 3300053148 Ga0500590_109601 Ga0500590_109601_827_1246 139
2509 3300053148 Ga0500590_158617 Ga0500590_158617_296_715 139
2510 3300053148 Ga0500590_215225 Ga0500590_215225_192_611 139
2511 3300053150 Ga0500603_000308 Ga0500603_000308_10782_11201 139
2512 3300053150 Ga0500603_001676 Ga0500603_001676_1162_1581 139
2513 3300053150 Ga0500603_007701 Ga0500603_007701_848_1267 139
2514 3300053150 Ga0500603_032151 Ga0500603_032151_431_850 139
2515 3300053150 Ga0500603_048348 Ga0500603_048348_258_677 139
2516 3300053150 Ga0500603_077671 Ga0500603_077671_370_789 139
2517 3300053151 Ga0500604_0002688 Ga0500604_0002688_1106_1525 139
2518 3300053151 Ga0500604_0016640 Ga0500604_0016640_706_1125 139
2519 3300053151 Ga0500604_0151194 Ga0500604_0151194_67_486 139
2520 3300053153 Ga0500616_0000252 Ga0500616_0000252_66777_67196 139
2521 3300053153 Ga0500616_0012430 Ga0500616_0012430_3213_3632 139
2522 3300053154 Ga0500619_016674 Ga0500619_016674_753_1172 139
2523 3300053155 Ga0500620_002178 Ga0500620_002178_2611_3030 139
2524 3300053156 Ga0500622_0009714 Ga0500622_0009714_1514_1933 139
2525 3300053156 Ga0500622_0011125 Ga0500622_0011125_3592_4011 139
2526 3300053156 Ga0500622_0042715 Ga0500622_0042715_568_987 139
2527 3300053156 Ga0500622_0116709 Ga0500622_0116709_730_1149 139
2528 3300053157 Ga0500624_025651 Ga0500624_025651_465_884 139
2529 3300053158 Ga0500627_0015399 Ga0500627_0015399_759_1178 139
2530 3300053158 Ga0500627_0089471 Ga0500627_0089471_558_977 139
2531 3300053158 Ga0500627_0356167 Ga0500627_0356167_135_554 139
2532 3300053159 Ga0500630_000105 Ga0500630_000105_24797_25216 139
2533 3300053160 Ga0500633_0163615 Ga0500633_0163615_216_635 139
2534 3300053161 Ga0500634_0025182 Ga0500634_0025182_2391_2810 139
2535 3300053161 Ga0500634_0043802 Ga0500634_0043802_1281_1700 139
2536 3300053162 Ga0500638_003053 Ga0500638_003053_1752_2171 139
2537 3300053162 Ga0500638_004764 Ga0500638_004764_3491_3910 139
2538 3300053162 Ga0500638_034990 Ga0500638_034990_1461_1880 139
2539 3300053162 Ga0500638_099082 Ga0500638_099082_790_1209 139
2540 3300053162 Ga0500638_105906 Ga0500638_105906_826_1245 139
2541 3300053163 Ga0500639_000004 Ga0500639_000004_180050_180469 139
2542 3300053163 Ga0500639_196501 Ga0500639_196501_22_441 139
2543 3300053177 Ga0500636_0000427 Ga0500636_0000427_4284_4703 139
2544 3300053177 Ga0500636_0003830 Ga0500636_0003830_6562_6981 139
2545 3300053177 Ga0500636_0015879 Ga0500636_0015879_1622_2041 139
2546 3300053177 Ga0500636_0207425 Ga0500636_0207425_260_679 139
2547 3300053177 Ga0500636_0208448 Ga0500636_0208448_345_764 139
2548 3300053177 Ga0500636_0270270 Ga0500636_0270270_151_570 139
2549 3300053177 Ga0500636_0517949 Ga0500636_0517949_56_475 139
2550 3300053178 Ga0500637_0000160 Ga0500637_0000160_11064_11483 139
2551 3300053178 Ga0500637_0005675 Ga0500637_0005675_3783_4202 139
2552 3300053178 Ga0500637_0018190 Ga0500637_0018190_268_687 139
2553 3300053178 Ga0500637_0111190 Ga0500637_0111190_796_1215 139
2554 3300053178 Ga0500637_0163923 Ga0500637_0163923_28_447 139
2555 3300053178 Ga0500637_0212915 Ga0500637_0212915_516_935 139
2556 3300053722 Ga0500649_119316 Ga0500649_119316_507_926 139
2557 3300053724 Ga0500570_101130 Ga0500570_101130_663_1082 139
2558 3300053728 Ga0500657_171211 Ga0500657_171211_46_465 139
2559 3300053730 Ga0500645_013896 Ga0500645_013896_498_917 139
2560 3300053730 Ga0500645_024769 Ga0500645_024769_183_602 139
2561 3300053730 Ga0500645_040357 Ga0500645_040357_32_451 139
2562 3300053730 Ga0500645_093525 Ga0500645_093525_340_759 139
2563 3300053731 Ga0500609_009091 Ga0500609_009091_709_1128 139
2564 3300053731 Ga0500609_014378 Ga0500609_014378_334_753 139
2565 3300053733 Ga0500552_013023 Ga0500552_013023_454_873 139
2566 3300053735 Ga0500596_001009 Ga0500596_001009_3873_4304 139
2567 3300053735 Ga0500596_007150 Ga0500596_007150_884_1303 139
2568 3300053735 Ga0500596_009861 Ga0500596_009861_335_754 139
2569 3300053735 Ga0500596_015194 Ga0500596_015194_308_727 139
2570 3300053736 Ga0500599_001271 Ga0500599_001271_2426_2845 139
2571 3300053737 Ga0500601_001440 Ga0500601_001440_2161_2580 139
2572 3300053737 Ga0500601_002757 Ga0500601_002757_123_542 139
2573 3300053737 Ga0500601_003868 Ga0500601_003868_1136_1555 139
2574 3300054114 Ga0501084_0038974 Ga0501084_0038974_428_847 139
2575 3300054114 Ga0501084_0689267 Ga0501084_0689267_237_656 139
2576 3300055283 Ga0500661_000910 Ga0500661_000910_4374_4793 139
2577 3300060353 Ga0501082_0006657 Ga0501082_0006657_6565_6984 139
2578 3300060353 Ga0501082_0014057 Ga0501082_0014057_1154_1573 139
2579 3300060353 Ga0501082_0183156 Ga0501082_0183156_484_903 139
2580 3300061719 Ga0466962_0081983 Ga0466962_0081983_136_555 139
2581 3300061734 Ga0530510_0023248 Ga0530510_0023248_3557_3976 139
2582 3300005616 Ga0068852_102582035 Ga0068852_1025820351 140
2583 3300005937 Ga0081455_10298667 Ga0081455_102986671 140
2584 3300005985 Ga0081539_10439945 Ga0081539_104399451 140
2585 3300026142 Ga0207698_11827463 Ga0207698_118274631 140
2586 3300041460 Ga0451802_1259343 Ga0451802_1259343_27_467 140
2587 3300048910 Ga0496107_0069230 Ga0496107_0069230_1968_2390 140
2588 3300048924 Ga0496121_0001547 Ga0496121_0001547_20090_20512 140
2589 3300048929 Ga0496126_0009181 Ga0496126_0009181_93_515 140
2590 3300049822 Ga0501035_0252302 Ga0501035_0252302_37_459 140
2591 3300001979 JGI24740J21852_10007437 JGI24740J21852_100074376 141
2592 3300001989 JGI24739J22299_10013706 JGI24739J22299_100137063 141
2593 3300001990 JGI24737J22298_10002064 JGI24737J22298_100020643 141
2594 3300002067 JGI24735J21928_10002565 JGI24735J21928_100025656 141
2595 3300005339 Ga0070660_100436656 Ga0070660_1004366562 141
2596 3300005366 Ga0070659_100063866 Ga0070659_1000638663 141
2597 3300005435 Ga0070714_100093416 Ga0070714_1000934162 141
2598 3300005455 Ga0070663_100010854 Ga0070663_1000108544 141
2599 3300005458 Ga0070681_10094893 Ga0070681_100948932 141
2600 3300005539 Ga0068853_100000691 Ga0068853_10000069110 141
2601 3300005539 Ga0068853_100018843 Ga0068853_1000188432 141
2602 3300005545 Ga0070695_100741487 Ga0070695_1007414871 141
2603 3300005563 Ga0068855_100059355 Ga0068855_1000593554 141
2604 3300005563 Ga0068855_100100085 Ga0068855_1001000854 141
2605 3300005563 Ga0068855_100653890 Ga0068855_1006538901 141
2606 3300005564 Ga0070664_100308174 Ga0070664_1003081742 141
2607 3300005577 Ga0068857_100017706 Ga0068857_1000177064 141
2608 3300005577 Ga0068857_100031001 Ga0068857_1000310014 141
2609 3300005578 Ga0068854_100031070 Ga0068854_1000310704 141
2610 3300005578 Ga0068854_100060438 Ga0068854_1000604383 141
2611 3300005614 Ga0068856_100042409 Ga0068856_1000424094 141
2612 3300005614 Ga0068856_100120464 Ga0068856_1001204643 141
2613 3300005616 Ga0068852_100639338 Ga0068852_1006393382 141
2614 3300005618 Ga0068864_100191077 Ga0068864_1001910772 141
2615 3300005834 Ga0068851_10000442 Ga0068851_100004428 141
2616 3300005834 Ga0068851_10089654 Ga0068851_100896542 141
2617 3300005842 Ga0068858_100361880 Ga0068858_1003618802 141
2618 3300005843 Ga0068860_100429259 Ga0068860_1004292592 141
2619 3300005937 Ga0081455_10003262 Ga0081455_1000326213 141
2620 3300006178 Ga0075367_10516402 Ga0075367_105164021 141
2621 3300006186 Ga0075369_10000537 Ga0075369_1000053714 141
2622 3300006881 Ga0068865_100476974 Ga0068865_1004769742 141
2623 3300009093 Ga0105240_10002409 Ga0105240_1000240913 141
2624 3300009093 Ga0105240_10088219 Ga0105240_100882193 141
2625 3300009101 Ga0105247_10412962 Ga0105247_104129622 141
2626 3300009174 Ga0105241_10000269 Ga0105241_1000026932 141
2627 3300009174 Ga0105241_10274194 Ga0105241_102741942 141
2628 3300009177 Ga0105248_10760177 Ga0105248_107601772 141
2629 3300009545 Ga0105237_10043519 Ga0105237_100435196 141
2630 3300009545 Ga0105237_10226669 Ga0105237_102266693 141
2631 3300009545 Ga0105237_10638350 Ga0105237_106383502 141
2632 3300009545 Ga0105237_10767891 Ga0105237_107678912 141
2633 3300009551 Ga0105238_10002408 Ga0105238_100024089 141
2634 3300009551 Ga0105238_10065158 Ga0105238_100651582 141
2635 3300009551 Ga0105238_10095253 Ga0105238_100952532 141
2636 3300009553 Ga0105249_10696990 Ga0105249_106969902 141
2637 3300010375 Ga0105239_10006100 Ga0105239_1000610012 141
2638 3300010375 Ga0105239_10168063 Ga0105239_101680633 141
2639 3300013102 Ga0157371_10321376 Ga0157371_103213762 141
2640 3300013104 Ga0157370_10517326 Ga0157370_105173261 141
2641 3300013105 Ga0157369_10006662 Ga0157369_1000666212 141
2642 3300013306 Ga0163162_11274751 Ga0163162_112747512 141
2643 3300014325 Ga0163163_10001936 Ga0163163_100019367 141
2644 3300020082 Ga0206353_10973987 Ga0206353_109739871 141
2645 3300025321 Ga0207656_10033764 Ga0207656_100337642 141
2646 3300025321 Ga0207656_10194438 Ga0207656_101944382 141
2647 3300025904 Ga0207647_10037887 Ga0207647_100378873 141
2648 3300025906 Ga0207699_10153736 Ga0207699_101537362 141
2649 3300025906 Ga0207699_10172818 Ga0207699_101728182 141
2650 3300025909 Ga0207705_10031420 Ga0207705_100314203 141
2651 3300025909 Ga0207705_10180424 Ga0207705_101804242 141
2652 3300025911 Ga0207654_10525916 Ga0207654_105259161 141
2653 3300025912 Ga0207707_10117979 Ga0207707_101179792 141
2654 3300025912 Ga0207707_10161272 Ga0207707_101612722 141
2655 3300025913 Ga0207695_10002086 Ga0207695_1000208624 141
2656 3300025913 Ga0207695_10148768 Ga0207695_101487683 141
2657 3300025914 Ga0207671_10113900 Ga0207671_101139002 141
2658 3300025914 Ga0207671_10224889 Ga0207671_102248892 141
2659 3300025914 Ga0207671_11103669 Ga0207671_111036691 141
2660 3300025919 Ga0207657_10003447 Ga0207657_100034473 141
2661 3300025919 Ga0207657_10397457 Ga0207657_103974572 141
2662 3300025921 Ga0207652_10024131 Ga0207652_100241314 141
2663 3300025924 Ga0207694_10006035 Ga0207694_100060353 141
2664 3300025929 Ga0207664_10134624 Ga0207664_101346241 141
2665 3300025932 Ga0207690_10433927 Ga0207690_104339272 141
2666 3300025933 Ga0207706_10153645 Ga0207706_101536452 141
2667 3300025938 Ga0207704_10852122 Ga0207704_108521222 141
2668 3300025941 Ga0207711_10875131 Ga0207711_108751311 141
2669 3300025944 Ga0207661_10025600 Ga0207661_100256006 141
2670 3300025949 Ga0207667_10014502 Ga0207667_100145025 141
2671 3300025949 Ga0207667_10017009 Ga0207667_100170095 141
2672 3300025981 Ga0207640_10029313 Ga0207640_100293133 141
2673 3300025981 Ga0207640_10109097 Ga0207640_101090973 141
2674 3300026035 Ga0207703_10297970 Ga0207703_102979702 141
2675 3300026041 Ga0207639_10004901 Ga0207639_100049018 141
2676 3300026041 Ga0207639_10208824 Ga0207639_102088243 141
2677 3300026067 Ga0207678_10032590 Ga0207678_100325903 141
2678 3300026078 Ga0207702_10000005 Ga0207702_1000000551 141
2679 3300026095 Ga0207676_10262458 Ga0207676_102624582 141
2680 3300026116 Ga0207674_10003061 Ga0207674_100030614 141
2681 3300026116 Ga0207674_10003961 Ga0207674_100039613 141
2682 3300026142 Ga0207698_10058336 Ga0207698_100583364 141
2683 3300028379 Ga0268266_10069646 Ga0268266_100696462 141
2684 3300035111 Ga0373923_0014792 Ga0373923_0014792_1038_1481 141
2685 3300035113 Ga0373936_0512463 Ga0373936_0512463_27_455 141
2686 3300035116 Ga0373945_0014548 Ga0373945_0014548_1180_1623 141
2687 3300035117 Ga0373953_0014343 Ga0373953_0014343_29_472 141
2688 3300035118 Ga0373954_0022014 Ga0373954_0022014_1550_1993 141
2689 3300035119 Ga0373956_0061028 Ga0373956_0061028_1173_1616 141
2690 3300035170 Ga0373943_0006607 Ga0373943_0006607_4185_4628 141
2691 3300035171 Ga0373946_0103307 Ga0373946_0103307_153_596 141
2692 3300035172 Ga0373955_0039892 Ga0373955_0039892_1110_1553 141
2693 3300035172 Ga0373955_0336986 Ga0373955_0336986_66_521 141
2694 3300035692 Ga0373935_0011114 Ga0373935_0011114_4543_4986 141
2695 3300035724 Ga0373933_0812037 Ga0373933_0812037_149_592 141
2696 3300036401 Ga0373937_0015620 Ga0373937_0015620_2249_2692 141
2697 3300037068 Ga0373925_1116595 Ga0373925_1116595_17_460 141
2698 3300039447 Ga0436361_0171409 Ga0436361_0171409_65_493 141
2699 3300046454 Ga0495592_0677210 Ga0495592_0677210_47_490 141
2700 3300046455 Ga0495603_0039990 Ga0495603_0039990_1580_2023 141
2701 3300046461 Ga0495641_0263404 Ga0495641_0263404_248_691 141
2702 3300046472 Ga0495580_0092201 Ga0495580_0092201_1078_1521 141
2703 3300046476 Ga0495662_0118733 Ga0495662_0118733_689_1132 141
2704 3300046477 Ga0495664_0550469 Ga0495664_0550469_210_653 141
2705 3300046517 Ga0495630_0011390 Ga0495630_0011390_4498_4941 141
2706 3300046529 Ga0495652_0037634 Ga0495652_0037634_1436_1879 141
2707 3300046533 Ga0495640_0033033 Ga0495640_0033033_1043_1486 141
2708 3300046535 Ga0495586_0060480 Ga0495586_0060480_1285_1728 141
2709 3300046559 Ga0495667_0027184 Ga0495667_0027184_3206_3649 141
2710 3300046642 Ga0495634_0102185 Ga0495634_0102185_330_773 141
2711 3300046663 Ga0495635_0266139 Ga0495635_0266139_514_957 141
2712 3300046678 Ga0495599_0068246 Ga0495599_0068246_153_596 141
2713 3300046681 Ga0495647_0017212 Ga0495647_0017212_1978_2421 141
2714 3300046683 Ga0495658_0068777 Ga0495658_0068777_994_1437 141
2715 3300046689 Ga0495613_0048889 Ga0495613_0048889_2251_2694 141
2716 3300047315 Ga0495581_0061244 Ga0495581_0061244_738_1181 141
2717 3300047317 Ga0495604_0161374 Ga0495604_0161374_507_950 141
2718 3300047319 Ga0495674_0007739 Ga0495674_0007739_6428_6871 141
2719 3300047322 Ga0495680_0636717 Ga0495680_0636717_71_514 141
2720 3300047444 Ga0495675_0110399 Ga0495675_0110399_433_876 141
2721 3300047471 Ga0495684_0005953 Ga0495684_0005953_3753_4196 141
2722 3300047673 Ga0495593_0087496 Ga0495593_0087496_161_604 141
2723 3300048904 Ga0496101_0449725 Ga0496101_0449725_178_639 141
2724 3300048907 Ga0496104_0006867 Ga0496104_0006867_9177_9638 141
2725 3300048908 Ga0496105_0980285 Ga0496105_0980285_106_567 141
2726 3300048909 Ga0496106_0006956 Ga0496106_0006956_6356_6817 141
2727 3300048910 Ga0496107_0285807 Ga0496107_0285807_721_1182 141
2728 3300048911 Ga0496108_0079832 Ga0496108_0079832_1734_2195 141
2729 3300048912 Ga0496109_0064819 Ga0496109_0064819_86_547 141
2730 3300048914 Ga0496111_0020492 Ga0496111_0020492_3246_3707 141
2731 3300048915 Ga0496112_0000992 Ga0496112_0000992_9038_9499 141
2732 3300048916 Ga0496113_0055876 Ga0496113_0055876_2219_2680 141
2733 3300048918 Ga0496115_0016380 Ga0496115_0016380_3457_3918 141
2734 3300048921 Ga0496118_0252113 Ga0496118_0252113_310_783 141
2735 3300048924 Ga0496121_0141466 Ga0496121_0141466_890_1363 141
2736 3300048929 Ga0496126_0367944 Ga0496126_0367944_392_865 141
2737 3300049568 Ga0501031_0107443 Ga0501031_0107443_849_1304 141
2738 3300049570 Ga0501033_0183871 Ga0501033_0183871_695_1150 141
2739 3300049571 Ga0501034_0079578 Ga0501034_0079578_2465_2920 141
2740 3300049572 Ga0501036_0106639 Ga0501036_0106639_1872_2327 141
2741 3300049575 Ga0501039_0138652 Ga0501039_0138652_374_829 141
2742 3300049575 Ga0501039_0509026 Ga0501039_0509026_304_759 141
2743 3300049580 Ga0501046_0194669 Ga0501046_0194669_123_578 141
2744 3300049581 Ga0501047_0383633 Ga0501047_0383633_95_550 141
2745 3300049584 Ga0501068_0267365 Ga0501068_0267365_23_478 141
2746 3300049585 Ga0501069_0629195 Ga0501069_0629195_164_619 141
2747 3300049586 Ga0501070_0046130 Ga0501070_0046130_2750_3205 141
2748 3300049588 Ga0501072_0162840 Ga0501072_0162840_155_610 141
2749 3300049590 Ga0501074_0204812 Ga0501074_0204812_483_938 141
2750 3300049742 Ga0501080_0846646 Ga0501080_0846646_121_576 141
2751 3300049823 Ga0501044_0218409 Ga0501044_0218409_1041_1496 141
2752 3300050495 nmdc:mga04h51_376016_c1 nmdc:mga04h51_376016_c1_16_456 141
2753 3300050496 nmdc:mga07m45_71218_c1 nmdc:mga07m45_71218_c1_182_622 141
2754 3300050516 nmdc:mga0sz30_757_c1 nmdc:mga0sz30_757_c1_3134_3574 141
2755 3300053078 Ga0495612_0016666 Ga0495612_0016666_1919_2362 141

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01648

ACPS

4'-phosphopantetheinyl transferase superfamily

4

127

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4dxe-assembly2.cif.gz_E 2.52 angstrom resolution crystal structure of the acyl-carrier-protein synthase (acps)-acyl carrier protein (acp) protein-protein complex from staphylococcus aureus subsp. aureus col 0.9228 1 133
4dxe-assembly1.cif.gz_B 2.52 angstrom resolution crystal structure of the acyl-carrier-protein synthase (acps)-acyl carrier protein (acp) protein-protein complex from staphylococcus aureus subsp. aureus col 0.9178 1 133
4dxe-assembly1.cif.gz_C 2.52 angstrom resolution crystal structure of the acyl-carrier-protein synthase (acps)-acyl carrier protein (acp) protein-protein complex from staphylococcus aureus subsp. aureus col 0.9173 1 133
1ftf-assembly1.cif.gz_C crystal structure of streptococcus pneumoniae acyl carrier protein synthase (native 2) 0.9136 1 132
4jm7-assembly1.cif.gz_B 1.82 angstrom resolution crystal structure of holo-(acyl-carrier-protein) synthase (acps) from staphylococcus aureus 0.9125 1 133
ID Description Score Start End Superfamily
5xuhB00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain 0.9038 1 132 3.90.470.20
3hykB00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain 0.8929 3 132 3.90.470.20
5xuhB00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain 0.8894 1 132 3.90.470.20
1fthC00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain 0.8893 1 132 3.90.470.20
2bddA00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain 0.8862 1 135 3.90.470.20
ID Description Score Start End GO Terms
AF-A0A6J4I184-F1-model_v4 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (EC 2.7.8.7) (4'-phosphopantetheinyl transferase AcpS) 0.9911 1 135 GO:0000287
GO:0005737
GO:0006633
GO:0008897
AF-A0A7W4P538-F1-model_v4 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (EC 2.7.8.7) (4'-phosphopantetheinyl transferase AcpS) 0.99 1 135 GO:0000287
GO:0005737
GO:0006633
GO:0008897
AF-A0A1H3YM80-F1-model_v4 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (EC 2.7.8.7) (4'-phosphopantetheinyl transferase AcpS) 0.9871 1 134 GO:0000287
GO:0005737
GO:0006633
GO:0008897
AF-A0A2V5B4B5-F1-model_v4 deleted 0.9866 1 135
AF-A0A1T5BAD5-F1-model_v4 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (EC 2.7.8.7) (4'-phosphopantetheinyl transferase AcpS) 0.986 1 135 GO:0000287
GO:0005737
GO:0006633
GO:0008897

Feature Viewer

pLDDT pTM Quality
93.9 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map