F497136

General Info

Members Datasets Scaffolds Average Seq Length
2905 818 5810 227

Family's Representative Sequence

Representative Sequence 3300048907|Ga0496104_0263866|Ga0496104_0263866_756_1592
Length 268
Sequence MLTTLLDQPERRSPGCSPRSSTSRSADHRVTHTGAVERIPPGSLTHVPMRVGVVTFPGSLDDRDAARAVRIGGGVAVPLWHADPSLHDVDAVILPGGFSYGDYLRCGAIARFAPVMQTLVQAARDGLPLLGICNGFQVLCEAHLLPGALIRNDHRKFVCRDQPLRVENNRTAWTSAYRERQDITIPLKNGEGGYVADPRTLAELEAQGRVVVRYLGNPNGSYHDIAGITNEAGNVVGLMPHPEHAVEALTGPGTDGLGFFHSLLGVPA

Samples

Sample ID Description Type Environment
1 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
11 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
12 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
13 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
14 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
15 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
16 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
17 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
18 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
39 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
40 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
44 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
45 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
46 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
47 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
48 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
49 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
50 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
51 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
52 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
53 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
54 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
55 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
56 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
57 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
58 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
59 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
60 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
61 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
62 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
63 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
64 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
65 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
66 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
67 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
68 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
69 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
70 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
71 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
72 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
73 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
74 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
75 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
76 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
77 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
78 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
79 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
80 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
81 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
82 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
83 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
84 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
85 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
86 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
87 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
88 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
89 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
90 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
91 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
92 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
93 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
94 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
95 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
96 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
97 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
98 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
99 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
100 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
101 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
102 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
103 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
104 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
105 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
106 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
107 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
108 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
109 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
110 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
111 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
112 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
113 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
114 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
115 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
116 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
117 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
118 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
119 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
120 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
121 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
122 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
123 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
124 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
125 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
126 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
127 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
128 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
129 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
130 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
131 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
132 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
133 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
134 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
135 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
136 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
137 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
138 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
139 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
140 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
141 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
142 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
143 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
144 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
145 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
146 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
147 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
148 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
149 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
150 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
151 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
152 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
153 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
154 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
155 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
156 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
157 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
158 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
159 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
160 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
161 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
162 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
163 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
164 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
165 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
166 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
167 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
168 3300023436 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.stno.R1 Metatranscriptome Rhizosphere
169 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
170 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
176 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
177 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
181 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
183 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
184 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
253 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
254 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
258 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
259 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
260 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
261 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
262 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
263 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
264 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
265 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
266 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
267 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
268 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
269 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
270 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
271 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
272 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
273 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
274 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
275 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
276 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
277 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
278 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
279 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
280 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
281 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
282 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
283 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
284 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
285 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
286 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
287 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
288 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
289 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
290 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
291 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
292 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
293 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
294 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
295 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
296 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
297 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
298 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
299 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
300 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
301 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
302 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
303 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
304 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
305 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
306 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
307 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
308 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
309 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
310 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
311 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
312 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
313 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
314 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
315 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
316 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
317 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
318 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
319 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
320 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
321 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
322 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
323 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
324 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
325 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
326 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
327 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
328 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
329 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
330 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
331 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
332 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
333 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
334 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
335 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
336 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
337 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
338 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
339 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
340 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
341 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
342 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
343 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
344 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
345 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
346 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
347 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
348 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
349 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
350 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
351 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
352 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
353 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
354 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
355 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
356 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
357 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
358 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
359 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
360 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
361 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
362 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
363 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
364 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
365 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
366 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
367 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
368 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
369 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
370 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
371 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
372 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
373 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
374 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
375 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
376 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
377 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
378 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
379 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
380 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
381 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
382 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
383 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
384 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
385 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
386 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
387 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
388 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
389 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
390 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
391 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
392 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
393 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
394 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
395 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
396 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
397 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
398 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
399 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
400 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
401 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
402 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
403 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
404 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
405 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
406 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
407 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
408 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
409 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
410 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
411 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
412 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
413 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
414 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
415 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
416 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
417 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
418 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
419 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
420 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
421 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
422 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
423 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
424 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
425 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
426 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
427 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
428 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
429 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
430 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
431 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
432 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
433 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
434 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
435 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
436 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
437 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
438 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
439 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
440 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
441 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
442 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
443 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
444 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
445 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
446 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
447 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
448 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
449 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
450 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
451 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
452 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
453 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
454 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
455 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
456 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
457 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
458 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
459 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
460 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
461 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
462 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
463 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
464 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
465 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
466 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
467 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
468 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
469 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
470 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
471 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
472 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
473 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
474 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
475 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
476 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
477 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
478 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
479 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
480 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
481 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
482 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
483 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
484 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
485 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
486 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
487 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
488 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
489 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
490 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
491 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
492 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
493 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
494 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
495 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
496 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
497 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
498 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
499 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
500 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
501 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
502 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
503 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
504 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
505 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
506 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
507 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
508 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
509 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
510 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
511 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
512 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
513 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
514 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
515 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
516 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
517 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
518 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
519 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
520 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
521 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
522 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
523 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
524 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
525 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
526 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
527 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
528 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
529 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
530 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
531 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
532 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
533 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
534 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
535 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
536 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
537 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
538 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
539 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
540 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
541 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
542 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
543 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
544 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
545 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
546 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
547 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
548 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
549 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
550 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
551 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
552 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
553 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
554 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
555 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
556 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
557 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
558 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
559 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
560 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
561 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
562 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
563 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
564 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
565 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
566 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
567 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
568 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
569 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
570 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
571 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
572 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
573 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
574 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
575 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
576 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
577 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
578 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
579 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
580 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
581 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
582 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
583 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
584 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
585 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
586 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
587 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
588 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
589 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
590 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
591 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
592 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
593 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
594 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
595 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
596 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
597 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
598 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
599 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
600 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
601 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
602 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
603 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
604 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
605 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
606 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
607 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
608 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
609 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
610 3300059659 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
611 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
612 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
613 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
614 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
615 2506783011 Frankia datiscae Dg1 Isolate Nodule
616 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
617 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
618 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
619 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
620 2527291627 Frankia casuarinae Thr Isolate Nodule
621 2527291629 Frankia sp. BMG5.23 Isolate Nodule
622 2546825537 Frankia sp. CcI6 Isolate Rhizoplane
623 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
624 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
625 2558860280 Kutzneria sp. 744 Isolate Unclassified
626 2576861822 Frankia sp. CeD Isolate Nodule
627 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
628 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
629 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
630 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
631 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
632 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
633 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
634 2643221548 Streptomyces sp. Root55 Isolate Unclassified
635 2643221561 Nocardioides sp. Root151 Isolate Unclassified
636 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
637 2643221576 Nocardioides sp. Root614 Isolate Unclassified
638 2643221578 Streptomyces sp. Root63 Isolate Unclassified
639 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
640 2643221590 Nocardioides sp. Root682 Isolate Unclassified
641 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
642 2643221604 Nocardioides sp. Root190 Isolate Unclassified
643 2643221615 Nocardioides sp. Root224 Isolate Unclassified
644 2643221617 Nocardioides sp. Root79 Isolate Unclassified
645 2643221620 Nocardioides sp. Root240 Isolate Unclassified
646 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
647 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
648 2643221641 Nocardioides sp. Root122 Isolate Unclassified
649 2643221647 Streptomyces sp. Root369 Isolate Unclassified
650 2643221649 Leifsonia sp. Root4 Isolate Unclassified
651 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
652 2643221670 Streptomyces sp. Root431 Isolate Unclassified
653 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
654 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
655 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
656 2643221679 Angustibacter sp. Root456 Isolate Unclassified
657 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
658 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
659 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
660 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
661 2643221696 Nocardioides sp. Root140 Isolate Unclassified
662 2643221697 Aeromicrobium sp. Root495 Isolate Unclassified
663 2643221711 Terrabacter sp. Root85 Isolate Unclassified
664 2643221714 Streptomyces sp. Root264 Isolate Unclassified
665 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
666 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
667 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
668 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
669 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
670 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
671 2684623036 Frankia sp. CgIM4 Isolate Nodule
672 2710264753 Frankia sp. KB5 Isolate Nodule
673 2738541305 Nocardioides sp. CF167 Isolate Unclassified
674 2739367898 Nocardioides sp. CF479 Isolate Unclassified
675 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
676 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
677 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
678 2773857922 Frankia sp. CcI49 Isolate Nodule
679 2773857924 Frankia sp. CgIS1 Isolate Nodule
680 2773857933 Frankia sp. BMG5.30 Isolate Nodule
681 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
682 2784132109 Dermacoccus sp. DS28 SAI-028 Isolate Unclassified
683 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
684 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
685 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
686 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
687 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
688 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
689 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
690 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
691 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
692 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
693 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
694 2808606448 Streptomyces sp. 193411 Isolate Unclassified
695 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
696 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
697 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
698 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
699 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
700 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
701 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
702 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
703 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
704 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
705 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
706 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
707 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
708 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
709 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
710 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
711 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
712 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
713 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
714 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
715 2857710386 Brevibacterium sp. R-73093 Isolate Unclassified
716 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
717 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
718 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
719 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
720 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
721 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
722 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
723 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
724 2862574272 Streptomyces sp. AcE210 Isolate Nodule
725 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
726 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
727 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
728 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
729 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
730 2867428634 Streptomyces sp. RP5T Isolate Unclassified
731 2867475112 Streptomyces sp. TM32 Isolate Unclassified
732 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
733 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
734 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
735 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
736 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
737 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
738 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
739 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
740 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
741 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
742 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
743 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
744 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
745 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
746 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
747 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
748 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
749 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
750 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
751 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
752 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
753 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
754 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
755 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
756 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
757 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
758 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
759 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
760 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
761 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
762 2928153084 Leifsonia sp. 563 Isolate Unclassified
763 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
764 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
765 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
766 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
767 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
768 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
769 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
770 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
771 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
772 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
773 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
774 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
775 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
776 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
777 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
778 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
779 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
780 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
781 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
782 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
783 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
784 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
785 2966921586 Rathayibacter agropyri 617 Isolate Rhizosphere
786 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
787 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
788 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
789 2984592036 Aeromicrobium sp. SORGH_AS981 Isolate Aerial Root
790 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
791 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
792 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
793 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
794 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
795 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified
796 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
797 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
798 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
799 637000116 Frankia casuarinae CcI3 Isolate Nodule
800 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
801 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
802 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
803 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
804 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
805 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
806 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
807 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
808 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
809 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
810 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
811 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
812 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
813 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
814 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule
815 8055037949 Leucobacter rhizosphaerae H25R-14 Isolate Rhizosphere
816 8056054917 Glycomyces luteolus NEAU-A15 Isolate Rhizosphere
817 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
818 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.19
Metatranscriptomes 1.79
Isolates 7.02

Biome Distribution

Category Percentage (%)
Aerial Root 0.1
Bulb 0
Endosphere 4.85
Nodule 0.52
Rhizoplane 6.68
Rhizosphere 80.52
Stem 0
Stem Tuber 0.03
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496104_0263866 3300048907 Bacteria 1635
2 LJQas_1006181 3300000549 Bacteria 1499
3 JGI24740J21852_10010698 3300001979 Bacteria 3520
4 JGI24739J22299_10008515 3300001989 Bacteria 3829
5 JGI24739J22299_10022577 3300001989 Bacteria 2231
6 JGI24737J22298_10015391 3300001990 Bacteria 2476
7 JGI24737J22298_10021201 3300001990 Bacteria 2072
8 JGI24737J22298_10029497 3300001990 Bacteria 1720
9 JGI24737J22298_10038101 3300001990 Bacteria 1481
10 JGI24735J21928_10010075 3300002067 Bacteria 3022
11 JGI24735J21928_10017076 3300002067 Bacteria 2246
12 JGI24735J21928_10041415 3300002067 Bacteria 1342
13 JGI25406J46586_10049571 3300003203 Bacteria 1415
14 JGI25165J46597_1001642 3300003214 Bacteria 10402
15 JGI25160J50197_1009291 3300003354 Bacteria 3663
16 JGI25407J50210_10002920 3300003373 Bacteria 4075
17 Ga0006562J51391_1097815 3300003578 Bacteria 6078
18 Ga0006562J51391_1097816 3300003578 Bacteria 5970
19 Ga0006562J51391_1141224 3300003578 Bacteria 1550
20 Ga0055539_1000069 3300003752 Bacteria 134064
21 Ga0055533_1000037 3300003756 Bacteria 255573
22 Ga0055525_1000308 3300003759 Bacteria 39902
23 Ga0055525_1002484 3300003759 Bacteria 1863
24 Ga0055542_1000048 3300003762 Bacteria 195800
25 Ga0055529_1000057 3300003763 Bacteria 195807
26 Ga0055541_1003380 3300003841 Bacteria 3013
27 Ga0065714_10149987 3300005288 Bacteria 1112
28 Ga0070658_10000415 3300005327 Bacteria 36949
29 Ga0070658_10001574 3300005327 Bacteria 19323
30 Ga0070658_10051772 3300005327 Bacteria 3327
31 Ga0070658_10055835 3300005327 Bacteria 3209
32 Ga0070658_10065330 3300005327 Bacteria 2969
33 Ga0070658_10077738 3300005327 Bacteria 2723
34 Ga0070658_10095203 3300005327 Bacteria 2458
35 Ga0070658_10097029 3300005327 Bacteria 2434
36 Ga0070658_10293561 3300005327 Bacteria 1385
37 Ga0070658_10374793 3300005327 Bacteria 1220
38 Ga0070658_10725952 3300005327 Bacteria 863
39 Ga0070676_10110833 3300005328 Bacteria 1708
40 Ga0070676_10616354 3300005328 Bacteria 784
41 Ga0070683_100037712 3300005329 Bacteria 4425
42 Ga0070683_100087143 3300005329 Bacteria 2928
43 Ga0070683_100125312 3300005329 Bacteria 2428
44 Ga0070683_100305356 3300005329 Bacteria 1514
45 Ga0070683_100393433 3300005329 Bacteria 1321
46 Ga0070683_100707880 3300005329 Bacteria 965
47 Ga0070683_100859841 3300005329 Bacteria 870
48 Ga0070683_101012683 3300005329 Bacteria 797
49 Ga0070690_100056083 3300005330 Bacteria 2525
50 Ga0070690_100263589 3300005330 Bacteria 1223
51 Ga0070670_100677635 3300005331 Bacteria 926
52 Ga0068869_100344341 3300005334 Bacteria 1214
53 Ga0068869_100805627 3300005334 Bacteria 807
54 Ga0070666_10007989 3300005335 Bacteria 6542
55 Ga0070666_10030303 3300005335 Bacteria 3563
56 Ga0070680_100000038 3300005336 Bacteria 66468
57 Ga0070680_100000467 3300005336 Bacteria 27657
58 Ga0070680_100141605 3300005336 Bacteria 2017
59 Ga0070682_100022400 3300005337 Bacteria 3742
60 Ga0070682_100082438 3300005337 Bacteria 2085
61 Ga0070682_100274694 3300005337 Bacteria 1226
62 Ga0068868_100000864 3300005338 Bacteria 20513
63 Ga0068868_100023554 3300005338 Bacteria 4661
64 Ga0068868_100059263 3300005338 Bacteria 3028
65 Ga0068868_100140090 3300005338 Bacteria 1985
66 Ga0070660_100006957 3300005339 Bacteria 7847
67 Ga0070660_100068880 3300005339 Bacteria 2758
68 Ga0070660_100089337 3300005339 Bacteria 2427
69 Ga0070660_100111603 3300005339 Bacteria 2176
70 Ga0070689_100220033 3300005340 Bacteria 1557
71 Ga0070687_100169548 3300005343 Bacteria 1298
72 Ga0070687_100320902 3300005343 Bacteria 989
73 Ga0070661_100092982 3300005344 Bacteria 2235
74 Ga0070661_100136261 3300005344 Bacteria 1848
75 Ga0070661_100296885 3300005344 Bacteria 1257
76 Ga0070692_10097904 3300005345 Bacteria 1604
77 Ga0070692_10123054 3300005345 Bacteria 1449
78 Ga0070692_10208333 3300005345 Bacteria 1149
79 Ga0070668_100210366 3300005347 Bacteria 1600
80 Ga0070668_100434417 3300005347 Bacteria 1126
81 Ga0070668_100535542 3300005347 Bacteria 1018
82 Ga0070669_100058354 3300005353 Bacteria 2832
83 Ga0070669_100094132 3300005353 Bacteria 2251
84 Ga0070669_100510555 3300005353 Bacteria 998
85 Ga0070675_100000912 3300005354 Bacteria 20994
86 Ga0070675_100135351 3300005354 Bacteria 2103
87 Ga0070675_100412298 3300005354 Bacteria 1207
88 Ga0070675_100842838 3300005354 Bacteria 839
89 Ga0070671_100007886 3300005355 Bacteria 8513
90 Ga0070674_100024914 3300005356 Bacteria 3887
91 Ga0070674_100078367 3300005356 Bacteria 2354
92 Ga0070674_100146501 3300005356 Bacteria 1778
93 Ga0070674_100207359 3300005356 Bacteria 1517
94 Ga0070673_100233061 3300005364 Bacteria 1598
95 Ga0070688_100365578 3300005365 Bacteria 1060
96 Ga0070659_100000776 3300005366 Bacteria 23181
97 Ga0070659_100013798 3300005366 Bacteria 6026
98 Ga0070659_100028481 3300005366 Bacteria 4314
99 Ga0070659_100073374 3300005366 Bacteria 2724
100 Ga0070659_100353141 3300005366 Bacteria 1234
101 Ga0070659_100356656 3300005366 Bacteria 1228
102 Ga0070659_100399631 3300005366 Bacteria 1160
103 Ga0070659_100700522 3300005366 Bacteria 876
104 Ga0070667_100000930 3300005367 Bacteria 27043
105 Ga0070667_100001027 3300005367 Bacteria 25488
106 Ga0070667_100035660 3300005367 Bacteria 4168
107 Ga0070667_100182987 3300005367 Bacteria 1854
108 Ga0070667_100374200 3300005367 Bacteria 1293
109 Ga0070667_100472934 3300005367 Bacteria 1147
110 Ga0070703_10000050 3300005406 Bacteria 57436
111 Ga0070709_10033541 3300005434 Bacteria 3106
112 Ga0070709_10130897 3300005434 Bacteria 1713
113 Ga0070709_10297154 3300005434 Bacteria 1178
114 Ga0070714_100000126 3300005435 Bacteria 60425
115 Ga0070714_100116435 3300005435 Bacteria 2373
116 Ga0070714_100146887 3300005435 Bacteria 2122
117 Ga0070714_100494932 3300005435 Bacteria 1165
118 Ga0070714_100514800 3300005435 Bacteria 1142
119 Ga0070714_100612339 3300005435 Bacteria 1046
120 Ga0070713_100069900 3300005436 Bacteria 2962
121 Ga0070713_100113339 3300005436 Bacteria 2367
122 Ga0070713_100274352 3300005436 Bacteria 1545
123 Ga0070713_100485796 3300005436 Bacteria 1164
124 Ga0070710_10000045 3300005437 Bacteria 57765
125 Ga0070710_10039271 3300005437 Bacteria 2604
126 Ga0070710_10050163 3300005437 Bacteria 2338
127 Ga0070710_10052775 3300005437 Bacteria 2287
128 Ga0070701_10205661 3300005438 Bacteria 1166
129 Ga0070701_10264772 3300005438 Bacteria 1043
130 Ga0070711_100039884 3300005439 Bacteria 3164
131 Ga0070711_100072345 3300005439 Bacteria 2432
132 Ga0070705_100072574 3300005440 Bacteria 2086
133 Ga0070705_100079788 3300005440 Bacteria 2006
134 Ga0070705_100175731 3300005440 Bacteria 1446
135 Ga0070705_100183384 3300005440 Bacteria 1420
136 Ga0070700_100000041 3300005441 Bacteria 103180
137 Ga0070700_100056378 3300005441 Bacteria 2463
138 Ga0070700_100067447 3300005441 Bacteria 2273
139 Ga0070700_100129866 3300005441 Bacteria 1699
140 Ga0070694_100038596 3300005444 Bacteria 3175
141 Ga0070708_100001634 3300005445 Bacteria 17181
142 Ga0070708_100022773 3300005445 Bacteria 5318
143 Ga0070708_100061188 3300005445 Bacteria 3363
144 Ga0070708_100080735 3300005445 Bacteria 2943
145 Ga0070708_100451087 3300005445 Bacteria 1213
146 Ga0070663_100013940 3300005455 Bacteria 5144
147 Ga0070663_100057616 3300005455 Bacteria 2788
148 Ga0070663_100067127 3300005455 Bacteria 2601
149 Ga0070663_100125216 3300005455 Bacteria 1946
150 Ga0070678_100154560 3300005456 Bacteria 1852
151 Ga0070662_100000005 3300005457 Bacteria 183056
152 Ga0070662_100033423 3300005457 Bacteria 3621
153 Ga0070662_100260973 3300005457 Bacteria 1396
154 Ga0070662_100543375 3300005457 Bacteria 973
155 Ga0070662_100546527 3300005457 Bacteria 970
156 Ga0070681_10000139 3300005458 Bacteria 55074
157 Ga0070681_10005819 3300005458 Bacteria 11931
158 Ga0070681_10006001 3300005458 Bacteria 11773
159 Ga0070681_10233929 3300005458 Bacteria 1752
160 Ga0070681_10657555 3300005458 Bacteria 963
161 Ga0070681_10696009 3300005458 Bacteria 932
162 Ga0068867_100064887 3300005459 Bacteria 2715
163 Ga0068867_100121611 3300005459 Bacteria 2018
164 Ga0070685_10017859 3300005466 Bacteria 3805
165 Ga0070706_100002425 3300005467 Bacteria 18781
166 Ga0070706_100011726 3300005467 Bacteria 8134
167 Ga0070706_100017806 3300005467 Bacteria 6554
168 Ga0070706_100064011 3300005467 Bacteria 3399
169 Ga0070706_100082597 3300005467 Bacteria 2976
170 Ga0070706_100138279 3300005467 Bacteria 2273
171 Ga0070706_100156824 3300005467 Bacteria 2125
172 Ga0070706_100163271 3300005467 Bacteria 2080
173 Ga0070706_100205235 3300005467 Bacteria 1841
174 Ga0070707_100011661 3300005468 Bacteria 8201
175 Ga0070707_100013509 3300005468 Bacteria 7639
176 Ga0070707_100052263 3300005468 Bacteria 3917
177 Ga0070707_100070483 3300005468 Bacteria 3367
178 Ga0070707_100076550 3300005468 Bacteria 3227
179 Ga0070707_100177914 3300005468 Bacteria 2074
180 Ga0070707_100261998 3300005468 Bacteria 1682
181 Ga0070707_100482739 3300005468 Bacteria 1201
182 Ga0070698_100000293 3300005471 Bacteria 50987
183 Ga0070698_100000595 3300005471 Bacteria 38879
184 Ga0070698_100000670 3300005471 Bacteria 36531
185 Ga0070698_100006465 3300005471 Bacteria 12714
186 Ga0070698_100008302 3300005471 Bacteria 11227
187 Ga0070698_100008631 3300005471 Bacteria 10980
188 Ga0070698_100008883 3300005471 Bacteria 10804
189 Ga0070698_100027273 3300005471 Bacteria 5942
190 Ga0070698_100029836 3300005471 Bacteria 5659
191 Ga0070698_100046969 3300005471 Bacteria 4414
192 Ga0070698_100298539 3300005471 Bacteria 1542
193 Ga0070698_100308921 3300005471 Bacteria 1512
194 Ga0070698_100368691 3300005471 Bacteria 1368
195 Ga0070698_100404919 3300005471 Bacteria 1298
196 Ga0070699_100002142 3300005518 Bacteria 17905
197 Ga0070699_100171795 3300005518 Bacteria 1921
198 Ga0070699_100233263 3300005518 Bacteria 1641
199 Ga0070679_100000026 3300005530 Bacteria 115669
200 Ga0070679_100001988 3300005530 Bacteria 18356
201 Ga0070679_100027390 3300005530 Bacteria 5609
202 Ga0070679_100073317 3300005530 Bacteria 3415
203 Ga0070679_100175297 3300005530 Bacteria 2117
204 Ga0070679_100181445 3300005530 Bacteria 2077
205 Ga0070679_100218364 3300005530 Bacteria 1868
206 Ga0070679_100533120 3300005530 Bacteria 1118
207 Ga0070679_100736320 3300005530 Bacteria 929
208 Ga0070679_100874575 3300005530 Bacteria 842
209 Ga0070684_100001624 3300005535 Bacteria 16269
210 Ga0070684_100002697 3300005535 Bacteria 13116
211 Ga0070684_100016762 3300005535 Bacteria 5996
212 Ga0070684_100288652 3300005535 Bacteria 1504
213 Ga0070684_100385312 3300005535 Bacteria 1291
214 Ga0070684_100400167 3300005535 Bacteria 1266
215 Ga0070684_100476873 3300005535 Bacteria 1154
216 Ga0070684_100511195 3300005535 Bacteria 1113
217 Ga0070684_100529579 3300005535 Bacteria 1092
218 Ga0070684_100930560 3300005535 Bacteria 815
219 Ga0070697_100002584 3300005536 Bacteria 13924
220 Ga0070697_100246201 3300005536 Bacteria 1528
221 Ga0068853_100036838 3300005539 Bacteria 4161
222 Ga0068853_100055395 3300005539 Bacteria 3418
223 Ga0068853_100150353 3300005539 Bacteria 2096
224 Ga0070672_100081658 3300005543 Bacteria 2592
225 Ga0070672_100160828 3300005543 Bacteria 1863
226 Ga0070672_100209370 3300005543 Bacteria 1633
227 Ga0070672_100599079 3300005543 Bacteria 960
228 Ga0070686_100112821 3300005544 Bacteria 1854
229 Ga0070686_100113015 3300005544 Bacteria 1853
230 Ga0070686_100617866 3300005544 Bacteria 856
231 Ga0070696_100008700 3300005546 Bacteria 6793
232 Ga0070696_100021443 3300005546 Bacteria 4380
233 Ga0070696_100158457 3300005546 Bacteria 1666
234 Ga0070693_100002657 3300005547 Bacteria 8229
235 Ga0070693_100019030 3300005547 Bacteria 3593
236 Ga0070665_100001439 3300005548 Bacteria 27904
237 Ga0070665_100036468 3300005548 Bacteria 4946
238 Ga0070665_100058592 3300005548 Bacteria 3861
239 Ga0070665_100393363 3300005548 Bacteria 1394
240 Ga0070704_100281309 3300005549 Bacteria 1378
241 Ga0068855_100011249 3300005563 Bacteria 10807
242 Ga0068855_100012913 3300005563 Bacteria 10078
243 Ga0068855_100114852 3300005563 Bacteria 3086
244 Ga0068855_100285484 3300005563 Bacteria 1831
245 Ga0068855_100437057 3300005563 Bacteria 1429
246 Ga0068855_100689877 3300005563 Bacteria 1094
247 Ga0070664_100000216 3300005564 Bacteria 41059
248 Ga0070664_100003438 3300005564 Bacteria 12799
249 Ga0070664_100080811 3300005564 Bacteria 2800
250 Ga0070664_100192605 3300005564 Bacteria 1817
251 Ga0070664_100290637 3300005564 Bacteria 1476
252 Ga0070664_100891661 3300005564 Bacteria 834
253 Ga0068857_100251966 3300005577 Bacteria 1619
254 Ga0068857_100494331 3300005577 Bacteria 1147
255 Ga0068854_100253669 3300005578 Bacteria 1406
256 Ga0068856_100027919 3300005614 Bacteria 5506
257 Ga0068856_100041270 3300005614 Bacteria 4534
258 Ga0068856_100133330 3300005614 Bacteria 2489
259 Ga0068856_100180059 3300005614 Bacteria 2126
260 Ga0070702_100036376 3300005615 Bacteria 2727
261 Ga0070702_100203431 3300005615 Bacteria 1313
262 Ga0068852_100201612 3300005616 Bacteria 1883
263 Ga0068852_100550704 3300005616 Bacteria 1154
264 Ga0068859_100288496 3300005617 Bacteria 1734
265 Ga0068859_100552439 3300005617 Bacteria 1246
266 Ga0068859_100562313 3300005617 Bacteria 1235
267 Ga0068864_100464394 3300005618 Bacteria 1213
268 Ga0068866_10036130 3300005718 Bacteria 2418
269 Ga0068861_100020453 3300005719 Bacteria 4741
270 Ga0068861_100064428 3300005719 Bacteria 2819
271 Ga0068861_100130604 3300005719 Bacteria 2038
272 Ga0068861_100502033 3300005719 Bacteria 1097
273 Ga0068851_10104527 3300005834 Bacteria 1506
274 Ga0068863_100001135 3300005841 Bacteria 26616
275 Ga0068863_100121658 3300005841 Bacteria 2489
276 Ga0068863_100340702 3300005841 Bacteria 1458
277 Ga0068858_100000034 3300005842 Bacteria 140680
278 Ga0068858_100000519 3300005842 Bacteria 40469
279 Ga0068858_100007523 3300005842 Bacteria 10528
280 Ga0068858_100296702 3300005842 Bacteria 1541
281 Ga0068860_100022386 3300005843 Bacteria 6113
282 Ga0068860_100354788 3300005843 Bacteria 1444
283 Ga0068860_101114104 3300005843 Bacteria 809
284 Ga0081455_10000046 3300005937 Bacteria 127053
285 Ga0081455_10001170 3300005937 Bacteria 32840
286 Ga0081455_10003133 3300005937 Bacteria 19239
287 Ga0081455_10020993 3300005937 Bacteria 6135
288 Ga0081455_10028965 3300005937 Bacteria 5054
289 Ga0081455_10043362 3300005937 Bacteria 3935
290 Ga0081455_10066811 3300005937 Bacteria 3000
291 Ga0081538_10000139 3300005981 Bacteria 75075
292 Ga0081538_10000973 3300005981 Bacteria 30622
293 Ga0081538_10009168 3300005981 Bacteria 8300
294 Ga0081540_1015598 3300005983 Bacteria 4803
295 Ga0081540_1037176 3300005983 Bacteria 2584
296 Ga0081540_1041674 3300005983 Bacteria 2378
297 Ga0081539_10001917 3300005985 Bacteria 32201
298 Ga0081539_10008049 3300005985 Bacteria 9336
299 Ga0081539_10022431 3300005985 Bacteria 4177
300 Ga0081539_10095258 3300005985 Bacteria 1529
301 Ga0070717_10012285 3300006028 Bacteria 6528
302 Ga0070717_10017562 3300006028 Bacteria 5571
303 Ga0070717_10061334 3300006028 Bacteria 3116
304 Ga0070717_10176317 3300006028 Bacteria 1861
305 Ga0070717_10223000 3300006028 Bacteria 1658
306 Ga0075365_10000549 3300006038 Bacteria 14476
307 Ga0075365_10005313 3300006038 Bacteria 6930
308 Ga0075365_10006845 3300006038 Bacteria 6322
309 Ga0075365_10029035 3300006038 Bacteria 3530
310 Ga0075365_10071084 3300006038 Bacteria 2342
311 Ga0075365_10084415 3300006038 Bacteria 2155
312 Ga0075365_10192053 3300006038 Bacteria 1429
313 Ga0075365_10192338 3300006038 Bacteria 1428
314 Ga0075365_10238565 3300006038 Bacteria 1277
315 Ga0075365_10318830 3300006038 Bacteria 1095
316 Ga0075368_10000543 3300006042 Bacteria 11314
317 Ga0075368_10009348 3300006042 Bacteria 3525
318 Ga0075368_10020207 3300006042 Bacteria 2519
319 Ga0075368_10031714 3300006042 Bacteria 2050
320 Ga0075363_100000422 3300006048 Bacteria 13172
321 Ga0075363_100022144 3300006048 Bacteria 3210
322 Ga0075363_100044863 3300006048 Bacteria 2343
323 Ga0075363_100062240 3300006048 Bacteria 2012
324 Ga0075363_100243875 3300006048 Bacteria 1033
325 Ga0075364_10000256 3300006051 Bacteria 25654
326 Ga0075364_10019013 3300006051 Bacteria 4309
327 Ga0075364_10026514 3300006051 Bacteria 3697
328 Ga0075364_10047980 3300006051 Bacteria 2782
329 Ga0075364_10070972 3300006051 Bacteria 2293
330 Ga0075364_10096039 3300006051 Bacteria 1971
331 Ga0075364_10179288 3300006051 Bacteria 1433
332 Ga0075364_10284040 3300006051 Bacteria 1126
333 Ga0075364_10408719 3300006051 Bacteria 926
334 Ga0075364_10472009 3300006051 Bacteria 857
335 Ga0075432_10005086 3300006058 Bacteria 4479
336 Ga0075432_10005816 3300006058 Bacteria 4195
337 Ga0070715_10133746 3300006163 Bacteria 1196
338 Ga0070716_100082426 3300006173 Bacteria 1924
339 Ga0070716_100264959 3300006173 Bacteria 1178
340 Ga0070716_100306739 3300006173 Bacteria 1106
341 Ga0070712_100034487 3300006175 Bacteria 3430
342 Ga0070712_100057592 3300006175 Bacteria 2731
343 Ga0070712_100083212 3300006175 Bacteria 2323
344 Ga0070712_100133375 3300006175 Bacteria 1885
345 Ga0070712_100206835 3300006175 Bacteria 1545
346 Ga0070712_100258812 3300006175 Bacteria 1394
347 Ga0075362_10016208 3300006177 Bacteria 3047
348 Ga0075367_10002757 3300006178 Bacteria 8132
349 Ga0075367_10025818 3300006178 Bacteria 3325
350 Ga0075367_10046090 3300006178 Bacteria 2561
351 Ga0075367_10137917 3300006178 Bacteria 1510
352 Ga0075369_10002615 3300006186 Bacteria 6449
353 Ga0097621_100144312 3300006237 Bacteria 2036
354 Ga0097621_100606968 3300006237 Bacteria 1001
355 Ga0075370_10104117 3300006353 Bacteria 1644
356 Ga0068871_100056669 3300006358 Bacteria 3186
357 Ga0068871_100139371 3300006358 Bacteria 2062
358 Ga0068871_100193665 3300006358 Bacteria 1752
359 Ga0075428_100010069 3300006844 Bacteria 10504
360 Ga0075428_100013993 3300006844 Bacteria 8931
361 Ga0075428_100026841 3300006844 Bacteria 6377
362 Ga0075428_100119832 3300006844 Bacteria 2864
363 Ga0075428_100153114 3300006844 Bacteria 2505
364 Ga0075430_100001887 3300006846 Bacteria 17167
365 Ga0075430_100002175 3300006846 Bacteria 16227
366 Ga0075430_100172431 3300006846 Bacteria 1800
367 Ga0075431_100001708 3300006847 Bacteria 20632
368 Ga0075431_100007675 3300006847 Bacteria 10742
369 Ga0075431_100014473 3300006847 Bacteria 7980
370 Ga0075431_100240025 3300006847 Bacteria 1844
371 Ga0075431_100240740 3300006847 Bacteria 1841
372 Ga0075431_100740499 3300006847 Bacteria 959
373 Ga0075433_10003428 3300006852 Bacteria 12227
374 Ga0075434_100001158 3300006871 Bacteria 21807
375 Ga0075434_100001999 3300006871 Bacteria 17701
376 Ga0075434_100176319 3300006871 Bacteria 2157
377 Ga0075434_100449418 3300006871 Bacteria 1310
378 Ga0075434_100800935 3300006871 Bacteria 958
379 Ga0075429_100003236 3300006880 Bacteria 13858
380 Ga0075429_100007203 3300006880 Bacteria 9652
381 Ga0075429_100146451 3300006880 Bacteria 2067
382 Ga0075429_100256222 3300006880 Bacteria 1532
383 Ga0068865_100016895 3300006881 Bacteria 4681
384 Ga0068865_100064220 3300006881 Bacteria 2583
385 Ga0068865_100076413 3300006881 Bacteria 2390
386 Ga0068865_100451573 3300006881 Bacteria 1063
387 Ga0075436_100199227 3300006914 Bacteria 1418
388 Ga0097620_100288472 3300006931 Bacteria 1734
389 Ga0097620_100552515 3300006931 Bacteria 1246
390 Ga0097620_100562312 3300006931 Bacteria 1235
391 Ga0099826_10062312 3300006948 Bacteria 2417
392 Ga0075435_100032705 3300007076 Bacteria 4109
393 Ga0099794_10021718 3300007265 Bacteria 2919
394 Ga0105251_10045565 3300009011 Bacteria 2114
395 Ga0105251_10103556 3300009011 Bacteria 1300
396 Ga0105251_10188747 3300009011 Bacteria 928
397 Ga0105244_10230766 3300009036 Bacteria 866
398 Ga0105240_10035367 3300009093 Bacteria 6439
399 Ga0105240_10047673 3300009093 Bacteria 5420
400 Ga0105240_10110085 3300009093 Bacteria 3334
401 Ga0105240_10179399 3300009093 Bacteria 2501
402 Ga0111539_10010664 3300009094 Bacteria 11573
403 Ga0111539_10015651 3300009094 Bacteria 9428
404 Ga0111539_10058003 3300009094 Bacteria 4595
405 Ga0111539_10065104 3300009094 Bacteria 4309
406 Ga0111539_10069508 3300009094 Bacteria 4158
407 Ga0111539_10415922 3300009094 Bacteria 1566
408 Ga0111539_10986491 3300009094 Bacteria 979
409 Ga0111539_11268427 3300009094 Bacteria 855
410 Ga0105245_10028995 3300009098 Bacteria 4887
411 Ga0105245_10034861 3300009098 Bacteria 4465
412 Ga0105245_10083076 3300009098 Bacteria 2931
413 Ga0105245_10101197 3300009098 Bacteria 2667
414 Ga0105245_10115302 3300009098 Bacteria 2503
415 Ga0105245_10139973 3300009098 Bacteria 2278
416 Ga0105245_10158346 3300009098 Bacteria 2147
417 Ga0105245_10203358 3300009098 Bacteria 1903
418 Ga0105245_10362379 3300009098 Bacteria 1439
419 Ga0105245_10476814 3300009098 Bacteria 1260
420 Ga0105245_10705382 3300009098 Bacteria 1042
421 Ga0105245_10790336 3300009098 Bacteria 987
422 Ga0105247_10000075 3300009101 Bacteria 112448
423 Ga0105247_10002944 3300009101 Bacteria 11314
424 Ga0105247_10227418 3300009101 Bacteria 1265
425 Ga0114129_10005450 3300009147 Bacteria 17980
426 Ga0114129_10010215 3300009147 Bacteria 13386
427 Ga0114129_10057998 3300009147 Bacteria 5417
428 Ga0114129_10189664 3300009147 Bacteria 2792
429 Ga0105243_10004875 3300009148 Bacteria 10531
430 Ga0105243_10006484 3300009148 Bacteria 9050
431 Ga0105243_10055430 3300009148 Bacteria 3150
432 Ga0105243_10104437 3300009148 Bacteria 2359
433 Ga0105243_10221961 3300009148 Bacteria 1671
434 Ga0105243_10302664 3300009148 Bacteria 1450
435 Ga0105243_10324459 3300009148 Bacteria 1404
436 Ga0105243_10378643 3300009148 Bacteria 1308
437 Ga0105243_10422742 3300009148 Bacteria 1243
438 Ga0105243_10524482 3300009148 Bacteria 1127
439 Ga0105243_10636697 3300009148 Bacteria 1032
440 Ga0105243_10759267 3300009148 Bacteria 951
441 Ga0105243_10938025 3300009148 Bacteria 864
442 Ga0105241_10010098 3300009174 Bacteria 6932
443 Ga0105241_10495298 3300009174 Bacteria 1089
444 Ga0105242_10006982 3300009176 Bacteria 8716
445 Ga0105242_10009725 3300009176 Bacteria 7368
446 Ga0105242_10045134 3300009176 Bacteria 3570
447 Ga0105242_10146886 3300009176 Bacteria 2052
448 Ga0105242_10255940 3300009176 Bacteria 1579
449 Ga0105242_10300082 3300009176 Bacteria 1466
450 Ga0105242_10731460 3300009176 Bacteria 972
451 Ga0105248_10001951 3300009177 Bacteria 22927
452 Ga0105248_10076949 3300009177 Bacteria 3750
453 Ga0105248_10077050 3300009177 Bacteria 3748
454 Ga0105248_10192671 3300009177 Bacteria 2297
455 Ga0105248_10398480 3300009177 Bacteria 1550
456 Ga0105237_10042732 3300009545 Bacteria 4570
457 Ga0105237_10048564 3300009545 Bacteria 4266
458 Ga0105237_10052524 3300009545 Bacteria 4091
459 Ga0105237_10074187 3300009545 Bacteria 3394
460 Ga0105238_10000028 3300009551 Bacteria 188361
461 Ga0105238_10033337 3300009551 Bacteria 5243
462 Ga0105238_10064439 3300009551 Bacteria 3665
463 Ga0105238_10410411 3300009551 Bacteria 1348
464 Ga0105238_10507134 3300009551 Bacteria 1208
465 Ga0105238_10778853 3300009551 Bacteria 971
466 Ga0105238_10968610 3300009551 Bacteria 871
467 Ga0105249_10042938 3300009553 Bacteria 4112
468 Ga0105249_10064988 3300009553 Bacteria 3355
469 Ga0105249_10134510 3300009553 Bacteria 2364
470 Ga0105249_10147162 3300009553 Bacteria 2264
471 Ga0105249_10160930 3300009553 Bacteria 2169
472 Ga0105249_10393663 3300009553 Bacteria 1414
473 Ga0099796_10050610 3300010159 Bacteria 1441
474 Ga0105239_10009367 3300010375 Bacteria 11051
475 Ga0105239_10023467 3300010375 Bacteria 6794
476 Ga0105239_10026377 3300010375 Bacteria 6395
477 Ga0105239_10071776 3300010375 Bacteria 3804
478 Ga0105239_10147230 3300010375 Bacteria 2627
479 Ga0105239_10161730 3300010375 Bacteria 2501
480 Ga0105239_10331665 3300010375 Bacteria 1716
481 Ga0105239_10491199 3300010375 Bacteria 1395
482 Ga0105239_10635767 3300010375 Bacteria 1218
483 Ga0105246_10009675 3300011119 Bacteria 5942
484 Ga0105246_10082295 3300011119 Bacteria 2297
485 Ga0105246_10266064 3300011119 Bacteria 1368
486 Ga0105246_10322005 3300011119 Bacteria 1257
487 Ga0105246_10439333 3300011119 Bacteria 1094
488 Ga0105246_10743539 3300011119 Bacteria 864
489 Ga0157373_10557791 3300013100 Bacteria 831
490 Ga0157371_10522257 3300013102 Bacteria 878
491 Ga0157370_10136742 3300013104 Bacteria 2284
492 Ga0157370_10213844 3300013104 Bacteria 1786
493 Ga0157370_10407425 3300013104 Bacteria 1251
494 Ga0157370_10556568 3300013104 Bacteria 1051
495 Ga0157370_10634195 3300013104 Bacteria 977
496 Ga0157369_10000311 3300013105 Bacteria 65381
497 Ga0157369_10011696 3300013105 Bacteria 9964
498 Ga0157369_10083249 3300013105 Bacteria 3422
499 Ga0157369_10125241 3300013105 Bacteria 2725
500 Ga0157369_10183892 3300013105 Bacteria 2198
501 Ga0157369_10316737 3300013105 Bacteria 1622
502 Ga0157369_10494731 3300013105 Bacteria 1265
503 Ga0157369_10556116 3300013105 Bacteria 1186
504 Ga0157369_11114911 3300013105 Bacteria 806
505 Ga0157374_10058090 3300013296 Bacteria 3616
506 Ga0157374_10116509 3300013296 Bacteria 2574
507 Ga0157374_10622853 3300013296 Bacteria 1090
508 Ga0157374_11146348 3300013296 Bacteria 798
509 Ga0157378_10008086 3300013297 Bacteria 9179
510 Ga0157378_10037874 3300013297 Bacteria 4273
511 Ga0157378_10838568 3300013297 Bacteria 947
512 Ga0163162_10008306 3300013306 Bacteria 10129
513 Ga0163162_10127997 3300013306 Bacteria 2647
514 Ga0163162_10136601 3300013306 Bacteria 2563
515 Ga0163162_10267574 3300013306 Bacteria 1841
516 Ga0163162_10414303 3300013306 Bacteria 1480
517 Ga0163162_10629695 3300013306 Bacteria 1197
518 Ga0157372_10000131 3300013307 Bacteria 82235
519 Ga0157372_10052343 3300013307 Bacteria 4546
520 Ga0157372_10054888 3300013307 Bacteria 4447
521 Ga0157372_10058414 3300013307 Bacteria 4312
522 Ga0157372_10144279 3300013307 Bacteria 2745
523 Ga0157372_10296785 3300013307 Bacteria 1880
524 Ga0157372_10486700 3300013307 Bacteria 1438
525 Ga0157372_10700345 3300013307 Bacteria 1179
526 Ga0157372_10726962 3300013307 Bacteria 1155
527 Ga0157372_11187073 3300013307 Bacteria 882
528 Ga0157375_10041087 3300013308 Bacteria 4463
529 Ga0157375_10053293 3300013308 Bacteria 3980
530 Ga0157375_10103381 3300013308 Bacteria 2936
531 Ga0157375_10107704 3300013308 Bacteria 2880
532 Ga0157375_10200983 3300013308 Bacteria 2149
533 Ga0157375_10250234 3300013308 Bacteria 1933
534 Ga0157375_10423958 3300013308 Bacteria 1496
535 Ga0157375_10477746 3300013308 Bacteria 1411
536 Ga0157375_10601108 3300013308 Bacteria 1259
537 Ga0157375_10931066 3300013308 Bacteria 1012
538 Ga0157375_11347361 3300013308 Bacteria 840
539 Ga0163163_10040375 3300014325 Bacteria 4557
540 Ga0163163_10190561 3300014325 Bacteria 2099
541 Ga0163163_10349228 3300014325 Bacteria 1535
542 Ga0163163_10383723 3300014325 Bacteria 1462
543 Ga0163163_10426751 3300014325 Bacteria 1385
544 Ga0163163_10520858 3300014325 Bacteria 1251
545 Ga0163163_10537617 3300014325 Bacteria 1231
546 Ga0163163_10727492 3300014325 Bacteria 1056
547 Ga0163163_10762723 3300014325 Bacteria 1031
548 Ga0163163_10900996 3300014325 Bacteria 948
549 Ga0163163_11378454 3300014325 Bacteria 767
550 Ga0157380_10025616 3300014326 Bacteria 4474
551 Ga0157380_10179481 3300014326 Bacteria 1859
552 Ga0157380_10327589 3300014326 Bacteria 1423
553 Ga0157380_10329291 3300014326 Bacteria 1420
554 Ga0157380_10385713 3300014326 Bacteria 1324
555 Ga0157380_10394097 3300014326 Bacteria 1311
556 Ga0157380_11083223 3300014326 Bacteria 839
557 Ga0182008_10000766 3300014497 Bacteria 22531
558 Ga0157377_10021826 3300014745 Bacteria 3372
559 Ga0157377_10075460 3300014745 Bacteria 1958
560 Ga0157377_10101330 3300014745 Bacteria 1716
561 Ga0157377_10112907 3300014745 Bacteria 1636
562 Ga0157377_10369534 3300014745 Bacteria 968
563 Ga0157377_10461502 3300014745 Bacteria 879
564 Ga0157379_10000407 3300014968 Bacteria 34932
565 Ga0157379_10014251 3300014968 Bacteria 6973
566 Ga0157379_10018606 3300014968 Bacteria 6125
567 Ga0157379_10070968 3300014968 Bacteria 3117
568 Ga0157379_10270050 3300014968 Bacteria 1546
569 Ga0157376_10152167 3300014969 Bacteria 2087
570 Ga0157376_10452160 3300014969 Bacteria 1253
571 Ga0157376_10606213 3300014969 Bacteria 1090
572 Ga0182006_1022682 3300015261 Bacteria 2607
573 Ga0182007_10001033 3300015262 Bacteria 15217
574 Ga0183367_1008 3300015688 Bacteria 490626
575 Ga0163161_10036971 3300017792 Bacteria 3499
576 Ga0163161_10155650 3300017792 Bacteria 1740
577 Ga0163161_10206975 3300017792 Bacteria 1514
578 Ga0197907_10099213 3300020069 Bacteria 1104
579 Ga0197907_10149748 3300020069 Bacteria 2648
580 Ga0197907_10258559 3300020069 Bacteria 1288
581 Ga0197907_10667558 3300020069 Bacteria 1305
582 Ga0197907_11019075 3300020069 Bacteria 1774
583 Ga0206356_10808405 3300020070 Bacteria 3407
584 Ga0206356_11042554 3300020070 Bacteria 1446
585 Ga0206349_1497713 3300020075 Bacteria 1640
586 Ga0206355_1319644 3300020076 Bacteria 2203
587 Ga0206351_10742812 3300020077 Bacteria 1481
588 Ga0206352_10167612 3300020078 Bacteria 1291
589 Ga0206350_10857344 3300020080 Bacteria 975
590 Ga0206350_11200495 3300020080 Bacteria 1643
591 Ga0206354_10004643 3300020081 Bacteria 5043
592 Ga0206354_10249832 3300020081 Bacteria 3870
593 Ga0206354_10491255 3300020081 Bacteria 858
594 Ga0206353_10114684 3300020082 Bacteria 4009
595 Ga0206353_10316218 3300020082 Bacteria 1081
596 Ga0206353_10713643 3300020082 Bacteria 8615
597 Ga0206353_10801422 3300020082 Bacteria 7452
598 Ga0206353_10848721 3300020082 Bacteria 2065
599 Ga0206353_11794140 3300020082 Bacteria 8978
600 Ga0206353_11939773 3300020082 Bacteria 941
601 Ga0213874_10003186 3300021377 Bacteria 3615
602 Ga0213875_10000209 3300021388 Bacteria 59579
603 Ga0213875_10041934 3300021388 Bacteria 2152
604 Ga0213875_10097948 3300021388 Bacteria 1368
605 Ga0213875_10100186 3300021388 Bacteria 1352
606 Ga0224712_10030602 3300022467 Bacteria 1944
607 Ga0224712_10034033 3300022467 Bacteria 1871
608 Ga0224712_10061184 3300022467 Bacteria 1501
609 Ga0224712_10071077 3300022467 Bacteria 1413
610 Ga0224712_10099392 3300022467 Bacteria 1231
611 Ga0224712_10099674 3300022467 Bacteria 1230
612 Ga0224712_10138845 3300022467 Bacteria 1068
613 Ga0256743_122685 3300023436 Bacteria 1033
614 Ga0224572_1000445 3300024225 Bacteria 4832
615 Ga0224572_1003147 3300024225 Bacteria 2759
616 Ga0209566_100283 3300025225 Bacteria 46914
617 Ga0209674_100001 3300025226 Bacteria 4013750
618 Ga0209672_100011 3300025228 Bacteria 856297
619 Ga0209147_100592 3300025229 Bacteria 20025
620 Ga0209563_100001 3300025230 Bacteria 4013775
621 Ga0209563_101620 3300025230 Bacteria 5817
622 Ga0207427_100028 3300025231 Bacteria 388949
623 Ga0209437_100557 3300025233 Bacteria 24763
624 Ga0209258_106621 3300025242 Bacteria 1795
625 Ga0209677_100001 3300025253 Bacteria 4013787
626 Ga0209148_1000023 3300025254 Bacteria 680511
627 Ga0209233_1000001 3300025261 Bacteria 2992747
628 Ga0209455_1000023 3300025272 Bacteria 680449
629 Ga0209455_1003409 3300025272 Bacteria 5630
630 Ga0209758_1005384 3300025297 Bacteria 9903
631 Ga0207426_1003485 3300025302 Bacteria 8496
632 Ga0209051_1000033 3300025303 Bacteria 380540
633 Ga0207697_10003672 3300025315 Bacteria 7518
634 Ga0207656_10318779 3300025321 Bacteria 772
635 Ga0207653_10000062 3300025885 Bacteria 82254
636 Ga0207692_10046634 3300025898 Bacteria 2173
637 Ga0207692_10088375 3300025898 Bacteria 1675
638 Ga0207710_10000095 3300025900 Bacteria 116153
639 Ga0207710_10000121 3300025900 Bacteria 94774
640 Ga0207710_10053732 3300025900 Bacteria 1813
641 Ga0207710_10089476 3300025900 Bacteria 1439
642 Ga0207688_10002981 3300025901 Bacteria 9220
643 Ga0207688_10008852 3300025901 Bacteria 5477
644 Ga0207688_10013191 3300025901 Bacteria 4492
645 Ga0207688_10088126 3300025901 Bacteria 1780
646 Ga0207680_10006757 3300025903 Bacteria 5567
647 Ga0207680_10092974 3300025903 Bacteria 1923
648 Ga0207647_10013290 3300025904 Bacteria 5714
649 Ga0207647_10019317 3300025904 Bacteria 4585
650 Ga0207647_10034361 3300025904 Bacteria 3237
651 Ga0207647_10039353 3300025904 Bacteria 2984
652 Ga0207647_10060522 3300025904 Bacteria 2314
653 Ga0207685_10026982 3300025905 Bacteria 2004
654 Ga0207685_10091291 3300025905 Bacteria 1283
655 Ga0207685_10165749 3300025905 Bacteria 1013
656 Ga0207699_10014037 3300025906 Bacteria 4118
657 Ga0207699_10220009 3300025906 Bacteria 1296
658 Ga0207699_10402021 3300025906 Bacteria 976
659 Ga0207645_10005011 3300025907 Bacteria 9704
660 Ga0207645_10090931 3300025907 Bacteria 1963
661 Ga0207645_10164913 3300025907 Bacteria 1450
662 Ga0207643_10009362 3300025908 Bacteria 5264
663 Ga0207705_10000914 3300025909 Bacteria 24187
664 Ga0207705_10003492 3300025909 Bacteria 11962
665 Ga0207705_10015364 3300025909 Bacteria 5492
666 Ga0207705_10076976 3300025909 Bacteria 2426
667 Ga0207705_10096484 3300025909 Bacteria 2170
668 Ga0207705_10114589 3300025909 Bacteria 1994
669 Ga0207705_10144958 3300025909 Bacteria 1776
670 Ga0207705_10239505 3300025909 Bacteria 1382
671 Ga0207705_10363227 3300025909 Bacteria 1117
672 Ga0207684_10000325 3300025910 Bacteria 67308
673 Ga0207684_10042642 3300025910 Bacteria 3847
674 Ga0207684_10085401 3300025910 Bacteria 2688
675 Ga0207684_10090959 3300025910 Bacteria 2600
676 Ga0207684_10136965 3300025910 Bacteria 2103
677 Ga0207684_10261779 3300025910 Bacteria 1492
678 Ga0207654_10072623 3300025911 Bacteria 2049
679 Ga0207654_10407280 3300025911 Bacteria 947
680 Ga0207707_10000071 3300025912 Bacteria 102604
681 Ga0207707_10000543 3300025912 Bacteria 38393
682 Ga0207707_10006373 3300025912 Bacteria 10299
683 Ga0207707_10204305 3300025912 Bacteria 1722
684 Ga0207707_10703257 3300025912 Bacteria 848
685 Ga0207707_10733460 3300025912 Bacteria 827
686 Ga0207695_10037346 3300025913 Bacteria 5241
687 Ga0207671_10022072 3300025914 Bacteria 4819
688 Ga0207671_10032921 3300025914 Bacteria 3858
689 Ga0207671_10088218 3300025914 Bacteria 2333
690 Ga0207693_10000726 3300025915 Bacteria 29700
691 Ga0207693_10062461 3300025915 Bacteria 2918
692 Ga0207693_10078837 3300025915 Bacteria 2578
693 Ga0207693_10091793 3300025915 Bacteria 2381
694 Ga0207693_10262180 3300025915 Bacteria 1355
695 Ga0207693_10489977 3300025915 Bacteria 960
696 Ga0207663_10083195 3300025916 Bacteria 2102
697 Ga0207663_10103780 3300025916 Bacteria 1915
698 Ga0207663_10481868 3300025916 Bacteria 961
699 Ga0207660_10000123 3300025917 Bacteria 45252
700 Ga0207660_10000671 3300025917 Bacteria 22850
701 Ga0207660_10018789 3300025917 Bacteria 4613
702 Ga0207660_10040609 3300025917 Bacteria 3258
703 Ga0207660_10149363 3300025917 Bacteria 1794
704 Ga0207660_10542049 3300025917 Bacteria 946
705 Ga0207662_10008849 3300025918 Bacteria 5523
706 Ga0207662_10053769 3300025918 Bacteria 2399
707 Ga0207657_10013582 3300025919 Bacteria 7989
708 Ga0207657_10023988 3300025919 Bacteria 5663
709 Ga0207657_10031925 3300025919 Bacteria 4763
710 Ga0207657_10090298 3300025919 Bacteria 2557
711 Ga0207657_10091277 3300025919 Bacteria 2540
712 Ga0207657_10116008 3300025919 Bacteria 2207
713 Ga0207649_10020694 3300025920 Bacteria 3775
714 Ga0207652_10000088 3300025921 Bacteria 99810
715 Ga0207652_10000393 3300025921 Bacteria 45552
716 Ga0207652_10022541 3300025921 Bacteria 5211
717 Ga0207652_10145738 3300025921 Bacteria 2119
718 Ga0207652_10171444 3300025921 Bacteria 1947
719 Ga0207652_10215196 3300025921 Bacteria 1731
720 Ga0207652_10241052 3300025921 Bacteria 1630
721 Ga0207652_10674217 3300025921 Bacteria 924
722 Ga0207646_10012234 3300025922 Bacteria 8255
723 Ga0207646_10018813 3300025922 Bacteria 6434
724 Ga0207646_10046818 3300025922 Bacteria 3880
725 Ga0207646_10055137 3300025922 Bacteria 3555
726 Ga0207646_10058050 3300025922 Bacteria 3457
727 Ga0207646_10062231 3300025922 Bacteria 3332
728 Ga0207646_10097329 3300025922 Bacteria 2636
729 Ga0207646_10105120 3300025922 Bacteria 2532
730 Ga0207646_10109535 3300025922 Bacteria 2478
731 Ga0207646_10130729 3300025922 Bacteria 2259
732 Ga0207646_10142801 3300025922 Bacteria 2157
733 Ga0207681_10092365 3300025923 Bacteria 2164
734 Ga0207694_10000008 3300025924 Bacteria 484902
735 Ga0207694_10079935 3300025924 Bacteria 2565
736 Ga0207694_10228059 3300025924 Bacteria 1521
737 Ga0207694_10479844 3300025924 Bacteria 1040
738 Ga0207650_10313778 3300025925 Bacteria 1283
739 Ga0207659_10007761 3300025926 Bacteria 6625
740 Ga0207687_10000352 3300025927 Bacteria 30585
741 Ga0207687_10010493 3300025927 Bacteria 6051
742 Ga0207687_10013718 3300025927 Bacteria 5290
743 Ga0207687_10061098 3300025927 Bacteria 2660
744 Ga0207687_10109062 3300025927 Bacteria 2050
745 Ga0207687_10116893 3300025927 Bacteria 1989
746 Ga0207687_10268492 3300025927 Bacteria 1363
747 Ga0207687_10290048 3300025927 Bacteria 1315
748 Ga0207687_10407566 3300025927 Bacteria 1119
749 Ga0207687_10662844 3300025927 Bacteria 883
750 Ga0207700_10010987 3300025928 Bacteria 5751
751 Ga0207700_10047959 3300025928 Bacteria 3169
752 Ga0207700_10182155 3300025928 Bacteria 1760
753 Ga0207700_10312688 3300025928 Bacteria 1359
754 Ga0207664_10000082 3300025929 Bacteria 95257
755 Ga0207664_10002032 3300025929 Bacteria 13325
756 Ga0207664_10015138 3300025929 Bacteria 5588
757 Ga0207664_10084011 3300025929 Bacteria 2596
758 Ga0207664_10116579 3300025929 Bacteria 2229
759 Ga0207664_10335875 3300025929 Bacteria 1335
760 Ga0207664_10480473 3300025929 Bacteria 1111
761 Ga0207664_10491050 3300025929 Bacteria 1099
762 Ga0207644_10055420 3300025931 Bacteria 2857
763 Ga0207644_10096167 3300025931 Bacteria 2216
764 Ga0207690_10000172 3300025932 Bacteria 50070
765 Ga0207690_10004690 3300025932 Bacteria 8074
766 Ga0207690_10016798 3300025932 Bacteria 4460
767 Ga0207690_10140158 3300025932 Bacteria 1781
768 Ga0207690_10214249 3300025932 Bacteria 1470
769 Ga0207690_10257766 3300025932 Bacteria 1350
770 Ga0207690_10291689 3300025932 Bacteria 1273
771 Ga0207690_10343417 3300025932 Bacteria 1179
772 Ga0207690_10384910 3300025932 Bacteria 1115
773 Ga0207690_10405701 3300025932 Bacteria 1087
774 Ga0207690_10776404 3300025932 Bacteria 791
775 Ga0207706_10000006 3300025933 Bacteria 216994
776 Ga0207706_10007345 3300025933 Bacteria 10187
777 Ga0207706_10037660 3300025933 Bacteria 4293
778 Ga0207706_10049539 3300025933 Bacteria 3712
779 Ga0207706_10051105 3300025933 Bacteria 3651
780 Ga0207686_10011415 3300025934 Bacteria 4864
781 Ga0207686_10023251 3300025934 Bacteria 3577
782 Ga0207686_10264048 3300025934 Bacteria 1263
783 Ga0207709_10013215 3300025935 Bacteria 4554
784 Ga0207709_10031345 3300025935 Bacteria 3104
785 Ga0207709_10055497 3300025935 Bacteria 2447
786 Ga0207709_10348788 3300025935 Bacteria 1117
787 Ga0207709_10350666 3300025935 Bacteria 1114
788 Ga0207709_10428940 3300025935 Bacteria 1017
789 Ga0207670_10209393 3300025936 Bacteria 1486
790 Ga0207669_10076561 3300025937 Bacteria 2124
791 Ga0207669_10080357 3300025937 Bacteria 2085
792 Ga0207669_10093008 3300025937 Bacteria 1969
793 Ga0207669_10112966 3300025937 Bacteria 1825
794 Ga0207669_10155758 3300025937 Bacteria 1607
795 Ga0207669_10245242 3300025937 Bacteria 1330
796 Ga0207669_10393912 3300025937 Bacteria 1083
797 Ga0207704_10009312 3300025938 Bacteria 4731
798 Ga0207704_10105545 3300025938 Bacteria 1890
799 Ga0207704_10126196 3300025938 Bacteria 1762
800 Ga0207665_10014299 3300025939 Bacteria 5225
801 Ga0207665_10033009 3300025939 Bacteria 3429
802 Ga0207665_10077349 3300025939 Bacteria 2284
803 Ga0207665_10296498 3300025939 Bacteria 1207
804 Ga0207691_10171115 3300025940 Bacteria 1902
805 Ga0207691_10337497 3300025940 Bacteria 1290
806 Ga0207691_10487057 3300025940 Bacteria 1048
807 Ga0207691_10515959 3300025940 Bacteria 1014
808 Ga0207711_10003892 3300025941 Bacteria 12846
809 Ga0207689_10103809 3300025942 Bacteria 2335
810 Ga0207661_10011173 3300025944 Bacteria 6495
811 Ga0207661_10016468 3300025944 Bacteria 5454
812 Ga0207661_10133254 3300025944 Bacteria 2131
813 Ga0207661_10247501 3300025944 Bacteria 1583
814 Ga0207661_10273404 3300025944 Bacteria 1508
815 Ga0207661_10719008 3300025944 Bacteria 919
816 Ga0207679_10001914 3300025945 Bacteria 12916
817 Ga0207679_10016001 3300025945 Bacteria 4972
818 Ga0207679_10065139 3300025945 Bacteria 2726
819 Ga0207679_10123442 3300025945 Bacteria 2065
820 Ga0207679_10213495 3300025945 Bacteria 1620
821 Ga0207679_10458171 3300025945 Bacteria 1132
822 Ga0207667_10013652 3300025949 Bacteria 9284
823 Ga0207667_10040466 3300025949 Bacteria 4963
824 Ga0207667_10050841 3300025949 Bacteria 4372
825 Ga0207667_10102152 3300025949 Bacteria 2958
826 Ga0207667_10223386 3300025949 Bacteria 1930
827 Ga0207667_10695643 3300025949 Bacteria 1019
828 Ga0207667_10822740 3300025949 Bacteria 924
829 Ga0207651_10168974 3300025960 Bacteria 1723
830 Ga0207651_10187302 3300025960 Bacteria 1648
831 Ga0207651_10393210 3300025960 Bacteria 1178
832 Ga0207712_10068943 3300025961 Bacteria 2536
833 Ga0207712_10990569 3300025961 Bacteria 745
834 Ga0207668_10182609 3300025972 Bacteria 1656
835 Ga0207668_10465694 3300025972 Bacteria 1081
836 Ga0207640_10425287 3300025981 Bacteria 1088
837 Ga0207658_10002007 3300025986 Bacteria 15172
838 Ga0207658_10028306 3300025986 Bacteria 3946
839 Ga0207658_10125979 3300025986 Bacteria 2050
840 Ga0207658_10173560 3300025986 Bacteria 1778
841 Ga0207658_10178010 3300025986 Bacteria 1758
842 Ga0207658_10215944 3300025986 Bacteria 1610
843 Ga0207658_10782797 3300025986 Bacteria 865
844 Ga0207677_10000760 3300026023 Bacteria 18586
845 Ga0207677_10006413 3300026023 Bacteria 6452
846 Ga0207677_10008340 3300026023 Bacteria 5782
847 Ga0207677_10027898 3300026023 Bacteria 3564
848 Ga0207677_10236352 3300026023 Bacteria 1475
849 Ga0207677_10394584 3300026023 Bacteria 1172
850 Ga0207677_10596916 3300026023 Bacteria 968
851 Ga0207703_10000057 3300026035 Bacteria 140694
852 Ga0207703_10000813 3300026035 Bacteria 30797
853 Ga0207703_10007359 3300026035 Bacteria 8747
854 Ga0207703_10026844 3300026035 Bacteria 4535
855 Ga0207703_10035199 3300026035 Bacteria 3979
856 Ga0207703_10044857 3300026035 Bacteria 3554
857 Ga0207703_10387666 3300026035 Bacteria 1294
858 Ga0207639_10026200 3300026041 Bacteria 4236
859 Ga0207639_10123165 3300026041 Bacteria 2134
860 Ga0207639_10125280 3300026041 Bacteria 2118
861 Ga0207639_10817469 3300026041 Bacteria 869
862 Ga0207678_10006757 3300026067 Bacteria 10173
863 Ga0207678_10018447 3300026067 Bacteria 6127
864 Ga0207678_10242872 3300026067 Bacteria 1542
865 Ga0207708_10002986 3300026075 Bacteria 12459
866 Ga0207708_10003588 3300026075 Bacteria 11446
867 Ga0207708_10011953 3300026075 Bacteria 6467
868 Ga0207708_10053986 3300026075 Bacteria 3062
869 Ga0207708_10086897 3300026075 Bacteria 2407
870 Ga0207708_10203714 3300026075 Bacteria 1579
871 Ga0207702_10070763 3300026078 Bacteria 3001
872 Ga0207702_10114094 3300026078 Bacteria 2407
873 Ga0207702_10115399 3300026078 Bacteria 2395
874 Ga0207702_10291509 3300026078 Bacteria 1546
875 Ga0207702_10735379 3300026078 Bacteria 973
876 Ga0207702_10985794 3300026078 Bacteria 836
877 Ga0207641_10002103 3300026088 Bacteria 18819
878 Ga0207641_10447189 3300026088 Bacteria 1248
879 Ga0207648_10008174 3300026089 Bacteria 10171
880 Ga0207648_10029534 3300026089 Bacteria 4861
881 Ga0207648_10053691 3300026089 Bacteria 3522
882 Ga0207648_10132827 3300026089 Bacteria 2191
883 Ga0207648_10248675 3300026089 Bacteria 1585
884 Ga0207676_10301412 3300026095 Bacteria 1463
885 Ga0207676_10319932 3300026095 Bacteria 1424
886 Ga0207676_10341728 3300026095 Bacteria 1381
887 Ga0207676_10484444 3300026095 Bacteria 1172
888 Ga0207674_10011054 3300026116 Bacteria 10152
889 Ga0207674_10035176 3300026116 Bacteria 5229
890 Ga0207674_10089127 3300026116 Bacteria 3078
891 Ga0207674_10098657 3300026116 Bacteria 2904
892 Ga0207674_10145176 3300026116 Bacteria 2331
893 Ga0207674_10169316 3300026116 Bacteria 2138
894 Ga0207674_10190003 3300026116 Bacteria 2003
895 Ga0207674_10331414 3300026116 Bacteria 1472
896 Ga0207674_10631673 3300026116 Bacteria 1034
897 Ga0207675_100004551 3300026118 Bacteria 13373
898 Ga0207675_100050827 3300026118 Bacteria 3868
899 Ga0207675_100074293 3300026118 Bacteria 3181
900 Ga0207675_100103383 3300026118 Bacteria 2685
901 Ga0207675_100212224 3300026118 Bacteria 1862
902 Ga0207675_100250576 3300026118 Bacteria 1714
903 Ga0207675_100475005 3300026118 Bacteria 1242
904 Ga0207683_10118039 3300026121 Bacteria 2379
905 Ga0207683_10327725 3300026121 Bacteria 1403
906 Ga0207698_10242197 3300026142 Bacteria 1645
907 Ga0207698_10588650 3300026142 Bacteria 1095
908 Ga0209588_1072720 3300027671 Bacteria 1111
909 Ga0209813_10000699 3300027866 Bacteria 7663
910 Ga0209813_10003496 3300027866 Bacteria 3683
911 Ga0207428_10000832 3300027907 Bacteria 34815
912 Ga0207428_10003736 3300027907 Bacteria 14611
913 Ga0207428_10015943 3300027907 Bacteria 6481
914 Ga0268266_10032319 3300028379 Bacteria 4446
915 Ga0268266_10145437 3300028379 Bacteria 2131
916 Ga0268266_10156808 3300028379 Bacteria 2057
917 Ga0268266_10218007 3300028379 Bacteria 1753
918 Ga0268266_10416341 3300028379 Bacteria 1273
919 Ga0268265_10181560 3300028380 Bacteria 1808
920 Ga0268264_10000226 3300028381 Bacteria 109817
921 Ga0268264_10023727 3300028381 Bacteria 5003
922 Ga0268264_10261350 3300028381 Bacteria 1613
923 Ga0268264_10362342 3300028381 Bacteria 1383
924 Ga0268264_10711516 3300028381 Bacteria 998
925 Ga0265326_10000721 3300028558 Bacteria 12202
926 Ga0265319_1001125 3300028563 Bacteria 16620
927 Ga0265334_10001080 3300028573 Bacteria 13336
928 Ga0265322_10006589 3300028654 Bacteria 3415
929 Ga0265336_10018431 3300028666 Bacteria 2262
930 Ga0307517_10017001 3300028786 Bacteria 9512
931 Ga0307517_10226120 3300028786 Bacteria 1130
932 Ga0307515_10006510 3300028794 Bacteria 23364
933 Ga0307515_10023498 3300028794 Bacteria 10798
934 Ga0307515_10066567 3300028794 Bacteria 4988
935 Ga0307515_10484648 3300028794 Bacteria 848
936 Ga0265338_10000739 3300028800 Bacteria 55715
937 Ga0265338_10001458 3300028800 Bacteria 38337
938 Ga0265338_10004856 3300028800 Bacteria 17923
939 Ga0265324_10001298 3300029957 Bacteria 14671
940 Ga0268256_1019085 3300030500 Bacteria 1885
941 Ga0307511_10000018 3300030521 Bacteria 118259
942 Ga0307511_10000678 3300030521 Bacteria 36277
943 Ga0307511_10050610 3300030521 Bacteria 3343
944 Ga0307511_10090245 3300030521 Bacteria 2082
945 Ga0307511_10092449 3300030521 Bacteria 2040
946 Ga0307512_10008326 3300030522 Bacteria 10129
947 Ga0307512_10011092 3300030522 Bacteria 8553
948 Ga0307512_10012743 3300030522 Bacteria 7920
949 Ga0316177_1011649 3300030731 Bacteria 3853
950 Ga0316176_1055943 3300030732 Bacteria 1491
951 Ga0316176_1079855 3300030732 Bacteria 7800
952 Ga0314311_1038622 3300030733 Bacteria 2361
953 Ga0316178_1059711 3300030735 Bacteria 1128
954 Ga0316178_1062364 3300030735 Bacteria 1077
955 Ga0316182_1156322 3300030745 Bacteria 3913
956 Ga0265332_10002373 3300031238 Bacteria 9598
957 Ga0265320_10004222 3300031240 Bacteria 9445
958 Ga0265325_10001663 3300031241 Bacteria 15441
959 Ga0265340_10002561 3300031247 Bacteria 10329
960 Ga0265339_10021165 3300031249 Bacteria 3789
961 Ga0307513_10000002 3300031456 Bacteria 842612
962 Ga0307513_10006778 3300031456 Bacteria 14939
963 Ga0307513_10059260 3300031456 Bacteria 4064
964 Ga0307513_10066088 3300031456 Bacteria 3802
965 Ga0307513_10173126 3300031456 Bacteria 2033
966 Ga0307509_10143827 3300031507 Bacteria 2314
967 Ga0307509_10536741 3300031507 Bacteria 849
968 Ga0307408_100011471 3300031548 Bacteria 5855
969 Ga0307408_100054155 3300031548 Bacteria 2900
970 Ga0307408_100056459 3300031548 Bacteria 2847
971 Ga0307408_100174612 3300031548 Bacteria 1718
972 Ga0307408_100230590 3300031548 Bacteria 1516
973 Ga0307408_100456507 3300031548 Bacteria 1110
974 Ga0307408_100756585 3300031548 Bacteria 878
975 Ga0265313_10058980 3300031595 Bacteria 1807
976 Ga0307508_10005457 3300031616 Bacteria 12089
977 Ga0307508_10007816 3300031616 Bacteria 9930
978 Ga0307508_10013420 3300031616 Bacteria 7491
979 Ga0307508_10045212 3300031616 Bacteria 3935
980 Ga0307508_10198705 3300031616 Bacteria 1606
981 Ga0307508_10349994 3300031616 Bacteria 1069
982 Ga0307508_10463688 3300031616 Bacteria 860
983 Ga0307514_10005558 3300031649 Bacteria 11187
984 Ga0307514_10074032 3300031649 Bacteria 2544
985 Ga0307514_10099614 3300031649 Bacteria 2090
986 Ga0307514_10121935 3300031649 Bacteria 1816
987 Ga0307514_10193664 3300031649 Bacteria 1290
988 Ga0307514_10261253 3300031649 Bacteria 1013
989 Ga0316575_10008356 3300031665 Bacteria 3768
990 Ga0316579_10015042 3300031691 Bacteria 3354
991 Ga0265314_10012006 3300031711 Bacteria 7103
992 Ga0265342_10001188 3300031712 Bacteria 24738
993 Ga0316576_10003924 3300031727 Bacteria 8821
994 Ga0316576_10215604 3300031727 Bacteria 1444
995 Ga0316576_10286711 3300031727 Bacteria 1232
996 Ga0316578_10063488 3300031728 Bacteria 2178
997 Ga0307516_10019666 3300031730 Bacteria 6989
998 Ga0307516_10108515 3300031730 Bacteria 2582
999 Ga0307516_10261392 3300031730 Bacteria 1421
1000 Ga0307516_10263393 3300031730 Bacteria 1413
1001 Ga0307405_10002768 3300031731 Bacteria 7863
1002 Ga0307405_10024608 3300031731 Bacteria 3442
1003 Ga0307405_10050672 3300031731 Bacteria 2572
1004 Ga0307405_10303988 3300031731 Bacteria 1211
1005 Ga0307405_10335536 3300031731 Bacteria 1160
1006 Ga0307405_10337446 3300031731 Bacteria 1157
1007 Ga0307405_10521030 3300031731 Bacteria 957
1008 Ga0316577_10022010 3300031733 Bacteria 3537
1009 Ga0307413_10021902 3300031824 Bacteria 3431
1010 Ga0307413_10051437 3300031824 Bacteria 2482
1011 Ga0307413_10202266 3300031824 Bacteria 1435
1012 Ga0307413_10269769 3300031824 Bacteria 1273
1013 Ga0307413_10286195 3300031824 Bacteria 1242
1014 Ga0307413_10349790 3300031824 Bacteria 1140
1015 Ga0307413_10420582 3300031824 Bacteria 1052
1016 Ga0307413_10424300 3300031824 Bacteria 1048
1017 Ga0307413_10425479 3300031824 Bacteria 1047
1018 Ga0307413_10689249 3300031824 Bacteria 847
1019 Ga0307518_10266484 3300031838 Bacteria 1073
1020 Ga0307410_10000409 3300031852 Bacteria 16994
1021 Ga0307410_10009061 3300031852 Bacteria 5560
1022 Ga0307410_10019624 3300031852 Bacteria 4116
1023 Ga0307410_10019657 3300031852 Bacteria 4113
1024 Ga0307410_10048365 3300031852 Bacteria 2848
1025 Ga0307410_10085240 3300031852 Bacteria 2229
1026 Ga0307410_10228763 3300031852 Bacteria 1434
1027 Ga0307410_10261210 3300031852 Bacteria 1350
1028 Ga0326468_10009393 3300031889 Bacteria 968
1029 Ga0307406_10000212 3300031901 Bacteria 35056
1030 Ga0307406_10014963 3300031901 Bacteria 4478
1031 Ga0307406_10039669 3300031901 Bacteria 2923
1032 Ga0307406_10195501 3300031901 Bacteria 1484
1033 Ga0307406_10214215 3300031901 Bacteria 1427
1034 Ga0307406_10247882 3300031901 Bacteria 1340
1035 Ga0307406_10517217 3300031901 Bacteria 971
1036 Ga0307406_10925109 3300031901 Bacteria 744
1037 Ga0307407_10000816 3300031903 Bacteria 10335
1038 Ga0307407_10006985 3300031903 Bacteria 5074
1039 Ga0307407_10009183 3300031903 Bacteria 4590
1040 Ga0307407_10010295 3300031903 Bacteria 4403
1041 Ga0307407_10060189 3300031903 Bacteria 2215
1042 Ga0307407_10202173 3300031903 Bacteria 1332
1043 Ga0307407_10267058 3300031903 Bacteria 1179
1044 Ga0307407_10286412 3300031903 Bacteria 1143
1045 Ga0307407_10317313 3300031903 Bacteria 1092
1046 Ga0307407_10403066 3300031903 Bacteria 982
1047 Ga0307407_10695635 3300031903 Bacteria 765
1048 Ga0307412_10009769 3300031911 Bacteria 5508
1049 Ga0307412_10068794 3300031911 Bacteria 2408
1050 Ga0307412_10077149 3300031911 Bacteria 2291
1051 Ga0307412_10100355 3300031911 Bacteria 2046
1052 Ga0307412_10190309 3300031911 Bacteria 1551
1053 Ga0307412_10365758 3300031911 Bacteria 1163
1054 Ga0307409_100000551 3300031995 Bacteria 16263
1055 Ga0307409_100009519 3300031995 Bacteria 5974
1056 Ga0307409_100014234 3300031995 Bacteria 5162
1057 Ga0307409_100015509 3300031995 Bacteria 5004
1058 Ga0307409_100040876 3300031995 Bacteria 3457
1059 Ga0307409_100051496 3300031995 Bacteria 3151
1060 Ga0307409_100056417 3300031995 Bacteria 3037
1061 Ga0307409_100086873 3300031995 Bacteria 2547
1062 Ga0307409_100136903 3300031995 Bacteria 2103
1063 Ga0307409_100205429 3300031995 Bacteria 1766
1064 Ga0307409_100336130 3300031995 Bacteria 1419
1065 Ga0307409_100339694 3300031995 Bacteria 1412
1066 Ga0307409_100346222 3300031995 Bacteria 1400
1067 Ga0307409_100580930 3300031995 Bacteria 1104
1068 Ga0307409_100600947 3300031995 Bacteria 1087
1069 Ga0307409_100684353 3300031995 Bacteria 1023
1070 Ga0307409_100938240 3300031995 Bacteria 881
1071 Ga0307409_100983462 3300031995 Bacteria 861
1072 Ga0307416_100000892 3300032002 Bacteria 15767
1073 Ga0307416_100045773 3300032002 Bacteria 3448
1074 Ga0307416_100059585 3300032002 Bacteria 3103
1075 Ga0307416_100062829 3300032002 Bacteria 3038
1076 Ga0307416_100072300 3300032002 Bacteria 2870
1077 Ga0307416_100091602 3300032002 Bacteria 2612
1078 Ga0307416_100114070 3300032002 Bacteria 2390
1079 Ga0307416_100133123 3300032002 Bacteria 2243
1080 Ga0307416_100174525 3300032002 Bacteria 2006
1081 Ga0307416_100199077 3300032002 Bacteria 1898
1082 Ga0307416_100215641 3300032002 Bacteria 1836
1083 Ga0307416_100251107 3300032002 Bacteria 1721
1084 Ga0307416_100275511 3300032002 Bacteria 1655
1085 Ga0307416_100289985 3300032002 Bacteria 1619
1086 Ga0307416_100355744 3300032002 Bacteria 1484
1087 Ga0307416_100481205 3300032002 Bacteria 1301
1088 Ga0307416_100657451 3300032002 Bacteria 1133
1089 Ga0307416_100702405 3300032002 Bacteria 1100
1090 Ga0307416_100828352 3300032002 Bacteria 1022
1091 Ga0307416_100837487 3300032002 Bacteria 1017
1092 Ga0307416_100859687 3300032002 Bacteria 1005
1093 Ga0307416_100960273 3300032002 Bacteria 957
1094 Ga0307414_10091914 3300032004 Bacteria 2257
1095 Ga0307414_10145540 3300032004 Bacteria 1861
1096 Ga0307414_10154966 3300032004 Bacteria 1812
1097 Ga0307414_10189630 3300032004 Bacteria 1662
1098 Ga0307414_10722264 3300032004 Bacteria 903
1099 Ga0307414_10795035 3300032004 Bacteria 862
1100 Ga0307411_10028347 3300032005 Bacteria 3403
1101 Ga0307411_10068007 3300032005 Bacteria 2400
1102 Ga0307411_10195499 3300032005 Bacteria 1548
1103 Ga0307411_10209133 3300032005 Bacteria 1505
1104 Ga0307411_10524823 3300032005 Bacteria 1006
1105 Ga0307411_10659587 3300032005 Bacteria 907
1106 Ga0307411_10773990 3300032005 Bacteria 843
1107 Ga0307415_100011906 3300032126 Bacteria 5004
1108 Ga0307415_100020019 3300032126 Bacteria 4075
1109 Ga0307415_100022865 3300032126 Bacteria 3868
1110 Ga0307415_100026762 3300032126 Bacteria 3644
1111 Ga0307415_100037109 3300032126 Bacteria 3200
1112 Ga0307415_100096744 3300032126 Bacteria 2153
1113 Ga0307415_100105588 3300032126 Bacteria 2077
1114 Ga0307415_100136764 3300032126 Bacteria 1865
1115 Ga0307415_100146426 3300032126 Bacteria 1811
1116 Ga0307415_100168712 3300032126 Bacteria 1704
1117 Ga0307415_100168905 3300032126 Bacteria 1704
1118 Ga0307415_100296427 3300032126 Bacteria 1337
1119 Ga0307415_100331038 3300032126 Bacteria 1274
1120 Ga0307415_100535361 3300032126 Bacteria 1031
1121 Ga0307415_100962508 3300032126 Bacteria 791
1122 Ga0316583_10005921 3300032133 Bacteria 4396
1123 Ga0316585_10001956 3300032137 Bacteria 5505
1124 Ga0316580_10004754 3300032139 Bacteria 3949
1125 Ga0307507_10030933 3300033179 Bacteria 5631
1126 Ga0307507_10040586 3300033179 Bacteria 4671
1127 Ga0307507_10085604 3300033179 Bacteria 2740
1128 Ga0307510_10014944 3300033180 Bacteria 9182
1129 Ga0373926_0000405 3300035083 Bacteria 11108
1130 Ga0373926_0005280 3300035083 Bacteria 4252
1131 Ga0373929_0005121 3300035085 Bacteria 2357
1132 Ga0373934_0054652 3300035086 Bacteria 1586
1133 Ga0373934_0073037 3300035086 Bacteria 1373
1134 Ga0373944_0000004 3300035089 Bacteria 49340
1135 Ga0373952_0023666 3300035092 Bacteria 1314
1136 Ga0373923_0003863 3300035111 Bacteria 4881
1137 Ga0373923_0242235 3300035111 Bacteria 842
1138 Ga0373936_0002733 3300035113 Bacteria 6572
1139 Ga0373936_0164595 3300035113 Bacteria 967
1140 Ga0373941_0016159 3300035115 Bacteria 2024
1141 Ga0373945_0007123 3300035116 Bacteria 3621
1142 Ga0373945_0031937 3300035116 Bacteria 1863
1143 Ga0373953_0001003 3300035117 Bacteria 7954
1144 Ga0373953_0027543 3300035117 Bacteria 2185
1145 Ga0373954_0036467 3300035118 Bacteria 2283
1146 Ga0373956_0003417 3300035119 Bacteria 6390
1147 Ga0373956_0054340 3300035119 Bacteria 1804
1148 Ga0373956_0066354 3300035119 Bacteria 1641
1149 Ga0373957_0070122 3300035120 Bacteria 1369
1150 Ga0373960_0025358 3300035121 Bacteria 1611
1151 Ga0373943_0001706 3300035170 Bacteria 9951
1152 Ga0373943_0078258 3300035170 Bacteria 1690
1153 Ga0373943_0123468 3300035170 Bacteria 1378
1154 Ga0373946_0000393 3300035171 Bacteria 14223
1155 Ga0373946_0052646 3300035171 Bacteria 1708
1156 Ga0373955_0096063 3300035172 Bacteria 1695
1157 Ga0373961_0025207 3300035241 Bacteria 1615
1158 Ga0373924_0002841 3300035410 Bacteria 5867
1159 Ga0373935_0002409 3300035692 Bacteria 10704
1160 Ga0373935_0028004 3300035692 Bacteria 3482
1161 Ga0373935_0029215 3300035692 Bacteria 3412
1162 Ga0373935_0262498 3300035692 Bacteria 1211
1163 Ga0373927_0000623 3300035695 Bacteria 26873
1164 Ga0373927_0484334 3300035695 Bacteria 817
1165 Ga0373933_0002530 3300035724 Bacteria 10257
1166 Ga0373933_0020887 3300035724 Bacteria 3713
1167 Ga0373933_0032042 3300035724 Bacteria 3053
1168 Ga0373947_0002475 3300035725 Bacteria 11109
1169 Ga0373947_0002807 3300035725 Bacteria 10409
1170 Ga0373947_0030220 3300035725 Bacteria 3183
1171 Ga0373947_0084718 3300035725 Bacteria 1967
1172 Ga0373947_0232202 3300035725 Bacteria 1215
1173 Ga0373937_0002929 3300036401 Bacteria 14272
1174 Ga0373937_0040932 3300036401 Bacteria 4225
1175 Ga0373937_0043592 3300036401 Bacteria 4096
1176 Ga0373937_0205822 3300036401 Bacteria 1850
1177 Ga0373937_0575612 3300036401 Bacteria 1069
1178 Ga0316582_0034093 3300036647 Bacteria 3132
1179 Ga0316584_0009242 3300036712 Bacteria 6830
1180 Ga0373925_0008611 3300037068 Bacteria 7433
1181 Ga0373925_0079341 3300037068 Bacteria 2494
1182 Ga0373925_0085253 3300037068 Bacteria 2408
1183 Ga0373925_0462672 3300037068 Bacteria 1039
1184 Ga0395899_0010951 3300037312 Bacteria 6948
1185 Ga0395899_0047160 3300037312 Bacteria 3208
1186 Ga0395899_0064100 3300037312 Bacteria 2702
1187 Ga0395899_0175576 3300037312 Bacteria 1507
1188 Ga0395900_0001826 3300037418 Bacteria 24309
1189 Ga0395900_0011591 3300037418 Bacteria 9022
1190 Ga0395900_0015079 3300037418 Bacteria 7879
1191 Ga0395900_0021604 3300037418 Bacteria 6579
1192 Ga0395900_0024839 3300037418 Bacteria 6133
1193 Ga0395900_0037600 3300037418 Bacteria 4990
1194 Ga0395900_0051815 3300037418 Bacteria 4226
1195 Ga0395900_0055447 3300037418 Bacteria 4081
1196 Ga0395900_0062055 3300037418 Bacteria 3842
1197 Ga0395900_0141834 3300037418 Bacteria 2460
1198 Ga0395900_0153093 3300037418 Bacteria 2355
1199 Ga0395900_0166620 3300037418 Bacteria 2245
1200 Ga0395900_0181966 3300037418 Bacteria 2135
1201 Ga0395900_0385549 3300037418 Bacteria 1369
1202 Ga0395900_0466159 3300037418 Bacteria 1217
1203 Ga0395900_0540997 3300037418 Bacteria 1110
1204 Ga0395900_0667311 3300037418 Bacteria 975
1205 Ga0395900_0890295 3300037418 Bacteria 814
1206 Ga0395898_0000100 3300037466 Bacteria 226446
1207 Ga0395898_0003889 3300037466 Bacteria 16496
1208 Ga0395898_0017408 3300037466 Bacteria 7342
1209 Ga0395898_0054233 3300037466 Bacteria 3912
1210 Ga0395898_0062000 3300037466 Bacteria 3632
1211 Ga0395898_0067650 3300037466 Bacteria 3458
1212 Ga0395898_0096501 3300037466 Bacteria 2840
1213 Ga0395898_0184004 3300037466 Bacteria 1996
1214 Ga0395898_0204397 3300037466 Bacteria 1885
1215 Ga0395898_0423859 3300037466 Bacteria 1268
1216 Ga0395898_0863442 3300037466 Bacteria 844
1217 Ga0395905_0016703 3300037471 Bacteria 6975
1218 Ga0395905_0020717 3300037471 Bacteria 6226
1219 Ga0395905_0125842 3300037471 Bacteria 2410
1220 Ga0395905_0340895 3300037471 Bacteria 1390
1221 Ga0395905_0403355 3300037471 Bacteria 1262
1222 Ga0316581_0001603 3300037588 Bacteria 5159
1223 Ga0436364_0069665 3300037853 Bacteria 2710
1224 Ga0436364_0136911 3300037853 Bacteria 1347
1225 Ga0436364_0193728 3300037853 Bacteria 39312
1226 Ga0436364_0415392 3300037853 Bacteria 1488
1227 Ga0436364_0630197 3300037853 Bacteria 2649
1228 Ga0436364_0783642 3300037853 Bacteria 30576
1229 Ga0436364_1363958 3300037853 Bacteria 3472
1230 Ga0436364_1380637 3300037853 Bacteria 1777
1231 Ga0395901_0011064 3300038443 Bacteria 9144
1232 Ga0395901_0012052 3300038443 Bacteria 8770
1233 Ga0395901_0019196 3300038443 Bacteria 6989
1234 Ga0395901_0044031 3300038443 Bacteria 4629
1235 Ga0395901_0082185 3300038443 Bacteria 3365
1236 Ga0395901_0086665 3300038443 Bacteria 3274
1237 Ga0395901_0104011 3300038443 Bacteria 2979
1238 Ga0395901_0112412 3300038443 Bacteria 2860
1239 Ga0395901_0144777 3300038443 Bacteria 2498
1240 Ga0395901_0154186 3300038443 Bacteria 2413
1241 Ga0395901_0190352 3300038443 Bacteria 2152
1242 Ga0395901_0239003 3300038443 Bacteria 1895
1243 Ga0395901_0242130 3300038443 Bacteria 1881
1244 Ga0395901_0244171 3300038443 Bacteria 1872
1245 Ga0395901_0337302 3300038443 Bacteria 1558
1246 Ga0436365_0220000 3300039437 Bacteria 2568
1247 Ga0436365_0252441 3300039437 Bacteria 2096
1248 Ga0436360_0074050 3300039438 Bacteria 1034
1249 Ga0436360_0277941 3300039438 Bacteria 1117
1250 Ga0436360_0484994 3300039438 Bacteria 1053
1251 Ga0436363_0668458 3300039450 Bacteria 947
1252 Ga0436363_1341732 3300039450 Bacteria 1546
1253 Ga0436362_0621323 3300039453 Bacteria 1298
1254 Ga0436362_0676178 3300039453 Bacteria 647
1255 Ga0439436_0001318 3300041404 Bacteria 7114
1256 Ga0439436_0021174 3300041404 Bacteria 1934
1257 Ga0439438_031389 3300041405 Bacteria 1412
1258 Ga0439439_0006078 3300041406 Bacteria 2783
1259 Ga0439439_0089780 3300041406 Bacteria 838
1260 Ga0439447_016397 3300041407 Bacteria 2035
1261 Ga0439466_0119386 3300041411 Bacteria 815
1262 Ga0451791_0823639 3300041451 Bacteria 882
1263 Ga0451791_1778226 3300041451 Bacteria 1579
1264 Ga0451791_1902291 3300041451 Bacteria 953
1265 Ga0451793_1728370 3300041452 Bacteria 1860
1266 Ga0451797_0569201 3300041453 Bacteria 3552
1267 Ga0451795_0729969 3300041456 Bacteria 883
1268 Ga0451802_1141136 3300041460 Bacteria 1575
1269 Ga0451833_0813952 3300041491 Bacteria 4901
1270 Ga0451837_0303883 3300041494 Bacteria 2394
1271 Ga0451837_1483773 3300041494 Bacteria 2110
1272 Ga0451843_1651104 3300041509 Bacteria 951
1273 Ga0451853_0720412 3300041512 Bacteria 1336
1274 Ga0439431_0026641 3300041997 Bacteria 1417
1275 Ga0439433_0000990 3300041999 Bacteria 5731
1276 Ga0439442_021142 3300042002 Bacteria 1349
1277 Ga0439442_028289 3300042002 Bacteria 1169
1278 Ga0439445_0050745 3300042004 Bacteria 1119
1279 Ga0439448_0006033 3300042005 Bacteria 3471
1280 Ga0439448_0086018 3300042005 Bacteria 1059
1281 Ga0439432_040017 3300042006 Bacteria 1488
1282 Ga0439449_0000357 3300042007 Bacteria 16784
1283 Ga0439449_0021498 3300042007 Bacteria 2414
1284 Ga0439450_034222 3300042008 Bacteria 1155
1285 Ga0439455_0003808 3300042012 Bacteria 2924
1286 Ga0439457_001232 3300042014 Bacteria 7696
1287 Ga0439457_002347 3300042014 Bacteria 5436
1288 Ga0439457_034608 3300042014 Bacteria 1122
1289 Ga0450890_002060 3300042127 Bacteria 2820
1290 Ga0450894_000050 3300042131 Bacteria 17933
1291 Ga0450896_002013 3300042133 Bacteria 2586
1292 Ga0450898_011304 3300042134 Bacteria 1459
1293 Ga0450899_000125 3300042135 Bacteria 7131
1294 Ga0450903_000183 3300042138 Bacteria 13862
1295 Ga0450906_001478 3300042145 Bacteria 5125
1296 Ga0450907_009034 3300042146 Bacteria 1653
1297 Ga0450910_011056 3300042147 Bacteria 1292
1298 Ga0439446_0061328 3300042156 Bacteria 1137
1299 Ga0439458_0035562 3300042157 Bacteria 1198
1300 Ga0439434_0014216 3300042435 Bacteria 2368
1301 Ga0439434_0015862 3300042435 Bacteria 2247
1302 Ga0439464_0033866 3300042439 Bacteria 1439
1303 Ga0439460_0077740 3300042461 Bacteria 1037
1304 Ga0466969_0001880 3300044656 Bacteria 11227
1305 Ga0466969_0029779 3300044656 Bacteria 2785
1306 Ga0466969_0067642 3300044656 Bacteria 1723
1307 Ga0466969_0117258 3300044656 Bacteria 1242
1308 Ga0466969_0274902 3300044656 Bacteria 763
1309 Ga0466972_0004069 3300044658 Bacteria 7299
1310 Ga0466972_0017229 3300044658 Bacteria 3614
1311 Ga0466972_0020285 3300044658 Bacteria 3321
1312 Ga0466972_0041190 3300044658 Bacteria 2249
1313 Ga0466972_0076559 3300044658 Bacteria 1593
1314 Ga0466972_0078872 3300044658 Bacteria 1568
1315 Ga0466972_0110662 3300044658 Bacteria 1298
1316 Ga0466972_0154251 3300044658 Bacteria 1079
1317 Ga0466972_0165278 3300044658 Bacteria 1039
1318 Ga0466972_0173944 3300044658 Bacteria 1010
1319 Ga0466972_0188477 3300044658 Bacteria 967
1320 Ga0466965_0000004 3300044683 Bacteria 229348
1321 Ga0466965_0004472 3300044683 Bacteria 6221
1322 Ga0466965_0020080 3300044683 Bacteria 3209
1323 Ga0466965_0023598 3300044683 Bacteria 2970
1324 Ga0466965_0024457 3300044683 Bacteria 2922
1325 Ga0466965_0028514 3300044683 Bacteria 2713
1326 Ga0466965_0038082 3300044683 Bacteria 2362
1327 Ga0466965_0040784 3300044683 Bacteria 2286
1328 Ga0466965_0090215 3300044683 Bacteria 1559
1329 Ga0466965_0128344 3300044683 Bacteria 1313
1330 Ga0466965_0139025 3300044683 Bacteria 1263
1331 Ga0466965_0204560 3300044683 Bacteria 1048
1332 Ga0466965_0298675 3300044683 Bacteria 873
1333 Ga0466966_0004948 3300044684 Bacteria 8756
1334 Ga0466966_0005197 3300044684 Bacteria 8549
1335 Ga0466966_0005307 3300044684 Bacteria 8474
1336 Ga0466966_0009642 3300044684 Bacteria 6390
1337 Ga0466966_0029041 3300044684 Bacteria 3600
1338 Ga0466966_0031908 3300044684 Bacteria 3416
1339 Ga0466966_0098959 3300044684 Bacteria 1805
1340 Ga0466966_0142120 3300044684 Bacteria 1466
1341 Ga0466966_0299380 3300044684 Bacteria 967
1342 Ga0466966_0357685 3300044684 Bacteria 877
1343 Ga0466966_0380483 3300044684 Bacteria 848
1344 Ga0466961_0001592 3300044693 Bacteria 14063
1345 Ga0466961_0001710 3300044693 Bacteria 13667
1346 Ga0466961_0004312 3300044693 Bacteria 8904
1347 Ga0466961_0013332 3300044693 Bacteria 5262
1348 Ga0466961_0026313 3300044693 Bacteria 3740
1349 Ga0466961_0029798 3300044693 Bacteria 3506
1350 Ga0466961_0029892 3300044693 Bacteria 3500
1351 Ga0466961_0034974 3300044693 Bacteria 3225
1352 Ga0466961_0039705 3300044693 Bacteria 3017
1353 Ga0466961_0045346 3300044693 Bacteria 2813
1354 Ga0466961_0061784 3300044693 Bacteria 2381
1355 Ga0466961_0069405 3300044693 Bacteria 2237
1356 Ga0466961_0071508 3300044693 Bacteria 2201
1357 Ga0466961_0078840 3300044693 Bacteria 2086
1358 Ga0466961_0079131 3300044693 Bacteria 2082
1359 Ga0466961_0113302 3300044693 Bacteria 1705
1360 Ga0466961_0135438 3300044693 Bacteria 1543
1361 Ga0466961_0140092 3300044693 Bacteria 1514
1362 Ga0466961_0172219 3300044693 Bacteria 1346
1363 Ga0466961_0210460 3300044693 Bacteria 1200
1364 Ga0466961_0271287 3300044693 Bacteria 1039
1365 Ga0466963_0000277 3300044694 Bacteria 22841
1366 Ga0466963_0000286 3300044694 Bacteria 22703
1367 Ga0466963_0017186 3300044694 Bacteria 4506
1368 Ga0466963_0020095 3300044694 Bacteria 4198
1369 Ga0466963_0072290 3300044694 Bacteria 2324
1370 Ga0466963_0118904 3300044694 Bacteria 1817
1371 Ga0466963_0158761 3300044694 Bacteria 1573
1372 Ga0466963_0217847 3300044694 Bacteria 1336
1373 Ga0466963_0237653 3300044694 Bacteria 1277
1374 Ga0466963_0290582 3300044694 Bacteria 1149
1375 Ga0466963_0319671 3300044694 Bacteria 1092
1376 Ga0466963_0422200 3300044694 Bacteria 940
1377 Ga0466964_0027207 3300044706 Bacteria 2244
1378 Ga0466964_0030254 3300044706 Bacteria 2141
1379 Ga0466964_0067308 3300044706 Bacteria 1505
1380 Ga0466964_0107692 3300044706 Bacteria 1238
1381 Ga0466964_0133652 3300044706 Bacteria 1133
1382 Ga0466971_0000708 3300044719 Bacteria 13328
1383 Ga0466971_0006647 3300044719 Bacteria 5029
1384 Ga0466971_0019226 3300044719 Bacteria 3032
1385 Ga0466971_0029095 3300044719 Bacteria 2470
1386 Ga0466971_0037071 3300044719 Bacteria 2186
1387 Ga0466971_0045805 3300044719 Bacteria 1965
1388 Ga0466971_0073460 3300044719 Bacteria 1554
1389 Ga0466971_0080023 3300044719 Bacteria 1489
1390 Ga0466971_0118288 3300044719 Bacteria 1225
1391 Ga0466971_0119875 3300044719 Bacteria 1217
1392 Ga0466968_0114567 3300044735 Bacteria 1215
1393 Ga0466968_0125710 3300044735 Bacteria 1163
1394 Ga0466968_0177813 3300044735 Bacteria 988
1395 Ga0466968_0219189 3300044735 Bacteria 896
1396 Ga0466970_0001383 3300044765 Bacteria 11691
1397 Ga0466970_0007134 3300044765 Bacteria 5595
1398 Ga0466970_0007909 3300044765 Bacteria 5340
1399 Ga0466970_0011141 3300044765 Bacteria 4579
1400 Ga0466970_0018052 3300044765 Bacteria 3651
1401 Ga0466970_0022761 3300044765 Bacteria 3269
1402 Ga0466970_0058398 3300044765 Bacteria 2065
1403 Ga0466970_0073046 3300044765 Bacteria 1846
1404 Ga0466970_0079112 3300044765 Bacteria 1775
1405 Ga0466970_0130634 3300044765 Bacteria 1379
1406 Ga0466970_0152786 3300044765 Bacteria 1275
1407 Ga0466970_0164341 3300044765 Bacteria 1228
1408 Ga0466970_0176532 3300044765 Bacteria 1185
1409 Ga0466970_0237288 3300044765 Bacteria 1020
1410 Ga0466970_0247398 3300044765 Bacteria 998
1411 Ga0466970_0321876 3300044765 Bacteria 874
1412 Ga0466970_0409497 3300044765 Bacteria 774
1413 Ga0466957_0008501 3300044842 Bacteria 5841
1414 Ga0466957_0014046 3300044842 Bacteria 4658
1415 Ga0466957_0022246 3300044842 Bacteria 3738
1416 Ga0466957_0024879 3300044842 Bacteria 3546
1417 Ga0466957_0033710 3300044842 Bacteria 3072
1418 Ga0466957_0059452 3300044842 Bacteria 2343
1419 Ga0466957_0139096 3300044842 Bacteria 1563
1420 Ga0466957_0154795 3300044842 Bacteria 1485
1421 Ga0466957_0162843 3300044842 Bacteria 1449
1422 Ga0466957_0216285 3300044842 Bacteria 1264
1423 Ga0466957_0302033 3300044842 Bacteria 1076
1424 Ga0466957_0309691 3300044842 Bacteria 1063
1425 Ga0466957_0421991 3300044842 Bacteria 915
1426 Ga0466957_0522065 3300044842 Bacteria 825
1427 Ga0466960_0001786 3300044901 Bacteria 7900
1428 Ga0466960_0003061 3300044901 Bacteria 6390
1429 Ga0466960_0005711 3300044901 Bacteria 4944
1430 Ga0466960_0009456 3300044901 Bacteria 4018
1431 Ga0466960_0028308 3300044901 Bacteria 2563
1432 Ga0466960_0062528 3300044901 Bacteria 1830
1433 Ga0466960_0067345 3300044901 Bacteria 1773
1434 Ga0466960_0093391 3300044901 Bacteria 1537
1435 Ga0466960_0102246 3300044901 Bacteria 1477
1436 Ga0466960_0104763 3300044901 Bacteria 1461
1437 Ga0466960_0124723 3300044901 Bacteria 1352
1438 Ga0466960_0130840 3300044901 Bacteria 1324
1439 Ga0466960_0132743 3300044901 Bacteria 1316
1440 Ga0466960_0177262 3300044901 Bacteria 1153
1441 Ga0466960_0177301 3300044901 Bacteria 1153
1442 Ga0466960_0178116 3300044901 Bacteria 1151
1443 Ga0466960_0219619 3300044901 Bacteria 1045
1444 Ga0466959_0003667 3300045049 Bacteria 10129
1445 Ga0466959_0005444 3300045049 Bacteria 8717
1446 Ga0466959_0006709 3300045049 Bacteria 8009
1447 Ga0466959_0011643 3300045049 Bacteria 6325
1448 Ga0466959_0013366 3300045049 Bacteria 5952
1449 Ga0466959_0062685 3300045049 Bacteria 2701
1450 Ga0466959_0085010 3300045049 Bacteria 2277
1451 Ga0466959_0130027 3300045049 Bacteria 1784
1452 Ga0466959_0150637 3300045049 Bacteria 1640
1453 Ga0466959_0425978 3300045049 Bacteria 901
1454 Ga0466959_0517407 3300045049 Bacteria 806
1455 Ga0451576_0157108 3300045051 Bacteria 2373
1456 Ga0466958_0002266 3300045836 Bacteria 9592
1457 Ga0466958_0005577 3300045836 Bacteria 6787
1458 Ga0466958_0011198 3300045836 Bacteria 5045
1459 Ga0466958_0031205 3300045836 Bacteria 3167
1460 Ga0466958_0043619 3300045836 Bacteria 2701
1461 Ga0466958_0051117 3300045836 Bacteria 2501
1462 Ga0466958_0056237 3300045836 Bacteria 2389
1463 Ga0466958_0107517 3300045836 Bacteria 1740
1464 Ga0466958_0115540 3300045836 Bacteria 1677
1465 Ga0466958_0117344 3300045836 Bacteria 1664
1466 Ga0466958_0165987 3300045836 Bacteria 1397
1467 Ga0466958_0215023 3300045836 Bacteria 1226
1468 Ga0466958_0256461 3300045836 Bacteria 1119
1469 Ga0466967_0000923 3300045976 Bacteria 15803
1470 Ga0466967_0001237 3300045976 Bacteria 14418
1471 Ga0466967_0006305 3300045976 Bacteria 8372
1472 Ga0466967_0013631 3300045976 Bacteria 6292
1473 Ga0466967_0015581 3300045976 Bacteria 5962
1474 Ga0466967_0016997 3300045976 Bacteria 5756
1475 Ga0466967_0017139 3300045976 Bacteria 5739
1476 Ga0466967_0034531 3300045976 Bacteria 4293
1477 Ga0466967_0040088 3300045976 Bacteria 4030
1478 Ga0466967_0043114 3300045976 Bacteria 3905
1479 Ga0466967_0055056 3300045976 Bacteria 3503
1480 Ga0466967_0091611 3300045976 Bacteria 2763
1481 Ga0466967_0092958 3300045976 Bacteria 2744
1482 Ga0466967_0093559 3300045976 Bacteria 2735
1483 Ga0466967_0094342 3300045976 Bacteria 2725
1484 Ga0466967_0122345 3300045976 Bacteria 2406
1485 Ga0466967_0178561 3300045976 Bacteria 2001
1486 Ga0466967_0188132 3300045976 Bacteria 1950
1487 Ga0466967_0196509 3300045976 Bacteria 1908
1488 Ga0466967_0225378 3300045976 Bacteria 1783
1489 Ga0466967_0228868 3300045976 Bacteria 1769
1490 Ga0466967_0260679 3300045976 Bacteria 1658
1491 Ga0466967_0298486 3300045976 Bacteria 1549
1492 Ga0466967_0313319 3300045976 Bacteria 1512
1493 Ga0466967_0334193 3300045976 Bacteria 1464
1494 Ga0466967_0379227 3300045976 Bacteria 1373
1495 Ga0466967_0400524 3300045976 Bacteria 1335
1496 Ga0466967_0402130 3300045976 Bacteria 1333
1497 Ga0466967_0416963 3300045976 Bacteria 1308
1498 Ga0466967_0478358 3300045976 Bacteria 1220
1499 Ga0466967_0488156 3300045976 Bacteria 1207
1500 Ga0466967_0505481 3300045976 Bacteria 1186
1501 Ga0466967_0734270 3300045976 Bacteria 979
1502 Ga0466967_0815904 3300045976 Bacteria 926
1503 Ga0466967_0874408 3300045976 Bacteria 893
1504 Ga0466967_1062977 3300045976 Bacteria 806
1505 Ga0466967_1182011 3300045976 Bacteria 762
1506 Ga0466967_1289177 3300045976 Bacteria 728
1507 Ga0495617_008533 3300046452 Bacteria 3528
1508 Ga0495627_005071 3300046453 Bacteria 5381
1509 Ga0495592_0007158 3300046454 Bacteria 8356
1510 Ga0495592_0013433 3300046454 Bacteria 6232
1511 Ga0495592_0016759 3300046454 Bacteria 5562
1512 Ga0495592_0128163 3300046454 Bacteria 1777
1513 Ga0495603_0006921 3300046455 Bacteria 6803
1514 Ga0495603_0007997 3300046455 Bacteria 6383
1515 Ga0495603_0010921 3300046455 Bacteria 5509
1516 Ga0495603_0038780 3300046455 Bacteria 2856
1517 Ga0495603_0048196 3300046455 Bacteria 2537
1518 Ga0495603_0187953 3300046455 Bacteria 1194
1519 Ga0495590_0059150 3300046457 Bacteria 1340
1520 Ga0495629_0007038 3300046459 Bacteria 8289
1521 Ga0495629_0031103 3300046459 Bacteria 3780
1522 Ga0495629_0093725 3300046459 Bacteria 2095
1523 Ga0495629_0217815 3300046459 Bacteria 1317
1524 Ga0495629_0254973 3300046459 Bacteria 1206
1525 Ga0495629_0396966 3300046459 Bacteria 937
1526 Ga0495641_0001496 3300046461 Bacteria 19912
1527 Ga0495641_0017374 3300046461 Bacteria 3751
1528 Ga0495641_0025621 3300046461 Bacteria 2893
1529 Ga0495651_0000760 3300046462 Bacteria 24943
1530 Ga0495651_0006709 3300046462 Bacteria 8798
1531 Ga0495651_0027278 3300046462 Bacteria 4449
1532 Ga0495651_0039522 3300046462 Bacteria 3672
1533 Ga0495651_0370626 3300046462 Bacteria 941
1534 Ga0495653_0013501 3300046463 Bacteria 6656
1535 Ga0495653_0037664 3300046463 Bacteria 3797
1536 Ga0495653_0051211 3300046463 Bacteria 3171
1537 Ga0495653_0064240 3300046463 Bacteria 2766
1538 Ga0495653_0244963 3300046463 Bacteria 1192
1539 Ga0495653_0268609 3300046463 Bacteria 1124
1540 Ga0495580_0008729 3300046472 Bacteria 8032
1541 Ga0495582_0000400 3300046473 Bacteria 23636
1542 Ga0495582_0028115 3300046473 Bacteria 3085
1543 Ga0495582_0038206 3300046473 Bacteria 2641
1544 Ga0495582_0044589 3300046473 Bacteria 2442
1545 Ga0495582_0139257 3300046473 Bacteria 1374
1546 Ga0495582_0412981 3300046473 Bacteria 778
1547 Ga0495605_0042925 3300046474 Bacteria 2244
1548 Ga0495639_0005159 3300046475 Bacteria 5612
1549 Ga0495639_0015027 3300046475 Bacteria 3356
1550 Ga0495639_0056117 3300046475 Bacteria 1798
1551 Ga0495662_0000832 3300046476 Bacteria 14975
1552 Ga0495662_0010301 3300046476 Bacteria 4582
1553 Ga0495662_0018319 3300046476 Bacteria 3388
1554 Ga0495662_0021341 3300046476 Bacteria 3131
1555 Ga0495662_0054298 3300046476 Bacteria 1935
1556 Ga0495662_0055037 3300046476 Bacteria 1922
1557 Ga0495662_0058132 3300046476 Bacteria 1868
1558 Ga0495662_0194224 3300046476 Bacteria 1000
1559 Ga0495664_0002592 3300046477 Bacteria 9724
1560 Ga0495664_0004315 3300046477 Bacteria 7767
1561 Ga0495664_0021708 3300046477 Bacteria 3709
1562 Ga0495664_0059218 3300046477 Bacteria 2279
1563 Ga0495664_0089835 3300046477 Bacteria 1847
1564 Ga0495664_0099826 3300046477 Bacteria 1748
1565 Ga0495664_0222807 3300046477 Bacteria 1141
1566 Ga0495664_0257375 3300046477 Bacteria 1055
1567 Ga0495664_0369984 3300046477 Bacteria 862
1568 Ga0495584_0012140 3300046491 Bacteria 4403
1569 Ga0495584_0170396 3300046491 Bacteria 1107
1570 Ga0495585_0006379 3300046492 Bacteria 7326
1571 Ga0495585_0017756 3300046492 Bacteria 4108
1572 Ga0495585_0226902 3300046492 Bacteria 940
1573 Ga0495594_0000230 3300046499 Bacteria 27077
1574 Ga0495594_0004764 3300046499 Bacteria 6987
1575 Ga0495594_0008577 3300046499 Bacteria 5268
1576 Ga0495594_0056933 3300046499 Bacteria 2158
1577 Ga0495594_0173009 3300046499 Bacteria 1228
1578 Ga0495596_0090026 3300046500 Bacteria 1191
1579 Ga0495596_0134955 3300046500 Bacteria 958
1580 Ga0495607_0074113 3300046501 Bacteria 1890
1581 Ga0495607_0140909 3300046501 Bacteria 1244
1582 Ga0495608_0003900 3300046511 Bacteria 10724
1583 Ga0495608_0011720 3300046511 Bacteria 6096
1584 Ga0495608_0028210 3300046511 Bacteria 3815
1585 Ga0495608_0100637 3300046511 Bacteria 1863
1586 Ga0495608_0233212 3300046511 Bacteria 1152
1587 Ga0495610_0010260 3300046512 Bacteria 5837
1588 Ga0495616_0013753 3300046513 Bacteria 4555
1589 Ga0495618_0017214 3300046514 Bacteria 4430
1590 Ga0495618_0027075 3300046514 Bacteria 3569
1591 Ga0495618_0182932 3300046514 Bacteria 1331
1592 Ga0495618_0365946 3300046514 Bacteria 886
1593 Ga0495618_0440207 3300046514 Bacteria 792
1594 Ga0495620_0065291 3300046515 Bacteria 1502
1595 Ga0495620_0167740 3300046515 Bacteria 852
1596 Ga0495628_0002613 3300046516 Bacteria 16167
1597 Ga0495628_0016354 3300046516 Bacteria 6189
1598 Ga0495628_0018202 3300046516 Bacteria 5826
1599 Ga0495628_0027165 3300046516 Bacteria 4659
1600 Ga0495628_0051963 3300046516 Bacteria 3238
1601 Ga0495628_0095321 3300046516 Bacteria 2299
1602 Ga0495628_0228465 3300046516 Bacteria 1395
1603 Ga0495630_0001662 3300046517 Bacteria 15481
1604 Ga0495630_0084769 3300046517 Bacteria 2392
1605 Ga0495631_0011646 3300046518 Bacteria 4318
1606 Ga0495631_0028240 3300046518 Bacteria 2560
1607 Ga0495631_0055953 3300046518 Bacteria 1718
1608 Ga0495632_0109200 3300046519 Bacteria 1300
1609 Ga0495637_0040193 3300046520 Bacteria 2015
1610 Ga0495637_0159355 3300046520 Bacteria 847
1611 Ga0495643_0015313 3300046522 Bacteria 4534
1612 Ga0495643_0135748 3300046522 Bacteria 1231
1613 Ga0495644_0005262 3300046523 Bacteria 5056
1614 Ga0495644_0030072 3300046523 Bacteria 2051
1615 Ga0495663_0041782 3300046525 Bacteria 1396
1616 Ga0495666_0000236 3300046526 Bacteria 23671
1617 Ga0495666_0106787 3300046526 Bacteria 1317
1618 Ga0495666_0164120 3300046526 Bacteria 1029
1619 Ga0495652_0012217 3300046529 Bacteria 7754
1620 Ga0495652_0093455 3300046529 Bacteria 2455
1621 Ga0495652_0128910 3300046529 Bacteria 2005
1622 Ga0495652_0189929 3300046529 Bacteria 1568
1623 Ga0495652_0297996 3300046529 Bacteria 1173
1624 Ga0495652_0312713 3300046529 Bacteria 1137
1625 Ga0495654_0034985 3300046530 Bacteria 2532
1626 Ga0495665_0000161 3300046531 Bacteria 33493
1627 Ga0495665_0010719 3300046531 Bacteria 4965
1628 Ga0495665_0012690 3300046531 Bacteria 4560
1629 Ga0495665_0045467 3300046531 Bacteria 2332
1630 Ga0495665_0309660 3300046531 Bacteria 807
1631 Ga0495640_0001427 3300046533 Bacteria 18833
1632 Ga0495640_0007731 3300046533 Bacteria 8454
1633 Ga0495640_0029415 3300046533 Bacteria 3946
1634 Ga0495640_0052855 3300046533 Bacteria 2787
1635 Ga0495640_0075311 3300046533 Bacteria 2254
1636 Ga0495640_0081857 3300046533 Bacteria 2145
1637 Ga0495640_0084329 3300046533 Bacteria 2107
1638 Ga0495640_0167447 3300046533 Bacteria 1405
1639 Ga0495640_0170038 3300046533 Bacteria 1393
1640 Ga0495640_0289672 3300046533 Bacteria 1018
1641 Ga0495586_0001621 3300046535 Bacteria 12330
1642 Ga0495586_0020048 3300046535 Bacteria 3562
1643 Ga0495586_0051332 3300046535 Bacteria 2232
1644 Ga0495586_0067412 3300046535 Bacteria 1951
1645 Ga0495586_0194464 3300046535 Bacteria 1149
1646 Ga0495587_0001940 3300046536 Bacteria 13771
1647 Ga0495587_0008452 3300046536 Bacteria 6616
1648 Ga0495587_0014864 3300046536 Bacteria 4870
1649 Ga0495587_0019267 3300046536 Bacteria 4225
1650 Ga0495587_0019595 3300046536 Bacteria 4185
1651 Ga0495587_0048449 3300046536 Bacteria 2516
1652 Ga0495587_0065887 3300046536 Bacteria 2114
1653 Ga0495598_0002115 3300046537 Bacteria 4051
1654 Ga0495598_0046572 3300046537 Bacteria 1289
1655 Ga0495609_0009749 3300046538 Bacteria 4632
1656 Ga0495609_0102311 3300046538 Bacteria 1241
1657 Ga0495597_0037912 3300046542 Bacteria 2162
1658 Ga0495645_0008429 3300046543 Bacteria 7201
1659 Ga0495645_0018577 3300046543 Bacteria 4996
1660 Ga0495645_0039114 3300046543 Bacteria 3459
1661 Ga0495645_0084019 3300046543 Bacteria 2280
1662 Ga0495645_0115890 3300046543 Bacteria 1892
1663 Ga0495645_0229133 3300046543 Bacteria 1245
1664 Ga0495622_0012996 3300046557 Bacteria 3863
1665 Ga0495622_0023007 3300046557 Bacteria 2904
1666 Ga0495622_0037882 3300046557 Bacteria 2245
1667 Ga0495633_0022717 3300046558 Bacteria 3116
1668 Ga0495667_0001508 3300046559 Bacteria 15358
1669 Ga0495667_0017421 3300046559 Bacteria 4851
1670 Ga0495667_0022689 3300046559 Bacteria 4228
1671 Ga0495667_0032836 3300046559 Bacteria 3475
1672 Ga0495667_0106537 3300046559 Bacteria 1812
1673 Ga0495667_0107659 3300046559 Bacteria 1801
1674 Ga0495667_0126786 3300046559 Bacteria 1647
1675 Ga0495667_0144959 3300046559 Bacteria 1530
1676 Ga0495667_0231504 3300046559 Bacteria 1178
1677 Ga0495656_0047134 3300046615 Bacteria 1826
1678 Ga0495656_0050206 3300046615 Bacteria 1780
1679 Ga0495656_0190439 3300046615 Bacteria 1013
1680 Ga0495668_0024752 3300046616 Bacteria 3413
1681 Ga0495668_0080654 3300046616 Bacteria 1786
1682 Ga0495668_0113803 3300046616 Bacteria 1480
1683 Ga0495668_0180594 3300046616 Bacteria 1156
1684 Ga0495668_0222718 3300046616 Bacteria 1033
1685 Ga0495634_0001788 3300046642 Bacteria 18569
1686 Ga0495634_0003800 3300046642 Bacteria 11996
1687 Ga0495634_0007310 3300046642 Bacteria 8309
1688 Ga0495634_0041401 3300046642 Bacteria 3128
1689 Ga0495634_0061447 3300046642 Bacteria 2497
1690 Ga0495634_0077728 3300046642 Bacteria 2175
1691 Ga0495634_0365799 3300046642 Bacteria 861
1692 Ga0495611_0021451 3300046648 Bacteria 2789
1693 Ga0495625_0058682 3300046660 Bacteria 2733
1694 Ga0495625_0225636 3300046660 Bacteria 1225
1695 Ga0495625_0317870 3300046660 Bacteria 992
1696 Ga0495635_0006658 3300046663 Bacteria 8070
1697 Ga0495635_0024737 3300046663 Bacteria 4185
1698 Ga0495635_0040171 3300046663 Bacteria 3233
1699 Ga0495635_0051491 3300046663 Bacteria 2836
1700 Ga0495635_0067623 3300046663 Bacteria 2450
1701 Ga0495635_0083811 3300046663 Bacteria 2181
1702 Ga0495635_0091723 3300046663 Bacteria 2077
1703 Ga0495635_0373663 3300046663 Bacteria 949
1704 Ga0495635_0466823 3300046663 Bacteria 833
1705 Ga0495659_0002553 3300046664 Bacteria 5872
1706 Ga0495661_0047093 3300046665 Bacteria 2627
1707 Ga0495661_0173984 3300046665 Bacteria 1146
1708 Ga0495661_0229913 3300046665 Bacteria 957
1709 Ga0495588_0000366 3300046674 Bacteria 27897
1710 Ga0495588_0017633 3300046674 Bacteria 3472
1711 Ga0495588_0042211 3300046674 Bacteria 2331
1712 Ga0495588_0162836 3300046674 Bacteria 1179
1713 Ga0495588_0462246 3300046674 Bacteria 666
1714 Ga0495657_0009523 3300046675 Bacteria 7357
1715 Ga0495657_0012303 3300046675 Bacteria 6359
1716 Ga0495657_0069448 3300046675 Bacteria 2305
1717 Ga0495657_0165646 3300046675 Bacteria 1365
1718 Ga0495657_0243880 3300046675 Bacteria 1083
1719 Ga0495599_0080233 3300046678 Bacteria 2037
1720 Ga0495599_0479018 3300046678 Bacteria 734
1721 Ga0495623_0027453 3300046679 Bacteria 3662
1722 Ga0495623_0073003 3300046679 Bacteria 2133
1723 Ga0495623_0148548 3300046679 Bacteria 1387
1724 Ga0495646_0006736 3300046680 Bacteria 7289
1725 Ga0495646_0008366 3300046680 Bacteria 6577
1726 Ga0495646_0050964 3300046680 Bacteria 2506
1727 Ga0495646_0065740 3300046680 Bacteria 2146
1728 Ga0495647_0004650 3300046681 Bacteria 4473
1729 Ga0495647_0178272 3300046681 Bacteria 923
1730 Ga0495658_0001325 3300046683 Bacteria 12983
1731 Ga0495658_0033497 3300046683 Bacteria 2814
1732 Ga0495658_0068013 3300046683 Bacteria 2061
1733 Ga0495658_0086806 3300046683 Bacteria 1847
1734 Ga0495658_0269673 3300046683 Bacteria 1073
1735 Ga0495669_0035430 3300046684 Bacteria 2203
1736 Ga0495613_0021613 3300046689 Bacteria 4793
1737 Ga0495613_0021657 3300046689 Bacteria 4788
1738 Ga0495613_0105350 3300046689 Bacteria 2035
1739 Ga0495613_0138369 3300046689 Bacteria 1741
1740 Ga0495613_0334814 3300046689 Bacteria 1042
1741 Ga0495613_0370572 3300046689 Bacteria 981
1742 Ga0495613_0524859 3300046689 Bacteria 795
1743 Ga0495624_0004070 3300046690 Bacteria 10761
1744 Ga0495624_0006726 3300046690 Bacteria 8123
1745 Ga0495624_0048210 3300046690 Bacteria 2704
1746 Ga0495624_0098519 3300046690 Bacteria 1800
1747 Ga0495670_0028090 3300046691 Bacteria 2788
1748 Ga0495670_0083935 3300046691 Bacteria 1625
1749 Ga0495670_0120722 3300046691 Bacteria 1361
1750 Ga0495670_0360962 3300046691 Bacteria 782
1751 Ga0495671_0195563 3300046692 Bacteria 981
1752 Ga0495671_0250396 3300046692 Bacteria 855
1753 Ga0495649_0070459 3300046694 Bacteria 1874
1754 Ga0495649_0124576 3300046694 Bacteria 1361
1755 Ga0495600_0025618 3300046809 Bacteria 3801
1756 Ga0495600_0030208 3300046809 Bacteria 3509
1757 Ga0495600_0033647 3300046809 Bacteria 3326
1758 Ga0495600_0041482 3300046809 Bacteria 2999
1759 Ga0495600_0042848 3300046809 Bacteria 2951
1760 Ga0495600_0108880 3300046809 Bacteria 1804
1761 Ga0495600_0111726 3300046809 Bacteria 1779
1762 Ga0495600_0197272 3300046809 Bacteria 1293
1763 Ga0495581_0000415 3300047315 Bacteria 21545
1764 Ga0495581_0006636 3300047315 Bacteria 6704
1765 Ga0495581_0032667 3300047315 Bacteria 3013
1766 Ga0495581_0040327 3300047315 Bacteria 2702
1767 Ga0495581_0097830 3300047315 Bacteria 1704
1768 Ga0495581_0201733 3300047315 Bacteria 1163
1769 Ga0495604_0004135 3300047317 Bacteria 11521
1770 Ga0495604_0016560 3300047317 Bacteria 5894
1771 Ga0495604_0017783 3300047317 Bacteria 5687
1772 Ga0495604_0017969 3300047317 Bacteria 5658
1773 Ga0495604_0018503 3300047317 Bacteria 5579
1774 Ga0495604_0039388 3300047317 Bacteria 3714
1775 Ga0495604_0044193 3300047317 Bacteria 3483
1776 Ga0495604_0064612 3300047317 Bacteria 2788
1777 Ga0495604_0190278 3300047317 Bacteria 1430
1778 Ga0495604_0289200 3300047317 Bacteria 1104
1779 Ga0495604_0340488 3300047317 Bacteria 998
1780 Ga0495636_0000786 3300047318 Bacteria 11685
1781 Ga0495636_0001368 3300047318 Bacteria 9230
1782 Ga0495636_0059905 3300047318 Bacteria 1608
1783 Ga0495674_0006053 3300047319 Bacteria 11611
1784 Ga0495674_0023527 3300047319 Bacteria 5676
1785 Ga0495674_0037814 3300047319 Bacteria 4336
1786 Ga0495674_0045035 3300047319 Bacteria 3919
1787 Ga0495674_0062193 3300047319 Bacteria 3251
1788 Ga0495674_0067598 3300047319 Bacteria 3095
1789 Ga0495674_0101337 3300047319 Bacteria 2449
1790 Ga0495672_0159798 3300047320 Bacteria 1160
1791 Ga0495676_0002298 3300047321 Bacteria 16968
1792 Ga0495676_0004244 3300047321 Bacteria 13082
1793 Ga0495676_0009028 3300047321 Bacteria 9098
1794 Ga0495676_0011597 3300047321 Bacteria 7952
1795 Ga0495676_0017856 3300047321 Bacteria 6262
1796 Ga0495676_0045183 3300047321 Bacteria 3587
1797 Ga0495676_0052106 3300047321 Bacteria 3269
1798 Ga0495676_0070058 3300047321 Bacteria 2704
1799 Ga0495676_0193449 3300047321 Bacteria 1417
1800 Ga0495676_0368142 3300047321 Bacteria 958
1801 Ga0495680_0000932 3300047322 Bacteria 32512
1802 Ga0495680_0005012 3300047322 Bacteria 12530
1803 Ga0495680_0028294 3300047322 Bacteria 4596
1804 Ga0495680_0032572 3300047322 Bacteria 4228
1805 Ga0495680_0034538 3300047322 Bacteria 4081
1806 Ga0495687_002091 3300047443 Bacteria 16779
1807 Ga0495675_0012145 3300047444 Bacteria 5418
1808 Ga0495675_0030703 3300047444 Bacteria 3428
1809 Ga0495675_0055503 3300047444 Bacteria 2512
1810 Ga0495675_0081018 3300047444 Bacteria 2044
1811 Ga0495675_0104950 3300047444 Bacteria 1766
1812 Ga0495675_0128872 3300047444 Bacteria 1573
1813 Ga0495675_0143717 3300047444 Bacteria 1477
1814 Ga0495675_0245855 3300047444 Bacteria 1076
1815 Ga0495675_0421598 3300047444 Bacteria 775
1816 Ga0495677_0009911 3300047445 Bacteria 3507
1817 Ga0495677_0074728 3300047445 Bacteria 1265
1818 Ga0495677_0094856 3300047445 Bacteria 1126
1819 Ga0495685_002069 3300047447 Bacteria 6229
1820 Ga0495685_002284 3300047447 Bacteria 5976
1821 Ga0495685_005707 3300047447 Bacteria 4067
1822 Ga0495685_023998 3300047447 Bacteria 2099
1823 Ga0495681_0002072 3300047470 Bacteria 14566
1824 Ga0495681_0080269 3300047470 Bacteria 1457
1825 Ga0495684_0059782 3300047471 Bacteria 2901
1826 Ga0495684_0081437 3300047471 Bacteria 2456
1827 Ga0495684_0102276 3300047471 Bacteria 2166
1828 Ga0495684_0150460 3300047471 Bacteria 1740
1829 Ga0495686_0020278 3300047472 Bacteria 4433
1830 Ga0495686_0280876 3300047472 Bacteria 925
1831 Ga0495593_0000936 3300047673 Bacteria 17005
1832 Ga0495593_0001467 3300047673 Bacteria 13850
1833 Ga0495593_0007010 3300047673 Bacteria 6607
1834 Ga0495593_0055558 3300047673 Bacteria 2083
1835 Ga0495593_0105879 3300047673 Bacteria 1439
1836 Ga0495602_0017924 3300048088 Bacteria 7085
1837 Ga0495602_0025145 3300048088 Bacteria 5766
1838 Ga0495602_0047928 3300048088 Bacteria 3845
1839 Ga0495602_0063988 3300048088 Bacteria 3183
1840 Ga0495602_0100659 3300048088 Bacteria 2372
1841 Ga0495602_0138692 3300048088 Bacteria 1928
1842 Ga0495602_0315284 3300048088 Bacteria 1140
1843 Ga0495614_0001950 3300048089 Bacteria 9063
1844 Ga0495614_0003188 3300048089 Bacteria 7325
1845 Ga0495614_0020402 3300048089 Bacteria 2866
1846 Ga0495614_0026519 3300048089 Bacteria 2497
1847 Ga0495614_0061508 3300048089 Bacteria 1613
1848 Ga0495626_0029423 3300048091 Bacteria 2658
1849 Ga0495626_0030217 3300048091 Bacteria 2614
1850 Ga0496100_0000029 3300048903 Bacteria 110710
1851 Ga0496100_0018861 3300048903 Bacteria 4103
1852 Ga0496100_0049659 3300048903 Bacteria 2714
1853 Ga0496100_0069523 3300048903 Bacteria 2345
1854 Ga0496100_0099425 3300048903 Bacteria 2002
1855 Ga0496100_0102584 3300048903 Bacteria 1974
1856 Ga0496100_0177671 3300048903 Bacteria 1538
1857 Ga0496100_0233437 3300048903 Bacteria 1354
1858 Ga0496100_0253379 3300048903 Bacteria 1303
1859 Ga0496100_0433176 3300048903 Bacteria 1006
1860 Ga0496100_0664304 3300048903 Bacteria 812
1861 Ga0496101_0000015 3300048904 Bacteria 252368
1862 Ga0496101_0001829 3300048904 Bacteria 12830
1863 Ga0496101_0034711 3300048904 Bacteria 3565
1864 Ga0496101_0040623 3300048904 Bacteria 3313
1865 Ga0496101_0043233 3300048904 Bacteria 3219
1866 Ga0496101_0053360 3300048904 Bacteria 2917
1867 Ga0496101_0112008 3300048904 Bacteria 2055
1868 Ga0496101_0182887 3300048904 Bacteria 1615
1869 Ga0496101_0580864 3300048904 Bacteria 886
1870 Ga0496102_0015209 3300048905 Bacteria 6699
1871 Ga0496102_0016807 3300048905 Bacteria 6399
1872 Ga0496102_0025899 3300048905 Bacteria 5225
1873 Ga0496102_0060511 3300048905 Bacteria 3464
1874 Ga0496102_0075556 3300048905 Bacteria 3098
1875 Ga0496102_0104054 3300048905 Bacteria 2640
1876 Ga0496102_0109462 3300048905 Bacteria 2574
1877 Ga0496102_0119767 3300048905 Bacteria 2458
1878 Ga0496102_0139062 3300048905 Bacteria 2276
1879 Ga0496102_0172837 3300048905 Bacteria 2034
1880 Ga0496102_0176386 3300048905 Bacteria 2012
1881 Ga0496102_0240416 3300048905 Bacteria 1707
1882 Ga0496102_0266914 3300048905 Bacteria 1614
1883 Ga0496102_0392854 3300048905 Bacteria 1305
1884 Ga0496102_0404479 3300048905 Bacteria 1283
1885 Ga0496102_0660170 3300048905 Bacteria 969
1886 Ga0496102_0728782 3300048905 Bacteria 914
1887 Ga0496102_0777033 3300048905 Bacteria 880
1888 Ga0496102_0888270 3300048905 Bacteria 813
1889 Ga0496103_0008675 3300048906 Bacteria 6035
1890 Ga0496103_0013517 3300048906 Bacteria 4843
1891 Ga0496103_0016186 3300048906 Bacteria 4449
1892 Ga0496103_0033208 3300048906 Bacteria 3152
1893 Ga0496103_0040285 3300048906 Bacteria 2871
1894 Ga0496103_0232605 3300048906 Bacteria 1186
1895 Ga0496104_0009827 3300048907 Bacteria 8532
1896 Ga0496104_0015319 3300048907 Bacteria 6943
1897 Ga0496104_0025565 3300048907 Bacteria 5444
1898 Ga0496104_0080631 3300048907 Bacteria 3103
1899 Ga0496104_0381663 3300048907 Bacteria 1322
1900 Ga0496104_0481246 3300048907 Bacteria 1153
1901 Ga0496104_0827583 3300048907 Bacteria 832
1902 Ga0496105_0023864 3300048908 Bacteria 4966
1903 Ga0496105_0034156 3300048908 Bacteria 4182
1904 Ga0496105_0053137 3300048908 Bacteria 3345
1905 Ga0496105_0095264 3300048908 Bacteria 2459
1906 Ga0496105_0113428 3300048908 Bacteria 2237
1907 Ga0496105_0260272 3300048908 Bacteria 1403
1908 Ga0496105_0312108 3300048908 Bacteria 1262
1909 Ga0496105_0365444 3300048908 Bacteria 1150
1910 Ga0496105_0486198 3300048908 Bacteria 971
1911 Ga0496105_0581159 3300048908 Bacteria 871
1912 Ga0496106_0000013 3300048909 Bacteria 202263
1913 Ga0496106_0000390 3300048909 Bacteria 31290
1914 Ga0496106_0002411 3300048909 Bacteria 13929
1915 Ga0496106_0015132 3300048909 Bacteria 5709
1916 Ga0496106_0044196 3300048909 Bacteria 3343
1917 Ga0496106_0052105 3300048909 Bacteria 3087
1918 Ga0496106_0069531 3300048909 Bacteria 2687
1919 Ga0496106_0165579 3300048909 Bacteria 1750
1920 Ga0496106_0180204 3300048909 Bacteria 1677
1921 Ga0496106_0414895 3300048909 Bacteria 1082
1922 Ga0496107_0000330 3300048910 Bacteria 25647
1923 Ga0496107_0017969 3300048910 Bacteria 4976
1924 Ga0496107_0040532 3300048910 Bacteria 3343
1925 Ga0496107_0047062 3300048910 Bacteria 3105
1926 Ga0496107_0140766 3300048910 Bacteria 1783
1927 Ga0496107_0312126 3300048910 Bacteria 1170
1928 Ga0496107_0623050 3300048910 Bacteria 796
1929 Ga0496108_0009612 3300048911 Bacteria 7838
1930 Ga0496108_0009952 3300048911 Bacteria 7709
1931 Ga0496108_0022217 3300048911 Bacteria 5216
1932 Ga0496108_0029189 3300048911 Bacteria 4566
1933 Ga0496108_0040573 3300048911 Bacteria 3881
1934 Ga0496108_0054970 3300048911 Bacteria 3342
1935 Ga0496108_0064212 3300048911 Bacteria 3092
1936 Ga0496108_0072918 3300048911 Bacteria 2899
1937 Ga0496108_0097560 3300048911 Bacteria 2504
1938 Ga0496108_0130057 3300048911 Bacteria 2164
1939 Ga0496108_0150472 3300048911 Bacteria 2008
1940 Ga0496108_0295750 3300048911 Bacteria 1410
1941 Ga0496108_0358331 3300048911 Bacteria 1273
1942 Ga0496108_0363069 3300048911 Bacteria 1264
1943 Ga0496108_0367903 3300048911 Bacteria 1255
1944 Ga0496108_0382091 3300048911 Bacteria 1230
1945 Ga0496108_0425670 3300048911 Bacteria 1160
1946 Ga0496108_0426792 3300048911 Bacteria 1158
1947 Ga0496108_0617781 3300048911 Bacteria 944
1948 Ga0496108_0787477 3300048911 Bacteria 821
1949 Ga0496109_0000134 3300048912 Bacteria 75662
1950 Ga0496109_0024314 3300048912 Bacteria 5384
1951 Ga0496109_0028020 3300048912 Bacteria 5035
1952 Ga0496109_0034597 3300048912 Bacteria 4552
1953 Ga0496109_0040613 3300048912 Bacteria 4213
1954 Ga0496109_0050219 3300048912 Bacteria 3799
1955 Ga0496109_0053461 3300048912 Bacteria 3683
1956 Ga0496109_0058234 3300048912 Bacteria 3529
1957 Ga0496109_0137575 3300048912 Bacteria 2283
1958 Ga0496109_0140444 3300048912 Bacteria 2258
1959 Ga0496109_0149847 3300048912 Bacteria 2184
1960 Ga0496109_0171836 3300048912 Bacteria 2033
1961 Ga0496109_0311595 3300048912 Bacteria 1485
1962 Ga0496109_0312873 3300048912 Bacteria 1481
1963 Ga0496109_0342025 3300048912 Bacteria 1413
1964 Ga0496109_0378455 3300048912 Bacteria 1337
1965 Ga0496109_0430740 3300048912 Bacteria 1246
1966 Ga0496109_0452180 3300048912 Bacteria 1213
1967 Ga0496109_0818622 3300048912 Bacteria 869
1968 Ga0496109_1116071 3300048912 Bacteria 726
1969 Ga0496110_0017182 3300048913 Bacteria 6048
1970 Ga0496110_0017539 3300048913 Bacteria 5988
1971 Ga0496110_0027391 3300048913 Bacteria 4885
1972 Ga0496110_0036910 3300048913 Bacteria 4246
1973 Ga0496110_0106322 3300048913 Bacteria 2518
1974 Ga0496110_0113393 3300048913 Bacteria 2438
1975 Ga0496110_0134391 3300048913 Bacteria 2235
1976 Ga0496110_0183858 3300048913 Bacteria 1898
1977 Ga0496110_0204469 3300048913 Bacteria 1794
1978 Ga0496110_0352590 3300048913 Bacteria 1340
1979 Ga0496110_0412076 3300048913 Bacteria 1232
1980 Ga0496110_0434847 3300048913 Bacteria 1196
1981 Ga0496110_0574972 3300048913 Bacteria 1023
1982 Ga0496110_0629427 3300048913 Bacteria 972
1983 Ga0496110_0650083 3300048913 Bacteria 954
1984 Ga0496111_0004126 3300048914 Bacteria 9124
1985 Ga0496111_0010150 3300048914 Bacteria 6305
1986 Ga0496111_0010571 3300048914 Bacteria 6200
1987 Ga0496111_0097440 3300048914 Bacteria 2159
1988 Ga0496111_0098338 3300048914 Bacteria 2149
1989 Ga0496111_0225482 3300048914 Bacteria 1392
1990 Ga0496111_0225600 3300048914 Bacteria 1392
1991 Ga0496111_0307217 3300048914 Bacteria 1175
1992 Ga0496111_0543386 3300048914 Bacteria 853
1993 Ga0496111_0580906 3300048914 Bacteria 821
1994 Ga0496112_0074253 3300048915 Bacteria 3362
1995 Ga0496112_0195587 3300048915 Bacteria 1983
1996 Ga0496112_0301034 3300048915 Bacteria 1549
1997 Ga0496112_0410127 3300048915 Bacteria 1294
1998 Ga0496112_0474435 3300048915 Bacteria 1188
1999 Ga0496112_0645707 3300048915 Bacteria 988
2000 Ga0496112_0706261 3300048915 Bacteria 936
2001 Ga0496113_0039281 3300048916 Bacteria 3483
2002 Ga0496113_0089297 3300048916 Bacteria 2372
2003 Ga0496113_0129672 3300048916 Bacteria 1978
2004 Ga0496113_0138781 3300048916 Bacteria 1912
2005 Ga0496113_0173004 3300048916 Bacteria 1711
2006 Ga0496113_0175338 3300048916 Bacteria 1699
2007 Ga0496113_0262876 3300048916 Bacteria 1379
2008 Ga0496113_0298244 3300048916 Bacteria 1290
2009 Ga0496113_0443854 3300048916 Bacteria 1042
2010 Ga0496113_0893424 3300048916 Bacteria 703
2011 Ga0496114_0001198 3300048917 Bacteria 19604
2012 Ga0496114_0009551 3300048917 Bacteria 7699
2013 Ga0496114_0011997 3300048917 Bacteria 6930
2014 Ga0496114_0021428 3300048917 Bacteria 5259
2015 Ga0496114_0021916 3300048917 Bacteria 5201
2016 Ga0496114_0025348 3300048917 Bacteria 4847
2017 Ga0496114_0046553 3300048917 Bacteria 3605
2018 Ga0496114_0060024 3300048917 Bacteria 3178
2019 Ga0496114_0076889 3300048917 Bacteria 2813
2020 Ga0496114_0081897 3300048917 Bacteria 2727
2021 Ga0496114_0100060 3300048917 Bacteria 2473
2022 Ga0496114_0102039 3300048917 Bacteria 2450
2023 Ga0496114_0135037 3300048917 Bacteria 2133
2024 Ga0496114_0272536 3300048917 Bacteria 1491
2025 Ga0496114_0351843 3300048917 Bacteria 1303
2026 Ga0496114_0638249 3300048917 Bacteria 937
2027 Ga0496115_0005323 3300048918 Bacteria 9360
2028 Ga0496115_0024552 3300048918 Bacteria 4687
2029 Ga0496115_0032552 3300048918 Bacteria 4113
2030 Ga0496115_0033688 3300048918 Bacteria 4045
2031 Ga0496115_0046050 3300048918 Bacteria 3484
2032 Ga0496115_0329913 3300048918 Bacteria 1247
2033 Ga0496115_0729278 3300048918 Bacteria 777
2034 Ga0496116_0054044 3300048919 Bacteria 2648
2035 Ga0496117_0001693 3300048920 Bacteria 30599
2036 Ga0496117_0004911 3300048920 Bacteria 14378
2037 Ga0496117_0054723 3300048920 Bacteria 2793
2038 Ga0496117_0063674 3300048920 Bacteria 2519
2039 Ga0496117_0096325 3300048920 Bacteria 1888
2040 Ga0496118_0000201 3300048921 Bacteria 104874
2041 Ga0496118_0013571 3300048921 Bacteria 7691
2042 Ga0496118_0338686 3300048921 Bacteria 807
2043 Ga0496119_0000977 3300048922 Bacteria 36734
2044 Ga0496119_0004454 3300048922 Bacteria 13940
2045 Ga0496119_0010445 3300048922 Bacteria 7815
2046 Ga0496119_0015654 3300048922 Bacteria 5820
2047 Ga0496119_0045764 3300048922 Bacteria 2740
2048 Ga0496119_0098074 3300048922 Bacteria 1650
2049 Ga0496119_0134462 3300048922 Bacteria 1343
2050 Ga0496120_0000472 3300048923 Bacteria 63130
2051 Ga0496120_0003282 3300048923 Bacteria 14921
2052 Ga0496120_0007830 3300048923 Bacteria 7879
2053 Ga0496120_0039013 3300048923 Bacteria 2806
2054 Ga0496120_0049116 3300048923 Bacteria 2423
2055 Ga0496120_0117394 3300048923 Bacteria 1380
2056 Ga0496120_0168307 3300048923 Bacteria 1086
2057 Ga0496120_0172574 3300048923 Bacteria 1068
2058 Ga0496121_0000004 3300048924 Bacteria 1139011
2059 Ga0496121_0000046 3300048924 Bacteria 335942
2060 Ga0496121_0016409 3300048924 Bacteria 7652
2061 Ga0496121_0030120 3300048924 Bacteria 4993
2062 Ga0496122_0000138 3300048925 Bacteria 169434
2063 Ga0496122_0001892 3300048925 Bacteria 31688
2064 Ga0496122_0003436 3300048925 Bacteria 20830
2065 Ga0496122_0023817 3300048925 Bacteria 5379
2066 Ga0496122_0078557 3300048925 Bacteria 2311
2067 Ga0496123_0000845 3300048926 Bacteria 48945
2068 Ga0496123_0001708 3300048926 Bacteria 29341
2069 Ga0496123_0007235 3300048926 Bacteria 10535
2070 Ga0496123_0014051 3300048926 Bacteria 6663
2071 Ga0496123_0049660 3300048926 Bacteria 2810
2072 Ga0496124_0000012 3300048927 Bacteria 512581
2073 Ga0496124_0000194 3300048927 Bacteria 120672
2074 Ga0496124_0004326 3300048927 Bacteria 16645
2075 Ga0496124_0055309 3300048927 Bacteria 3354
2076 Ga0496124_0085187 3300048927 Bacteria 2590
2077 Ga0496124_0138304 3300048927 Bacteria 1925
2078 Ga0496125_0000003 3300048928 Bacteria 1189767
2079 Ga0496125_0110229 3300048928 Bacteria 1996
2080 Ga0496126_0000001 3300048929 Bacteria 1139011
2081 Ga0496126_0001538 3300048929 Bacteria 35479
2082 Ga0496126_0004823 3300048929 Bacteria 15819
2083 Ga0496126_0063032 3300048929 Bacteria 3324
2084 Ga0496126_0227686 3300048929 Bacteria 1563
2085 Ga0501306_014691 3300049127 Bacteria 1036
2086 Ga0495678_030789 3300049459 Bacteria 2242
2087 Ga0495682_0008445 3300049460 Bacteria 4056
2088 Ga0501311_012844 3300049527 Bacteria 1050
2089 Ga0501316_002615 3300049532 Bacteria 1679
2090 Ga0501318_003346 3300049534 Bacteria 1462
2091 Ga0501318_013106 3300049534 Bacteria 959
2092 Ga0501320_001160 3300049536 Bacteria 1845
2093 Ga0501320_015805 3300049536 Bacteria 829
2094 Ga0501323_000831 3300049539 Bacteria 2493
2095 Ga0501323_004248 3300049539 Bacteria 1507
2096 Ga0501323_006098 3300049539 Bacteria 1340
2097 Ga0501324_000669 3300049540 Bacteria 1979
2098 Ga0501031_0001837 3300049568 Bacteria 13351
2099 Ga0501031_0007189 3300049568 Bacteria 7265
2100 Ga0501031_0009851 3300049568 Bacteria 6222
2101 Ga0501031_0012840 3300049568 Bacteria 5472
2102 Ga0501031_0021109 3300049568 Bacteria 4247
2103 Ga0501031_0026725 3300049568 Bacteria 3762
2104 Ga0501031_0039042 3300049568 Bacteria 3097
2105 Ga0501031_0041435 3300049568 Bacteria 3006
2106 Ga0501031_0063364 3300049568 Bacteria 2408
2107 Ga0501031_0064572 3300049568 Bacteria 2384
2108 Ga0501031_0068974 3300049568 Bacteria 2303
2109 Ga0501031_0090339 3300049568 Bacteria 1997
2110 Ga0501031_0098772 3300049568 Bacteria 1905
2111 Ga0501031_0122607 3300049568 Bacteria 1698
2112 Ga0501031_0141209 3300049568 Bacteria 1574
2113 Ga0501031_0491014 3300049568 Bacteria 792
2114 Ga0501031_0507869 3300049568 Bacteria 777
2115 Ga0501032_0004038 3300049569 Bacteria 11129
2116 Ga0501032_0006760 3300049569 Bacteria 8418
2117 Ga0501032_0007921 3300049569 Bacteria 7737
2118 Ga0501032_0013151 3300049569 Bacteria 5891
2119 Ga0501032_0024031 3300049569 Bacteria 4209
2120 Ga0501032_0036441 3300049569 Bacteria 3357
2121 Ga0501032_0041942 3300049569 Bacteria 3105
2122 Ga0501032_0042384 3300049569 Bacteria 3087
2123 Ga0501032_0046009 3300049569 Bacteria 2949
2124 Ga0501032_0069421 3300049569 Bacteria 2351
2125 Ga0501032_0076293 3300049569 Bacteria 2232
2126 Ga0501032_0082481 3300049569 Bacteria 2139
2127 Ga0501032_0162774 3300049569 Bacteria 1465
2128 Ga0501032_0336575 3300049569 Bacteria 973
2129 Ga0501032_0406259 3300049569 Bacteria 874
2130 Ga0501032_0422387 3300049569 Bacteria 855
2131 Ga0501033_0002609 3300049570 Bacteria 15193
2132 Ga0501033_0002629 3300049570 Bacteria 15111
2133 Ga0501033_0011909 3300049570 Bacteria 6644
2134 Ga0501033_0012249 3300049570 Bacteria 6545
2135 Ga0501033_0017564 3300049570 Bacteria 5404
2136 Ga0501033_0029904 3300049570 Bacteria 4094
2137 Ga0501033_0035074 3300049570 Bacteria 3760
2138 Ga0501033_0051639 3300049570 Bacteria 3047
2139 Ga0501033_0071198 3300049570 Bacteria 2554
2140 Ga0501033_0086436 3300049570 Bacteria 2296
2141 Ga0501033_0104919 3300049570 Bacteria 2060
2142 Ga0501033_0125642 3300049570 Bacteria 1860
2143 Ga0501033_0152119 3300049570 Bacteria 1669
2144 Ga0501033_0224364 3300049570 Bacteria 1336
2145 Ga0501033_0269608 3300049570 Bacteria 1203
2146 Ga0501033_0316574 3300049570 Bacteria 1096
2147 Ga0501034_0007592 3300049571 Bacteria 11538
2148 Ga0501034_0010172 3300049571 Bacteria 9814
2149 Ga0501034_0012032 3300049571 Bacteria 8944
2150 Ga0501034_0012296 3300049571 Bacteria 8843
2151 Ga0501034_0045523 3300049571 Bacteria 4433
2152 Ga0501034_0046941 3300049571 Bacteria 4363
2153 Ga0501034_0074854 3300049571 Bacteria 3393
2154 Ga0501034_0095448 3300049571 Bacteria 2970
2155 Ga0501034_0134042 3300049571 Bacteria 2459
2156 Ga0501034_0170873 3300049571 Bacteria 2141
2157 Ga0501034_0184667 3300049571 Bacteria 2049
2158 Ga0501034_0189836 3300049571 Bacteria 2017
2159 Ga0501034_0228294 3300049571 Bacteria 1811
2160 Ga0501034_0233260 3300049571 Bacteria 1788
2161 Ga0501034_0259063 3300049571 Bacteria 1682
2162 Ga0501034_0344212 3300049571 Bacteria 1420
2163 Ga0501036_0003794 3300049572 Bacteria 12120
2164 Ga0501036_0005209 3300049572 Bacteria 10511
2165 Ga0501036_0010281 3300049572 Bacteria 7719
2166 Ga0501036_0012290 3300049572 Bacteria 7090
2167 Ga0501036_0019821 3300049572 Bacteria 5647
2168 Ga0501036_0020042 3300049572 Bacteria 5615
2169 Ga0501036_0021151 3300049572 Bacteria 5464
2170 Ga0501036_0029800 3300049572 Bacteria 4611
2171 Ga0501036_0036294 3300049572 Bacteria 4170
2172 Ga0501036_0042193 3300049572 Bacteria 3863
2173 Ga0501036_0047012 3300049572 Bacteria 3654
2174 Ga0501036_0070633 3300049572 Bacteria 2953
2175 Ga0501036_0110350 3300049572 Bacteria 2324
2176 Ga0501036_0168542 3300049572 Bacteria 1845
2177 Ga0501036_0192583 3300049572 Bacteria 1715
2178 Ga0501036_0360672 3300049572 Bacteria 1213
2179 Ga0501036_0430412 3300049572 Bacteria 1100
2180 Ga0501036_0463750 3300049572 Bacteria 1055
2181 Ga0501037_0000294 3300049573 Bacteria 42178
2182 Ga0501037_0005902 3300049573 Bacteria 8942
2183 Ga0501037_0009805 3300049573 Bacteria 7029
2184 Ga0501037_0013679 3300049573 Bacteria 5978
2185 Ga0501037_0022703 3300049573 Bacteria 4639
2186 Ga0501037_0031305 3300049573 Bacteria 3928
2187 Ga0501037_0059222 3300049573 Bacteria 2794
2188 Ga0501037_0068597 3300049573 Bacteria 2582
2189 Ga0501037_0087627 3300049573 Bacteria 2253
2190 Ga0501037_0115170 3300049573 Bacteria 1935
2191 Ga0501037_0132914 3300049573 Bacteria 1783
2192 Ga0501037_0140941 3300049573 Bacteria 1725
2193 Ga0501037_0213892 3300049573 Bacteria 1358
2194 Ga0501037_0284909 3300049573 Bacteria 1150
2195 Ga0501038_0000303 3300049574 Bacteria 41854
2196 Ga0501038_0000651 3300049574 Bacteria 30855
2197 Ga0501038_0007193 3300049574 Bacteria 10289
2198 Ga0501038_0008787 3300049574 Bacteria 9264
2199 Ga0501038_0009773 3300049574 Bacteria 8791
2200 Ga0501038_0015178 3300049574 Bacteria 7007
2201 Ga0501038_0018593 3300049574 Bacteria 6276
2202 Ga0501038_0021670 3300049574 Bacteria 5764
2203 Ga0501038_0025755 3300049574 Bacteria 5240
2204 Ga0501038_0041524 3300049574 Bacteria 4011
2205 Ga0501038_0056607 3300049574 Bacteria 3367
2206 Ga0501038_0059332 3300049574 Bacteria 3278
2207 Ga0501038_0066628 3300049574 Bacteria 3066
2208 Ga0501038_0074468 3300049574 Bacteria 2872
2209 Ga0501038_0096932 3300049574 Bacteria 2461
2210 Ga0501038_0144613 3300049574 Bacteria 1942
2211 Ga0501038_0728350 3300049574 Bacteria 741
2212 Ga0501039_0002057 3300049575 Bacteria 14908
2213 Ga0501039_0008174 3300049575 Bacteria 7973
2214 Ga0501039_0012603 3300049575 Bacteria 6461
2215 Ga0501039_0013861 3300049575 Bacteria 6167
2216 Ga0501039_0018395 3300049575 Bacteria 5363
2217 Ga0501039_0038347 3300049575 Bacteria 3700
2218 Ga0501039_0060279 3300049575 Bacteria 2939
2219 Ga0501039_0070392 3300049575 Bacteria 2718
2220 Ga0501039_0070450 3300049575 Bacteria 2716
2221 Ga0501039_0075447 3300049575 Bacteria 2621
2222 Ga0501039_0079664 3300049575 Bacteria 2548
2223 Ga0501039_0088525 3300049575 Bacteria 2412
2224 Ga0501039_0093525 3300049575 Bacteria 2343
2225 Ga0501039_0097782 3300049575 Bacteria 2289
2226 Ga0501039_0159038 3300049575 Bacteria 1775
2227 Ga0501039_0183706 3300049575 Bacteria 1644
2228 Ga0501039_0301051 3300049575 Bacteria 1261
2229 Ga0501040_0005270 3300049576 Bacteria 8359
2230 Ga0501040_0011718 3300049576 Bacteria 5735
2231 Ga0501040_0014634 3300049576 Bacteria 5174
2232 Ga0501040_0040954 3300049576 Bacteria 3154
2233 Ga0501040_0082328 3300049576 Bacteria 2231
2234 Ga0501040_0107087 3300049576 Bacteria 1953
2235 Ga0501040_0152337 3300049576 Bacteria 1632
2236 Ga0501040_0176642 3300049576 Bacteria 1513
2237 Ga0501040_0228560 3300049576 Bacteria 1324
2238 Ga0501040_0327940 3300049576 Bacteria 1095
2239 Ga0501040_0453071 3300049576 Bacteria 924
2240 Ga0501040_0914935 3300049576 Bacteria 635
2241 Ga0501041_0007164 3300049577 Bacteria 6542
2242 Ga0501041_0008921 3300049577 Bacteria 5899
2243 Ga0501041_0009506 3300049577 Bacteria 5731
2244 Ga0501041_0011292 3300049577 Bacteria 5279
2245 Ga0501041_0015748 3300049577 Bacteria 4491
2246 Ga0501041_0022805 3300049577 Bacteria 3751
2247 Ga0501041_0089318 3300049577 Bacteria 1902
2248 Ga0501041_0174722 3300049577 Bacteria 1344
2249 Ga0501042_0002482 3300049578 Bacteria 11340
2250 Ga0501042_0005330 3300049578 Bacteria 8265
2251 Ga0501042_0008580 3300049578 Bacteria 6760
2252 Ga0501042_0018840 3300049578 Bacteria 4784
2253 Ga0501042_0024133 3300049578 Bacteria 4263
2254 Ga0501042_0024563 3300049578 Bacteria 4228
2255 Ga0501042_0025867 3300049578 Bacteria 4125
2256 Ga0501042_0032697 3300049578 Bacteria 3684
2257 Ga0501042_0050343 3300049578 Bacteria 2971
2258 Ga0501042_0052954 3300049578 Bacteria 2895
2259 Ga0501042_0090442 3300049578 Bacteria 2197
2260 Ga0501042_0150850 3300049578 Bacteria 1676
2261 Ga0501043_0001902 3300049579 Bacteria 17894
2262 Ga0501043_0002724 3300049579 Bacteria 14778
2263 Ga0501043_0007376 3300049579 Bacteria 8725
2264 Ga0501043_0008555 3300049579 Bacteria 8066
2265 Ga0501043_0020165 3300049579 Bacteria 5234
2266 Ga0501043_0033654 3300049579 Bacteria 4032
2267 Ga0501043_0045495 3300049579 Bacteria 3452
2268 Ga0501043_0133847 3300049579 Bacteria 1942
2269 Ga0501043_0149748 3300049579 Bacteria 1826
2270 Ga0501043_0237794 3300049579 Bacteria 1405
2271 Ga0501043_0241998 3300049579 Bacteria 1391
2272 Ga0501043_0252209 3300049579 Bacteria 1359
2273 Ga0501043_0273392 3300049579 Bacteria 1296
2274 Ga0501043_0274494 3300049579 Bacteria 1293
2275 Ga0501043_0337669 3300049579 Bacteria 1146
2276 Ga0501046_0001725 3300049580 Bacteria 20856
2277 Ga0501046_0001732 3300049580 Bacteria 20815
2278 Ga0501046_0007291 3300049580 Bacteria 9725
2279 Ga0501046_0009885 3300049580 Bacteria 8218
2280 Ga0501046_0018029 3300049580 Bacteria 5883
2281 Ga0501046_0020969 3300049580 Bacteria 5395
2282 Ga0501046_0028348 3300049580 Bacteria 4560
2283 Ga0501046_0029151 3300049580 Bacteria 4490
2284 Ga0501046_0068794 3300049580 Bacteria 2755
2285 Ga0501046_0213255 3300049580 Bacteria 1432
2286 Ga0501046_0359777 3300049580 Bacteria 1055
2287 Ga0501046_0394982 3300049580 Bacteria 999
2288 Ga0501046_0424641 3300049580 Bacteria 958
2289 Ga0501047_0000083 3300049581 Bacteria 121172
2290 Ga0501047_0000093 3300049581 Bacteria 110613
2291 Ga0501047_0010293 3300049581 Bacteria 8844
2292 Ga0501047_0022341 3300049581 Bacteria 6076
2293 Ga0501047_0023232 3300049581 Bacteria 5953
2294 Ga0501047_0028825 3300049581 Bacteria 5355
2295 Ga0501047_0046162 3300049581 Bacteria 4210
2296 Ga0501047_0051607 3300049581 Bacteria 3974
2297 Ga0501047_0054377 3300049581 Bacteria 3872
2298 Ga0501047_0062933 3300049581 Bacteria 3579
2299 Ga0501047_0155727 3300049581 Bacteria 2159
2300 Ga0501047_0159158 3300049581 Bacteria 2130
2301 Ga0501047_0169605 3300049581 Bacteria 2051
2302 Ga0501047_0177119 3300049581 Bacteria 2000
2303 Ga0501047_0195767 3300049581 Bacteria 1883
2304 Ga0501047_0205210 3300049581 Bacteria 1830
2305 Ga0501047_0212499 3300049581 Bacteria 1792
2306 Ga0501047_0402725 3300049581 Bacteria 1201
2307 Ga0501048_0000913 3300049582 Bacteria 21774
2308 Ga0501048_0003194 3300049582 Bacteria 12486
2309 Ga0501048_0007456 3300049582 Bacteria 8291
2310 Ga0501048_0007952 3300049582 Bacteria 8032
2311 Ga0501048_0007965 3300049582 Bacteria 8024
2312 Ga0501048_0010548 3300049582 Bacteria 6895
2313 Ga0501048_0019129 3300049582 Bacteria 5029
2314 Ga0501048_0019250 3300049582 Bacteria 5011
2315 Ga0501048_0019682 3300049582 Bacteria 4950
2316 Ga0501048_0040955 3300049582 Bacteria 3319
2317 Ga0501048_0101403 3300049582 Bacteria 2031
2318 Ga0501048_0133797 3300049582 Bacteria 1752
2319 Ga0501048_0134748 3300049582 Bacteria 1745
2320 Ga0501067_0006401 3300049583 Bacteria 6522
2321 Ga0501067_0011759 3300049583 Bacteria 4848
2322 Ga0501067_0022964 3300049583 Bacteria 3454
2323 Ga0501067_0027133 3300049583 Bacteria 3173
2324 Ga0501067_0041326 3300049583 Bacteria 2560
2325 Ga0501067_0050589 3300049583 Bacteria 2302
2326 Ga0501068_0022872 3300049584 Bacteria 3659
2327 Ga0501068_0043015 3300049584 Bacteria 2716
2328 Ga0501068_0043101 3300049584 Bacteria 2714
2329 Ga0501068_0047487 3300049584 Bacteria 2590
2330 Ga0501068_0070383 3300049584 Bacteria 2134
2331 Ga0501068_0153194 3300049584 Bacteria 1449
2332 Ga0501068_0456253 3300049584 Bacteria 827
2333 Ga0501068_0533394 3300049584 Bacteria 762
2334 Ga0501069_0004057 3300049585 Bacteria 7562
2335 Ga0501069_0009567 3300049585 Bacteria 5117
2336 Ga0501069_0050618 3300049585 Bacteria 2310
2337 Ga0501069_0088849 3300049585 Bacteria 1747
2338 Ga0501069_0189960 3300049585 Bacteria 1188
2339 Ga0501069_0241894 3300049585 Bacteria 1052
2340 Ga0501069_0277521 3300049585 Bacteria 980
2341 Ga0501069_0283554 3300049585 Bacteria 970
2342 Ga0501070_0001285 3300049586 Bacteria 22529
2343 Ga0501070_0003044 3300049586 Bacteria 14598
2344 Ga0501070_0003281 3300049586 Bacteria 14039
2345 Ga0501070_0004487 3300049586 Bacteria 11983
2346 Ga0501070_0011424 3300049586 Bacteria 7503
2347 Ga0501070_0014520 3300049586 Bacteria 6626
2348 Ga0501070_0016277 3300049586 Bacteria 6248
2349 Ga0501070_0022682 3300049586 Bacteria 5257
2350 Ga0501070_0025266 3300049586 Bacteria 4980
2351 Ga0501070_0029339 3300049586 Bacteria 4613
2352 Ga0501070_0029768 3300049586 Bacteria 4576
2353 Ga0501070_0068064 3300049586 Bacteria 2948
2354 Ga0501070_0072443 3300049586 Bacteria 2852
2355 Ga0501070_0084123 3300049586 Bacteria 2634
2356 Ga0501070_0127481 3300049586 Bacteria 2103
2357 Ga0501070_0163651 3300049586 Bacteria 1834
2358 Ga0501070_0185053 3300049586 Bacteria 1713
2359 Ga0501070_0199104 3300049586 Bacteria 1645
2360 Ga0501070_0260172 3300049586 Bacteria 1418
2361 Ga0501070_0596077 3300049586 Bacteria 881
2362 Ga0501071_0009680 3300049587 Bacteria 6430
2363 Ga0501071_0019128 3300049587 Bacteria 4751
2364 Ga0501071_0020666 3300049587 Bacteria 4578
2365 Ga0501071_0032930 3300049587 Bacteria 3682
2366 Ga0501071_0066244 3300049587 Bacteria 2624
2367 Ga0501071_0212397 3300049587 Bacteria 1455
2368 Ga0501071_0270149 3300049587 Bacteria 1285
2369 Ga0501071_0377955 3300049587 Bacteria 1080
2370 Ga0501071_0674734 3300049587 Bacteria 795
2371 Ga0501072_0003157 3300049588 Bacteria 12400
2372 Ga0501072_0007879 3300049588 Bacteria 8090
2373 Ga0501072_0010838 3300049588 Bacteria 6947
2374 Ga0501072_0016480 3300049588 Bacteria 5675
2375 Ga0501072_0017825 3300049588 Bacteria 5460
2376 Ga0501072_0023336 3300049588 Bacteria 4804
2377 Ga0501072_0034362 3300049588 Bacteria 3973
2378 Ga0501072_0042612 3300049588 Bacteria 3565
2379 Ga0501072_0053454 3300049588 Bacteria 3181
2380 Ga0501072_0083050 3300049588 Bacteria 2539
2381 Ga0501072_0160060 3300049588 Bacteria 1796
2382 Ga0501072_0235446 3300049588 Bacteria 1458
2383 Ga0501072_0399175 3300049588 Bacteria 1091
2384 Ga0501072_0674759 3300049588 Bacteria 813
2385 Ga0501073_0000046 3300049589 Bacteria 78180
2386 Ga0501073_0001403 3300049589 Bacteria 17775
2387 Ga0501073_0015372 3300049589 Bacteria 5551
2388 Ga0501073_0021178 3300049589 Bacteria 4689
2389 Ga0501073_0026052 3300049589 Bacteria 4190
2390 Ga0501073_0045255 3300049589 Bacteria 3099
2391 Ga0501073_0102099 3300049589 Bacteria 1991
2392 Ga0501073_0240782 3300049589 Bacteria 1249
2393 Ga0501073_0288594 3300049589 Bacteria 1132
2394 Ga0501073_0356414 3300049589 Bacteria 1010
2395 Ga0501074_0003640 3300049590 Bacteria 10941
2396 Ga0501074_0004322 3300049590 Bacteria 10147
2397 Ga0501074_0009586 3300049590 Bacteria 7030
2398 Ga0501074_0014754 3300049590 Bacteria 5683
2399 Ga0501074_0026403 3300049590 Bacteria 4211
2400 Ga0501074_0046363 3300049590 Bacteria 3142
2401 Ga0501074_0055471 3300049590 Bacteria 2855
2402 Ga0501074_0057565 3300049590 Bacteria 2800
2403 Ga0501074_0081715 3300049590 Bacteria 2317
2404 Ga0501074_0294535 3300049590 Bacteria 1153
2405 Ga0501075_0005120 3300049591 Bacteria 8961
2406 Ga0501075_0005138 3300049591 Bacteria 8950
2407 Ga0501075_0006976 3300049591 Bacteria 7805
2408 Ga0501075_0033042 3300049591 Bacteria 3847
2409 Ga0501075_0051478 3300049591 Bacteria 3096
2410 Ga0501075_0126721 3300049591 Bacteria 1944
2411 Ga0501075_0279505 3300049591 Bacteria 1272
2412 Ga0501075_0341956 3300049591 Bacteria 1140
2413 Ga0501076_0001890 3300049592 Bacteria 14270
2414 Ga0501076_0010824 3300049592 Bacteria 6781
2415 Ga0501076_0012283 3300049592 Bacteria 6403
2416 Ga0501076_0021209 3300049592 Bacteria 4981
2417 Ga0501076_0074805 3300049592 Bacteria 2714
2418 Ga0501076_0138172 3300049592 Bacteria 1979
2419 Ga0501076_0219074 3300049592 Bacteria 1556
2420 Ga0501076_0338542 3300049592 Bacteria 1234
2421 Ga0501076_0508600 3300049592 Bacteria 993
2422 Ga0501077_0003402 3300049593 Bacteria 9563
2423 Ga0501077_0006591 3300049593 Bacteria 7129
2424 Ga0501077_0012839 3300049593 Bacteria 5250
2425 Ga0501077_0014483 3300049593 Bacteria 4957
2426 Ga0501077_0014580 3300049593 Bacteria 4942
2427 Ga0501077_0035590 3300049593 Bacteria 3170
2428 Ga0501077_0062013 3300049593 Bacteria 2372
2429 Ga0501077_0142444 3300049593 Bacteria 1520
2430 Ga0501077_0199042 3300049593 Bacteria 1272
2431 Ga0501243_032702 3300049675 Bacteria 893
2432 Ga0501079_0000567 3300049741 Bacteria 24344
2433 Ga0501079_0005166 3300049741 Bacteria 9705
2434 Ga0501079_0022276 3300049741 Bacteria 4857
2435 Ga0501079_0045603 3300049741 Bacteria 3383
2436 Ga0501079_0047805 3300049741 Bacteria 3301
2437 Ga0501079_0048152 3300049741 Bacteria 3289
2438 Ga0501079_0078218 3300049741 Bacteria 2558
2439 Ga0501080_0001919 3300049742 Bacteria 17923
2440 Ga0501080_0007921 3300049742 Bacteria 9623
2441 Ga0501080_0021268 3300049742 Bacteria 6005
2442 Ga0501080_0023647 3300049742 Bacteria 5693
2443 Ga0501080_0041680 3300049742 Bacteria 4277
2444 Ga0501080_0046667 3300049742 Bacteria 4033
2445 Ga0501080_0069334 3300049742 Bacteria 3279
2446 Ga0501080_0072756 3300049742 Bacteria 3198
2447 Ga0501080_0082094 3300049742 Bacteria 2994
2448 Ga0501080_0092232 3300049742 Bacteria 2813
2449 Ga0501080_0101539 3300049742 Bacteria 2669
2450 Ga0501080_0108536 3300049742 Bacteria 2572
2451 Ga0501080_0170476 3300049742 Bacteria 2007
2452 Ga0501080_0180555 3300049742 Bacteria 1942
2453 Ga0501080_0281597 3300049742 Bacteria 1511
2454 Ga0501080_0482936 3300049742 Bacteria 1108
2455 Ga0501080_0580668 3300049742 Bacteria 996
2456 Ga0501080_0645051 3300049742 Bacteria 937
2457 Ga0501081_0003162 3300049743 Bacteria 10475
2458 Ga0501081_0007531 3300049743 Bacteria 7061
2459 Ga0501081_0060864 3300049743 Bacteria 2617
2460 Ga0501083_0000026 3300049744 Bacteria 119076
2461 Ga0501083_0000728 3300049744 Bacteria 21449
2462 Ga0501083_0005442 3300049744 Bacteria 9017
2463 Ga0501083_0005618 3300049744 Bacteria 8878
2464 Ga0501083_0012334 3300049744 Bacteria 5980
2465 Ga0501083_0146133 3300049744 Bacteria 1548
2466 Ga0501035_0004849 3300049822 Bacteria 12755
2467 Ga0501035_0009171 3300049822 Bacteria 9200
2468 Ga0501035_0014568 3300049822 Bacteria 7257
2469 Ga0501035_0016194 3300049822 Bacteria 6880
2470 Ga0501035_0026521 3300049822 Bacteria 5300
2471 Ga0501035_0027427 3300049822 Bacteria 5206
2472 Ga0501035_0069370 3300049822 Bacteria 3125
2473 Ga0501035_0069579 3300049822 Bacteria 3119
2474 Ga0501035_0077581 3300049822 Bacteria 2935
2475 Ga0501035_0096173 3300049822 Bacteria 2602
2476 Ga0501035_0166682 3300049822 Bacteria 1905
2477 Ga0501035_0170702 3300049822 Bacteria 1879
2478 Ga0501035_0188659 3300049822 Bacteria 1773
2479 Ga0501035_0201777 3300049822 Bacteria 1705
2480 Ga0501035_0230752 3300049822 Bacteria 1577
2481 Ga0501035_0258266 3300049822 Bacteria 1478
2482 Ga0501035_0455724 3300049822 Bacteria 1057
2483 Ga0501035_0503557 3300049822 Bacteria 996
2484 Ga0501035_0549005 3300049822 Bacteria 947
2485 Ga0501044_0001800 3300049823 Bacteria 25001
2486 Ga0501044_0002740 3300049823 Bacteria 20041
2487 Ga0501044_0022807 3300049823 Bacteria 6667
2488 Ga0501044_0023321 3300049823 Bacteria 6584
2489 Ga0501044_0027980 3300049823 Bacteria 5950
2490 Ga0501044_0030004 3300049823 Bacteria 5732
2491 Ga0501044_0030953 3300049823 Bacteria 5634
2492 Ga0501044_0037496 3300049823 Bacteria 5066
2493 Ga0501044_0040292 3300049823 Bacteria 4868
2494 Ga0501044_0049385 3300049823 Bacteria 4344
2495 Ga0501044_0115140 3300049823 Bacteria 2694
2496 Ga0501044_0115283 3300049823 Bacteria 2692
2497 Ga0501044_0119721 3300049823 Bacteria 2634
2498 Ga0501044_0139647 3300049823 Bacteria 2412
2499 Ga0501044_0191603 3300049823 Bacteria 2007
2500 Ga0501044_0198452 3300049823 Bacteria 1965
2501 Ga0501044_0260007 3300049823 Bacteria 1674
2502 Ga0501044_0289526 3300049823 Bacteria 1569
2503 Ga0501044_0379084 3300049823 Bacteria 1329
2504 Ga0501044_0387377 3300049823 Bacteria 1312
2505 Ga0501044_0634376 3300049823 Bacteria 959
2506 Ga0501045_0001193 3300049824 Bacteria 17292
2507 Ga0501045_0010772 3300049824 Bacteria 6407
2508 Ga0501045_0014385 3300049824 Bacteria 5607
2509 Ga0501045_0014780 3300049824 Bacteria 5534
2510 Ga0501045_0019563 3300049824 Bacteria 4829
2511 Ga0501045_0042745 3300049824 Bacteria 3299
2512 Ga0501045_0044640 3300049824 Bacteria 3229
2513 Ga0501045_0069428 3300049824 Bacteria 2590
2514 Ga0501045_0069713 3300049824 Bacteria 2585
2515 Ga0501045_0074073 3300049824 Bacteria 2507
2516 Ga0501045_0082387 3300049824 Bacteria 2372
2517 Ga0501045_0090716 3300049824 Bacteria 2258
2518 Ga0501045_0119096 3300049824 Bacteria 1960
2519 Ga0501045_0123275 3300049824 Bacteria 1924
2520 Ga0501045_0247743 3300049824 Bacteria 1326
2521 Ga0501045_0258269 3300049824 Bacteria 1297
2522 Ga0501045_0382999 3300049824 Bacteria 1047
2523 Ga0501045_0566088 3300049824 Bacteria 842
2524 nmdc:mga03n38_18104_c1 3300050490 Bacteria 2775
2525 nmdc:mga03n38_31460_c1 3300050490 Bacteria 2239
2526 nmdc:mga03n38_31553_c1 3300050490 Bacteria 2237
2527 nmdc:mga03n38_7020_c1 3300050490 Bacteria 3959
2528 nmdc:mga00v17_131070_c1 3300050491 Bacteria 1602
2529 nmdc:mga00v17_187074_c1 3300050491 Bacteria 1337
2530 nmdc:mga00v17_230487_c1 3300050491 Bacteria 1200
2531 nmdc:mga00v17_277_c1 3300050491 Bacteria 30276
2532 nmdc:mga00v17_33469_c1 3300050491 Bacteria 3045
2533 nmdc:mga00v17_44896_c1 3300050491 Bacteria 2188
2534 nmdc:mga00v17_5183_c1 3300050491 Bacteria 6856
2535 nmdc:mga00v17_5589_c1 3300050491 Bacteria 6630
2536 nmdc:mga00v17_7069_c1 3300050491 Bacteria 5975
2537 nmdc:mga00v17_70985_c1 3300050491 Bacteria 2158
2538 nmdc:mga0yw44_14094_c1 3300050492 Bacteria 4233
2539 nmdc:mga0yw44_17205_c1 3300050492 Bacteria 3929
2540 nmdc:mga0yw44_178020_c1 3300050492 Bacteria 1399
2541 nmdc:mga0yw44_22196_c1 3300050492 Bacteria 3555
2542 nmdc:mga0yw44_23125_c1 3300050492 Bacteria 3497
2543 nmdc:mga0yw44_26133_c1 3300050492 Bacteria 3331
2544 nmdc:mga0yw44_280721_c1 3300050492 Bacteria 1113
2545 nmdc:mga0yw44_365954_c1 3300050492 Bacteria 972
2546 nmdc:mga0yw44_371209_c1 3300050492 Bacteria 965
2547 nmdc:mga0yw44_4438_c2 3300050492 Bacteria 5851
2548 nmdc:mga0yw44_44475_c1 3300050492 Bacteria 2656
2549 nmdc:mga0yw44_474123_c1 3300050492 Bacteria 849
2550 nmdc:mga0yw44_49006_c1 3300050492 Bacteria 2548
2551 nmdc:mga0yw44_51044_c1 3300050492 Bacteria 2503
2552 nmdc:mga0yw44_81767_c1 3300050492 Bacteria 2026
2553 nmdc:mga06z11_120829_c1 3300050494 Bacteria 1461
2554 nmdc:mga06z11_189864_c1 3300050494 Bacteria 1189
2555 nmdc:mga06z11_5211_c1 3300050494 Bacteria 5194
2556 nmdc:mga04h51_5086_c1 3300050495 Bacteria 3330
2557 nmdc:mga04h51_5311_c1 3300050495 Bacteria 3275
2558 nmdc:mga07m45_14817_c1 3300050496 Bacteria 4162
2559 nmdc:mga07m45_24348_c1 3300050496 Bacteria 3315
2560 nmdc:mga07m45_49621_c1 3300050496 Bacteria 2363
2561 nmdc:mga05p37_105331_c1 3300050507 Bacteria 3470
2562 nmdc:mga05p37_198509_c1 3300050507 Bacteria 2431
2563 nmdc:mga05p37_23434_c1 3300050507 Bacteria 7490
2564 nmdc:mga05p37_2501_c2 3300050507 Bacteria 12944
2565 nmdc:mga05p37_31226_c1 3300050507 Bacteria 6507
2566 nmdc:mga05p37_334435_c1 3300050507 Bacteria 1788
2567 nmdc:mga05p37_9094_c1 3300050507 Bacteria 11741
2568 nmdc:mga09592_126018_c1 3300050508 Bacteria 2201
2569 nmdc:mga09592_41885_c1 3300050508 Bacteria 3852
2570 nmdc:mga09592_88859_c1 3300050508 Bacteria 2639
2571 nmdc:mga0qj67_1094_c1 3300050509 Bacteria 18774
2572 nmdc:mga0qj67_2653_c1 3300050509 Bacteria 12815
2573 nmdc:mga06r32_29270_c1 3300050510 Bacteria 5160
2574 nmdc:mga06r32_295294_c1 3300050510 Bacteria 1607
2575 nmdc:mga06r32_37627_c1 3300050510 Bacteria 4578
2576 nmdc:mga06r32_588744_c1 3300050510 Bacteria 1084
2577 nmdc:mga06r32_660541_c1 3300050510 Bacteria 1013
2578 nmdc:mga06r32_9811_c1 3300050510 Bacteria 8637
2579 nmdc:mga08y16_10704_c1 3300050511 Bacteria 9625
2580 nmdc:mga08y16_35414_c1 3300050511 Bacteria 5242
2581 nmdc:mga08y16_56494_c1 3300050511 Bacteria 4102
2582 nmdc:mga08y16_662133_c1 3300050511 Bacteria 1047
2583 nmdc:mga08y16_793784_c1 3300050511 Bacteria 940
2584 nmdc:mga08y16_849061_c1 3300050511 Bacteria 903
2585 nmdc:mga0n895_1840_c1 3300050512 Bacteria 16182
2586 nmdc:mga0n895_618236_c1 3300050512 Bacteria 1084
2587 nmdc:mga0n895_651896_c1 3300050512 Bacteria 1052
2588 nmdc:mga0rr50_129717_c1 3300050513 Bacteria 2017
2589 nmdc:mga0rr50_392858_c1 3300050513 Bacteria 1171
2590 nmdc:mga0rr50_483568_c1 3300050513 Bacteria 1052
2591 nmdc:mga08x19_33233_c1 3300050514 Bacteria 3255
2592 nmdc:mga0a205_13936_c1 3300050515 Bacteria 7498
2593 nmdc:mga0a205_20106_c1 3300050515 Bacteria 6299
2594 nmdc:mga0a205_2361_c1 3300050515 Bacteria 16644
2595 nmdc:mga0a205_39925_c1 3300050515 Bacteria 4518
2596 nmdc:mga0a205_5919_c1 3300050515 Bacteria 11018
2597 nmdc:mga0sz30_2429_c1 3300050516 Bacteria 4942
2598 Ga0495601_0005892 3300053077 Bacteria 7147
2599 Ga0495601_0084215 3300053077 Bacteria 2042
2600 Ga0495601_0179096 3300053077 Bacteria 1386
2601 Ga0495612_0034537 3300053078 Bacteria 2048
2602 Ga0495612_0078546 3300053078 Bacteria 1384
2603 Ga0495612_0129772 3300053078 Bacteria 1088
2604 Ga0500610_0097035 3300053079 Bacteria 1528
2605 Ga0500635_0000138 3300053080 Bacteria 41788
2606 Ga0500635_0002023 3300053080 Bacteria 4953
2607 Ga0495655_0027650 3300053083 Bacteria 1347
2608 Ga0495595_0244126 3300053084 Bacteria 899
2609 Ga0495619_0000287 3300053085 Bacteria 35945
2610 Ga0495619_0015499 3300053085 Bacteria 4822
2611 Ga0495619_0130763 3300053085 Bacteria 1725
2612 Ga0495619_0187007 3300053085 Bacteria 1433
2613 Ga0495619_0341627 3300053085 Bacteria 1036
2614 Ga0495619_0424210 3300053085 Bacteria 917
2615 Ga0500578_0108321 3300053086 Bacteria 1753
2616 Ga0500643_000132 3300053087 Bacteria 76916
2617 Ga0500643_000358 3300053087 Bacteria 36349
2618 Ga0500644_0000183 3300053088 Bacteria 39850
2619 Ga0500651_0000109 3300053093 Bacteria 50554
2620 Ga0500640_003421 3300053095 Bacteria 5540
2621 Ga0500641_0023792 3300053096 Bacteria 2359
2622 Ga0500641_0037929 3300053096 Bacteria 1934
2623 Ga0500650_0013318 3300053098 Bacteria 3446
2624 Ga0500650_0040286 3300053098 Bacteria 2155
2625 Ga0500556_0000059 3300053104 Bacteria 112837
2626 Ga0500556_0000283 3300053104 Bacteria 39686
2627 Ga0500556_0001365 3300053104 Bacteria 10742
2628 Ga0500558_155628 3300053106 Bacteria 844
2629 Ga0500560_013016 3300053107 Bacteria 2175
2630 Ga0500562_003188 3300053108 Bacteria 4093
2631 Ga0500593_000301 3300053117 Bacteria 20066
2632 Ga0500593_013314 3300053117 Bacteria 3510
2633 Ga0500628_070930 3300053129 Bacteria 873
2634 Ga0500655_000909 3300053133 Bacteria 5725
2635 Ga0500559_0000387 3300053136 Bacteria 32302
2636 Ga0500559_0065701 3300053136 Bacteria 1626
2637 Ga0500564_200219 3300053138 Bacteria 821
2638 Ga0500568_0000012 3300053139 Bacteria 225711
2639 Ga0500568_0006341 3300053139 Bacteria 5949
2640 Ga0500573_0008676 3300053140 Bacteria 5607
2641 Ga0500573_0026270 3300053140 Bacteria 3347
2642 Ga0500573_0032312 3300053140 Bacteria 3020
2643 Ga0500573_0093208 3300053140 Bacteria 1699
2644 Ga0500573_0187789 3300053140 Bacteria 1106
2645 Ga0500600_0243743 3300053149 Bacteria 810
2646 Ga0500603_060412 3300053150 Bacteria 1059
2647 Ga0500616_0003129 3300053153 Bacteria 12940
2648 Ga0500616_0015663 3300053153 Bacteria 4328
2649 Ga0500624_001677 3300053157 Bacteria 3302
2650 Ga0500633_0012143 3300053160 Bacteria 2370
2651 Ga0501084_0014931 3300054114 Bacteria 6440
2652 Ga0501084_0019782 3300054114 Bacteria 5611
2653 Ga0501084_0030098 3300054114 Bacteria 4540
2654 Ga0501084_0041186 3300054114 Bacteria 3863
2655 Ga0501084_0041853 3300054114 Bacteria 3831
2656 Ga0501084_0046496 3300054114 Bacteria 3636
2657 Ga0501084_0097481 3300054114 Bacteria 2468
2658 Ga0501084_0109433 3300054114 Bacteria 2321
2659 Ga0501084_0133478 3300054114 Bacteria 2090
2660 Ga0501084_0424850 3300054114 Bacteria 1123
2661 Ga0501084_0541470 3300054114 Bacteria 984
2662 Ga0587101_012203 3300059623 Bacteria 1113
2663 Ga0587128_028128 3300059630 Bacteria 913
2664 Ga0587128_044218 3300059630 Bacteria 790
2665 Ga0587072_051922 3300059643 Bacteria 824
2666 Ga0587107_029504 3300059652 Bacteria 826
2667 Ga0587120_006417 3300059659 Bacteria 924
2668 Ga0587111_0028226 3300060346 Bacteria 1129
2669 Ga0501082_0004453 3300060353 Bacteria 12232
2670 Ga0501082_0023770 3300060353 Bacteria 5284
2671 Ga0501082_0031446 3300060353 Bacteria 4577
2672 Ga0501082_0044147 3300060353 Bacteria 3845
2673 Ga0501082_0051393 3300060353 Bacteria 3552
2674 Ga0501082_0086195 3300060353 Bacteria 2708
2675 Ga0501082_0186964 3300060353 Bacteria 1802
2676 Ga0501082_0221462 3300060353 Bacteria 1646
2677 Ga0501082_0312504 3300060353 Bacteria 1368
2678 Ga0501082_0327874 3300060353 Bacteria 1334
2679 Ga0466962_0000547 3300061719 Bacteria 16568
2680 Ga0466962_0008761 3300061719 Bacteria 4849
2681 Ga0466962_0009880 3300061719 Bacteria 4578
2682 Ga0466962_0016134 3300061719 Bacteria 3603
2683 Ga0466962_0033258 3300061719 Bacteria 2467
2684 Ga0466962_0052237 3300061719 Bacteria 1954
2685 Ga0466962_0055266 3300061719 Bacteria 1897
2686 Ga0466962_0067293 3300061719 Bacteria 1710
2687 Ga0466962_0138340 3300061719 Bacteria 1179
2688 Ga0466962_0205586 3300061719 Bacteria 963
2689 Ga0530510_0002161 3300061734 Bacteria 13479
2690 Ga0530510_0010990 3300061734 Bacteria 6349
2691 Ga0530510_0018454 3300061734 Bacteria 4946
2692 Ga0530510_0054659 3300061734 Bacteria 2885
2693 Ga0530510_0090111 3300061734 Bacteria 2237
2694 Ga0530510_0096175 3300061734 Bacteria 2164
2695 Ga0530510_0096754 3300061734 Bacteria 2157
2696 Ga0530510_0157495 3300061734 Bacteria 1679
2697 Ga0530510_0219606 3300061734 Bacteria 1413
2698 Ga0530510_0220405 3300061734 Bacteria 1410
2699 Ga0530510_0261396 3300061734 Bacteria 1291
2700 Ga0530510_0267415 3300061734 Bacteria 1276
2701 Ga0530510_0309220 3300061734 Bacteria 1183
2702 2506864688 2506783011 Bacteria 5323186
2703 2515497470 2515154088 Bacteria 5526283
2704 2515756067 2515154137 Bacteria 5711575
2705 2516084720 2515154202 Bacteria 5471270
2706 2516091470 2515154203 Bacteria 5458536
2707 2528203353 2527291627 Bacteria 5309833
2708 2528212903 2527291629 Bacteria 5267418
2709 2546948632 2546825537 Bacteria 5389291
2710 2547412476 2547132111 Bacteria 8013147
2711 2554257365 2554235005 Bacteria 6457341
2712 2559428249 2558860280 Bacteria 11429938
2713 2579747773 2576861822 Bacteria 5004595
2714 2585300312 2582581312 Bacteria 7308206
2715 2585310636 2582581313 Bacteria 10042643
2716 2585314403 2582581314 Bacteria 11452267
2717 2587861571 2585428094 Bacteria 3604039
2718 2616700204 2616644814 Bacteria 11555299
2719 2616905279 2616644941 Bacteria 8510691
2720 2623497912 2622736605 Bacteria 4992138
2721 2643762992 2643221548 Bacteria 8053412
2722 2643827197 2643221561 Bacteria 4984412
2723 2643852208 2643221567 Bacteria 4163945
2724 2643890464 2643221576 Bacteria 5214352
2725 2643899936 2643221578 Bacteria 9213798
2726 2643947754 2643221587 Bacteria 7586415
2727 2643959520 2643221590 Bacteria 5214697
2728 2644015183 2643221601 Bacteria 7493239
2729 2644033011 2643221604 Bacteria 5014917
2730 2644092959 2643221615 Bacteria 5487866
2731 2644099995 2643221617 Bacteria 5139111
2732 2644117601 2643221620 Bacteria 5134593
2733 2644136361 2643221624 Bacteria 4384879
2734 2644175346 2643221631 Bacteria 8168043
2735 2644228378 2643221641 Bacteria 4490190
2736 2644263023 2643221647 Bacteria 10741251
2737 2644278187 2643221649 Bacteria 3867359
2738 2644322572 2643221657 Bacteria 5490246
2739 2644390812 2643221670 Bacteria 6497041
2740 2644405841 2643221673 Bacteria 9196637
2741 2644433619 2643221677 Bacteria 7584031
2742 2644443238 2643221678 Bacteria 9540101
2743 2644447518 2643221679 Bacteria 3839507
2744 2644454820 2643221681 Bacteria 3707866
2745 2644464150 2643221682 Bacteria 6743283
2746 2644505310 2643221690 Bacteria 4654705
2747 2644524873 2643221694 Bacteria 4392972
2748 2644533976 2643221696 Bacteria 5431823
2749 2644536251 2643221697 Bacteria 3575694
2750 2644607906 2643221711 Bacteria 4865335
2751 2644626950 2643221714 Bacteria 9015452
2752 2644668959 2643221722 Bacteria 4247614
2753 2645722085 2643221961 Bacteria 3919167
2754 2645724927 2643221962 Bacteria 3874254
2755 2676477488 2675903058 Bacteria 6822861
2756 2676482772 2675903059 Bacteria 8644972
2757 2676490663 2675903060 Bacteria 10051191
2758 2686540812 2684623036 Bacteria 5199090
2759 2710604458 2710264753 Bacteria 5455564
2760 2738871881 2738541305 Bacteria 4910150
2761 2740165883 2739367898 Bacteria 4367674
2762 2753069569 2751185734 Bacteria 8863695
2763 2753300749 2751185788 Bacteria 4541048
2764 2758225091 2757320536 Bacteria 3629334
2765 2774855016 2773857922 Bacteria 9757215
2766 2774867482 2773857924 Bacteria 5256821
2767 2774904917 2773857933 Bacteria 5818019
2768 2776371414 2775506925 Bacteria 7237746
2769 2784473144 2784132109 Bacteria 3141763
2770 2784588875 2784132148 Bacteria 8627943
2771 2785343012 2784746763 Bacteria 9783172
2772 2785369815 2784746768 Bacteria 10036182
2773 2786670904 2786546132 Bacteria 10419719
2774 2791915450 2791354901 Bacteria 8322202
2775 2793983503 2791355406 Bacteria 11364898
2776 2804846478 2802429296 Bacteria 7227771
2777 2808842319 2808606359 Bacteria 9866990
2778 2808872003 2808606365 Bacteria 4301966
2779 2808920843 2808606375 Bacteria 9466072
2780 2809197747 2808606439 Bacteria 5952208
2781 2809232491 2808606448 Bacteria 8656184
2782 2811849318 2808606982 Bacteria 7791042
2783 2812331015 2811994874 Bacteria 5367947
2784 2812347764 2811994878 Bacteria 5992952
2785 2812357796 2811994879 Bacteria 9313447
2786 2812373095 2811994882 Bacteria 4688362
2787 2812480269 2811994917 Bacteria 7761064
2788 2816421786 2816332119 Bacteria 8120218
2789 2816509996 2816332139 Bacteria 9138787
2790 2819425875 2818991318 Bacteria 5266538
2791 2819664959 2818991458 Bacteria 4794049
2792 2819689386 2818991462 Bacteria 4320267
2793 2819697163 2818991463 Bacteria 7948711
2794 2819727077 2818991469 Bacteria 4644110
2795 2827634745 2827628540 Bacteria 6858585
2796 2837274566 2837268691 Bacteria 7850704
2797 2844843723 2844841374 Bacteria 3917147
2798 2844851430 2844849076 Bacteria 4091819
2799 2852637079 2852635781 Bacteria 8251373
2800 2855388825 2855386786 Bacteria 4752232
2801 2857482029 2857481737 Bacteria 4761446
2802 2857711798 2857710386 Bacteria 3186771
2803 2857733034 2857729791 Bacteria 4040535
2804 2857741872 2857740372 Bacteria 4782044
2805 2861528138 2861520306 Bacteria 8348283
2806 2862183401 2862178590 Bacteria 8583590
2807 2862285937 2862281513 Bacteria 9621493
2808 2862291263 2862290372 Bacteria 7471434
2809 2862388320 2862382967 Bacteria 10317375
2810 2862507990 2862507626 Bacteria 9425308
2811 2862578974 2862574272 Bacteria 10567477
2812 2863070043 2863067949 Bacteria 8541735
2813 2863404274 2863404153 Bacteria 9672205
2814 2866555864 2866552031 Bacteria 5824618
2815 2866616293 2866612099 Bacteria 7543886
2816 2867347771 2867346516 Bacteria 7608576
2817 2867436796 2867428634 Bacteria 9590268
2818 2867476940 2867475112 Bacteria 6909112
2819 2870727876 2870721527 Bacteria 9689237
2820 2873155460 2873151551 Bacteria 8625867
2821 2875395396 2875391855 Bacteria 7600475
2822 2877680824 2877676314 Bacteria 9512378
2823 2884766912 2884763398 Bacteria 4091164
2824 2887447257 2887443736 Bacteria 4426037
2825 2891327865 2891326441 Bacteria 6439512
2826 2891968828 2891968417 Bacteria 5821697
2827 2895447368 2895442618 Bacteria 11027144
2828 2904431318 2904430863 Bacteria 3486923
2829 2904497698 2904497146 Bacteria 4731781
2830 2904504710 2904501621 Bacteria 3401437
2831 2908674862 2908674828 Bacteria 3382763
2832 2909075820 2909074476 Bacteria 3436050
2833 2910812493 2910809715 Bacteria 4982797
2834 2912719635 2912715099 Bacteria 9460473
2835 2912731306 2912723979 Bacteria 8557534
2836 2912761081 2912757875 Bacteria 7940295
2837 2915360012 2915358134 Bacteria 6050864
2838 2917744023 2917736166 Bacteria 9690793
2839 2918505303 2918501144 Bacteria 8668083
2840 2919041090 2919039151 Bacteria 3391018
2841 2919046094 2919042368 Bacteria 3905917
2842 2919055720 2919055335 Bacteria 3875751
2843 2919448387 2919446982 Bacteria 3994487
2844 2919472005 2919468124 Bacteria 9133025
2845 2919525814 2919523602 Bacteria 3788128
2846 2919539639 2919538618 Bacteria 4677069
2847 2928108157 2928104781 Bacteria 3877447
2848 2928121735 2928121344 Bacteria 3972376
2849 2928153862 2928153084 Bacteria 4020257
2850 2928501830 2928500415 Bacteria 3384541
2851 2933419852 2933418574 Bacteria 4476724
2852 2935390946 2935390628 Bacteria 7043367
2853 2939676559 2939674588 Bacteria 4844420
2854 2946049712 2946045630 Bacteria 8527308
2855 2946068070 2946064051 Bacteria 8957905
2856 2946076172 2946072368 Bacteria 8999607
2857 2947228868 2947224130 Bacteria 9938529
2858 2954006666 2954002825 Bacteria 9173742
2859 2954385923 2954380949 Bacteria 10050426
2860 2954677230 2954673503 Bacteria 9685905
2861 2954686925 2954682443 Bacteria 9862841
2862 2954696575 2954691527 Bacteria 10720516
2863 2954705649 2954701450 Bacteria 10834262
2864 2954715934 2954711539 Bacteria 10867210
2865 2954725873 2954721474 Bacteria 10456478
2866 2954735925 2954731030 Bacteria 10243860
2867 2954744811 2954740390 Bacteria 10229294
2868 2954754788 2954749733 Bacteria 10366972
2869 2954763796 2954759201 Bacteria 9358192
2870 2964328168 2964326757 Bacteria 3290868
2871 2966601962 2966598605 Bacteria 7676064
2872 2966923735 2966921586 Bacteria 3092803
2873 2966927545 2966924647 Bacteria 3268643
2874 2974325013 2974324384 Bacteria 3750535
2875 2984578477 2984576629 Bacteria 4248407
2876 2984593920 2984592036 Bacteria 3670284
2877 2990065653 2990059506 Bacteria 9321252
2878 2990259286 2990256926 Bacteria 4252839
2879 2995468984 2995463766 Bacteria 8577691
2880 2997454709 2997451912 Bacteria 8492419
2881 2997604408 2997600082 Bacteria 9896405
2882 3001890217 3001889506 Bacteria 2975194
2883 3006328419 3006321560 Bacteria 8247479
2884 3006397170 3006393351 Bacteria 6615579
2885 3006493767 3006486233 Bacteria 8157040
2886 637881747 637000116 Bacteria 5433628
2887 8008566965 8008558824 Bacteria 10610750
2888 8008578638 8008574985 Bacteria 7815457
2889 8016255440 8016254467 Bacteria 3797036
2890 8023629432 8023623736 Bacteria 8593882
2891 8025413659 8025413630 Bacteria 7014048
2892 8033688027 8033684223 Bacteria 6906479
2893 8047716250 8047710418 Bacteria 11023148
2894 8047897313 8047893842 Bacteria 11723082
2895 8048128226 8048127548 Bacteria 11053136
2896 8048361630 8048356638 Bacteria 11044339
2897 8048374301 8048369669 Bacteria 11666822
2898 8048383922 8048379754 Bacteria 11877923
2899 8048412639 8048406513 Bacteria 8936924
2900 8053948275 8053945823 Bacteria 8962862
2901 8054609689 8054609563 Bacteria 5170090
2902 8055039342 8055037949 Bacteria 3337834
2903 8056055917 8056054917 Bacteria 5736694
2904 8056669270 8056667051 Bacteria 6953971
2905 8056833391 8056829672 Bacteria 9045328
2906 Ga0496104_0263866
2907 LJQas_1006181
2908 JGI24740J21852_10010698
2909 JGI24739J22299_10008515
2910 JGI24739J22299_10022577
2911 JGI24737J22298_10015391
2912 JGI24737J22298_10021201
2913 JGI24737J22298_10029497
2914 JGI24737J22298_10038101
2915 JGI24735J21928_10010075
2916 JGI24735J21928_10017076
2917 JGI24735J21928_10041415
2918 JGI25406J46586_10049571
2919 JGI25165J46597_1001642
2920 JGI25160J50197_1009291
2921 JGI25407J50210_10002920
2922 Ga0006562J51391_1097815
2923 Ga0006562J51391_1097816
2924 Ga0006562J51391_1141224
2925 Ga0055539_1000069
2926 Ga0055533_1000037
2927 Ga0055525_1000308
2928 Ga0055525_1002484
2929 Ga0055542_1000048
2930 Ga0055529_1000057
2931 Ga0055541_1003380
2932 Ga0065714_10149987
2933 Ga0070658_10000415
2934 Ga0070658_10001574
2935 Ga0070658_10051772
2936 Ga0070658_10055835
2937 Ga0070658_10065330
2938 Ga0070658_10077738
2939 Ga0070658_10095203
2940 Ga0070658_10097029
2941 Ga0070658_10293561
2942 Ga0070658_10374793
2943 Ga0070658_10725952
2944 Ga0070676_10110833
2945 Ga0070676_10616354
2946 Ga0070683_100037712
2947 Ga0070683_100087143
2948 Ga0070683_100125312
2949 Ga0070683_100305356
2950 Ga0070683_100393433
2951 Ga0070683_100707880
2952 Ga0070683_100859841
2953 Ga0070683_101012683
2954 Ga0070690_100056083
2955 Ga0070690_100263589
2956 Ga0070670_100677635
2957 Ga0068869_100344341
2958 Ga0068869_100805627
2959 Ga0070666_10007989
2960 Ga0070666_10030303
2961 Ga0070680_100000038
2962 Ga0070680_100000467
2963 Ga0070680_100141605
2964 Ga0070682_100022400
2965 Ga0070682_100082438
2966 Ga0070682_100274694
2967 Ga0068868_100000864
2968 Ga0068868_100023554
2969 Ga0068868_100059263
2970 Ga0068868_100140090
2971 Ga0070660_100006957
2972 Ga0070660_100068880
2973 Ga0070660_100089337
2974 Ga0070660_100111603
2975 Ga0070689_100220033
2976 Ga0070687_100169548
2977 Ga0070687_100320902
2978 Ga0070661_100092982
2979 Ga0070661_100136261
2980 Ga0070661_100296885
2981 Ga0070692_10097904
2982 Ga0070692_10123054
2983 Ga0070692_10208333
2984 Ga0070668_100210366
2985 Ga0070668_100434417
2986 Ga0070668_100535542
2987 Ga0070669_100058354
2988 Ga0070669_100094132
2989 Ga0070669_100510555
2990 Ga0070675_100000912
2991 Ga0070675_100135351
2992 Ga0070675_100412298
2993 Ga0070675_100842838
2994 Ga0070671_100007886
2995 Ga0070674_100024914
2996 Ga0070674_100078367
2997 Ga0070674_100146501
2998 Ga0070674_100207359
2999 Ga0070673_100233061
3000 Ga0070688_100365578
3001 Ga0070659_100000776
3002 Ga0070659_100013798
3003 Ga0070659_100028481
3004 Ga0070659_100073374
3005 Ga0070659_100353141
3006 Ga0070659_100356656
3007 Ga0070659_100399631
3008 Ga0070659_100700522
3009 Ga0070667_100000930
3010 Ga0070667_100001027
3011 Ga0070667_100035660
3012 Ga0070667_100182987
3013 Ga0070667_100374200
3014 Ga0070667_100472934
3015 Ga0070703_10000050
3016 Ga0070709_10033541
3017 Ga0070709_10130897
3018 Ga0070709_10297154
3019 Ga0070714_100000126
3020 Ga0070714_100116435
3021 Ga0070714_100146887
3022 Ga0070714_100494932
3023 Ga0070714_100514800
3024 Ga0070714_100612339
3025 Ga0070713_100069900
3026 Ga0070713_100113339
3027 Ga0070713_100274352
3028 Ga0070713_100485796
3029 Ga0070710_10000045
3030 Ga0070710_10039271
3031 Ga0070710_10050163
3032 Ga0070710_10052775
3033 Ga0070701_10205661
3034 Ga0070701_10264772
3035 Ga0070711_100039884
3036 Ga0070711_100072345
3037 Ga0070705_100072574
3038 Ga0070705_100079788
3039 Ga0070705_100175731
3040 Ga0070705_100183384
3041 Ga0070700_100000041
3042 Ga0070700_100056378
3043 Ga0070700_100067447
3044 Ga0070700_100129866
3045 Ga0070694_100038596
3046 Ga0070708_100001634
3047 Ga0070708_100022773
3048 Ga0070708_100061188
3049 Ga0070708_100080735
3050 Ga0070708_100451087
3051 Ga0070663_100013940
3052 Ga0070663_100057616
3053 Ga0070663_100067127
3054 Ga0070663_100125216
3055 Ga0070678_100154560
3056 Ga0070662_100000005
3057 Ga0070662_100033423
3058 Ga0070662_100260973
3059 Ga0070662_100543375
3060 Ga0070662_100546527
3061 Ga0070681_10000139
3062 Ga0070681_10005819
3063 Ga0070681_10006001
3064 Ga0070681_10233929
3065 Ga0070681_10657555
3066 Ga0070681_10696009
3067 Ga0068867_100064887
3068 Ga0068867_100121611
3069 Ga0070685_10017859
3070 Ga0070706_100002425
3071 Ga0070706_100011726
3072 Ga0070706_100017806
3073 Ga0070706_100064011
3074 Ga0070706_100082597
3075 Ga0070706_100138279
3076 Ga0070706_100156824
3077 Ga0070706_100163271
3078 Ga0070706_100205235
3079 Ga0070707_100011661
3080 Ga0070707_100013509
3081 Ga0070707_100052263
3082 Ga0070707_100070483
3083 Ga0070707_100076550
3084 Ga0070707_100177914
3085 Ga0070707_100261998
3086 Ga0070707_100482739
3087 Ga0070698_100000293
3088 Ga0070698_100000595
3089 Ga0070698_100000670
3090 Ga0070698_100006465
3091 Ga0070698_100008302
3092 Ga0070698_100008631
3093 Ga0070698_100008883
3094 Ga0070698_100027273
3095 Ga0070698_100029836
3096 Ga0070698_100046969
3097 Ga0070698_100298539
3098 Ga0070698_100308921
3099 Ga0070698_100368691
3100 Ga0070698_100404919
3101 Ga0070699_100002142
3102 Ga0070699_100171795
3103 Ga0070699_100233263
3104 Ga0070679_100000026
3105 Ga0070679_100001988
3106 Ga0070679_100027390
3107 Ga0070679_100073317
3108 Ga0070679_100175297
3109 Ga0070679_100181445
3110 Ga0070679_100218364
3111 Ga0070679_100533120
3112 Ga0070679_100736320
3113 Ga0070679_100874575
3114 Ga0070684_100001624
3115 Ga0070684_100002697
3116 Ga0070684_100016762
3117 Ga0070684_100288652
3118 Ga0070684_100385312
3119 Ga0070684_100400167
3120 Ga0070684_100476873
3121 Ga0070684_100511195
3122 Ga0070684_100529579
3123 Ga0070684_100930560
3124 Ga0070697_100002584
3125 Ga0070697_100246201
3126 Ga0068853_100036838
3127 Ga0068853_100055395
3128 Ga0068853_100150353
3129 Ga0070672_100081658
3130 Ga0070672_100160828
3131 Ga0070672_100209370
3132 Ga0070672_100599079
3133 Ga0070686_100112821
3134 Ga0070686_100113015
3135 Ga0070686_100617866
3136 Ga0070696_100008700
3137 Ga0070696_100021443
3138 Ga0070696_100158457
3139 Ga0070693_100002657
3140 Ga0070693_100019030
3141 Ga0070665_100001439
3142 Ga0070665_100036468
3143 Ga0070665_100058592
3144 Ga0070665_100393363
3145 Ga0070704_100281309
3146 Ga0068855_100011249
3147 Ga0068855_100012913
3148 Ga0068855_100114852
3149 Ga0068855_100285484
3150 Ga0068855_100437057
3151 Ga0068855_100689877
3152 Ga0070664_100000216
3153 Ga0070664_100003438
3154 Ga0070664_100080811
3155 Ga0070664_100192605
3156 Ga0070664_100290637
3157 Ga0070664_100891661
3158 Ga0068857_100251966
3159 Ga0068857_100494331
3160 Ga0068854_100253669
3161 Ga0068856_100027919
3162 Ga0068856_100041270
3163 Ga0068856_100133330
3164 Ga0068856_100180059
3165 Ga0070702_100036376
3166 Ga0070702_100203431
3167 Ga0068852_100201612
3168 Ga0068852_100550704
3169 Ga0068859_100288496
3170 Ga0068859_100552439
3171 Ga0068859_100562313
3172 Ga0068864_100464394
3173 Ga0068866_10036130
3174 Ga0068861_100020453
3175 Ga0068861_100064428
3176 Ga0068861_100130604
3177 Ga0068861_100502033
3178 Ga0068851_10104527
3179 Ga0068863_100001135
3180 Ga0068863_100121658
3181 Ga0068863_100340702
3182 Ga0068858_100000034
3183 Ga0068858_100000519
3184 Ga0068858_100007523
3185 Ga0068858_100296702
3186 Ga0068860_100022386
3187 Ga0068860_100354788
3188 Ga0068860_101114104
3189 Ga0081455_10000046
3190 Ga0081455_10001170
3191 Ga0081455_10003133
3192 Ga0081455_10020993
3193 Ga0081455_10028965
3194 Ga0081455_10043362
3195 Ga0081455_10066811
3196 Ga0081538_10000139
3197 Ga0081538_10000973
3198 Ga0081538_10009168
3199 Ga0081540_1015598
3200 Ga0081540_1037176
3201 Ga0081540_1041674
3202 Ga0081539_10001917
3203 Ga0081539_10008049
3204 Ga0081539_10022431
3205 Ga0081539_10095258
3206 Ga0070717_10012285
3207 Ga0070717_10017562
3208 Ga0070717_10061334
3209 Ga0070717_10176317
3210 Ga0070717_10223000
3211 Ga0075365_10000549
3212 Ga0075365_10005313
3213 Ga0075365_10006845
3214 Ga0075365_10029035
3215 Ga0075365_10071084
3216 Ga0075365_10084415
3217 Ga0075365_10192053
3218 Ga0075365_10192338
3219 Ga0075365_10238565
3220 Ga0075365_10318830
3221 Ga0075368_10000543
3222 Ga0075368_10009348
3223 Ga0075368_10020207
3224 Ga0075368_10031714
3225 Ga0075363_100000422
3226 Ga0075363_100022144
3227 Ga0075363_100044863
3228 Ga0075363_100062240
3229 Ga0075363_100243875
3230 Ga0075364_10000256
3231 Ga0075364_10019013
3232 Ga0075364_10026514
3233 Ga0075364_10047980
3234 Ga0075364_10070972
3235 Ga0075364_10096039
3236 Ga0075364_10179288
3237 Ga0075364_10284040
3238 Ga0075364_10408719
3239 Ga0075364_10472009
3240 Ga0075432_10005086
3241 Ga0075432_10005816
3242 Ga0070715_10133746
3243 Ga0070716_100082426
3244 Ga0070716_100264959
3245 Ga0070716_100306739
3246 Ga0070712_100034487
3247 Ga0070712_100057592
3248 Ga0070712_100083212
3249 Ga0070712_100133375
3250 Ga0070712_100206835
3251 Ga0070712_100258812
3252 Ga0075362_10016208
3253 Ga0075367_10002757
3254 Ga0075367_10025818
3255 Ga0075367_10046090
3256 Ga0075367_10137917
3257 Ga0075369_10002615
3258 Ga0097621_100144312
3259 Ga0097621_100606968
3260 Ga0075370_10104117
3261 Ga0068871_100056669
3262 Ga0068871_100139371
3263 Ga0068871_100193665
3264 Ga0075428_100010069
3265 Ga0075428_100013993
3266 Ga0075428_100026841
3267 Ga0075428_100119832
3268 Ga0075428_100153114
3269 Ga0075430_100001887
3270 Ga0075430_100002175
3271 Ga0075430_100172431
3272 Ga0075431_100001708
3273 Ga0075431_100007675
3274 Ga0075431_100014473
3275 Ga0075431_100240025
3276 Ga0075431_100240740
3277 Ga0075431_100740499
3278 Ga0075433_10003428
3279 Ga0075434_100001158
3280 Ga0075434_100001999
3281 Ga0075434_100176319
3282 Ga0075434_100449418
3283 Ga0075434_100800935
3284 Ga0075429_100003236
3285 Ga0075429_100007203
3286 Ga0075429_100146451
3287 Ga0075429_100256222
3288 Ga0068865_100016895
3289 Ga0068865_100064220
3290 Ga0068865_100076413
3291 Ga0068865_100451573
3292 Ga0075436_100199227
3293 Ga0097620_100288472
3294 Ga0097620_100552515
3295 Ga0097620_100562312
3296 Ga0099826_10062312
3297 Ga0075435_100032705
3298 Ga0099794_10021718
3299 Ga0105251_10045565
3300 Ga0105251_10103556
3301 Ga0105251_10188747
3302 Ga0105244_10230766
3303 Ga0105240_10035367
3304 Ga0105240_10047673
3305 Ga0105240_10110085
3306 Ga0105240_10179399
3307 Ga0111539_10010664
3308 Ga0111539_10015651
3309 Ga0111539_10058003
3310 Ga0111539_10065104
3311 Ga0111539_10069508
3312 Ga0111539_10415922
3313 Ga0111539_10986491
3314 Ga0111539_11268427
3315 Ga0105245_10028995
3316 Ga0105245_10034861
3317 Ga0105245_10083076
3318 Ga0105245_10101197
3319 Ga0105245_10115302
3320 Ga0105245_10139973
3321 Ga0105245_10158346
3322 Ga0105245_10203358
3323 Ga0105245_10362379
3324 Ga0105245_10476814
3325 Ga0105245_10705382
3326 Ga0105245_10790336
3327 Ga0105247_10000075
3328 Ga0105247_10002944
3329 Ga0105247_10227418
3330 Ga0114129_10005450
3331 Ga0114129_10010215
3332 Ga0114129_10057998
3333 Ga0114129_10189664
3334 Ga0105243_10004875
3335 Ga0105243_10006484
3336 Ga0105243_10055430
3337 Ga0105243_10104437
3338 Ga0105243_10221961
3339 Ga0105243_10302664
3340 Ga0105243_10324459
3341 Ga0105243_10378643
3342 Ga0105243_10422742
3343 Ga0105243_10524482
3344 Ga0105243_10636697
3345 Ga0105243_10759267
3346 Ga0105243_10938025
3347 Ga0105241_10010098
3348 Ga0105241_10495298
3349 Ga0105242_10006982
3350 Ga0105242_10009725
3351 Ga0105242_10045134
3352 Ga0105242_10146886
3353 Ga0105242_10255940
3354 Ga0105242_10300082
3355 Ga0105242_10731460
3356 Ga0105248_10001951
3357 Ga0105248_10076949
3358 Ga0105248_10077050
3359 Ga0105248_10192671
3360 Ga0105248_10398480
3361 Ga0105237_10042732
3362 Ga0105237_10048564
3363 Ga0105237_10052524
3364 Ga0105237_10074187
3365 Ga0105238_10000028
3366 Ga0105238_10033337
3367 Ga0105238_10064439
3368 Ga0105238_10410411
3369 Ga0105238_10507134
3370 Ga0105238_10778853
3371 Ga0105238_10968610
3372 Ga0105249_10042938
3373 Ga0105249_10064988
3374 Ga0105249_10134510
3375 Ga0105249_10147162
3376 Ga0105249_10160930
3377 Ga0105249_10393663
3378 Ga0099796_10050610
3379 Ga0105239_10009367
3380 Ga0105239_10023467
3381 Ga0105239_10026377
3382 Ga0105239_10071776
3383 Ga0105239_10147230
3384 Ga0105239_10161730
3385 Ga0105239_10331665
3386 Ga0105239_10491199
3387 Ga0105239_10635767
3388 Ga0105246_10009675
3389 Ga0105246_10082295
3390 Ga0105246_10266064
3391 Ga0105246_10322005
3392 Ga0105246_10439333
3393 Ga0105246_10743539
3394 Ga0157373_10557791
3395 Ga0157371_10522257
3396 Ga0157370_10136742
3397 Ga0157370_10213844
3398 Ga0157370_10407425
3399 Ga0157370_10556568
3400 Ga0157370_10634195
3401 Ga0157369_10000311
3402 Ga0157369_10011696
3403 Ga0157369_10083249
3404 Ga0157369_10125241
3405 Ga0157369_10183892
3406 Ga0157369_10316737
3407 Ga0157369_10494731
3408 Ga0157369_10556116
3409 Ga0157369_11114911
3410 Ga0157374_10058090
3411 Ga0157374_10116509
3412 Ga0157374_10622853
3413 Ga0157374_11146348
3414 Ga0157378_10008086
3415 Ga0157378_10037874
3416 Ga0157378_10838568
3417 Ga0163162_10008306
3418 Ga0163162_10127997
3419 Ga0163162_10136601
3420 Ga0163162_10267574
3421 Ga0163162_10414303
3422 Ga0163162_10629695
3423 Ga0157372_10000131
3424 Ga0157372_10052343
3425 Ga0157372_10054888
3426 Ga0157372_10058414
3427 Ga0157372_10144279
3428 Ga0157372_10296785
3429 Ga0157372_10486700
3430 Ga0157372_10700345
3431 Ga0157372_10726962
3432 Ga0157372_11187073
3433 Ga0157375_10041087
3434 Ga0157375_10053293
3435 Ga0157375_10103381
3436 Ga0157375_10107704
3437 Ga0157375_10200983
3438 Ga0157375_10250234
3439 Ga0157375_10423958
3440 Ga0157375_10477746
3441 Ga0157375_10601108
3442 Ga0157375_10931066
3443 Ga0157375_11347361
3444 Ga0163163_10040375
3445 Ga0163163_10190561
3446 Ga0163163_10349228
3447 Ga0163163_10383723
3448 Ga0163163_10426751
3449 Ga0163163_10520858
3450 Ga0163163_10537617
3451 Ga0163163_10727492
3452 Ga0163163_10762723
3453 Ga0163163_10900996
3454 Ga0163163_11378454
3455 Ga0157380_10025616
3456 Ga0157380_10179481
3457 Ga0157380_10327589
3458 Ga0157380_10329291
3459 Ga0157380_10385713
3460 Ga0157380_10394097
3461 Ga0157380_11083223
3462 Ga0182008_10000766
3463 Ga0157377_10021826
3464 Ga0157377_10075460
3465 Ga0157377_10101330
3466 Ga0157377_10112907
3467 Ga0157377_10369534
3468 Ga0157377_10461502
3469 Ga0157379_10000407
3470 Ga0157379_10014251
3471 Ga0157379_10018606
3472 Ga0157379_10070968
3473 Ga0157379_10270050
3474 Ga0157376_10152167
3475 Ga0157376_10452160
3476 Ga0157376_10606213
3477 Ga0182006_1022682
3478 Ga0182007_10001033
3479 Ga0183367_1008
3480 Ga0163161_10036971
3481 Ga0163161_10155650
3482 Ga0163161_10206975
3483 Ga0197907_10099213
3484 Ga0197907_10149748
3485 Ga0197907_10258559
3486 Ga0197907_10667558
3487 Ga0197907_11019075
3488 Ga0206356_10808405
3489 Ga0206356_11042554
3490 Ga0206349_1497713
3491 Ga0206355_1319644
3492 Ga0206351_10742812
3493 Ga0206352_10167612
3494 Ga0206350_10857344
3495 Ga0206350_11200495
3496 Ga0206354_10004643
3497 Ga0206354_10249832
3498 Ga0206354_10491255
3499 Ga0206353_10114684
3500 Ga0206353_10316218
3501 Ga0206353_10713643
3502 Ga0206353_10801422
3503 Ga0206353_10848721
3504 Ga0206353_11794140
3505 Ga0206353_11939773
3506 Ga0213874_10003186
3507 Ga0213875_10000209
3508 Ga0213875_10041934
3509 Ga0213875_10097948
3510 Ga0213875_10100186
3511 Ga0224712_10030602
3512 Ga0224712_10034033
3513 Ga0224712_10061184
3514 Ga0224712_10071077
3515 Ga0224712_10099392
3516 Ga0224712_10099674
3517 Ga0224712_10138845
3518 Ga0256743_122685
3519 Ga0224572_1000445
3520 Ga0224572_1003147
3521 Ga0209566_100283
3522 Ga0209674_100001
3523 Ga0209672_100011
3524 Ga0209147_100592
3525 Ga0209563_100001
3526 Ga0209563_101620
3527 Ga0207427_100028
3528 Ga0209437_100557
3529 Ga0209258_106621
3530 Ga0209677_100001
3531 Ga0209148_1000023
3532 Ga0209233_1000001
3533 Ga0209455_1000023
3534 Ga0209455_1003409
3535 Ga0209758_1005384
3536 Ga0207426_1003485
3537 Ga0209051_1000033
3538 Ga0207697_10003672
3539 Ga0207656_10318779
3540 Ga0207653_10000062
3541 Ga0207692_10046634
3542 Ga0207692_10088375
3543 Ga0207710_10000095
3544 Ga0207710_10000121
3545 Ga0207710_10053732
3546 Ga0207710_10089476
3547 Ga0207688_10002981
3548 Ga0207688_10008852
3549 Ga0207688_10013191
3550 Ga0207688_10088126
3551 Ga0207680_10006757
3552 Ga0207680_10092974
3553 Ga0207647_10013290
3554 Ga0207647_10019317
3555 Ga0207647_10034361
3556 Ga0207647_10039353
3557 Ga0207647_10060522
3558 Ga0207685_10026982
3559 Ga0207685_10091291
3560 Ga0207685_10165749
3561 Ga0207699_10014037
3562 Ga0207699_10220009
3563 Ga0207699_10402021
3564 Ga0207645_10005011
3565 Ga0207645_10090931
3566 Ga0207645_10164913
3567 Ga0207643_10009362
3568 Ga0207705_10000914
3569 Ga0207705_10003492
3570 Ga0207705_10015364
3571 Ga0207705_10076976
3572 Ga0207705_10096484
3573 Ga0207705_10114589
3574 Ga0207705_10144958
3575 Ga0207705_10239505
3576 Ga0207705_10363227
3577 Ga0207684_10000325
3578 Ga0207684_10042642
3579 Ga0207684_10085401
3580 Ga0207684_10090959
3581 Ga0207684_10136965
3582 Ga0207684_10261779
3583 Ga0207654_10072623
3584 Ga0207654_10407280
3585 Ga0207707_10000071
3586 Ga0207707_10000543
3587 Ga0207707_10006373
3588 Ga0207707_10204305
3589 Ga0207707_10703257
3590 Ga0207707_10733460
3591 Ga0207695_10037346
3592 Ga0207671_10022072
3593 Ga0207671_10032921
3594 Ga0207671_10088218
3595 Ga0207693_10000726
3596 Ga0207693_10062461
3597 Ga0207693_10078837
3598 Ga0207693_10091793
3599 Ga0207693_10262180
3600 Ga0207693_10489977
3601 Ga0207663_10083195
3602 Ga0207663_10103780
3603 Ga0207663_10481868
3604 Ga0207660_10000123
3605 Ga0207660_10000671
3606 Ga0207660_10018789
3607 Ga0207660_10040609
3608 Ga0207660_10149363
3609 Ga0207660_10542049
3610 Ga0207662_10008849
3611 Ga0207662_10053769
3612 Ga0207657_10013582
3613 Ga0207657_10023988
3614 Ga0207657_10031925
3615 Ga0207657_10090298
3616 Ga0207657_10091277
3617 Ga0207657_10116008
3618 Ga0207649_10020694
3619 Ga0207652_10000088
3620 Ga0207652_10000393
3621 Ga0207652_10022541
3622 Ga0207652_10145738
3623 Ga0207652_10171444
3624 Ga0207652_10215196
3625 Ga0207652_10241052
3626 Ga0207652_10674217
3627 Ga0207646_10012234
3628 Ga0207646_10018813
3629 Ga0207646_10046818
3630 Ga0207646_10055137
3631 Ga0207646_10058050
3632 Ga0207646_10062231
3633 Ga0207646_10097329
3634 Ga0207646_10105120
3635 Ga0207646_10109535
3636 Ga0207646_10130729
3637 Ga0207646_10142801
3638 Ga0207681_10092365
3639 Ga0207694_10000008
3640 Ga0207694_10079935
3641 Ga0207694_10228059
3642 Ga0207694_10479844
3643 Ga0207650_10313778
3644 Ga0207659_10007761
3645 Ga0207687_10000352
3646 Ga0207687_10010493
3647 Ga0207687_10013718
3648 Ga0207687_10061098
3649 Ga0207687_10109062
3650 Ga0207687_10116893
3651 Ga0207687_10268492
3652 Ga0207687_10290048
3653 Ga0207687_10407566
3654 Ga0207687_10662844
3655 Ga0207700_10010987
3656 Ga0207700_10047959
3657 Ga0207700_10182155
3658 Ga0207700_10312688
3659 Ga0207664_10000082
3660 Ga0207664_10002032
3661 Ga0207664_10015138
3662 Ga0207664_10084011
3663 Ga0207664_10116579
3664 Ga0207664_10335875
3665 Ga0207664_10480473
3666 Ga0207664_10491050
3667 Ga0207644_10055420
3668 Ga0207644_10096167
3669 Ga0207690_10000172
3670 Ga0207690_10004690
3671 Ga0207690_10016798
3672 Ga0207690_10140158
3673 Ga0207690_10214249
3674 Ga0207690_10257766
3675 Ga0207690_10291689
3676 Ga0207690_10343417
3677 Ga0207690_10384910
3678 Ga0207690_10405701
3679 Ga0207690_10776404
3680 Ga0207706_10000006
3681 Ga0207706_10007345
3682 Ga0207706_10037660
3683 Ga0207706_10049539
3684 Ga0207706_10051105
3685 Ga0207686_10011415
3686 Ga0207686_10023251
3687 Ga0207686_10264048
3688 Ga0207709_10013215
3689 Ga0207709_10031345
3690 Ga0207709_10055497
3691 Ga0207709_10348788
3692 Ga0207709_10350666
3693 Ga0207709_10428940
3694 Ga0207670_10209393
3695 Ga0207669_10076561
3696 Ga0207669_10080357
3697 Ga0207669_10093008
3698 Ga0207669_10112966
3699 Ga0207669_10155758
3700 Ga0207669_10245242
3701 Ga0207669_10393912
3702 Ga0207704_10009312
3703 Ga0207704_10105545
3704 Ga0207704_10126196
3705 Ga0207665_10014299
3706 Ga0207665_10033009
3707 Ga0207665_10077349
3708 Ga0207665_10296498
3709 Ga0207691_10171115
3710 Ga0207691_10337497
3711 Ga0207691_10487057
3712 Ga0207691_10515959
3713 Ga0207711_10003892
3714 Ga0207689_10103809
3715 Ga0207661_10011173
3716 Ga0207661_10016468
3717 Ga0207661_10133254
3718 Ga0207661_10247501
3719 Ga0207661_10273404
3720 Ga0207661_10719008
3721 Ga0207679_10001914
3722 Ga0207679_10016001
3723 Ga0207679_10065139
3724 Ga0207679_10123442
3725 Ga0207679_10213495
3726 Ga0207679_10458171
3727 Ga0207667_10013652
3728 Ga0207667_10040466
3729 Ga0207667_10050841
3730 Ga0207667_10102152
3731 Ga0207667_10223386
3732 Ga0207667_10695643
3733 Ga0207667_10822740
3734 Ga0207651_10168974
3735 Ga0207651_10187302
3736 Ga0207651_10393210
3737 Ga0207712_10068943
3738 Ga0207712_10990569
3739 Ga0207668_10182609
3740 Ga0207668_10465694
3741 Ga0207640_10425287
3742 Ga0207658_10002007
3743 Ga0207658_10028306
3744 Ga0207658_10125979
3745 Ga0207658_10173560
3746 Ga0207658_10178010
3747 Ga0207658_10215944
3748 Ga0207658_10782797
3749 Ga0207677_10000760
3750 Ga0207677_10006413
3751 Ga0207677_10008340
3752 Ga0207677_10027898
3753 Ga0207677_10236352
3754 Ga0207677_10394584
3755 Ga0207677_10596916
3756 Ga0207703_10000057
3757 Ga0207703_10000813
3758 Ga0207703_10007359
3759 Ga0207703_10026844
3760 Ga0207703_10035199
3761 Ga0207703_10044857
3762 Ga0207703_10387666
3763 Ga0207639_10026200
3764 Ga0207639_10123165
3765 Ga0207639_10125280
3766 Ga0207639_10817469
3767 Ga0207678_10006757
3768 Ga0207678_10018447
3769 Ga0207678_10242872
3770 Ga0207708_10002986
3771 Ga0207708_10003588
3772 Ga0207708_10011953
3773 Ga0207708_10053986
3774 Ga0207708_10086897
3775 Ga0207708_10203714
3776 Ga0207702_10070763
3777 Ga0207702_10114094
3778 Ga0207702_10115399
3779 Ga0207702_10291509
3780 Ga0207702_10735379
3781 Ga0207702_10985794
3782 Ga0207641_10002103
3783 Ga0207641_10447189
3784 Ga0207648_10008174
3785 Ga0207648_10029534
3786 Ga0207648_10053691
3787 Ga0207648_10132827
3788 Ga0207648_10248675
3789 Ga0207676_10301412
3790 Ga0207676_10319932
3791 Ga0207676_10341728
3792 Ga0207676_10484444
3793 Ga0207674_10011054
3794 Ga0207674_10035176
3795 Ga0207674_10089127
3796 Ga0207674_10098657
3797 Ga0207674_10145176
3798 Ga0207674_10169316
3799 Ga0207674_10190003
3800 Ga0207674_10331414
3801 Ga0207674_10631673
3802 Ga0207675_100004551
3803 Ga0207675_100050827
3804 Ga0207675_100074293
3805 Ga0207675_100103383
3806 Ga0207675_100212224
3807 Ga0207675_100250576
3808 Ga0207675_100475005
3809 Ga0207683_10118039
3810 Ga0207683_10327725
3811 Ga0207698_10242197
3812 Ga0207698_10588650
3813 Ga0209588_1072720
3814 Ga0209813_10000699
3815 Ga0209813_10003496
3816 Ga0207428_10000832
3817 Ga0207428_10003736
3818 Ga0207428_10015943
3819 Ga0268266_10032319
3820 Ga0268266_10145437
3821 Ga0268266_10156808
3822 Ga0268266_10218007
3823 Ga0268266_10416341
3824 Ga0268265_10181560
3825 Ga0268264_10000226
3826 Ga0268264_10023727
3827 Ga0268264_10261350
3828 Ga0268264_10362342
3829 Ga0268264_10711516
3830 Ga0265326_10000721
3831 Ga0265319_1001125
3832 Ga0265334_10001080
3833 Ga0265322_10006589
3834 Ga0265336_10018431
3835 Ga0307517_10017001
3836 Ga0307517_10226120
3837 Ga0307515_10006510
3838 Ga0307515_10023498
3839 Ga0307515_10066567
3840 Ga0307515_10484648
3841 Ga0265338_10000739
3842 Ga0265338_10001458
3843 Ga0265338_10004856
3844 Ga0265324_10001298
3845 Ga0268256_1019085
3846 Ga0307511_10000018
3847 Ga0307511_10000678
3848 Ga0307511_10050610
3849 Ga0307511_10090245
3850 Ga0307511_10092449
3851 Ga0307512_10008326
3852 Ga0307512_10011092
3853 Ga0307512_10012743
3854 Ga0316177_1011649
3855 Ga0316176_1055943
3856 Ga0316176_1079855
3857 Ga0314311_1038622
3858 Ga0316178_1059711
3859 Ga0316178_1062364
3860 Ga0316182_1156322
3861 Ga0265332_10002373
3862 Ga0265320_10004222
3863 Ga0265325_10001663
3864 Ga0265340_10002561
3865 Ga0265339_10021165
3866 Ga0307513_10000002
3867 Ga0307513_10006778
3868 Ga0307513_10059260
3869 Ga0307513_10066088
3870 Ga0307513_10173126
3871 Ga0307509_10143827
3872 Ga0307509_10536741
3873 Ga0307408_100011471
3874 Ga0307408_100054155
3875 Ga0307408_100056459
3876 Ga0307408_100174612
3877 Ga0307408_100230590
3878 Ga0307408_100456507
3879 Ga0307408_100756585
3880 Ga0265313_10058980
3881 Ga0307508_10005457
3882 Ga0307508_10007816
3883 Ga0307508_10013420
3884 Ga0307508_10045212
3885 Ga0307508_10198705
3886 Ga0307508_10349994
3887 Ga0307508_10463688
3888 Ga0307514_10005558
3889 Ga0307514_10074032
3890 Ga0307514_10099614
3891 Ga0307514_10121935
3892 Ga0307514_10193664
3893 Ga0307514_10261253
3894 Ga0316575_10008356
3895 Ga0316579_10015042
3896 Ga0265314_10012006
3897 Ga0265342_10001188
3898 Ga0316576_10003924
3899 Ga0316576_10215604
3900 Ga0316576_10286711
3901 Ga0316578_10063488
3902 Ga0307516_10019666
3903 Ga0307516_10108515
3904 Ga0307516_10261392
3905 Ga0307516_10263393
3906 Ga0307405_10002768
3907 Ga0307405_10024608
3908 Ga0307405_10050672
3909 Ga0307405_10303988
3910 Ga0307405_10335536
3911 Ga0307405_10337446
3912 Ga0307405_10521030
3913 Ga0316577_10022010
3914 Ga0307413_10021902
3915 Ga0307413_10051437
3916 Ga0307413_10202266
3917 Ga0307413_10269769
3918 Ga0307413_10286195
3919 Ga0307413_10349790
3920 Ga0307413_10420582
3921 Ga0307413_10424300
3922 Ga0307413_10425479
3923 Ga0307413_10689249
3924 Ga0307518_10266484
3925 Ga0307410_10000409
3926 Ga0307410_10009061
3927 Ga0307410_10019624
3928 Ga0307410_10019657
3929 Ga0307410_10048365
3930 Ga0307410_10085240
3931 Ga0307410_10228763
3932 Ga0307410_10261210
3933 Ga0326468_10009393
3934 Ga0307406_10000212
3935 Ga0307406_10014963
3936 Ga0307406_10039669
3937 Ga0307406_10195501
3938 Ga0307406_10214215
3939 Ga0307406_10247882
3940 Ga0307406_10517217
3941 Ga0307406_10925109
3942 Ga0307407_10000816
3943 Ga0307407_10006985
3944 Ga0307407_10009183
3945 Ga0307407_10010295
3946 Ga0307407_10060189
3947 Ga0307407_10202173
3948 Ga0307407_10267058
3949 Ga0307407_10286412
3950 Ga0307407_10317313
3951 Ga0307407_10403066
3952 Ga0307407_10695635
3953 Ga0307412_10009769
3954 Ga0307412_10068794
3955 Ga0307412_10077149
3956 Ga0307412_10100355
3957 Ga0307412_10190309
3958 Ga0307412_10365758
3959 Ga0307409_100000551
3960 Ga0307409_100009519
3961 Ga0307409_100014234
3962 Ga0307409_100015509
3963 Ga0307409_100040876
3964 Ga0307409_100051496
3965 Ga0307409_100056417
3966 Ga0307409_100086873
3967 Ga0307409_100136903
3968 Ga0307409_100205429
3969 Ga0307409_100336130
3970 Ga0307409_100339694
3971 Ga0307409_100346222
3972 Ga0307409_100580930
3973 Ga0307409_100600947
3974 Ga0307409_100684353
3975 Ga0307409_100938240
3976 Ga0307409_100983462
3977 Ga0307416_100000892
3978 Ga0307416_100045773
3979 Ga0307416_100059585
3980 Ga0307416_100062829
3981 Ga0307416_100072300
3982 Ga0307416_100091602
3983 Ga0307416_100114070
3984 Ga0307416_100133123
3985 Ga0307416_100174525
3986 Ga0307416_100199077
3987 Ga0307416_100215641
3988 Ga0307416_100251107
3989 Ga0307416_100275511
3990 Ga0307416_100289985
3991 Ga0307416_100355744
3992 Ga0307416_100481205
3993 Ga0307416_100657451
3994 Ga0307416_100702405
3995 Ga0307416_100828352
3996 Ga0307416_100837487
3997 Ga0307416_100859687
3998 Ga0307416_100960273
3999 Ga0307414_10091914
4000 Ga0307414_10145540
4001 Ga0307414_10154966
4002 Ga0307414_10189630
4003 Ga0307414_10722264
4004 Ga0307414_10795035
4005 Ga0307411_10028347
4006 Ga0307411_10068007
4007 Ga0307411_10195499
4008 Ga0307411_10209133
4009 Ga0307411_10524823
4010 Ga0307411_10659587
4011 Ga0307411_10773990
4012 Ga0307415_100011906
4013 Ga0307415_100020019
4014 Ga0307415_100022865
4015 Ga0307415_100026762
4016 Ga0307415_100037109
4017 Ga0307415_100096744
4018 Ga0307415_100105588
4019 Ga0307415_100136764
4020 Ga0307415_100146426
4021 Ga0307415_100168712
4022 Ga0307415_100168905
4023 Ga0307415_100296427
4024 Ga0307415_100331038
4025 Ga0307415_100535361
4026 Ga0307415_100962508
4027 Ga0316583_10005921
4028 Ga0316585_10001956
4029 Ga0316580_10004754
4030 Ga0307507_10030933
4031 Ga0307507_10040586
4032 Ga0307507_10085604
4033 Ga0307510_10014944
4034 Ga0373926_0000405
4035 Ga0373926_0005280
4036 Ga0373929_0005121
4037 Ga0373934_0054652
4038 Ga0373934_0073037
4039 Ga0373944_0000004
4040 Ga0373952_0023666
4041 Ga0373923_0003863
4042 Ga0373923_0242235
4043 Ga0373936_0002733
4044 Ga0373936_0164595
4045 Ga0373941_0016159
4046 Ga0373945_0007123
4047 Ga0373945_0031937
4048 Ga0373953_0001003
4049 Ga0373953_0027543
4050 Ga0373954_0036467
4051 Ga0373956_0003417
4052 Ga0373956_0054340
4053 Ga0373956_0066354
4054 Ga0373957_0070122
4055 Ga0373960_0025358
4056 Ga0373943_0001706
4057 Ga0373943_0078258
4058 Ga0373943_0123468
4059 Ga0373946_0000393
4060 Ga0373946_0052646
4061 Ga0373955_0096063
4062 Ga0373961_0025207
4063 Ga0373924_0002841
4064 Ga0373935_0002409
4065 Ga0373935_0028004
4066 Ga0373935_0029215
4067 Ga0373935_0262498
4068 Ga0373927_0000623
4069 Ga0373927_0484334
4070 Ga0373933_0002530
4071 Ga0373933_0020887
4072 Ga0373933_0032042
4073 Ga0373947_0002475
4074 Ga0373947_0002807
4075 Ga0373947_0030220
4076 Ga0373947_0084718
4077 Ga0373947_0232202
4078 Ga0373937_0002929
4079 Ga0373937_0040932
4080 Ga0373937_0043592
4081 Ga0373937_0205822
4082 Ga0373937_0575612
4083 Ga0316582_0034093
4084 Ga0316584_0009242
4085 Ga0373925_0008611
4086 Ga0373925_0079341
4087 Ga0373925_0085253
4088 Ga0373925_0462672
4089 Ga0395899_0010951
4090 Ga0395899_0047160
4091 Ga0395899_0064100
4092 Ga0395899_0175576
4093 Ga0395900_0001826
4094 Ga0395900_0011591
4095 Ga0395900_0015079
4096 Ga0395900_0021604
4097 Ga0395900_0024839
4098 Ga0395900_0037600
4099 Ga0395900_0051815
4100 Ga0395900_0055447
4101 Ga0395900_0062055
4102 Ga0395900_0141834
4103 Ga0395900_0153093
4104 Ga0395900_0166620
4105 Ga0395900_0181966
4106 Ga0395900_0385549
4107 Ga0395900_0466159
4108 Ga0395900_0540997
4109 Ga0395900_0667311
4110 Ga0395900_0890295
4111 Ga0395898_0000100
4112 Ga0395898_0003889
4113 Ga0395898_0017408
4114 Ga0395898_0054233
4115 Ga0395898_0062000
4116 Ga0395898_0067650
4117 Ga0395898_0096501
4118 Ga0395898_0184004
4119 Ga0395898_0204397
4120 Ga0395898_0423859
4121 Ga0395898_0863442
4122 Ga0395905_0016703
4123 Ga0395905_0020717
4124 Ga0395905_0125842
4125 Ga0395905_0340895
4126 Ga0395905_0403355
4127 Ga0316581_0001603
4128 Ga0436364_0069665
4129 Ga0436364_0136911
4130 Ga0436364_0193728
4131 Ga0436364_0415392
4132 Ga0436364_0630197
4133 Ga0436364_0783642
4134 Ga0436364_1363958
4135 Ga0436364_1380637
4136 Ga0395901_0011064
4137 Ga0395901_0012052
4138 Ga0395901_0019196
4139 Ga0395901_0044031
4140 Ga0395901_0082185
4141 Ga0395901_0086665
4142 Ga0395901_0104011
4143 Ga0395901_0112412
4144 Ga0395901_0144777
4145 Ga0395901_0154186
4146 Ga0395901_0190352
4147 Ga0395901_0239003
4148 Ga0395901_0242130
4149 Ga0395901_0244171
4150 Ga0395901_0337302
4151 Ga0436365_0220000
4152 Ga0436365_0252441
4153 Ga0436360_0074050
4154 Ga0436360_0277941
4155 Ga0436360_0484994
4156 Ga0436363_0668458
4157 Ga0436363_1341732
4158 Ga0436362_0621323
4159 Ga0436362_0676178
4160 Ga0439436_0001318
4161 Ga0439436_0021174
4162 Ga0439438_031389
4163 Ga0439439_0006078
4164 Ga0439439_0089780
4165 Ga0439447_016397
4166 Ga0439466_0119386
4167 Ga0451791_0823639
4168 Ga0451791_1778226
4169 Ga0451791_1902291
4170 Ga0451793_1728370
4171 Ga0451797_0569201
4172 Ga0451795_0729969
4173 Ga0451802_1141136
4174 Ga0451833_0813952
4175 Ga0451837_0303883
4176 Ga0451837_1483773
4177 Ga0451843_1651104
4178 Ga0451853_0720412
4179 Ga0439431_0026641
4180 Ga0439433_0000990
4181 Ga0439442_021142
4182 Ga0439442_028289
4183 Ga0439445_0050745
4184 Ga0439448_0006033
4185 Ga0439448_0086018
4186 Ga0439432_040017
4187 Ga0439449_0000357
4188 Ga0439449_0021498
4189 Ga0439450_034222
4190 Ga0439455_0003808
4191 Ga0439457_001232
4192 Ga0439457_002347
4193 Ga0439457_034608
4194 Ga0450890_002060
4195 Ga0450894_000050
4196 Ga0450896_002013
4197 Ga0450898_011304
4198 Ga0450899_000125
4199 Ga0450903_000183
4200 Ga0450906_001478
4201 Ga0450907_009034
4202 Ga0450910_011056
4203 Ga0439446_0061328
4204 Ga0439458_0035562
4205 Ga0439434_0014216
4206 Ga0439434_0015862
4207 Ga0439464_0033866
4208 Ga0439460_0077740
4209 Ga0466969_0001880
4210 Ga0466969_0029779
4211 Ga0466969_0067642
4212 Ga0466969_0117258
4213 Ga0466969_0274902
4214 Ga0466972_0004069
4215 Ga0466972_0017229
4216 Ga0466972_0020285
4217 Ga0466972_0041190
4218 Ga0466972_0076559
4219 Ga0466972_0078872
4220 Ga0466972_0110662
4221 Ga0466972_0154251
4222 Ga0466972_0165278
4223 Ga0466972_0173944
4224 Ga0466972_0188477
4225 Ga0466965_0000004
4226 Ga0466965_0004472
4227 Ga0466965_0020080
4228 Ga0466965_0023598
4229 Ga0466965_0024457
4230 Ga0466965_0028514
4231 Ga0466965_0038082
4232 Ga0466965_0040784
4233 Ga0466965_0090215
4234 Ga0466965_0128344
4235 Ga0466965_0139025
4236 Ga0466965_0204560
4237 Ga0466965_0298675
4238 Ga0466966_0004948
4239 Ga0466966_0005197
4240 Ga0466966_0005307
4241 Ga0466966_0009642
4242 Ga0466966_0029041
4243 Ga0466966_0031908
4244 Ga0466966_0098959
4245 Ga0466966_0142120
4246 Ga0466966_0299380
4247 Ga0466966_0357685
4248 Ga0466966_0380483
4249 Ga0466961_0001592
4250 Ga0466961_0001710
4251 Ga0466961_0004312
4252 Ga0466961_0013332
4253 Ga0466961_0026313
4254 Ga0466961_0029798
4255 Ga0466961_0029892
4256 Ga0466961_0034974
4257 Ga0466961_0039705
4258 Ga0466961_0045346
4259 Ga0466961_0061784
4260 Ga0466961_0069405
4261 Ga0466961_0071508
4262 Ga0466961_0078840
4263 Ga0466961_0079131
4264 Ga0466961_0113302
4265 Ga0466961_0135438
4266 Ga0466961_0140092
4267 Ga0466961_0172219
4268 Ga0466961_0210460
4269 Ga0466961_0271287
4270 Ga0466963_0000277
4271 Ga0466963_0000286
4272 Ga0466963_0017186
4273 Ga0466963_0020095
4274 Ga0466963_0072290
4275 Ga0466963_0118904
4276 Ga0466963_0158761
4277 Ga0466963_0217847
4278 Ga0466963_0237653
4279 Ga0466963_0290582
4280 Ga0466963_0319671
4281 Ga0466963_0422200
4282 Ga0466964_0027207
4283 Ga0466964_0030254
4284 Ga0466964_0067308
4285 Ga0466964_0107692
4286 Ga0466964_0133652
4287 Ga0466971_0000708
4288 Ga0466971_0006647
4289 Ga0466971_0019226
4290 Ga0466971_0029095
4291 Ga0466971_0037071
4292 Ga0466971_0045805
4293 Ga0466971_0073460
4294 Ga0466971_0080023
4295 Ga0466971_0118288
4296 Ga0466971_0119875
4297 Ga0466968_0114567
4298 Ga0466968_0125710
4299 Ga0466968_0177813
4300 Ga0466968_0219189
4301 Ga0466970_0001383
4302 Ga0466970_0007134
4303 Ga0466970_0007909
4304 Ga0466970_0011141
4305 Ga0466970_0018052
4306 Ga0466970_0022761
4307 Ga0466970_0058398
4308 Ga0466970_0073046
4309 Ga0466970_0079112
4310 Ga0466970_0130634
4311 Ga0466970_0152786
4312 Ga0466970_0164341
4313 Ga0466970_0176532
4314 Ga0466970_0237288
4315 Ga0466970_0247398
4316 Ga0466970_0321876
4317 Ga0466970_0409497
4318 Ga0466957_0008501
4319 Ga0466957_0014046
4320 Ga0466957_0022246
4321 Ga0466957_0024879
4322 Ga0466957_0033710
4323 Ga0466957_0059452
4324 Ga0466957_0139096
4325 Ga0466957_0154795
4326 Ga0466957_0162843
4327 Ga0466957_0216285
4328 Ga0466957_0302033
4329 Ga0466957_0309691
4330 Ga0466957_0421991
4331 Ga0466957_0522065
4332 Ga0466960_0001786
4333 Ga0466960_0003061
4334 Ga0466960_0005711
4335 Ga0466960_0009456
4336 Ga0466960_0028308
4337 Ga0466960_0062528
4338 Ga0466960_0067345
4339 Ga0466960_0093391
4340 Ga0466960_0102246
4341 Ga0466960_0104763
4342 Ga0466960_0124723
4343 Ga0466960_0130840
4344 Ga0466960_0132743
4345 Ga0466960_0177262
4346 Ga0466960_0177301
4347 Ga0466960_0178116
4348 Ga0466960_0219619
4349 Ga0466959_0003667
4350 Ga0466959_0005444
4351 Ga0466959_0006709
4352 Ga0466959_0011643
4353 Ga0466959_0013366
4354 Ga0466959_0062685
4355 Ga0466959_0085010
4356 Ga0466959_0130027
4357 Ga0466959_0150637
4358 Ga0466959_0425978
4359 Ga0466959_0517407
4360 Ga0451576_0157108
4361 Ga0466958_0002266
4362 Ga0466958_0005577
4363 Ga0466958_0011198
4364 Ga0466958_0031205
4365 Ga0466958_0043619
4366 Ga0466958_0051117
4367 Ga0466958_0056237
4368 Ga0466958_0107517
4369 Ga0466958_0115540
4370 Ga0466958_0117344
4371 Ga0466958_0165987
4372 Ga0466958_0215023
4373 Ga0466958_0256461
4374 Ga0466967_0000923
4375 Ga0466967_0001237
4376 Ga0466967_0006305
4377 Ga0466967_0013631
4378 Ga0466967_0015581
4379 Ga0466967_0016997
4380 Ga0466967_0017139
4381 Ga0466967_0034531
4382 Ga0466967_0040088
4383 Ga0466967_0043114
4384 Ga0466967_0055056
4385 Ga0466967_0091611
4386 Ga0466967_0092958
4387 Ga0466967_0093559
4388 Ga0466967_0094342
4389 Ga0466967_0122345
4390 Ga0466967_0178561
4391 Ga0466967_0188132
4392 Ga0466967_0196509
4393 Ga0466967_0225378
4394 Ga0466967_0228868
4395 Ga0466967_0260679
4396 Ga0466967_0298486
4397 Ga0466967_0313319
4398 Ga0466967_0334193
4399 Ga0466967_0379227
4400 Ga0466967_0400524
4401 Ga0466967_0402130
4402 Ga0466967_0416963
4403 Ga0466967_0478358
4404 Ga0466967_0488156
4405 Ga0466967_0505481
4406 Ga0466967_0734270
4407 Ga0466967_0815904
4408 Ga0466967_0874408
4409 Ga0466967_1062977
4410 Ga0466967_1182011
4411 Ga0466967_1289177
4412 Ga0495617_008533
4413 Ga0495627_005071
4414 Ga0495592_0007158
4415 Ga0495592_0013433
4416 Ga0495592_0016759
4417 Ga0495592_0128163
4418 Ga0495603_0006921
4419 Ga0495603_0007997
4420 Ga0495603_0010921
4421 Ga0495603_0038780
4422 Ga0495603_0048196
4423 Ga0495603_0187953
4424 Ga0495590_0059150
4425 Ga0495629_0007038
4426 Ga0495629_0031103
4427 Ga0495629_0093725
4428 Ga0495629_0217815
4429 Ga0495629_0254973
4430 Ga0495629_0396966
4431 Ga0495641_0001496
4432 Ga0495641_0017374
4433 Ga0495641_0025621
4434 Ga0495651_0000760
4435 Ga0495651_0006709
4436 Ga0495651_0027278
4437 Ga0495651_0039522
4438 Ga0495651_0370626
4439 Ga0495653_0013501
4440 Ga0495653_0037664
4441 Ga0495653_0051211
4442 Ga0495653_0064240
4443 Ga0495653_0244963
4444 Ga0495653_0268609
4445 Ga0495580_0008729
4446 Ga0495582_0000400
4447 Ga0495582_0028115
4448 Ga0495582_0038206
4449 Ga0495582_0044589
4450 Ga0495582_0139257
4451 Ga0495582_0412981
4452 Ga0495605_0042925
4453 Ga0495639_0005159
4454 Ga0495639_0015027
4455 Ga0495639_0056117
4456 Ga0495662_0000832
4457 Ga0495662_0010301
4458 Ga0495662_0018319
4459 Ga0495662_0021341
4460 Ga0495662_0054298
4461 Ga0495662_0055037
4462 Ga0495662_0058132
4463 Ga0495662_0194224
4464 Ga0495664_0002592
4465 Ga0495664_0004315
4466 Ga0495664_0021708
4467 Ga0495664_0059218
4468 Ga0495664_0089835
4469 Ga0495664_0099826
4470 Ga0495664_0222807
4471 Ga0495664_0257375
4472 Ga0495664_0369984
4473 Ga0495584_0012140
4474 Ga0495584_0170396
4475 Ga0495585_0006379
4476 Ga0495585_0017756
4477 Ga0495585_0226902
4478 Ga0495594_0000230
4479 Ga0495594_0004764
4480 Ga0495594_0008577
4481 Ga0495594_0056933
4482 Ga0495594_0173009
4483 Ga0495596_0090026
4484 Ga0495596_0134955
4485 Ga0495607_0074113
4486 Ga0495607_0140909
4487 Ga0495608_0003900
4488 Ga0495608_0011720
4489 Ga0495608_0028210
4490 Ga0495608_0100637
4491 Ga0495608_0233212
4492 Ga0495610_0010260
4493 Ga0495616_0013753
4494 Ga0495618_0017214
4495 Ga0495618_0027075
4496 Ga0495618_0182932
4497 Ga0495618_0365946
4498 Ga0495618_0440207
4499 Ga0495620_0065291
4500 Ga0495620_0167740
4501 Ga0495628_0002613
4502 Ga0495628_0016354
4503 Ga0495628_0018202
4504 Ga0495628_0027165
4505 Ga0495628_0051963
4506 Ga0495628_0095321
4507 Ga0495628_0228465
4508 Ga0495630_0001662
4509 Ga0495630_0084769
4510 Ga0495631_0011646
4511 Ga0495631_0028240
4512 Ga0495631_0055953
4513 Ga0495632_0109200
4514 Ga0495637_0040193
4515 Ga0495637_0159355
4516 Ga0495643_0015313
4517 Ga0495643_0135748
4518 Ga0495644_0005262
4519 Ga0495644_0030072
4520 Ga0495663_0041782
4521 Ga0495666_0000236
4522 Ga0495666_0106787
4523 Ga0495666_0164120
4524 Ga0495652_0012217
4525 Ga0495652_0093455
4526 Ga0495652_0128910
4527 Ga0495652_0189929
4528 Ga0495652_0297996
4529 Ga0495652_0312713
4530 Ga0495654_0034985
4531 Ga0495665_0000161
4532 Ga0495665_0010719
4533 Ga0495665_0012690
4534 Ga0495665_0045467
4535 Ga0495665_0309660
4536 Ga0495640_0001427
4537 Ga0495640_0007731
4538 Ga0495640_0029415
4539 Ga0495640_0052855
4540 Ga0495640_0075311
4541 Ga0495640_0081857
4542 Ga0495640_0084329
4543 Ga0495640_0167447
4544 Ga0495640_0170038
4545 Ga0495640_0289672
4546 Ga0495586_0001621
4547 Ga0495586_0020048
4548 Ga0495586_0051332
4549 Ga0495586_0067412
4550 Ga0495586_0194464
4551 Ga0495587_0001940
4552 Ga0495587_0008452
4553 Ga0495587_0014864
4554 Ga0495587_0019267
4555 Ga0495587_0019595
4556 Ga0495587_0048449
4557 Ga0495587_0065887
4558 Ga0495598_0002115
4559 Ga0495598_0046572
4560 Ga0495609_0009749
4561 Ga0495609_0102311
4562 Ga0495597_0037912
4563 Ga0495645_0008429
4564 Ga0495645_0018577
4565 Ga0495645_0039114
4566 Ga0495645_0084019
4567 Ga0495645_0115890
4568 Ga0495645_0229133
4569 Ga0495622_0012996
4570 Ga0495622_0023007
4571 Ga0495622_0037882
4572 Ga0495633_0022717
4573 Ga0495667_0001508
4574 Ga0495667_0017421
4575 Ga0495667_0022689
4576 Ga0495667_0032836
4577 Ga0495667_0106537
4578 Ga0495667_0107659
4579 Ga0495667_0126786
4580 Ga0495667_0144959
4581 Ga0495667_0231504
4582 Ga0495656_0047134
4583 Ga0495656_0050206
4584 Ga0495656_0190439
4585 Ga0495668_0024752
4586 Ga0495668_0080654
4587 Ga0495668_0113803
4588 Ga0495668_0180594
4589 Ga0495668_0222718
4590 Ga0495634_0001788
4591 Ga0495634_0003800
4592 Ga0495634_0007310
4593 Ga0495634_0041401
4594 Ga0495634_0061447
4595 Ga0495634_0077728
4596 Ga0495634_0365799
4597 Ga0495611_0021451
4598 Ga0495625_0058682
4599 Ga0495625_0225636
4600 Ga0495625_0317870
4601 Ga0495635_0006658
4602 Ga0495635_0024737
4603 Ga0495635_0040171
4604 Ga0495635_0051491
4605 Ga0495635_0067623
4606 Ga0495635_0083811
4607 Ga0495635_0091723
4608 Ga0495635_0373663
4609 Ga0495635_0466823
4610 Ga0495659_0002553
4611 Ga0495661_0047093
4612 Ga0495661_0173984
4613 Ga0495661_0229913
4614 Ga0495588_0000366
4615 Ga0495588_0017633
4616 Ga0495588_0042211
4617 Ga0495588_0162836
4618 Ga0495588_0462246
4619 Ga0495657_0009523
4620 Ga0495657_0012303
4621 Ga0495657_0069448
4622 Ga0495657_0165646
4623 Ga0495657_0243880
4624 Ga0495599_0080233
4625 Ga0495599_0479018
4626 Ga0495623_0027453
4627 Ga0495623_0073003
4628 Ga0495623_0148548
4629 Ga0495646_0006736
4630 Ga0495646_0008366
4631 Ga0495646_0050964
4632 Ga0495646_0065740
4633 Ga0495647_0004650
4634 Ga0495647_0178272
4635 Ga0495658_0001325
4636 Ga0495658_0033497
4637 Ga0495658_0068013
4638 Ga0495658_0086806
4639 Ga0495658_0269673
4640 Ga0495669_0035430
4641 Ga0495613_0021613
4642 Ga0495613_0021657
4643 Ga0495613_0105350
4644 Ga0495613_0138369
4645 Ga0495613_0334814
4646 Ga0495613_0370572
4647 Ga0495613_0524859
4648 Ga0495624_0004070
4649 Ga0495624_0006726
4650 Ga0495624_0048210
4651 Ga0495624_0098519
4652 Ga0495670_0028090
4653 Ga0495670_0083935
4654 Ga0495670_0120722
4655 Ga0495670_0360962
4656 Ga0495671_0195563
4657 Ga0495671_0250396
4658 Ga0495649_0070459
4659 Ga0495649_0124576
4660 Ga0495600_0025618
4661 Ga0495600_0030208
4662 Ga0495600_0033647
4663 Ga0495600_0041482
4664 Ga0495600_0042848
4665 Ga0495600_0108880
4666 Ga0495600_0111726
4667 Ga0495600_0197272
4668 Ga0495581_0000415
4669 Ga0495581_0006636
4670 Ga0495581_0032667
4671 Ga0495581_0040327
4672 Ga0495581_0097830
4673 Ga0495581_0201733
4674 Ga0495604_0004135
4675 Ga0495604_0016560
4676 Ga0495604_0017783
4677 Ga0495604_0017969
4678 Ga0495604_0018503
4679 Ga0495604_0039388
4680 Ga0495604_0044193
4681 Ga0495604_0064612
4682 Ga0495604_0190278
4683 Ga0495604_0289200
4684 Ga0495604_0340488
4685 Ga0495636_0000786
4686 Ga0495636_0001368
4687 Ga0495636_0059905
4688 Ga0495674_0006053
4689 Ga0495674_0023527
4690 Ga0495674_0037814
4691 Ga0495674_0045035
4692 Ga0495674_0062193
4693 Ga0495674_0067598
4694 Ga0495674_0101337
4695 Ga0495672_0159798
4696 Ga0495676_0002298
4697 Ga0495676_0004244
4698 Ga0495676_0009028
4699 Ga0495676_0011597
4700 Ga0495676_0017856
4701 Ga0495676_0045183
4702 Ga0495676_0052106
4703 Ga0495676_0070058
4704 Ga0495676_0193449
4705 Ga0495676_0368142
4706 Ga0495680_0000932
4707 Ga0495680_0005012
4708 Ga0495680_0028294
4709 Ga0495680_0032572
4710 Ga0495680_0034538
4711 Ga0495687_002091
4712 Ga0495675_0012145
4713 Ga0495675_0030703
4714 Ga0495675_0055503
4715 Ga0495675_0081018
4716 Ga0495675_0104950
4717 Ga0495675_0128872
4718 Ga0495675_0143717
4719 Ga0495675_0245855
4720 Ga0495675_0421598
4721 Ga0495677_0009911
4722 Ga0495677_0074728
4723 Ga0495677_0094856
4724 Ga0495685_002069
4725 Ga0495685_002284
4726 Ga0495685_005707
4727 Ga0495685_023998
4728 Ga0495681_0002072
4729 Ga0495681_0080269
4730 Ga0495684_0059782
4731 Ga0495684_0081437
4732 Ga0495684_0102276
4733 Ga0495684_0150460
4734 Ga0495686_0020278
4735 Ga0495686_0280876
4736 Ga0495593_0000936
4737 Ga0495593_0001467
4738 Ga0495593_0007010
4739 Ga0495593_0055558
4740 Ga0495593_0105879
4741 Ga0495602_0017924
4742 Ga0495602_0025145
4743 Ga0495602_0047928
4744 Ga0495602_0063988
4745 Ga0495602_0100659
4746 Ga0495602_0138692
4747 Ga0495602_0315284
4748 Ga0495614_0001950
4749 Ga0495614_0003188
4750 Ga0495614_0020402
4751 Ga0495614_0026519
4752 Ga0495614_0061508
4753 Ga0495626_0029423
4754 Ga0495626_0030217
4755 Ga0496100_0000029
4756 Ga0496100_0018861
4757 Ga0496100_0049659
4758 Ga0496100_0069523
4759 Ga0496100_0099425
4760 Ga0496100_0102584
4761 Ga0496100_0177671
4762 Ga0496100_0233437
4763 Ga0496100_0253379
4764 Ga0496100_0433176
4765 Ga0496100_0664304
4766 Ga0496101_0000015
4767 Ga0496101_0001829
4768 Ga0496101_0034711
4769 Ga0496101_0040623
4770 Ga0496101_0043233
4771 Ga0496101_0053360
4772 Ga0496101_0112008
4773 Ga0496101_0182887
4774 Ga0496101_0580864
4775 Ga0496102_0015209
4776 Ga0496102_0016807
4777 Ga0496102_0025899
4778 Ga0496102_0060511
4779 Ga0496102_0075556
4780 Ga0496102_0104054
4781 Ga0496102_0109462
4782 Ga0496102_0119767
4783 Ga0496102_0139062
4784 Ga0496102_0172837
4785 Ga0496102_0176386
4786 Ga0496102_0240416
4787 Ga0496102_0266914
4788 Ga0496102_0392854
4789 Ga0496102_0404479
4790 Ga0496102_0660170
4791 Ga0496102_0728782
4792 Ga0496102_0777033
4793 Ga0496102_0888270
4794 Ga0496103_0008675
4795 Ga0496103_0013517
4796 Ga0496103_0016186
4797 Ga0496103_0033208
4798 Ga0496103_0040285
4799 Ga0496103_0232605
4800 Ga0496104_0009827
4801 Ga0496104_0015319
4802 Ga0496104_0025565
4803 Ga0496104_0080631
4804 Ga0496104_0381663
4805 Ga0496104_0481246
4806 Ga0496104_0827583
4807 Ga0496105_0023864
4808 Ga0496105_0034156
4809 Ga0496105_0053137
4810 Ga0496105_0095264
4811 Ga0496105_0113428
4812 Ga0496105_0260272
4813 Ga0496105_0312108
4814 Ga0496105_0365444
4815 Ga0496105_0486198
4816 Ga0496105_0581159
4817 Ga0496106_0000013
4818 Ga0496106_0000390
4819 Ga0496106_0002411
4820 Ga0496106_0015132
4821 Ga0496106_0044196
4822 Ga0496106_0052105
4823 Ga0496106_0069531
4824 Ga0496106_0165579
4825 Ga0496106_0180204
4826 Ga0496106_0414895
4827 Ga0496107_0000330
4828 Ga0496107_0017969
4829 Ga0496107_0040532
4830 Ga0496107_0047062
4831 Ga0496107_0140766
4832 Ga0496107_0312126
4833 Ga0496107_0623050
4834 Ga0496108_0009612
4835 Ga0496108_0009952
4836 Ga0496108_0022217
4837 Ga0496108_0029189
4838 Ga0496108_0040573
4839 Ga0496108_0054970
4840 Ga0496108_0064212
4841 Ga0496108_0072918
4842 Ga0496108_0097560
4843 Ga0496108_0130057
4844 Ga0496108_0150472
4845 Ga0496108_0295750
4846 Ga0496108_0358331
4847 Ga0496108_0363069
4848 Ga0496108_0367903
4849 Ga0496108_0382091
4850 Ga0496108_0425670
4851 Ga0496108_0426792
4852 Ga0496108_0617781
4853 Ga0496108_0787477
4854 Ga0496109_0000134
4855 Ga0496109_0024314
4856 Ga0496109_0028020
4857 Ga0496109_0034597
4858 Ga0496109_0040613
4859 Ga0496109_0050219
4860 Ga0496109_0053461
4861 Ga0496109_0058234
4862 Ga0496109_0137575
4863 Ga0496109_0140444
4864 Ga0496109_0149847
4865 Ga0496109_0171836
4866 Ga0496109_0311595
4867 Ga0496109_0312873
4868 Ga0496109_0342025
4869 Ga0496109_0378455
4870 Ga0496109_0430740
4871 Ga0496109_0452180
4872 Ga0496109_0818622
4873 Ga0496109_1116071
4874 Ga0496110_0017182
4875 Ga0496110_0017539
4876 Ga0496110_0027391
4877 Ga0496110_0036910
4878 Ga0496110_0106322
4879 Ga0496110_0113393
4880 Ga0496110_0134391
4881 Ga0496110_0183858
4882 Ga0496110_0204469
4883 Ga0496110_0352590
4884 Ga0496110_0412076
4885 Ga0496110_0434847
4886 Ga0496110_0574972
4887 Ga0496110_0629427
4888 Ga0496110_0650083
4889 Ga0496111_0004126
4890 Ga0496111_0010150
4891 Ga0496111_0010571
4892 Ga0496111_0097440
4893 Ga0496111_0098338
4894 Ga0496111_0225482
4895 Ga0496111_0225600
4896 Ga0496111_0307217
4897 Ga0496111_0543386
4898 Ga0496111_0580906
4899 Ga0496112_0074253
4900 Ga0496112_0195587
4901 Ga0496112_0301034
4902 Ga0496112_0410127
4903 Ga0496112_0474435
4904 Ga0496112_0645707
4905 Ga0496112_0706261
4906 Ga0496113_0039281
4907 Ga0496113_0089297
4908 Ga0496113_0129672
4909 Ga0496113_0138781
4910 Ga0496113_0173004
4911 Ga0496113_0175338
4912 Ga0496113_0262876
4913 Ga0496113_0298244
4914 Ga0496113_0443854
4915 Ga0496113_0893424
4916 Ga0496114_0001198
4917 Ga0496114_0009551
4918 Ga0496114_0011997
4919 Ga0496114_0021428
4920 Ga0496114_0021916
4921 Ga0496114_0025348
4922 Ga0496114_0046553
4923 Ga0496114_0060024
4924 Ga0496114_0076889
4925 Ga0496114_0081897
4926 Ga0496114_0100060
4927 Ga0496114_0102039
4928 Ga0496114_0135037
4929 Ga0496114_0272536
4930 Ga0496114_0351843
4931 Ga0496114_0638249
4932 Ga0496115_0005323
4933 Ga0496115_0024552
4934 Ga0496115_0032552
4935 Ga0496115_0033688
4936 Ga0496115_0046050
4937 Ga0496115_0329913
4938 Ga0496115_0729278
4939 Ga0496116_0054044
4940 Ga0496117_0001693
4941 Ga0496117_0004911
4942 Ga0496117_0054723
4943 Ga0496117_0063674
4944 Ga0496117_0096325
4945 Ga0496118_0000201
4946 Ga0496118_0013571
4947 Ga0496118_0338686
4948 Ga0496119_0000977
4949 Ga0496119_0004454
4950 Ga0496119_0010445
4951 Ga0496119_0015654
4952 Ga0496119_0045764
4953 Ga0496119_0098074
4954 Ga0496119_0134462
4955 Ga0496120_0000472
4956 Ga0496120_0003282
4957 Ga0496120_0007830
4958 Ga0496120_0039013
4959 Ga0496120_0049116
4960 Ga0496120_0117394
4961 Ga0496120_0168307
4962 Ga0496120_0172574
4963 Ga0496121_0000004
4964 Ga0496121_0000046
4965 Ga0496121_0016409
4966 Ga0496121_0030120
4967 Ga0496122_0000138
4968 Ga0496122_0001892
4969 Ga0496122_0003436
4970 Ga0496122_0023817
4971 Ga0496122_0078557
4972 Ga0496123_0000845
4973 Ga0496123_0001708
4974 Ga0496123_0007235
4975 Ga0496123_0014051
4976 Ga0496123_0049660
4977 Ga0496124_0000012
4978 Ga0496124_0000194
4979 Ga0496124_0004326
4980 Ga0496124_0055309
4981 Ga0496124_0085187
4982 Ga0496124_0138304
4983 Ga0496125_0000003
4984 Ga0496125_0110229
4985 Ga0496126_0000001
4986 Ga0496126_0001538
4987 Ga0496126_0004823
4988 Ga0496126_0063032
4989 Ga0496126_0227686
4990 Ga0501306_014691
4991 Ga0495678_030789
4992 Ga0495682_0008445
4993 Ga0501311_012844
4994 Ga0501316_002615
4995 Ga0501318_003346
4996 Ga0501318_013106
4997 Ga0501320_001160
4998 Ga0501320_015805
4999 Ga0501323_000831
5000 Ga0501323_004248
5001 Ga0501323_006098
5002 Ga0501324_000669
5003 Ga0501031_0001837
5004 Ga0501031_0007189
5005 Ga0501031_0009851
5006 Ga0501031_0012840
5007 Ga0501031_0021109
5008 Ga0501031_0026725
5009 Ga0501031_0039042
5010 Ga0501031_0041435
5011 Ga0501031_0063364
5012 Ga0501031_0064572
5013 Ga0501031_0068974
5014 Ga0501031_0090339
5015 Ga0501031_0098772
5016 Ga0501031_0122607
5017 Ga0501031_0141209
5018 Ga0501031_0491014
5019 Ga0501031_0507869
5020 Ga0501032_0004038
5021 Ga0501032_0006760
5022 Ga0501032_0007921
5023 Ga0501032_0013151
5024 Ga0501032_0024031
5025 Ga0501032_0036441
5026 Ga0501032_0041942
5027 Ga0501032_0042384
5028 Ga0501032_0046009
5029 Ga0501032_0069421
5030 Ga0501032_0076293
5031 Ga0501032_0082481
5032 Ga0501032_0162774
5033 Ga0501032_0336575
5034 Ga0501032_0406259
5035 Ga0501032_0422387
5036 Ga0501033_0002609
5037 Ga0501033_0002629
5038 Ga0501033_0011909
5039 Ga0501033_0012249
5040 Ga0501033_0017564
5041 Ga0501033_0029904
5042 Ga0501033_0035074
5043 Ga0501033_0051639
5044 Ga0501033_0071198
5045 Ga0501033_0086436
5046 Ga0501033_0104919
5047 Ga0501033_0125642
5048 Ga0501033_0152119
5049 Ga0501033_0224364
5050 Ga0501033_0269608
5051 Ga0501033_0316574
5052 Ga0501034_0007592
5053 Ga0501034_0010172
5054 Ga0501034_0012032
5055 Ga0501034_0012296
5056 Ga0501034_0045523
5057 Ga0501034_0046941
5058 Ga0501034_0074854
5059 Ga0501034_0095448
5060 Ga0501034_0134042
5061 Ga0501034_0170873
5062 Ga0501034_0184667
5063 Ga0501034_0189836
5064 Ga0501034_0228294
5065 Ga0501034_0233260
5066 Ga0501034_0259063
5067 Ga0501034_0344212
5068 Ga0501036_0003794
5069 Ga0501036_0005209
5070 Ga0501036_0010281
5071 Ga0501036_0012290
5072 Ga0501036_0019821
5073 Ga0501036_0020042
5074 Ga0501036_0021151
5075 Ga0501036_0029800
5076 Ga0501036_0036294
5077 Ga0501036_0042193
5078 Ga0501036_0047012
5079 Ga0501036_0070633
5080 Ga0501036_0110350
5081 Ga0501036_0168542
5082 Ga0501036_0192583
5083 Ga0501036_0360672
5084 Ga0501036_0430412
5085 Ga0501036_0463750
5086 Ga0501037_0000294
5087 Ga0501037_0005902
5088 Ga0501037_0009805
5089 Ga0501037_0013679
5090 Ga0501037_0022703
5091 Ga0501037_0031305
5092 Ga0501037_0059222
5093 Ga0501037_0068597
5094 Ga0501037_0087627
5095 Ga0501037_0115170
5096 Ga0501037_0132914
5097 Ga0501037_0140941
5098 Ga0501037_0213892
5099 Ga0501037_0284909
5100 Ga0501038_0000303
5101 Ga0501038_0000651
5102 Ga0501038_0007193
5103 Ga0501038_0008787
5104 Ga0501038_0009773
5105 Ga0501038_0015178
5106 Ga0501038_0018593
5107 Ga0501038_0021670
5108 Ga0501038_0025755
5109 Ga0501038_0041524
5110 Ga0501038_0056607
5111 Ga0501038_0059332
5112 Ga0501038_0066628
5113 Ga0501038_0074468
5114 Ga0501038_0096932
5115 Ga0501038_0144613
5116 Ga0501038_0728350
5117 Ga0501039_0002057
5118 Ga0501039_0008174
5119 Ga0501039_0012603
5120 Ga0501039_0013861
5121 Ga0501039_0018395
5122 Ga0501039_0038347
5123 Ga0501039_0060279
5124 Ga0501039_0070392
5125 Ga0501039_0070450
5126 Ga0501039_0075447
5127 Ga0501039_0079664
5128 Ga0501039_0088525
5129 Ga0501039_0093525
5130 Ga0501039_0097782
5131 Ga0501039_0159038
5132 Ga0501039_0183706
5133 Ga0501039_0301051
5134 Ga0501040_0005270
5135 Ga0501040_0011718
5136 Ga0501040_0014634
5137 Ga0501040_0040954
5138 Ga0501040_0082328
5139 Ga0501040_0107087
5140 Ga0501040_0152337
5141 Ga0501040_0176642
5142 Ga0501040_0228560
5143 Ga0501040_0327940
5144 Ga0501040_0453071
5145 Ga0501040_0914935
5146 Ga0501041_0007164
5147 Ga0501041_0008921
5148 Ga0501041_0009506
5149 Ga0501041_0011292
5150 Ga0501041_0015748
5151 Ga0501041_0022805
5152 Ga0501041_0089318
5153 Ga0501041_0174722
5154 Ga0501042_0002482
5155 Ga0501042_0005330
5156 Ga0501042_0008580
5157 Ga0501042_0018840
5158 Ga0501042_0024133
5159 Ga0501042_0024563
5160 Ga0501042_0025867
5161 Ga0501042_0032697
5162 Ga0501042_0050343
5163 Ga0501042_0052954
5164 Ga0501042_0090442
5165 Ga0501042_0150850
5166 Ga0501043_0001902
5167 Ga0501043_0002724
5168 Ga0501043_0007376
5169 Ga0501043_0008555
5170 Ga0501043_0020165
5171 Ga0501043_0033654
5172 Ga0501043_0045495
5173 Ga0501043_0133847
5174 Ga0501043_0149748
5175 Ga0501043_0237794
5176 Ga0501043_0241998
5177 Ga0501043_0252209
5178 Ga0501043_0273392
5179 Ga0501043_0274494
5180 Ga0501043_0337669
5181 Ga0501046_0001725
5182 Ga0501046_0001732
5183 Ga0501046_0007291
5184 Ga0501046_0009885
5185 Ga0501046_0018029
5186 Ga0501046_0020969
5187 Ga0501046_0028348
5188 Ga0501046_0029151
5189 Ga0501046_0068794
5190 Ga0501046_0213255
5191 Ga0501046_0359777
5192 Ga0501046_0394982
5193 Ga0501046_0424641
5194 Ga0501047_0000083
5195 Ga0501047_0000093
5196 Ga0501047_0010293
5197 Ga0501047_0022341
5198 Ga0501047_0023232
5199 Ga0501047_0028825
5200 Ga0501047_0046162
5201 Ga0501047_0051607
5202 Ga0501047_0054377
5203 Ga0501047_0062933
5204 Ga0501047_0155727
5205 Ga0501047_0159158
5206 Ga0501047_0169605
5207 Ga0501047_0177119
5208 Ga0501047_0195767
5209 Ga0501047_0205210
5210 Ga0501047_0212499
5211 Ga0501047_0402725
5212 Ga0501048_0000913
5213 Ga0501048_0003194
5214 Ga0501048_0007456
5215 Ga0501048_0007952
5216 Ga0501048_0007965
5217 Ga0501048_0010548
5218 Ga0501048_0019129
5219 Ga0501048_0019250
5220 Ga0501048_0019682
5221 Ga0501048_0040955
5222 Ga0501048_0101403
5223 Ga0501048_0133797
5224 Ga0501048_0134748
5225 Ga0501067_0006401
5226 Ga0501067_0011759
5227 Ga0501067_0022964
5228 Ga0501067_0027133
5229 Ga0501067_0041326
5230 Ga0501067_0050589
5231 Ga0501068_0022872
5232 Ga0501068_0043015
5233 Ga0501068_0043101
5234 Ga0501068_0047487
5235 Ga0501068_0070383
5236 Ga0501068_0153194
5237 Ga0501068_0456253
5238 Ga0501068_0533394
5239 Ga0501069_0004057
5240 Ga0501069_0009567
5241 Ga0501069_0050618
5242 Ga0501069_0088849
5243 Ga0501069_0189960
5244 Ga0501069_0241894
5245 Ga0501069_0277521
5246 Ga0501069_0283554
5247 Ga0501070_0001285
5248 Ga0501070_0003044
5249 Ga0501070_0003281
5250 Ga0501070_0004487
5251 Ga0501070_0011424
5252 Ga0501070_0014520
5253 Ga0501070_0016277
5254 Ga0501070_0022682
5255 Ga0501070_0025266
5256 Ga0501070_0029339
5257 Ga0501070_0029768
5258 Ga0501070_0068064
5259 Ga0501070_0072443
5260 Ga0501070_0084123
5261 Ga0501070_0127481
5262 Ga0501070_0163651
5263 Ga0501070_0185053
5264 Ga0501070_0199104
5265 Ga0501070_0260172
5266 Ga0501070_0596077
5267 Ga0501071_0009680
5268 Ga0501071_0019128
5269 Ga0501071_0020666
5270 Ga0501071_0032930
5271 Ga0501071_0066244
5272 Ga0501071_0212397
5273 Ga0501071_0270149
5274 Ga0501071_0377955
5275 Ga0501071_0674734
5276 Ga0501072_0003157
5277 Ga0501072_0007879
5278 Ga0501072_0010838
5279 Ga0501072_0016480
5280 Ga0501072_0017825
5281 Ga0501072_0023336
5282 Ga0501072_0034362
5283 Ga0501072_0042612
5284 Ga0501072_0053454
5285 Ga0501072_0083050
5286 Ga0501072_0160060
5287 Ga0501072_0235446
5288 Ga0501072_0399175
5289 Ga0501072_0674759
5290 Ga0501073_0000046
5291 Ga0501073_0001403
5292 Ga0501073_0015372
5293 Ga0501073_0021178
5294 Ga0501073_0026052
5295 Ga0501073_0045255
5296 Ga0501073_0102099
5297 Ga0501073_0240782
5298 Ga0501073_0288594
5299 Ga0501073_0356414
5300 Ga0501074_0003640
5301 Ga0501074_0004322
5302 Ga0501074_0009586
5303 Ga0501074_0014754
5304 Ga0501074_0026403
5305 Ga0501074_0046363
5306 Ga0501074_0055471
5307 Ga0501074_0057565
5308 Ga0501074_0081715
5309 Ga0501074_0294535
5310 Ga0501075_0005120
5311 Ga0501075_0005138
5312 Ga0501075_0006976
5313 Ga0501075_0033042
5314 Ga0501075_0051478
5315 Ga0501075_0126721
5316 Ga0501075_0279505
5317 Ga0501075_0341956
5318 Ga0501076_0001890
5319 Ga0501076_0010824
5320 Ga0501076_0012283
5321 Ga0501076_0021209
5322 Ga0501076_0074805
5323 Ga0501076_0138172
5324 Ga0501076_0219074
5325 Ga0501076_0338542
5326 Ga0501076_0508600
5327 Ga0501077_0003402
5328 Ga0501077_0006591
5329 Ga0501077_0012839
5330 Ga0501077_0014483
5331 Ga0501077_0014580
5332 Ga0501077_0035590
5333 Ga0501077_0062013
5334 Ga0501077_0142444
5335 Ga0501077_0199042
5336 Ga0501243_032702
5337 Ga0501079_0000567
5338 Ga0501079_0005166
5339 Ga0501079_0022276
5340 Ga0501079_0045603
5341 Ga0501079_0047805
5342 Ga0501079_0048152
5343 Ga0501079_0078218
5344 Ga0501080_0001919
5345 Ga0501080_0007921
5346 Ga0501080_0021268
5347 Ga0501080_0023647
5348 Ga0501080_0041680
5349 Ga0501080_0046667
5350 Ga0501080_0069334
5351 Ga0501080_0072756
5352 Ga0501080_0082094
5353 Ga0501080_0092232
5354 Ga0501080_0101539
5355 Ga0501080_0108536
5356 Ga0501080_0170476
5357 Ga0501080_0180555
5358 Ga0501080_0281597
5359 Ga0501080_0482936
5360 Ga0501080_0580668
5361 Ga0501080_0645051
5362 Ga0501081_0003162
5363 Ga0501081_0007531
5364 Ga0501081_0060864
5365 Ga0501083_0000026
5366 Ga0501083_0000728
5367 Ga0501083_0005442
5368 Ga0501083_0005618
5369 Ga0501083_0012334
5370 Ga0501083_0146133
5371 Ga0501035_0004849
5372 Ga0501035_0009171
5373 Ga0501035_0014568
5374 Ga0501035_0016194
5375 Ga0501035_0026521
5376 Ga0501035_0027427
5377 Ga0501035_0069370
5378 Ga0501035_0069579
5379 Ga0501035_0077581
5380 Ga0501035_0096173
5381 Ga0501035_0166682
5382 Ga0501035_0170702
5383 Ga0501035_0188659
5384 Ga0501035_0201777
5385 Ga0501035_0230752
5386 Ga0501035_0258266
5387 Ga0501035_0455724
5388 Ga0501035_0503557
5389 Ga0501035_0549005
5390 Ga0501044_0001800
5391 Ga0501044_0002740
5392 Ga0501044_0022807
5393 Ga0501044_0023321
5394 Ga0501044_0027980
5395 Ga0501044_0030004
5396 Ga0501044_0030953
5397 Ga0501044_0037496
5398 Ga0501044_0040292
5399 Ga0501044_0049385
5400 Ga0501044_0115140
5401 Ga0501044_0115283
5402 Ga0501044_0119721
5403 Ga0501044_0139647
5404 Ga0501044_0191603
5405 Ga0501044_0198452
5406 Ga0501044_0260007
5407 Ga0501044_0289526
5408 Ga0501044_0379084
5409 Ga0501044_0387377
5410 Ga0501044_0634376
5411 Ga0501045_0001193
5412 Ga0501045_0010772
5413 Ga0501045_0014385
5414 Ga0501045_0014780
5415 Ga0501045_0019563
5416 Ga0501045_0042745
5417 Ga0501045_0044640
5418 Ga0501045_0069428
5419 Ga0501045_0069713
5420 Ga0501045_0074073
5421 Ga0501045_0082387
5422 Ga0501045_0090716
5423 Ga0501045_0119096
5424 Ga0501045_0123275
5425 Ga0501045_0247743
5426 Ga0501045_0258269
5427 Ga0501045_0382999
5428 Ga0501045_0566088
5429 nmdc:mga03n38_18104_c1
5430 nmdc:mga03n38_31460_c1
5431 nmdc:mga03n38_31553_c1
5432 nmdc:mga03n38_7020_c1
5433 nmdc:mga00v17_131070_c1
5434 nmdc:mga00v17_187074_c1
5435 nmdc:mga00v17_230487_c1
5436 nmdc:mga00v17_277_c1
5437 nmdc:mga00v17_33469_c1
5438 nmdc:mga00v17_44896_c1
5439 nmdc:mga00v17_5183_c1
5440 nmdc:mga00v17_5589_c1
5441 nmdc:mga00v17_7069_c1
5442 nmdc:mga00v17_70985_c1
5443 nmdc:mga0yw44_14094_c1
5444 nmdc:mga0yw44_17205_c1
5445 nmdc:mga0yw44_178020_c1
5446 nmdc:mga0yw44_22196_c1
5447 nmdc:mga0yw44_23125_c1
5448 nmdc:mga0yw44_26133_c1
5449 nmdc:mga0yw44_280721_c1
5450 nmdc:mga0yw44_365954_c1
5451 nmdc:mga0yw44_371209_c1
5452 nmdc:mga0yw44_4438_c2
5453 nmdc:mga0yw44_44475_c1
5454 nmdc:mga0yw44_474123_c1
5455 nmdc:mga0yw44_49006_c1
5456 nmdc:mga0yw44_51044_c1
5457 nmdc:mga0yw44_81767_c1
5458 nmdc:mga06z11_120829_c1
5459 nmdc:mga06z11_189864_c1
5460 nmdc:mga06z11_5211_c1
5461 nmdc:mga04h51_5086_c1
5462 nmdc:mga04h51_5311_c1
5463 nmdc:mga07m45_14817_c1
5464 nmdc:mga07m45_24348_c1
5465 nmdc:mga07m45_49621_c1
5466 nmdc:mga05p37_105331_c1
5467 nmdc:mga05p37_198509_c1
5468 nmdc:mga05p37_23434_c1
5469 nmdc:mga05p37_2501_c2
5470 nmdc:mga05p37_31226_c1
5471 nmdc:mga05p37_334435_c1
5472 nmdc:mga05p37_9094_c1
5473 nmdc:mga09592_126018_c1
5474 nmdc:mga09592_41885_c1
5475 nmdc:mga09592_88859_c1
5476 nmdc:mga0qj67_1094_c1
5477 nmdc:mga0qj67_2653_c1
5478 nmdc:mga06r32_29270_c1
5479 nmdc:mga06r32_295294_c1
5480 nmdc:mga06r32_37627_c1
5481 nmdc:mga06r32_588744_c1
5482 nmdc:mga06r32_660541_c1
5483 nmdc:mga06r32_9811_c1
5484 nmdc:mga08y16_10704_c1
5485 nmdc:mga08y16_35414_c1
5486 nmdc:mga08y16_56494_c1
5487 nmdc:mga08y16_662133_c1
5488 nmdc:mga08y16_793784_c1
5489 nmdc:mga08y16_849061_c1
5490 nmdc:mga0n895_1840_c1
5491 nmdc:mga0n895_618236_c1
5492 nmdc:mga0n895_651896_c1
5493 nmdc:mga0rr50_129717_c1
5494 nmdc:mga0rr50_392858_c1
5495 nmdc:mga0rr50_483568_c1
5496 nmdc:mga08x19_33233_c1
5497 nmdc:mga0a205_13936_c1
5498 nmdc:mga0a205_20106_c1
5499 nmdc:mga0a205_2361_c1
5500 nmdc:mga0a205_39925_c1
5501 nmdc:mga0a205_5919_c1
5502 nmdc:mga0sz30_2429_c1
5503 Ga0495601_0005892
5504 Ga0495601_0084215
5505 Ga0495601_0179096
5506 Ga0495612_0034537
5507 Ga0495612_0078546
5508 Ga0495612_0129772
5509 Ga0500610_0097035
5510 Ga0500635_0000138
5511 Ga0500635_0002023
5512 Ga0495655_0027650
5513 Ga0495595_0244126
5514 Ga0495619_0000287
5515 Ga0495619_0015499
5516 Ga0495619_0130763
5517 Ga0495619_0187007
5518 Ga0495619_0341627
5519 Ga0495619_0424210
5520 Ga0500578_0108321
5521 Ga0500643_000132
5522 Ga0500643_000358
5523 Ga0500644_0000183
5524 Ga0500651_0000109
5525 Ga0500640_003421
5526 Ga0500641_0023792
5527 Ga0500641_0037929
5528 Ga0500650_0013318
5529 Ga0500650_0040286
5530 Ga0500556_0000059
5531 Ga0500556_0000283
5532 Ga0500556_0001365
5533 Ga0500558_155628
5534 Ga0500560_013016
5535 Ga0500562_003188
5536 Ga0500593_000301
5537 Ga0500593_013314
5538 Ga0500628_070930
5539 Ga0500655_000909
5540 Ga0500559_0000387
5541 Ga0500559_0065701
5542 Ga0500564_200219
5543 Ga0500568_0000012
5544 Ga0500568_0006341
5545 Ga0500573_0008676
5546 Ga0500573_0026270
5547 Ga0500573_0032312
5548 Ga0500573_0093208
5549 Ga0500573_0187789
5550 Ga0500600_0243743
5551 Ga0500603_060412
5552 Ga0500616_0003129
5553 Ga0500616_0015663
5554 Ga0500624_001677
5555 Ga0500633_0012143
5556 Ga0501084_0014931
5557 Ga0501084_0019782
5558 Ga0501084_0030098
5559 Ga0501084_0041186
5560 Ga0501084_0041853
5561 Ga0501084_0046496
5562 Ga0501084_0097481
5563 Ga0501084_0109433
5564 Ga0501084_0133478
5565 Ga0501084_0424850
5566 Ga0501084_0541470
5567 Ga0587101_012203
5568 Ga0587128_028128
5569 Ga0587128_044218
5570 Ga0587072_051922
5571 Ga0587107_029504
5572 Ga0587120_006417
5573 Ga0587111_0028226
5574 Ga0501082_0004453
5575 Ga0501082_0023770
5576 Ga0501082_0031446
5577 Ga0501082_0044147
5578 Ga0501082_0051393
5579 Ga0501082_0086195
5580 Ga0501082_0186964
5581 Ga0501082_0221462
5582 Ga0501082_0312504
5583 Ga0501082_0327874
5584 Ga0466962_0000547
5585 Ga0466962_0008761
5586 Ga0466962_0009880
5587 Ga0466962_0016134
5588 Ga0466962_0033258
5589 Ga0466962_0052237
5590 Ga0466962_0055266
5591 Ga0466962_0067293
5592 Ga0466962_0138340
5593 Ga0466962_0205586
5594 Ga0530510_0002161
5595 Ga0530510_0010990
5596 Ga0530510_0018454
5597 Ga0530510_0054659
5598 Ga0530510_0090111
5599 Ga0530510_0096175
5600 Ga0530510_0096754
5601 Ga0530510_0157495
5602 Ga0530510_0219606
5603 Ga0530510_0220405
5604 Ga0530510_0261396
5605 Ga0530510_0267415
5606 Ga0530510_0309220
5607 2506864688
5608 2515497470
5609 2515756067
5610 2516084720
5611 2516091470
5612 2528203353
5613 2528212903
5614 2546948632
5615 2547412476
5616 2554257365
5617 2559428249
5618 2579747773
5619 2585300312
5620 2585310636
5621 2585314403
5622 2587861571
5623 2616700204
5624 2616905279
5625 2623497912
5626 2643762992
5627 2643827197
5628 2643852208
5629 2643890464
5630 2643899936
5631 2643947754
5632 2643959520
5633 2644015183
5634 2644033011
5635 2644092959
5636 2644099995
5637 2644117601
5638 2644136361
5639 2644175346
5640 2644228378
5641 2644263023
5642 2644278187
5643 2644322572
5644 2644390812
5645 2644405841
5646 2644433619
5647 2644443238
5648 2644447518
5649 2644454820
5650 2644464150
5651 2644505310
5652 2644524873
5653 2644533976
5654 2644536251
5655 2644607906
5656 2644626950
5657 2644668959
5658 2645722085
5659 2645724927
5660 2676477488
5661 2676482772
5662 2676490663
5663 2686540812
5664 2710604458
5665 2738871881
5666 2740165883
5667 2753069569
5668 2753300749
5669 2758225091
5670 2774855016
5671 2774867482
5672 2774904917
5673 2776371414
5674 2784473144
5675 2784588875
5676 2785343012
5677 2785369815
5678 2786670904
5679 2791915450
5680 2793983503
5681 2804846478
5682 2808842319
5683 2808872003
5684 2808920843
5685 2809197747
5686 2809232491
5687 2811849318
5688 2812331015
5689 2812347764
5690 2812357796
5691 2812373095
5692 2812480269
5693 2816421786
5694 2816509996
5695 2819425875
5696 2819664959
5697 2819689386
5698 2819697163
5699 2819727077
5700 2827634745
5701 2837274566
5702 2844843723
5703 2844851430
5704 2852637079
5705 2855388825
5706 2857482029
5707 2857711798
5708 2857733034
5709 2857741872
5710 2861528138
5711 2862183401
5712 2862285937
5713 2862291263
5714 2862388320
5715 2862507990
5716 2862578974
5717 2863070043
5718 2863404274
5719 2866555864
5720 2866616293
5721 2867347771
5722 2867436796
5723 2867476940
5724 2870727876
5725 2873155460
5726 2875395396
5727 2877680824
5728 2884766912
5729 2887447257
5730 2891327865
5731 2891968828
5732 2895447368
5733 2904431318
5734 2904497698
5735 2904504710
5736 2908674862
5737 2909075820
5738 2910812493
5739 2912719635
5740 2912731306
5741 2912761081
5742 2915360012
5743 2917744023
5744 2918505303
5745 2919041090
5746 2919046094
5747 2919055720
5748 2919448387
5749 2919472005
5750 2919525814
5751 2919539639
5752 2928108157
5753 2928121735
5754 2928153862
5755 2928501830
5756 2933419852
5757 2935390946
5758 2939676559
5759 2946049712
5760 2946068070
5761 2946076172
5762 2947228868
5763 2954006666
5764 2954385923
5765 2954677230
5766 2954686925
5767 2954696575
5768 2954705649
5769 2954715934
5770 2954725873
5771 2954735925
5772 2954744811
5773 2954754788
5774 2954763796
5775 2964328168
5776 2966601962
5777 2966923735
5778 2966927545
5779 2974325013
5780 2984578477
5781 2984593920
5782 2990065653
5783 2990259286
5784 2995468984
5785 2997454709
5786 2997604408
5787 3001890217
5788 3006328419
5789 3006397170
5790 3006493767
5791 637881747
5792 8008566965
5793 8008578638
5794 8016255440
5795 8023629432
5796 8025413659
5797 8033688027
5798 8047716250
5799 8047897313
5800 8048128226
5801 8048361630
5802 8048374301
5803 8048383922
5804 8048412639
5805 8053948275
5806 8054609689
5807 8055039342
5808 8056055917
5809 8056669270
5810 8056833391

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13507

GATase_5

CobB/CobQ-like glutamine amidotransferase domain

48

256

0.88

PF07685

GATase_3

CobB/CobQ-like glutamine amidotransferase domain

64

148

0.8

PF00117

GATase

Glutamine amidotransferase class-I

65

248

0.69

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d54-assembly3.cif.gz_D structure of purlqs from thermotoga maritima 0.9577 2 220
3d54-assembly3.cif.gz_D structure of purlqs from thermotoga maritima 0.9358 2 220
1t3t-assembly1.cif.gz_A structure of formylglycinamide synthetase 0.8628 2 218
4l78-assembly1.cif.gz_A xenon trapping and statistical coupling analysis uncover regions important for structure and function of multidomain protein stpurl 0.8593 2 222
3ugj-assembly1.cif.gz_A formyl glycinamide ribonucletide amidotransferase from salmonella typhimurum: role of the atp complexation and glutaminase domain in catalytic coupling 0.8535 2 218
ID Description Score Start End Superfamily
af_P9WHL5_1_222_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9886 1 219 3.40.50.880
af_Q2FZJ1_1_219_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9758 1 219 3.40.50.880
af_Q2FZJ1_1_219_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9627 1 219 3.40.50.880
af_Q59042_1_229_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9607 1 222 3.40.50.880
3d54L00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9574 2 220 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A2W6E450-F1-model_v4 Phosphoribosylformylglycinamidine synthase subunit PurQ 0.9958 100 218 GO:0004642
GO:0005524
GO:0005737
GO:0006189
GO:0016787
AF-A0A6J4MTN5-F1-model_v4 Phosphoribosylformylglycinamidine synthase, glutamine amidotransferase subunit (EC 6.3.5.3) 0.9935 68 221 GO:0004642
GO:0005524
GO:0005737
GO:0006189
GO:0006541
GO:0016740
GO:0016787
AF-A0A6I3HLW9-F1-model_v4 Phosphoribosylformylglycinamidine synthase subunit PurQ 0.9921 85 220 GO:0004642
GO:0005524
GO:0005737
GO:0006189
GO:0006541
GO:0016787
AF-A0A6N7VBS1-F1-model_v4 Phosphoribosylformylglycinamidine synthase subunit PurQ (FGAM synthase) (EC 6.3.5.3) (Formylglycinamide ribonucleotide amidotransferase subunit I) (FGAR amidotransferase I) (FGAR-AT I) (Glutaminase PurQ) (EC 3.5.1.2) (Phosphoribosylformylglycinamidine synthase subunit I) 0.9916 1 220 GO:0004359
GO:0004642
GO:0005524
GO:0005737
GO:0006189
GO:0006541
AF-A0A7W0H9N6-F1-model_v4 Phosphoribosylformylglycinamidine synthase subunit PurQ (FGAM synthase) (EC 6.3.5.3) (Formylglycinamide ribonucleotide amidotransferase subunit I) (FGAR amidotransferase I) (FGAR-AT I) (Glutaminase PurQ) (EC 3.5.1.2) (Phosphoribosylformylglycinamidine synthase subunit I) 0.9911 1 219 GO:0004642
GO:0005524
GO:0005737
GO:0006189
GO:0006541
GO:0016787

Map