F497150

General Info

Members Datasets Scaffolds Average Seq Length
2929 1013 5836 449

Family's Representative Sequence

Representative Sequence 3300048917|Ga0496114_0000009|Ga0496114_0000009_125233_126816
Length 510
Sequence MNPEQGIFDLQGSHPNLSARPAPPETVGTPFCVCAQMLGGWTTPEGETMNDYTATLTVDADTEMISSRERAKNPAEPEFHQAVQEVAESLGPVLERHPEYRHARILERIIEPERVLMFRVPWQDDRGAVQINRGFRIEMNSAIGPYKGGLRFHPSVNLGILKFLAFEQVFKNSLTTLPMGGGKGGSDFDPKGKSDNEVMRFCQSFMTELCRHIGPNTDVPAGDIGVGGREIGYLFGQYKRLRNEFTGVLTGKGLNWGGSLIRPEATGYGCVYFAQEMLATRKQTLDGKTCLVSGSGNVAQYTVEKLLDLGAKPITLSDSSGYIIDEHGIDRERLAYVLDLKNVRRGRIEEYADQFKTAIYIPTTPGASHNPLWDMKADCAFPSATQNEINGKDAENLLRNGVYLVAEGANMPTHIDGVNKFVDAGILYGPGKAANAGGVATSGLEMAQNSMRYSWTREEVDNRLHLIMKSIHKACVETADRFGTPGNYVNGANIAGFLKVADAMMDQGLV

Samples

Sample ID Description Type Environment
1 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
5 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
6 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
7 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
8 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
9 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
10 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
11 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
12 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
16 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
17 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
18 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
19 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
20 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
21 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
22 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
23 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
24 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
25 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
26 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
27 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
28 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
29 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
30 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
31 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
32 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
33 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
34 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
35 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
36 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
37 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
38 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
39 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
40 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
41 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
42 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
43 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
44 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
45 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
46 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
47 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
48 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
49 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
50 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
51 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
52 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
53 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
54 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
55 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
56 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
57 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
58 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
59 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
60 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
61 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
62 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
63 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
64 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
65 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
66 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
67 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
68 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
69 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
70 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
71 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
72 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
73 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
74 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
75 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
76 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
77 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
78 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
79 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
80 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
81 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
82 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
83 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
84 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
85 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
86 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
87 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
88 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
89 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
90 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
91 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
92 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
93 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
94 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
95 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
96 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
97 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
98 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
99 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
100 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
101 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
102 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
103 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
104 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
105 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
106 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
107 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
108 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
109 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
110 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
111 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
112 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
113 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
114 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
115 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
116 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
117 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
118 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
119 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
120 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
121 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
122 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
123 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
124 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
125 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
126 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
127 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
128 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
129 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
130 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
131 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
132 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
133 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
134 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
135 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
136 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
137 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
138 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
139 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
140 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
141 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
142 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
143 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
144 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
145 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
146 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
147 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
148 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
149 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
150 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
151 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
152 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
153 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
154 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
155 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
156 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
157 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
158 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
159 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
160 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
161 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
162 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
163 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
164 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
165 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
166 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
167 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
168 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
169 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
170 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
171 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
172 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
173 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
174 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
175 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
176 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
177 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
178 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
179 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
180 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
181 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
184 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
186 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
187 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
188 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
189 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
190 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
191 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
192 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
193 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
194 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
195 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
196 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
197 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
198 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
199 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
200 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
201 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
202 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
269 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
270 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
271 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
272 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
273 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
274 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
275 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
276 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
277 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
278 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
279 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
280 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
281 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
282 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
284 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
285 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
286 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
287 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
288 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
289 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
290 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
291 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
292 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
293 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
294 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
295 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
296 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
297 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
298 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
299 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
300 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
301 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
302 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
303 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
304 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
305 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
306 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
307 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
308 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
309 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
310 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
311 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
312 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
313 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
314 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
315 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
316 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
317 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
318 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
319 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
320 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
321 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
322 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
323 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
324 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
325 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
326 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
327 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
328 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
329 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
330 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
331 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
332 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
333 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
334 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
335 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
336 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
337 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
338 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
339 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
340 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
341 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
342 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
343 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
344 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
345 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
346 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
347 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
348 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
349 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
350 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
351 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
352 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
353 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
354 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
355 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
356 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
357 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
358 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
359 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
360 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
361 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
362 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
363 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
364 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
365 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
366 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
367 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
368 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
369 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
370 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
371 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
372 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
373 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
374 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
375 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
376 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
377 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
378 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
379 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
380 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
381 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
382 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
383 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
384 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
385 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
386 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
387 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
388 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
389 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
390 3300041508 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaT Metatranscriptome Unclassified
391 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
392 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
393 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
394 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
395 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
396 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
397 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
398 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
399 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
400 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
401 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
402 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
403 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
404 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
405 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
406 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
407 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
408 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
409 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
410 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
411 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
412 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
413 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
414 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
415 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
416 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
417 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
418 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
419 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
420 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
421 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
422 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
423 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
424 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
425 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
426 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
427 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
428 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
429 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
430 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
431 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
432 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
433 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
434 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
435 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
436 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
437 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
438 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
439 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
440 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
441 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
442 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
443 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
444 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
445 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
446 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
447 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
448 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
449 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
450 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
451 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
452 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
453 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
454 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
455 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
456 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
457 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
458 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
459 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
460 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
461 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
462 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
463 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
464 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
465 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
466 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
467 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
468 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
469 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
470 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
471 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
472 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
473 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
474 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
475 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
476 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
477 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
478 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
479 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
480 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
481 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
482 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
483 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
484 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
485 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
486 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
487 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
488 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
489 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
490 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
491 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
492 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
493 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
494 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
495 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
496 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
497 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
498 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
499 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
500 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
501 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
502 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
503 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
504 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
505 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
506 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
507 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
508 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
509 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
510 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
511 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
512 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
513 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
514 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
515 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
516 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
517 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
518 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
519 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
520 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
521 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
522 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
523 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
524 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
525 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
526 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
527 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
528 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
529 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
530 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
531 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
532 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
533 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
534 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
535 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
536 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
537 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
538 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
539 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
540 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
541 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
542 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
543 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
544 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
545 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
546 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
547 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
548 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
549 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
550 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
551 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
552 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
553 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
554 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
555 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
556 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
557 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
558 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
559 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
560 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
561 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
562 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
563 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
564 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
565 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
566 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
567 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
568 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
569 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
570 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
571 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
572 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
573 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
574 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
575 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
576 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
577 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
578 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
579 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
580 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
581 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
582 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
583 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
584 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
585 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
586 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
587 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
588 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
589 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
590 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
591 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
592 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
593 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
594 2506520008 Serratia plymuthica AS12 Isolate Unclassified
595 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
596 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
597 2511231006 Pseudomonas sp. GM17 Isolate Nodule
598 2511231008 Pseudomonas sp. GM21 Isolate Nodule
599 2511231010 Pseudomonas sp. GM25 Isolate Nodule
600 2511231011 Pseudomonas sp. GM30 Isolate Nodule
601 2511231012 Pseudomonas sp. GM33 Isolate Nodule
602 2511231014 Pseudomonas sp. GM48 Isolate Nodule
603 2511231015 Pseudomonas sp. GM49 Isolate Nodule
604 2511231017 Pseudomonas sp. GM55 Isolate Nodule
605 2511231018 Pseudomonas sp. GM60 Isolate Nodule
606 2511231019 Pseudomonas sp. GM67 Isolate Nodule
607 2511231020 Pseudomonas sp. GM74 Isolate Nodule
608 2511231021 Pseudomonas sp. GM78 Isolate Nodule
609 2511231023 Pseudomonas sp. GM80 Isolate Nodule
610 2511231024 Pseudomonas sp. GM84 Isolate Nodule
611 2511231031 Pseudomonas sp. GM16 Isolate Nodule
612 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
613 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
614 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
615 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
616 2523533628 Maridesulfovibrio zosterae DSM 11974 Isolate Rhizosphere
617 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
618 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
619 2547132181 Kosakonia sacchari SP1 Isolate Stem
620 2547132374 Acidovorax radicis N35 Isolate Unclassified
621 2547132416 Enterobacter sp. MR1 Isolate Rhizoplane
622 2547132512 Azospira oryzae 6a3 Isolate Unclassified
623 2548877040 Paenibacillus sonchi X19-5 Isolate Rhizosphere
624 2551306352 Acinetobacter sp. GG2 Isolate Rhizosphere
625 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
626 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
627 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
628 2561511199 Enterobacter sp. R4-368 Isolate Nodule
629 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
630 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
631 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
632 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
633 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
634 2582581873 Chryseobacterium sp. OV259 Isolate Rhizosphere
635 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
636 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
637 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
638 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
639 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
640 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
641 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
642 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
643 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
644 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
645 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
646 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
647 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
648 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
649 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
650 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
651 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
652 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
653 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
654 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
655 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
656 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
657 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
658 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
659 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
660 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
661 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
662 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
663 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
664 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
665 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
666 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
667 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
668 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
669 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
670 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
671 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
672 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
673 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
674 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
675 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
676 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
677 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
678 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
679 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
680 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
681 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
682 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
683 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
684 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
685 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
686 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
687 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
688 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
689 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
690 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
691 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
692 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
693 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
694 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
695 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
696 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
697 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
698 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
699 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
700 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
701 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
702 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
703 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
704 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
705 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
706 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
707 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
708 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
709 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
710 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
711 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
712 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
713 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
714 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
715 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
716 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
717 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
718 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
719 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
720 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
721 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
722 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
723 2636415599 Klebsiella variicola DX120E Isolate Unclassified
724 2639762793 Acinetobacter calcoaceticus GK1 Isolate Rhizosphere
725 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
726 2643221569 Achromobacter sp. Root565 Isolate Unclassified
727 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
728 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
729 2643221594 Achromobacter sp. Root170 Isolate Unclassified
730 2643221596 Acidovorax sp. Root70 Isolate Unclassified
731 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
732 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
733 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
734 2643221609 Acidovorax sp. Root217 Isolate Unclassified
735 2643221611 Acidovorax sp. Root219 Isolate Unclassified
736 2643221621 Achromobacter sp. Root83 Isolate Unclassified
737 2643221652 Acidovorax sp. Root402 Isolate Unclassified
738 2643221665 Acinetobacter sp. Root1280 Isolate Unclassified
739 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
740 2643221683 Variovorax sp. Root473 Isolate Unclassified
741 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
742 2643221717 Acidovorax sp. Root267 Isolate Unclassified
743 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
744 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
745 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
746 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
747 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
748 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
749 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
750 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
751 2675903507 Acinetobacter calcoaceticus GK2 Isolate Unclassified
752 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
753 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
754 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
755 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
756 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
757 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
758 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
759 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
760 2721755523 Delftia sp. HK171 Isolate Unclassified
761 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
762 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
763 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
764 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
765 2738541277 Variovorax sp. GV051 Isolate Unclassified
766 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
767 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
768 2738541284 Pedobacter sp. YR016 Isolate Unclassified
769 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
770 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
771 2738541307 Variovorax sp. GV008 Isolate Unclassified
772 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
773 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
774 2738543012 Acidovorax sp. CF301 Isolate Unclassified
775 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
776 2738543019 Variovorax sp. GV040 Isolate Unclassified
777 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
778 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
779 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
780 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
781 2740891818 Desulfofaba hansenii DSM 12642 Isolate Unclassified
782 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
783 2744054655 Acinetobacter sp. BMW17 Isolate Unclassified
784 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
785 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
786 2751185917 Enterobacter sp. HK169 Isolate Unclassified
787 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
788 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
789 2765235841 Pseudomonas putida AA7 Isolate Unclassified
790 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
791 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
792 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
793 2773857673 Pseudomonas sp. 443 Isolate Unclassified
794 2773857761 Acinetobacter sp. 3664 Isolate Unclassified
795 2773857770 Acinetobacter sp. 3636 Isolate Unclassified
796 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
797 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
798 2775507074 Klebsiella sp. D5A Isolate Unclassified
799 2784132063 Pseudomonas sp. 424 Isolate Unclassified
800 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
801 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
802 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
803 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
804 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
805 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
806 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
807 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
808 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
809 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
810 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
811 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
812 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
813 2816332133 Acidovorax radicis 2721A Isolate Unclassified
814 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
815 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
816 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
817 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
818 2821118458 Enterobacter asburiae 609 Isolate Unclassified
819 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
820 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
821 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
822 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
823 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
824 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
825 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
826 2842733646 Variovorax sp. R-72446 Isolate Unclassified
827 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
828 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
829 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
830 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
831 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
832 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
833 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
834 2846540461 Photorhabdus luminescens HIM3 Isolate Rhizosphere
835 2847085930 Erwinia persicina B64 Isolate Bulb
836 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
837 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
838 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
839 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
840 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
841 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
842 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
843 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
844 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
845 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
846 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
847 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
848 2858950400 Achromobacter sp. K91 Isolate Unclassified
849 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
850 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
851 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
852 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
853 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
854 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
855 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
856 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
857 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
858 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
859 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
860 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
861 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
862 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
863 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
864 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
865 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
866 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
867 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
868 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
869 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
870 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
871 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
872 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
873 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
874 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
875 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
876 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
877 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
878 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
879 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
880 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
881 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
882 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
883 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
884 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
885 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
886 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
887 2916699645 Acinetobacter ursingii M3 Isolate Unclassified
888 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
889 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
890 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
891 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
892 2919150387 Rahnella aceris 1817 Isolate Unclassified
893 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
894 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
895 2919182534 Acinetobacter calcoaceticus 2589 Isolate Rhizosphere
896 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
897 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
898 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
899 2919493220 Aeromonas salmonicida salmonicida 3466 Isolate Unclassified
900 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
901 2919506607 Acinetobacter sp. 3657 Isolate Unclassified
902 2919509842 Flavobacterium arsenatis 3773 Isolate Unclassified
903 2919543075 Aeromonas salmonicida masoucida 4076 Isolate Unclassified
904 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
905 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
906 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
907 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
908 2923525760 Aeromonas caviae SLBN-129 Isolate Rhizosphere
909 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
910 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
911 2927143783 Rahnella sp. 2050 Isolate Unclassified
912 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
913 2928515477 Acinetobacter bereziniae 1375 Isolate Rhizosphere
914 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
915 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
916 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
917 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
918 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
919 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
920 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
921 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
922 2937539931 Pantoea sp. LS15 Isolate Unclassified
923 2937967321 Serratia sp. YC16 Isolate Unclassified
924 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
925 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
926 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
927 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
928 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
929 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
930 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
931 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
932 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
933 2941479691
934 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
935 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
936 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
937 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
938 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
939 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
940 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
941 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
942 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
943 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
944 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
945 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
946 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
947 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
948 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
949 2984568884 Acinetobacter baylyi SORGH_AS893 Isolate Aerial Root
950 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
951 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
952 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
953 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
954 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
955 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
956 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
957 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
958 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
959 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
960 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
961 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
962 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
963 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
964 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
965 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
966 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
967 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
968 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
969 640753048 Serratia proteamaculans 568 Isolate Endosphere
970 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
971 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
972 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
973 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
974 8004592986 Serratia sp. S119 Isolate Unclassified
975 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
976 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
977 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
978 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
979 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
980 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
981 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
982 8033232454 Acinetobacter radioresistens SA188 Isolate Unclassified
983 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
984 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified
985 8052494512 Pseudomonas putida LD6 Isolate Unclassified
986 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
987 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
988 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
989 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
990 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
991 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
992 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
993 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
994 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
995 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
996 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere
997 8055693939 Hafnia alvei A23BA Isolate Rhizosphere
998 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
999 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
1000 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
1001 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
1002 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
1003 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
1004 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
1005 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
1006 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
1007 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
1008 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
1009 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
1010 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere
1011 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
1012 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere
1013 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.42
Metatranscriptomes 0.2
Isolates 14.37

Biome Distribution

Category Percentage (%)
Aerial Root 0.1
Bulb 0.03
Endosphere 3.79
Nodule 1.5
Rhizoplane 5.5
Rhizosphere 75.18
Stem 0.03
Stem Tuber 0.17
Unclassified 0.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496114_0000009 3300048917 Bacteria 370373
2 SwRhRL2b_contig_1215741 2162886007 Bacteria 7157
3 MBSR1b_contig_7611668 2162886012 Bacteria 2977
4 CNXas_1000011 3300000545 Bacteria 39332
5 JGI24741J21665_1000421 3300001915 Bacteria 12841
6 JGI24033J26618_1000723 3300002155 Bacteria 3171
7 JGI24751J29686_10001414 3300002459 Bacteria 5030
8 JGI24751J29686_10007421 3300002459 Bacteria 2240
9 JGI25162J39368_1001029 3300002737 Bacteria 17235
10 JGI25163J39215_1000205 3300002771 Bacteria 22705
11 JGI25163J39215_1000395 3300002771 Bacteria 13867
12 JGI25164J39214_1000008 3300002772 Bacteria 311285
13 JGI25164J39214_1000550 3300002772 Bacteria 17235
14 JGI25406J46586_10013161 3300003203 Bacteria 3565
15 JGI25406J46586_10015249 3300003203 Bacteria 3246
16 JGI25165J46597_1000391 3300003214 Bacteria 46730
17 rootH2_10055948 3300003320 Bacteria 3070
18 rootL2_10170469 3300003322 Bacteria 1949
19 Ga0006562J51391_1009174 3300003578 Bacteria 3659
20 Ga0006562J51391_1013379 3300003578 Bacteria 3111
21 Ga0055538_1000014 3300003751 Bacteria 311285
22 Ga0055538_1000065 3300003751 Bacteria 100831
23 Ga0055539_1000020 3300003752 Bacteria 311285
24 Ga0055539_1000099 3300003752 Bacteria 100831
25 Ga0055533_1000027 3300003756 Bacteria 311285
26 Ga0055533_1000109 3300003756 Bacteria 100831
27 Ga0055532_1000094 3300003758 Bacteria 100832
28 Ga0055525_1000032 3300003759 Bacteria 311285
29 Ga0055525_1000143 3300003759 Bacteria 100831
30 Ga0055535_1005097 3300003761 Bacteria 2980
31 Ga0055526_1000233 3300003771 Bacteria 46692
32 Ga0055526_1002689 3300003771 Bacteria 11842
33 Ga0055524_1000159 3300003775 Bacteria 78586
34 Ga0055536_1000059 3300003781 Bacteria 103307
35 Ga0055536_1001131 3300003781 Bacteria 16699
36 Ga0055536_1004497 3300003781 Bacteria 7100
37 Ga0055536_1004850 3300003781 Bacteria 6722
38 Ga0055534_1009665 3300003784 Bacteria 2078
39 Ga0055530_10001818 3300003791 Bacteria 14748
40 Ga0055530_10002957 3300003791 Bacteria 10254
41 Ga0055530_10005896 3300003791 Bacteria 5658
42 Ga0055540_1000023 3300003792 Bacteria 201131
43 Ga0055540_1000084 3300003792 Bacteria 107482
44 Ga0055540_1003017 3300003792 Bacteria 8420
45 Ga0055540_1005110 3300003792 Bacteria 5654
46 Ga0055531_10000213 3300003794 Bacteria 63699
47 Ga0055531_10005322 3300003794 Bacteria 7550
48 Ga0055541_1000014 3300003841 Bacteria 311285
49 Ga0055541_1000066 3300003841 Bacteria 100831
50 Ga0058692_1000014 3300003856 Bacteria 313984
51 Ga0058692_1000796 3300003856 Bacteria 12621
52 Ga0058692_1001239 3300003856 Bacteria 9769
53 Ga0058692_1003345 3300003856 Bacteria 4972
54 Ga0058692_1003397 3300003856 Bacteria 4925
55 Ga0058692_1003486 3300003856 Bacteria 4849
56 Ga0058692_1004114 3300003856 Bacteria 4364
57 Ga0065165_1000539 3300005262 Bacteria 57421
58 Ga0065703_1018772 3300005272 Bacteria 9412
59 Ga0065703_1019024 3300005272 Bacteria 4335
60 Ga0065714_10002224 3300005288 Bacteria 45363
61 Ga0065714_10002661 3300005288 Bacteria 44282
62 Ga0065714_10002760 3300005288 Bacteria 11166
63 Ga0065714_10003556 3300005288 Bacteria 8571
64 Ga0065714_10064639 3300005288 Bacteria 26594
65 Ga0065714_10067571 3300005288 Bacteria 5367
66 Ga0065714_10068318 3300005288 Bacteria 4816
67 Ga0065714_10070672 3300005288 Bacteria 3797
68 Ga0065714_10084095 3300005288 Bacteria 2215
69 Ga0065714_10100057 3300005288 Bacteria 1673
70 Ga0065714_10101317 3300005288 Bacteria 1646
71 Ga0065704_10000562 3300005289 Bacteria 16554
72 Ga0065704_10002082 3300005289 Bacteria 7107
73 Ga0065704_10003382 3300005289 Bacteria 5777
74 Ga0065704_10078770 3300005289 Bacteria 4338
75 Ga0065704_10082107 3300005289 Bacteria 3652
76 Ga0065704_10084957 3300005289 Bacteria 3277
77 Ga0065704_10135794 3300005289 Bacteria 1573
78 Ga0065712_10117391 3300005290 Bacteria 1721
79 Ga0065715_10001484 3300005293 Bacteria 8424
80 Ga0065715_10019057 3300005293 Bacteria 2810
81 Ga0065715_10026204 3300005293 Bacteria 1899
82 Ga0065715_10126408 3300005293 Bacteria 2109
83 Ga0065707_10008614 3300005295 Bacteria 3309
84 Ga0065707_10121134 3300005295 Bacteria 2117
85 Ga0065707_10136519 3300005295 Bacteria 1827
86 Ga0065707_10144561 3300005295 Bacteria 1729
87 Ga0070676_10003061 3300005328 Bacteria 8636
88 Ga0070676_10015658 3300005328 Bacteria 4185
89 Ga0070676_10050231 3300005328 Bacteria 2444
90 Ga0070676_10093862 3300005328 Bacteria 1843
91 Ga0070683_100037047 3300005329 Bacteria 4464
92 Ga0070683_100087539 3300005329 Bacteria 2922
93 Ga0070683_100140797 3300005329 Bacteria 2285
94 Ga0070690_100009715 3300005330 Bacteria 5580
95 Ga0070690_100080595 3300005330 Bacteria 2129
96 Ga0070690_100125984 3300005330 Bacteria 1724
97 Ga0070670_100000189 3300005331 Bacteria 56435
98 Ga0070670_100007325 3300005331 Bacteria 9363
99 Ga0070670_100009786 3300005331 Bacteria 8188
100 Ga0070670_100017994 3300005331 Bacteria 6065
101 Ga0070670_100019496 3300005331 Bacteria 5821
102 Ga0070670_100081900 3300005331 Bacteria 2773
103 Ga0070670_100101339 3300005331 Bacteria 2479
104 Ga0070670_100149293 3300005331 Bacteria 2023
105 Ga0068869_100101382 3300005334 Bacteria 2178
106 Ga0070666_10006496 3300005335 Bacteria 7183
107 Ga0070666_10048619 3300005335 Bacteria 2850
108 Ga0070680_100004033 3300005336 Bacteria 10986
109 Ga0070680_100076216 3300005336 Bacteria 2760
110 Ga0070682_100000015 3300005337 Bacteria 249390
111 Ga0070682_100001862 3300005337 Bacteria 11767
112 Ga0070682_100014412 3300005337 Bacteria 4567
113 Ga0070682_100028533 3300005337 Bacteria 3357
114 Ga0068868_100002429 3300005338 Bacteria 12908
115 Ga0068868_100054873 3300005338 Bacteria 3142
116 Ga0070660_100008148 3300005339 Bacteria 7323
117 Ga0070660_100143983 3300005339 Bacteria 1914
118 Ga0070689_100006764 3300005340 Bacteria 7972
119 Ga0070689_100045716 3300005340 Bacteria 3372
120 Ga0070689_100054345 3300005340 Bacteria 3100
121 Ga0070689_100079510 3300005340 Bacteria 2572
122 Ga0070689_100119361 3300005340 Bacteria 2105
123 Ga0070689_100149461 3300005340 Bacteria 1883
124 Ga0070691_10029888 3300005341 Bacteria 2551
125 Ga0070687_100059499 3300005343 Bacteria 2012
126 Ga0070661_100001680 3300005344 Bacteria 15324
127 Ga0070692_10083966 3300005345 Bacteria 1720
128 Ga0070668_100020911 3300005347 Bacteria 4943
129 Ga0070668_100185899 3300005347 Bacteria 1699
130 Ga0070669_100000002 3300005353 Bacteria 506497
131 Ga0070669_100002540 3300005353 Bacteria 13189
132 Ga0070669_100005374 3300005353 Bacteria 9243
133 Ga0070669_100007453 3300005353 Bacteria 7839
134 Ga0070669_100010572 3300005353 Bacteria 6554
135 Ga0070669_100038114 3300005353 Bacteria 3489
136 Ga0070675_100021663 3300005354 Bacteria 5135
137 Ga0070675_100033490 3300005354 Bacteria 4166
138 Ga0070675_100034683 3300005354 Bacteria 4096
139 Ga0070675_100059434 3300005354 Bacteria 3153
140 Ga0070675_100147001 3300005354 Bacteria 2019
141 Ga0070671_100002469 3300005355 Bacteria 14294
142 Ga0070671_100012326 3300005355 Bacteria 6883
143 Ga0070671_100025279 3300005355 Bacteria 4871
144 Ga0070671_100045314 3300005355 Bacteria 3656
145 Ga0070671_100068159 3300005355 Bacteria 2967
146 Ga0070671_100083951 3300005355 Bacteria 2664
147 Ga0070671_100086392 3300005355 Bacteria 2624
148 Ga0070674_100003746 3300005356 Bacteria 8578
149 Ga0070674_100008167 3300005356 Bacteria 6214
150 Ga0070674_100085340 3300005356 Bacteria 2266
151 Ga0070673_100027228 3300005364 Bacteria 4236
152 Ga0070673_100029158 3300005364 Bacteria 4113
153 Ga0070673_100033180 3300005364 Bacteria 3895
154 Ga0070673_100057777 3300005364 Bacteria 3066
155 Ga0070673_100153400 3300005364 Bacteria 1953
156 Ga0070688_100008929 3300005365 Bacteria 5458
157 Ga0070688_100110024 3300005365 Bacteria 1831
158 Ga0070659_100025516 3300005366 Bacteria 4540
159 Ga0070659_100027673 3300005366 Bacteria 4370
160 Ga0070659_100034003 3300005366 Bacteria 3964
161 Ga0070667_100035493 3300005367 Bacteria 4177
162 Ga0070667_100052614 3300005367 Bacteria 3437
163 Ga0070703_10020319 3300005406 Bacteria 1931
164 Ga0070709_10001725 3300005434 Bacteria 11883
165 Ga0070709_10002168 3300005434 Bacteria 10639
166 Ga0070709_10103649 3300005434 Bacteria 1900
167 Ga0070714_100000060 3300005435 Bacteria 100913
168 Ga0070714_100000531 3300005435 Bacteria 27590
169 Ga0070714_100004116 3300005435 Bacteria 10936
170 Ga0070713_100001174 3300005436 Bacteria 16741
171 Ga0070713_100007027 3300005436 Bacteria 7862
172 Ga0070713_100023927 3300005436 Bacteria 4750
173 Ga0070713_100027544 3300005436 Bacteria 4475
174 Ga0070713_100047633 3300005436 Bacteria 3524
175 Ga0070713_100171450 3300005436 Bacteria 1944
176 Ga0070710_10005313 3300005437 Bacteria 6106
177 Ga0070701_10004411 3300005438 Bacteria 5694
178 Ga0070701_10006353 3300005438 Bacteria 4971
179 Ga0070711_100005895 3300005439 Bacteria 7355
180 Ga0070711_100158986 3300005439 Bacteria 1711
181 Ga0070705_100056768 3300005440 Bacteria 2307
182 Ga0070700_100004050 3300005441 Bacteria 7628
183 Ga0070700_100088227 3300005441 Bacteria 2018
184 Ga0070694_100020058 3300005444 Bacteria 4257
185 Ga0070708_100018696 3300005445 Bacteria 5801
186 Ga0070708_100019125 3300005445 Bacteria 5747
187 Ga0070708_100021917 3300005445 Bacteria 5413
188 Ga0070708_100032717 3300005445 Bacteria 4513
189 Ga0070708_100079345 3300005445 Bacteria 2969
190 Ga0070708_100090608 3300005445 Bacteria 2784
191 Ga0070708_100291261 3300005445 Bacteria 1537
192 Ga0070663_100070110 3300005455 Bacteria 2548
193 Ga0070678_100023462 3300005456 Bacteria 4112
194 Ga0070678_100081831 3300005456 Bacteria 2449
195 Ga0070678_100089453 3300005456 Bacteria 2357
196 Ga0070662_100001386 3300005457 Bacteria 14913
197 Ga0070662_100026299 3300005457 Bacteria 4029
198 Ga0070662_100105116 3300005457 Bacteria 2143
199 Ga0070681_10000172 3300005458 Bacteria 49288
200 Ga0070681_10000495 3300005458 Bacteria 32115
201 Ga0070681_10022247 3300005458 Bacteria 6364
202 Ga0070681_10027448 3300005458 Bacteria 5724
203 Ga0070681_10085711 3300005458 Bacteria 3103
204 Ga0070681_10124630 3300005458 Bacteria 2509
205 Ga0068867_100026060 3300005459 Bacteria 4195
206 Ga0070685_10003429 3300005466 Bacteria 8060
207 Ga0070706_100000060 3300005467 Bacteria 131097
208 Ga0070706_100001072 3300005467 Bacteria 29564
209 Ga0070706_100007318 3300005467 Bacteria 10356
210 Ga0070706_100008244 3300005467 Bacteria 9719
211 Ga0070706_100011145 3300005467 Bacteria 8345
212 Ga0070706_100025389 3300005467 Bacteria 5452
213 Ga0070706_100033458 3300005467 Bacteria 4745
214 Ga0070706_100035898 3300005467 Bacteria 4577
215 Ga0070706_100060806 3300005467 Bacteria 3487
216 Ga0070706_100062989 3300005467 Bacteria 3426
217 Ga0070707_100034163 3300005468 Bacteria 4849
218 Ga0070707_100036019 3300005468 Bacteria 4721
219 Ga0070707_100038068 3300005468 Bacteria 4593
220 Ga0070707_100042560 3300005468 Bacteria 4348
221 Ga0070707_100048349 3300005468 Bacteria 4075
222 Ga0070707_100049763 3300005468 Bacteria 4017
223 Ga0070707_100061094 3300005468 Bacteria 3613
224 Ga0070707_100109597 3300005468 Bacteria 2677
225 Ga0070698_100001426 3300005471 Bacteria 26470
226 Ga0070698_100005312 3300005471 Bacteria 14096
227 Ga0070698_100008064 3300005471 Bacteria 11390
228 Ga0070698_100008930 3300005471 Bacteria 10782
229 Ga0070698_100014479 3300005471 Bacteria 8329
230 Ga0070698_100025959 3300005471 Bacteria 6103
231 Ga0070698_100027732 3300005471 Bacteria 5886
232 Ga0070698_100034898 3300005471 Bacteria 5203
233 Ga0070698_100199202 3300005471 Bacteria 1938
234 Ga0070699_100006077 3300005518 Bacteria 10561
235 Ga0070699_100006860 3300005518 Bacteria 9911
236 Ga0070699_100011665 3300005518 Bacteria 7586
237 Ga0070699_100043920 3300005518 Bacteria 3868
238 Ga0070699_100051172 3300005518 Bacteria 3576
239 Ga0070699_100091272 3300005518 Bacteria 2663
240 Ga0070699_100103345 3300005518 Bacteria 2499
241 Ga0070699_100210724 3300005518 Bacteria 1730
242 Ga0070699_100243734 3300005518 Bacteria 1605
243 Ga0070684_100002299 3300005535 Bacteria 14095
244 Ga0070697_100002882 3300005536 Bacteria 13227
245 Ga0070697_100012468 3300005536 Bacteria 6660
246 Ga0070697_100129784 3300005536 Bacteria 2113
247 Ga0070697_100134395 3300005536 Bacteria 2076
248 Ga0070697_100214454 3300005536 Bacteria 1640
249 Ga0068853_100001735 3300005539 Bacteria 15980
250 Ga0068853_100117004 3300005539 Bacteria 2374
251 Ga0070672_100003894 3300005543 Bacteria 9725
252 Ga0070672_100005318 3300005543 Bacteria 8524
253 Ga0070672_100028350 3300005543 Bacteria 4188
254 Ga0070686_100065481 3300005544 Bacteria 2361
255 Ga0070696_100028410 3300005546 Bacteria 3817
256 Ga0070696_100111662 3300005546 Bacteria 1969
257 Ga0070693_100011413 3300005547 Bacteria 4474
258 Ga0070665_100005369 3300005548 Bacteria 13234
259 Ga0070665_100096789 3300005548 Bacteria 2956
260 Ga0070665_100235460 3300005548 Bacteria 1831
261 Ga0070704_100000472 3300005549 Bacteria 18965
262 Ga0070704_100174140 3300005549 Bacteria 1715
263 Ga0068855_100026120 3300005563 Bacteria 6986
264 Ga0068855_100090625 3300005563 Bacteria 3528
265 Ga0068855_100113023 3300005563 Bacteria 3116
266 Ga0068855_100194281 3300005563 Bacteria 2287
267 Ga0068855_100335573 3300005563 Bacteria 1668
268 Ga0070664_100000749 3300005564 Bacteria 25062
269 Ga0070664_100002405 3300005564 Bacteria 15038
270 Ga0068857_100003295 3300005577 Bacteria 13415
271 Ga0068857_100074806 3300005577 Bacteria 3019
272 Ga0068854_100004716 3300005578 Bacteria 8591
273 Ga0068854_100146062 3300005578 Bacteria 1819
274 Ga0068856_100001235 3300005614 Bacteria 26818
275 Ga0068856_100062067 3300005614 Bacteria 3692
276 Ga0068856_100068869 3300005614 Bacteria 3498
277 Ga0068856_100224725 3300005614 Bacteria 1893
278 Ga0068852_100103199 3300005616 Bacteria 2578
279 Ga0068859_100000021 3300005617 Bacteria 236322
280 Ga0068859_100026993 3300005617 Bacteria 5761
281 Ga0068859_100036793 3300005617 Bacteria 4914
282 Ga0068859_100053293 3300005617 Bacteria 4068
283 Ga0068859_100168190 3300005617 Bacteria 2273
284 Ga0068864_100038194 3300005618 Bacteria 4099
285 Ga0068861_100009201 3300005719 Bacteria 6812
286 Ga0068851_10000002 3300005834 Bacteria 302756
287 Ga0068863_100004355 3300005841 Bacteria 13953
288 Ga0068863_100138624 3300005841 Bacteria 2324
289 Ga0068863_100173707 3300005841 Bacteria 2068
290 Ga0068858_100001664 3300005842 Bacteria 22717
291 Ga0068858_100192582 3300005842 Bacteria 1927
292 Ga0068860_100011657 3300005843 Bacteria 8668
293 Ga0068860_100094445 3300005843 Bacteria 2850
294 Ga0068860_100145563 3300005843 Bacteria 2280
295 Ga0068862_100000907 3300005844 Bacteria 28711
296 Ga0068862_100016065 3300005844 Bacteria 6225
297 Ga0068862_100064830 3300005844 Bacteria 3145
298 Ga0068862_100073044 3300005844 Bacteria 2964
299 Ga0081455_10005178 3300005937 Bacteria 14354
300 Ga0081455_10006550 3300005937 Bacteria 12460
301 Ga0081455_10011929 3300005937 Bacteria 8696
302 Ga0081455_10014792 3300005937 Bacteria 7613
303 Ga0081455_10065679 3300005937 Bacteria 3033
304 Ga0081538_10039199 3300005981 Bacteria 3042
305 Ga0081539_10000403 3300005985 Bacteria 92820
306 Ga0081539_10001964 3300005985 Bacteria 31310
307 Ga0081539_10007470 3300005985 Bacteria 9950
308 Ga0081539_10034847 3300005985 Bacteria 3035
309 Ga0081539_10043424 3300005985 Bacteria 2606
310 Ga0070717_10008912 3300006028 Bacteria 7517
311 Ga0070717_10044430 3300006028 Bacteria 3627
312 Ga0070717_10061999 3300006028 Bacteria 3100
313 Ga0075368_10000340 3300006042 Bacteria 13640
314 Ga0075364_10011474 3300006051 Bacteria 5382
315 Ga0075364_10018889 3300006051 Bacteria 4322
316 Ga0075364_10058625 3300006051 Bacteria 2523
317 Ga0075432_10001455 3300006058 Bacteria 7717
318 Ga0075432_10003602 3300006058 Bacteria 5262
319 Ga0075432_10023012 3300006058 Bacteria 2133
320 Ga0075432_10023990 3300006058 Bacteria 2089
321 Ga0075432_10024517 3300006058 Bacteria 2067
322 Ga0070715_10003585 3300006163 Bacteria 4973
323 Ga0070716_100000137 3300006173 Bacteria 29476
324 Ga0070716_100017145 3300006173 Bacteria 3750
325 Ga0070716_100026127 3300006173 Bacteria 3124
326 Ga0070716_100041663 3300006173 Bacteria 2559
327 Ga0070716_100042413 3300006173 Bacteria 2540
328 Ga0070716_100074147 3300006173 Bacteria 2010
329 Ga0070716_100136924 3300006173 Bacteria 1556
330 Ga0070712_100000057 3300006175 Bacteria 56727
331 Ga0070712_100000154 3300006175 Bacteria 36911
332 Ga0070712_100001792 3300006175 Bacteria 13129
333 Ga0070712_100004923 3300006175 Bacteria 8260
334 Ga0070712_100006229 3300006175 Bacteria 7386
335 Ga0075362_10003824 3300006177 Bacteria 5338
336 Ga0075362_10038665 3300006177 Bacteria 2096
337 Ga0075369_10010212 3300006186 Bacteria 3669
338 Ga0075427_10002640 3300006194 Bacteria 2423
339 Ga0097621_100005910 3300006237 Bacteria 8649
340 Ga0068871_100015542 3300006358 Bacteria 5702
341 Ga0068871_100209699 3300006358 Bacteria 1685
342 Ga0075428_100001508 3300006844 Bacteria 24922
343 Ga0075428_100004126 3300006844 Bacteria 15993
344 Ga0075428_100006849 3300006844 Bacteria 12667
345 Ga0075428_100024446 3300006844 Bacteria 6685
346 Ga0075428_100049140 3300006844 Bacteria 4628
347 Ga0075428_100077354 3300006844 Bacteria 3632
348 Ga0075428_100107266 3300006844 Bacteria 3044
349 Ga0075430_100004750 3300006846 Bacteria 11433
350 Ga0075430_100045750 3300006846 Bacteria 3696
351 Ga0075431_100004236 3300006847 Bacteria 14055
352 Ga0075431_100015576 3300006847 Bacteria 7706
353 Ga0075431_100016188 3300006847 Bacteria 7564
354 Ga0075431_100016399 3300006847 Bacteria 7519
355 Ga0075431_100190491 3300006847 Bacteria 2101
356 Ga0075431_100194569 3300006847 Bacteria 2076
357 Ga0075433_10000856 3300006852 Bacteria 21334
358 Ga0075433_10002698 3300006852 Bacteria 13552
359 Ga0075433_10014389 3300006852 Bacteria 6461
360 Ga0075433_10032336 3300006852 Bacteria 4481
361 Ga0075433_10152001 3300006852 Bacteria 2059
362 Ga0075433_10168316 3300006852 Bacteria 1950
363 Ga0075433_10232388 3300006852 Bacteria 1637
364 Ga0075434_100001763 3300006871 Bacteria 18616
365 Ga0075434_100003148 3300006871 Bacteria 14709
366 Ga0075434_100007797 3300006871 Bacteria 9914
367 Ga0075434_100020162 3300006871 Bacteria 6461
368 Ga0075434_100043160 3300006871 Bacteria 4471
369 Ga0075429_100001560 3300006880 Bacteria 18832
370 Ga0075429_100128339 3300006880 Bacteria 2218
371 Ga0068865_100155757 3300006881 Bacteria 1738
372 Ga0075436_100016359 3300006914 Bacteria 5076
373 Ga0075436_100123164 3300006914 Bacteria 1815
374 Ga0097620_100000021 3300006931 Bacteria 236322
375 Ga0097620_100026994 3300006931 Bacteria 5761
376 Ga0097620_100036795 3300006931 Bacteria 4914
377 Ga0097620_100053296 3300006931 Bacteria 4068
378 Ga0097620_100168190 3300006931 Bacteria 2273
379 Ga0099823_1003937 3300006944 Bacteria 14335
380 Ga0079104_1000002 3300006946 Bacteria 514469
381 Ga0079104_1000071 3300006946 Bacteria 153790
382 Ga0079104_1000156 3300006946 Bacteria 97036
383 Ga0079104_1000157 3300006946 Bacteria 96925
384 Ga0079104_1000707 3300006946 Bacteria 30262
385 Ga0079104_1000804 3300006946 Bacteria 26453
386 Ga0079104_1001098 3300006946 Bacteria 20166
387 Ga0079104_1005686 3300006946 Bacteria 4913
388 Ga0075435_100006566 3300007076 Bacteria 8230
389 Ga0075435_100010771 3300007076 Bacteria 6698
390 Ga0075435_100014550 3300007076 Bacteria 5886
391 Ga0075435_100060378 3300007076 Bacteria 3074
392 Ga0075435_100075483 3300007076 Bacteria 2761
393 Ga0099794_10000025 3300007265 Bacteria 60175
394 Ga0105251_10000230 3300009011 Bacteria 56255
395 Ga0105251_10000713 3300009011 Bacteria 30624
396 Ga0105251_10002968 3300009011 Bacteria 12721
397 Ga0105251_10005208 3300009011 Bacteria 8572
398 Ga0105251_10006896 3300009011 Bacteria 7127
399 Ga0105251_10007894 3300009011 Bacteria 6468
400 Ga0105251_10010179 3300009011 Bacteria 5478
401 Ga0105251_10020652 3300009011 Bacteria 3457
402 Ga0105244_10000005 3300009036 Bacteria 481412
403 Ga0105244_10000038 3300009036 Bacteria 158460
404 Ga0105244_10000287 3300009036 Bacteria 49801
405 Ga0105244_10000380 3300009036 Bacteria 41289
406 Ga0105244_10000900 3300009036 Bacteria 25121
407 Ga0105244_10001172 3300009036 Bacteria 21688
408 Ga0105244_10002028 3300009036 Bacteria 15622
409 Ga0105244_10006729 3300009036 Bacteria 7395
410 Ga0105244_10008634 3300009036 Bacteria 6345
411 Ga0105244_10018941 3300009036 Bacteria 3853
412 Ga0105244_10029149 3300009036 Bacteria 2954
413 Ga0105244_10029411 3300009036 Bacteria 2937
414 Ga0105244_10031344 3300009036 Bacteria 2821
415 Ga0105250_10002294 3300009092 Bacteria 9720
416 Ga0105250_10004947 3300009092 Bacteria 6045
417 Ga0105250_10005194 3300009092 Bacteria 5873
418 Ga0105250_10009457 3300009092 Bacteria 4102
419 Ga0105250_10013887 3300009092 Bacteria 3317
420 Ga0105250_10026095 3300009092 Bacteria 2353
421 Ga0105250_10031892 3300009092 Bacteria 2116
422 Ga0105240_10029012 3300009093 Bacteria 7216
423 Ga0105240_10058712 3300009093 Bacteria 4803
424 Ga0105240_10157301 3300009093 Bacteria 2702
425 Ga0111539_10001894 3300009094 Bacteria 27841
426 Ga0111539_10003743 3300009094 Bacteria 20014
427 Ga0111539_10009531 3300009094 Bacteria 12255
428 Ga0111539_10012199 3300009094 Bacteria 10780
429 Ga0111539_10027092 3300009094 Bacteria 7001
430 Ga0111539_10058473 3300009094 Bacteria 4574
431 Ga0111539_10110048 3300009094 Bacteria 3233
432 Ga0111539_10114668 3300009094 Bacteria 3160
433 Ga0111539_10168462 3300009094 Bacteria 2560
434 Ga0105245_10011710 3300009098 Bacteria 7633
435 Ga0105245_10082913 3300009098 Bacteria 2934
436 Ga0105245_10111168 3300009098 Bacteria 2548
437 Ga0105245_10116985 3300009098 Bacteria 2486
438 Ga0105245_10158585 3300009098 Bacteria 2145
439 Ga0105245_10179920 3300009098 Bacteria 2019
440 Ga0105245_10184047 3300009098 Bacteria 1997
441 Ga0105247_10001413 3300009101 Bacteria 17422
442 Ga0105247_10006981 3300009101 Bacteria 6951
443 Ga0114129_10005945 3300009147 Bacteria 17275
444 Ga0114129_10008249 3300009147 Bacteria 14856
445 Ga0114129_10018324 3300009147 Bacteria 9974
446 Ga0114129_10026057 3300009147 Bacteria 8280
447 Ga0114129_10038347 3300009147 Bacteria 6760
448 Ga0114129_10050450 3300009147 Bacteria 5845
449 Ga0114129_10069504 3300009147 Bacteria 4909
450 Ga0114129_10106461 3300009147 Bacteria 3874
451 Ga0114129_10464939 3300009147 Bacteria 1657
452 Ga0114129_10475494 3300009147 Bacteria 1636
453 Ga0105243_10000007 3300009148 Bacteria 445042
454 Ga0105243_10000048 3300009148 Bacteria 148448
455 Ga0105243_10001529 3300009148 Bacteria 20211
456 Ga0105243_10002094 3300009148 Bacteria 16900
457 Ga0105243_10002720 3300009148 Bacteria 14693
458 Ga0105243_10004604 3300009148 Bacteria 10872
459 Ga0105243_10015831 3300009148 Bacteria 5705
460 Ga0105243_10042741 3300009148 Bacteria 3549
461 Ga0105243_10046667 3300009148 Bacteria 3408
462 Ga0105243_10053681 3300009148 Bacteria 3198
463 Ga0105243_10075822 3300009148 Bacteria 2730
464 Ga0105243_10116769 3300009148 Bacteria 2242
465 Ga0105243_10186576 3300009148 Bacteria 1808
466 Ga0105241_10000013 3300009174 Bacteria 172249
467 Ga0105241_10030979 3300009174 Bacteria 4001
468 Ga0105241_10050628 3300009174 Bacteria 3166
469 Ga0105241_10193482 3300009174 Bacteria 1694
470 Ga0105242_10007107 3300009176 Bacteria 8642
471 Ga0105242_10008850 3300009176 Bacteria 7725
472 Ga0105242_10015408 3300009176 Bacteria 5936
473 Ga0105242_10019091 3300009176 Bacteria 5369
474 Ga0105242_10024669 3300009176 Bacteria 4751
475 Ga0105242_10084905 3300009176 Bacteria 2654
476 Ga0105242_10155692 3300009176 Bacteria 1996
477 Ga0105242_10157935 3300009176 Bacteria 1982
478 Ga0105248_10002310 3300009177 Bacteria 21139
479 Ga0105248_10004739 3300009177 Bacteria 15057
480 Ga0105248_10027355 3300009177 Bacteria 6348
481 Ga0105248_10038991 3300009177 Bacteria 5319
482 Ga0105248_10090133 3300009177 Bacteria 3453
483 Ga0105248_10189276 3300009177 Bacteria 2319
484 Ga0105248_10272889 3300009177 Bacteria 1904
485 Ga0105237_10004364 3300009545 Bacteria 16399
486 Ga0105237_10011045 3300009545 Bacteria 9575
487 Ga0105237_10018913 3300009545 Bacteria 7121
488 Ga0105237_10131801 3300009545 Bacteria 2494
489 Ga0105237_10138542 3300009545 Bacteria 2428
490 Ga0105238_10068203 3300009551 Bacteria 3558
491 Ga0105238_10094839 3300009551 Bacteria 2971
492 Ga0105238_10204885 3300009551 Bacteria 1948
493 Ga0105249_10001559 3300009553 Bacteria 20120
494 Ga0105249_10013235 3300009553 Bacteria 7281
495 Ga0105239_10166554 3300010375 Bacteria 2464
496 Ga0105246_10001472 3300011119 Bacteria 13976
497 Ga0105246_10001828 3300011119 Bacteria 12755
498 Ga0105246_10006800 3300011119 Bacteria 6991
499 Ga0157345_1000341 3300012498 Bacteria 5516
500 Ga0157373_10000016 3300013100 Bacteria 181215
501 Ga0157373_10000094 3300013100 Bacteria 73332
502 Ga0157373_10000158 3300013100 Bacteria 54838
503 Ga0157373_10003540 3300013100 Bacteria 11795
504 Ga0157373_10005904 3300013100 Bacteria 9162
505 Ga0157373_10013594 3300013100 Bacteria 5971
506 Ga0157373_10017496 3300013100 Bacteria 5221
507 Ga0157373_10017678 3300013100 Bacteria 5191
508 Ga0157373_10020808 3300013100 Bacteria 4762
509 Ga0157373_10022021 3300013100 Bacteria 4624
510 Ga0157373_10023034 3300013100 Bacteria 4517
511 Ga0157373_10044939 3300013100 Bacteria 3154
512 Ga0157373_10108123 3300013100 Bacteria 1955
513 Ga0157371_10000056 3300013102 Bacteria 172695
514 Ga0157371_10003173 3300013102 Bacteria 15127
515 Ga0157371_10003333 3300013102 Bacteria 14671
516 Ga0157371_10017174 3300013102 Bacteria 5381
517 Ga0157371_10018757 3300013102 Bacteria 5112
518 Ga0157371_10023729 3300013102 Bacteria 4484
519 Ga0157371_10030734 3300013102 Bacteria 3873
520 Ga0157371_10035887 3300013102 Bacteria 3552
521 Ga0157371_10063603 3300013102 Bacteria 2615
522 Ga0157370_10002149 3300013104 Bacteria 24098
523 Ga0157370_10002520 3300013104 Bacteria 22024
524 Ga0157370_10004138 3300013104 Bacteria 16810
525 Ga0157370_10006949 3300013104 Bacteria 12363
526 Ga0157370_10022805 3300013104 Bacteria 6225
527 Ga0157370_10039461 3300013104 Bacteria 4563
528 Ga0157370_10067570 3300013104 Bacteria 3379
529 Ga0157370_10088769 3300013104 Bacteria 2904
530 Ga0157370_10092036 3300013104 Bacteria 2846
531 Ga0157370_10093062 3300013104 Bacteria 2829
532 Ga0157369_10002012 3300013105 Bacteria 24492
533 Ga0157369_10007119 3300013105 Bacteria 12896
534 Ga0157369_10007270 3300013105 Bacteria 12747
535 Ga0157369_10026460 3300013105 Bacteria 6434
536 Ga0157369_10031368 3300013105 Bacteria 5852
537 Ga0157369_10038599 3300013105 Bacteria 5222
538 Ga0157369_10070399 3300013105 Bacteria 3758
539 Ga0157369_10091905 3300013105 Bacteria 3239
540 Ga0157369_10112452 3300013105 Bacteria 2893
541 Ga0157369_10137644 3300013105 Bacteria 2584
542 Ga0157369_10313026 3300013105 Bacteria 1632
543 Ga0157374_10013735 3300013296 Bacteria 7074
544 Ga0157374_10049162 3300013296 Bacteria 3916
545 Ga0157374_10056586 3300013296 Bacteria 3662
546 Ga0157374_10086823 3300013296 Bacteria 2977
547 Ga0157374_10094321 3300013296 Bacteria 2860
548 Ga0157374_10107312 3300013296 Bacteria 2683
549 Ga0157378_10030675 3300013297 Bacteria 4749
550 Ga0157378_10038076 3300013297 Bacteria 4261
551 Ga0163162_10003825 3300013306 Bacteria 14429
552 Ga0163162_10003912 3300013306 Bacteria 14310
553 Ga0163162_10004734 3300013306 Bacteria 13125
554 Ga0163162_10012289 3300013306 Bacteria 8359
555 Ga0163162_10021609 3300013306 Bacteria 6339
556 Ga0163162_10026444 3300013306 Bacteria 5734
557 Ga0163162_10033999 3300013306 Bacteria 5070
558 Ga0163162_10103350 3300013306 Bacteria 2943
559 Ga0163162_10115192 3300013306 Bacteria 2788
560 Ga0163162_10151284 3300013306 Bacteria 2439
561 Ga0163162_10165119 3300013306 Bacteria 2337
562 Ga0157372_10019838 3300013307 Bacteria 7244
563 Ga0157372_10029402 3300013307 Bacteria 5999
564 Ga0157372_10051174 3300013307 Bacteria 4596
565 Ga0157372_10051427 3300013307 Bacteria 4585
566 Ga0157372_10092413 3300013307 Unclassified 3442
567 Ga0157372_10092620 3300013307 Bacteria 3438
568 Ga0157372_10151887 3300013307 Bacteria 2673
569 Ga0157372_10156663 3300013307 Bacteria 2631
570 Ga0157375_10000576 3300013308 Bacteria 32915
571 Ga0157375_10024997 3300013308 Bacteria 5539
572 Ga0157375_10060947 3300013308 Bacteria 3744
573 Ga0157375_10072977 3300013308 Bacteria 3450
574 Ga0157375_10354262 3300013308 Bacteria 1634
575 Ga0157375_10442899 3300013308 Bacteria 1465
576 Ga0163163_10000071 3300014325 Bacteria 112778
577 Ga0163163_10006618 3300014325 Bacteria 10148
578 Ga0163163_10011041 3300014325 Bacteria 8168
579 Ga0163163_10052418 3300014325 Bacteria 4024
580 Ga0157380_10000020 3300014326 Bacteria 114925
581 Ga0182008_10000005 3300014497 Bacteria 386556
582 Ga0182008_10000008 3300014497 Bacteria 371823
583 Ga0182008_10000287 3300014497 Bacteria 39636
584 Ga0182008_10001232 3300014497 Bacteria 17589
585 Ga0182008_10001739 3300014497 Bacteria 14303
586 Ga0182008_10002163 3300014497 Bacteria 12514
587 Ga0182008_10006185 3300014497 Bacteria 6727
588 Ga0182008_10008061 3300014497 Bacteria 5771
589 Ga0182008_10008200 3300014497 Bacteria 5717
590 Ga0182008_10012007 3300014497 Bacteria 4586
591 Ga0182008_10021111 3300014497 Bacteria 3347
592 Ga0182008_10023807 3300014497 Bacteria 3121
593 Ga0182008_10034808 3300014497 Bacteria 2524
594 Ga0182008_10035331 3300014497 Bacteria 2504
595 Ga0157377_10046203 3300014745 Bacteria 2434
596 Ga0157377_10080988 3300014745 Bacteria 1898
597 Ga0157379_10003726 3300014968 Bacteria 12966
598 Ga0157379_10149854 3300014968 Bacteria 2104
599 Ga0157379_10265055 3300014968 Bacteria 1562
600 Ga0157376_10023599 3300014969 Bacteria 4816
601 Ga0157376_10094358 3300014969 Bacteria 2600
602 Ga0157376_10141868 3300014969 Bacteria 2156
603 Ga0182006_1000033 3300015261 Bacteria 238180
604 Ga0182006_1000047 3300015261 Bacteria 187006
605 Ga0182006_1002152 3300015261 Bacteria 10927
606 Ga0182006_1003239 3300015261 Bacteria 8450
607 Ga0182006_1004345 3300015261 Bacteria 7007
608 Ga0182006_1007907 3300015261 Bacteria 4839
609 Ga0182006_1014114 3300015261 Bacteria 3448
610 Ga0182006_1028816 3300015261 Bacteria 2254
611 Ga0182007_10000042 3300015262 Bacteria 111840
612 Ga0182007_10007143 3300015262 Bacteria 4716
613 Ga0182007_10008911 3300015262 Bacteria 4088
614 Ga0182007_10013674 3300015262 Bacteria 3086
615 Ga0182007_10024410 3300015262 Bacteria 2115
616 Ga0182005_1000024 3300015265 Bacteria 238256
617 Ga0182005_1006401 3300015265 Bacteria 3605
618 Ga0183366_1001 3300015679 Bacteria 2743932
619 Ga0183370_1001 3300015680 Bacteria 2743932
620 Ga0183362_10001 3300015683 Bacteria 2046624
621 Ga0183369_1001 3300015685 Bacteria 2743932
622 Ga0183368_1001 3300015687 Bacteria 2743932
623 Ga0163161_10000019 3300017792 Bacteria 216758
624 Ga0163161_10000028 3300017792 Bacteria 197151
625 Ga0163161_10001759 3300017792 Bacteria 15822
626 Ga0163161_10016644 3300017792 Bacteria 5136
627 Ga0163161_10062002 3300017792 Bacteria 2723
628 Ga0163161_10088082 3300017792 Bacteria 2294
629 Ga0163161_10089081 3300017792 Bacteria 2282
630 Ga0163161_10090177 3300017792 Bacteria 2268
631 Ga0163161_10098387 3300017792 Bacteria 2174
632 Ga0163161_10104171 3300017792 Bacteria 2115
633 Ga0163161_10119078 3300017792 Bacteria 1982
634 Ga0163161_10124234 3300017792 Bacteria 1942
635 Ga0213872_10011172 3300021361 Bacteria 4254
636 Ga0213872_10054637 3300021361 Bacteria 1810
637 Ga0213874_10024427 3300021377 Bacteria 1695
638 Ga0213876_10000191 3300021384 Bacteria 64044
639 Ga0209435_100675 3300025206 Bacteria 5992
640 Ga0209760_100010 3300025207 Bacteria 205106
641 Ga0209760_100157 3300025207 Bacteria 40911
642 Ga0209784_100030 3300025224 Bacteria 327457
643 Ga0209784_100101 3300025224 Bacteria 100885
644 Ga0209566_100034 3300025225 Bacteria 327457
645 Ga0209566_100123 3300025225 Bacteria 100885
646 Ga0209674_100052 3300025226 Bacteria 327457
647 Ga0209674_100145 3300025226 Bacteria 100885
648 Ga0209147_100151 3300025229 Bacteria 100885
649 Ga0209563_100054 3300025230 Bacteria 327457
650 Ga0209563_100128 3300025230 Bacteria 100885
651 Ga0209563_100722 3300025230 Bacteria 10251
652 Ga0207427_100035 3300025231 Bacteria 311526
653 Ga0207427_100092 3300025231 Bacteria 128454
654 Ga0209437_100065 3300025233 Bacteria 332417
655 Ga0209437_100068 3300025233 Bacteria 311526
656 Ga0209258_100241 3300025242 Bacteria 100872
657 Ga0209646_1000354 3300025246 Bacteria 33264
658 Ga0209677_100032 3300025253 Bacteria 327457
659 Ga0209677_100094 3300025253 Bacteria 100885
660 Ga0209129_1000004 3300025258 Bacteria 884499
661 Ga0209233_1000085 3300025261 Bacteria 333078
662 Ga0209130_1004205 3300025284 Bacteria 5611
663 Ga0209675_1000022 3300025291 Bacteria 315280
664 Ga0209675_1000394 3300025291 Bacteria 36250
665 Ga0209675_1007953 3300025291 Bacteria 3968
666 Ga0209675_1009523 3300025291 Bacteria 3424
667 Ga0209675_1010696 3300025291 Bacteria 3108
668 Ga0209676_1000076 3300025292 Bacteria 301393
669 Ga0209676_1000264 3300025292 Bacteria 110593
670 Ga0209676_1000313 3300025292 Bacteria 94925
671 Ga0209676_1000396 3300025292 Bacteria 79502
672 Ga0209676_1000505 3300025292 Bacteria 61665
673 Ga0209676_1000788 3300025292 Bacteria 41882
674 Ga0209676_1003014 3300025292 Bacteria 10954
675 Ga0209676_1005425 3300025292 Bacteria 6668
676 Ga0209025_1000098 3300025294 Bacteria 233886
677 Ga0209025_1000548 3300025294 Bacteria 70257
678 Ga0209564_1000159 3300025295 Bacteria 164319
679 Ga0209564_1000615 3300025295 Bacteria 54694
680 Ga0209050_1000063 3300025298 Bacteria 314955
681 Ga0209050_1000106 3300025298 Bacteria 224396
682 Ga0209050_1001298 3300025298 Bacteria 28251
683 Ga0209050_1005444 3300025298 Bacteria 7992
684 Ga0209050_1005921 3300025298 Bacteria 7454
685 Ga0209050_1008240 3300025298 Bacteria 5620
686 Ga0209256_1000051 3300025299 Bacteria 307241
687 Ga0209051_1000045 3300025303 Bacteria 297882
688 Ga0209051_1000079 3300025303 Bacteria 201183
689 Ga0209051_1000139 3300025303 Bacteria 136281
690 Ga0209051_1000331 3300025303 Bacteria 71198
691 Ga0209051_1017155 3300025303 Bacteria 3245
692 Ga0209257_1000183 3300025304 Bacteria 156618
693 Ga0209257_1000539 3300025304 Bacteria 64964
694 Ga0209257_1010097 3300025304 Bacteria 4874
695 Ga0209257_1021461 3300025304 Bacteria 2344
696 Ga0207697_10000347 3300025315 Bacteria 25853
697 Ga0207697_10002263 3300025315 Bacteria 10065
698 Ga0207697_10005474 3300025315 Bacteria 5899
699 Ga0207656_10000045 3300025321 Bacteria 47492
700 Ga0207696_1000047 3300025711 Bacteria 285005
701 Ga0207696_1000068 3300025711 Bacteria 228017
702 Ga0207696_1000172 3300025711 Bacteria 102404
703 Ga0207696_1000269 3300025711 Bacteria 64683
704 Ga0207696_1000318 3300025711 Bacteria 52161
705 Ga0207696_1002729 3300025711 Bacteria 8414
706 Ga0207696_1003699 3300025711 Bacteria 6863
707 Ga0207696_1003984 3300025711 Bacteria 6491
708 Ga0207696_1005607 3300025711 Bacteria 5181
709 Ga0207696_1006843 3300025711 Bacteria 4537
710 Ga0207696_1007853 3300025711 Bacteria 4136
711 Ga0207696_1015484 3300025711 Bacteria 2584
712 Ga0207655_1000009 3300025728 Bacteria 664676
713 Ga0207655_1000015 3300025728 Bacteria 600662
714 Ga0207655_1000016 3300025728 Bacteria 551476
715 Ga0207655_1000034 3300025728 Bacteria 364737
716 Ga0207655_1000106 3300025728 Bacteria 181416
717 Ga0207655_1000319 3300025728 Bacteria 71324
718 Ga0207655_1000369 3300025728 Bacteria 63434
719 Ga0207655_1000643 3300025728 Bacteria 41715
720 Ga0207655_1001130 3300025728 Bacteria 26034
721 Ga0207655_1001199 3300025728 Bacteria 25008
722 Ga0207655_1001598 3300025728 Bacteria 20275
723 Ga0207655_1001764 3300025728 Bacteria 18906
724 Ga0207655_1002617 3300025728 Bacteria 14299
725 Ga0207655_1002619 3300025728 Bacteria 14296
726 Ga0207655_1002932 3300025728 Bacteria 13119
727 Ga0207655_1003139 3300025728 Bacteria 12500
728 Ga0207655_1004288 3300025728 Bacteria 10203
729 Ga0207655_1008136 3300025728 Bacteria 6707
730 Ga0207655_1008866 3300025728 Bacteria 6320
731 Ga0207655_1010022 3300025728 Bacteria 5806
732 Ga0207655_1010352 3300025728 Bacteria 5662
733 Ga0207655_1012920 3300025728 Bacteria 4834
734 Ga0207655_1035837 3300025728 Bacteria 2209
735 Ga0207655_1038469 3300025728 Bacteria 2091
736 Ga0207655_1049497 3300025728 Bacteria 1715
737 Ga0207713_1000044 3300025735 Bacteria 238074
738 Ga0207713_1000062 3300025735 Bacteria 208832
739 Ga0207713_1000229 3300025735 Bacteria 75343
740 Ga0207713_1000233 3300025735 Bacteria 74522
741 Ga0207713_1002181 3300025735 Bacteria 14511
742 Ga0207713_1002375 3300025735 Bacteria 13763
743 Ga0207713_1002651 3300025735 Bacteria 12849
744 Ga0207713_1003200 3300025735 Bacteria 11310
745 Ga0207713_1003495 3300025735 Bacteria 10666
746 Ga0207713_1003620 3300025735 Bacteria 10412
747 Ga0207713_1004042 3300025735 Bacteria 9688
748 Ga0207713_1005776 3300025735 Bacteria 7661
749 Ga0207713_1006553 3300025735 Bacteria 7068
750 Ga0207713_1007437 3300025735 Bacteria 6464
751 Ga0207713_1010892 3300025735 Bacteria 4994
752 Ga0207713_1011189 3300025735 Bacteria 4904
753 Ga0207713_1011446 3300025735 Bacteria 4823
754 Ga0207713_1020822 3300025735 Bacteria 3163
755 Ga0207653_10000001 3300025885 Bacteria 287007
756 Ga0207653_10004737 3300025885 Bacteria 4257
757 Ga0207692_10010710 3300025898 Bacteria 3876
758 Ga0207692_10014599 3300025898 Bacteria 3435
759 Ga0207692_10026636 3300025898 Bacteria 2714
760 Ga0207710_10000009 3300025900 Bacteria 485205
761 Ga0207710_10000145 3300025900 Bacteria 80941
762 Ga0207688_10001511 3300025901 Bacteria 12224
763 Ga0207680_10017992 3300025903 Bacteria 3745
764 Ga0207647_10029870 3300025904 Bacteria 3521
765 Ga0207685_10004107 3300025905 Bacteria 3649
766 Ga0207699_10003261 3300025906 Bacteria 7729
767 Ga0207699_10003871 3300025906 Bacteria 7153
768 Ga0207699_10013239 3300025906 Bacteria 4217
769 Ga0207645_10000980 3300025907 Bacteria 23596
770 Ga0207645_10006530 3300025907 Bacteria 8353
771 Ga0207643_10000852 3300025908 Bacteria 18473
772 Ga0207684_10000078 3300025910 Bacteria 181899
773 Ga0207684_10000118 3300025910 Bacteria 145120
774 Ga0207684_10003435 3300025910 Bacteria 15464
775 Ga0207684_10012551 3300025910 Bacteria 7363
776 Ga0207684_10018065 3300025910 Bacteria 6044
777 Ga0207684_10019367 3300025910 Bacteria 5823
778 Ga0207684_10024000 3300025910 Bacteria 5203
779 Ga0207684_10028722 3300025910 Bacteria 4738
780 Ga0207684_10043425 3300025910 Bacteria 3811
781 Ga0207684_10148839 3300025910 Bacteria 2014
782 Ga0207684_10177523 3300025910 Bacteria 1836
783 Ga0207684_10193470 3300025910 Bacteria 1754
784 Ga0207654_10000016 3300025911 Bacteria 211550
785 Ga0207707_10009245 3300025912 Bacteria 8551
786 Ga0207707_10086628 3300025912 Bacteria 2737
787 Ga0207707_10139202 3300025912 Bacteria 2122
788 Ga0207707_10169731 3300025912 Bacteria 1907
789 Ga0207695_10015038 3300025913 Bacteria 9132
790 Ga0207695_10018475 3300025913 Bacteria 8061
791 Ga0207695_10070045 3300025913 Bacteria 3587
792 Ga0207671_10000060 3300025914 Bacteria 178435
793 Ga0207671_10071563 3300025914 Bacteria 2587
794 Ga0207693_10000004 3300025915 Bacteria 193261
795 Ga0207693_10000865 3300025915 Bacteria 27049
796 Ga0207693_10001961 3300025915 Bacteria 18051
797 Ga0207693_10013105 3300025915 Bacteria 6689
798 Ga0207693_10018332 3300025915 Bacteria 5577
799 Ga0207663_10001502 3300025916 Bacteria 10877
800 Ga0207663_10005395 3300025916 Bacteria 6438
801 Ga0207663_10068825 3300025916 Bacteria 2275
802 Ga0207660_10014965 3300025917 Bacteria 5112
803 Ga0207660_10121757 3300025917 Bacteria 1977
804 Ga0207662_10083306 3300025918 Bacteria 1955
805 Ga0207657_10001299 3300025919 Bacteria 26510
806 Ga0207657_10015750 3300025919 Bacteria 7311
807 Ga0207657_10033112 3300025919 Bacteria 4662
808 Ga0207649_10000023 3300025920 Bacteria 188467
809 Ga0207652_10077936 3300025921 Bacteria 2893
810 Ga0207652_10133892 3300025921 Bacteria 2212
811 Ga0207646_10003069 3300025922 Bacteria 19206
812 Ga0207646_10003650 3300025922 Bacteria 17205
813 Ga0207646_10003906 3300025922 Bacteria 16548
814 Ga0207646_10008498 3300025922 Bacteria 10275
815 Ga0207646_10026374 3300025922 Bacteria 5304
816 Ga0207646_10026869 3300025922 Bacteria 5249
817 Ga0207646_10035115 3300025922 Bacteria 4530
818 Ga0207646_10037053 3300025922 Bacteria 4399
819 Ga0207646_10061856 3300025922 Bacteria 3342
820 Ga0207646_10076287 3300025922 Bacteria 2995
821 Ga0207646_10106525 3300025922 Bacteria 2514
822 Ga0207646_10117025 3300025922 Bacteria 2394
823 Ga0207646_10144294 3300025922 Bacteria 2145
824 Ga0207681_10000009 3300025923 Bacteria 410736
825 Ga0207681_10000386 3300025923 Bacteria 30907
826 Ga0207681_10007464 3300025923 Bacteria 6701
827 Ga0207681_10008588 3300025923 Bacteria 6238
828 Ga0207681_10012579 3300025923 Bacteria 5225
829 Ga0207650_10000100 3300025925 Bacteria 112181
830 Ga0207650_10000153 3300025925 Bacteria 82970
831 Ga0207650_10003497 3300025925 Bacteria 10790
832 Ga0207650_10012446 3300025925 Bacteria 5874
833 Ga0207650_10025430 3300025925 Bacteria 4217
834 Ga0207650_10055081 3300025925 Bacteria 2951
835 Ga0207650_10196851 3300025925 Bacteria 1612
836 Ga0207659_10066368 3300025926 Bacteria 2618
837 Ga0207659_10189277 3300025926 Bacteria 1637
838 Ga0207659_10201365 3300025926 Bacteria 1590
839 Ga0207659_10250918 3300025926 Bacteria 1436
840 Ga0207687_10044133 3300025927 Bacteria 3075
841 Ga0207687_10048049 3300025927 Bacteria 2960
842 Ga0207687_10092088 3300025927 Bacteria 2213
843 Ga0207700_10000307 3300025928 Bacteria 28738
844 Ga0207700_10001040 3300025928 Bacteria 16020
845 Ga0207700_10049630 3300025928 Bacteria 3123
846 Ga0207700_10129471 3300025928 Bacteria 2058
847 Ga0207700_10190936 3300025928 Bacteria 1721
848 Ga0207664_10000017 3300025929 Bacteria 230967
849 Ga0207664_10007838 3300025929 Bacteria 7419
850 Ga0207664_10008414 3300025929 Bacteria 7195
851 Ga0207664_10044193 3300025929 Bacteria 3488
852 Ga0207644_10005441 3300025931 Bacteria 8303
853 Ga0207644_10014353 3300025931 Bacteria 5298
854 Ga0207690_10040715 3300025932 Bacteria 3040
855 Ga0207706_10000056 3300025933 Bacteria 113022
856 Ga0207706_10059433 3300025933 Bacteria 3366
857 Ga0207706_10228080 3300025933 Bacteria 1630
858 Ga0207686_10006992 3300025934 Bacteria 6072
859 Ga0207686_10010448 3300025934 Bacteria 5056
860 Ga0207686_10011276 3300025934 Bacteria 4889
861 Ga0207686_10150193 3300025934 Bacteria 1621
862 Ga0207709_10000001 3300025935 Bacteria 2228154
863 Ga0207709_10000015 3300025935 Bacteria 493221
864 Ga0207709_10000030 3300025935 Bacteria 331710
865 Ga0207709_10000049 3300025935 Bacteria 237124
866 Ga0207709_10000127 3300025935 Bacteria 112650
867 Ga0207709_10000341 3300025935 Bacteria 48317
868 Ga0207709_10003847 3300025935 Bacteria 8799
869 Ga0207709_10006788 3300025935 Bacteria 6405
870 Ga0207709_10010578 3300025935 Bacteria 5083
871 Ga0207709_10010641 3300025935 Bacteria 5068
872 Ga0207709_10017129 3300025935 Bacteria 4039
873 Ga0207709_10038468 3300025935 Bacteria 2849
874 Ga0207709_10070895 3300025935 Bacteria 2211
875 Ga0207670_10016816 3300025936 Bacteria 4407
876 Ga0207670_10019786 3300025936 Bacteria 4120
877 Ga0207670_10033966 3300025936 Bacteria 3292
878 Ga0207670_10044429 3300025936 Bacteria 2939
879 Ga0207670_10045672 3300025936 Bacteria 2905
880 Ga0207670_10056996 3300025936 Bacteria 2648
881 Ga0207669_10003974 3300025937 Bacteria 6458
882 Ga0207669_10006610 3300025937 Bacteria 5314
883 Ga0207704_10189624 3300025938 Bacteria 1494
884 Ga0207665_10000140 3300025939 Bacteria 48624
885 Ga0207665_10003302 3300025939 Bacteria 10808
886 Ga0207665_10012711 3300025939 Bacteria 5537
887 Ga0207665_10024962 3300025939 Bacteria 3941
888 Ga0207665_10035011 3300025939 Bacteria 3332
889 Ga0207665_10061302 3300025939 Bacteria 2549
890 Ga0207665_10132772 3300025939 Bacteria 1769
891 Ga0207665_10192861 3300025939 Bacteria 1481
892 Ga0207691_10000134 3300025940 Bacteria 67672
893 Ga0207691_10001773 3300025940 Bacteria 21242
894 Ga0207691_10037115 3300025940 Bacteria 4513
895 Ga0207711_10023686 3300025941 Bacteria 5140
896 Ga0207711_10044011 3300025941 Bacteria 3809
897 Ga0207711_10077688 3300025941 Bacteria 2894
898 Ga0207689_10021059 3300025942 Bacteria 5480
899 Ga0207689_10070462 3300025942 Bacteria 2872
900 Ga0207689_10072516 3300025942 Bacteria 2829
901 Ga0207689_10103054 3300025942 Bacteria 2345
902 Ga0207679_10000017 3300025945 Bacteria 253004
903 Ga0207679_10011798 3300025945 Bacteria 5676
904 Ga0207667_10214985 3300025949 Bacteria 1970
905 Ga0207651_10002173 3300025960 Bacteria 9282
906 Ga0207651_10014874 3300025960 Bacteria 4506
907 Ga0207651_10018076 3300025960 Bacteria 4185
908 Ga0207651_10077769 3300025960 Bacteria 2377
909 Ga0207712_10001050 3300025961 Bacteria 19485
910 Ga0207712_10091843 3300025961 Bacteria 2237
911 Ga0207712_10125224 3300025961 Bacteria 1950
912 Ga0207712_10128155 3300025961 Bacteria 1930
913 Ga0207668_10021030 3300025972 Bacteria 4156
914 Ga0207640_10043338 3300025981 Bacteria 2875
915 Ga0207658_10022478 3300025986 Bacteria 4391
916 Ga0207658_10063388 3300025986 Bacteria 2770
917 Ga0207658_10169709 3300025986 Bacteria 1796
918 Ga0207658_10248311 3300025986 Bacteria 1511
919 Ga0207677_10000010 3300026023 Bacteria 218007
920 Ga0207677_10006394 3300026023 Bacteria 6462
921 Ga0207677_10009167 3300026023 Bacteria 5557
922 Ga0207677_10060250 3300026023 Bacteria 2622
923 Ga0207703_10000269 3300026035 Bacteria 57506
924 Ga0207703_10238652 3300026035 Bacteria 1633
925 Ga0207639_10006403 3300026041 Bacteria 7998
926 Ga0207639_10069300 3300026041 Bacteria 2751
927 Ga0207639_10122499 3300026041 Bacteria 2139
928 Ga0207678_10036919 3300026067 Bacteria 4254
929 Ga0207708_10002865 3300026075 Bacteria 12703
930 Ga0207708_10009116 3300026075 Bacteria 7342
931 Ga0207708_10067740 3300026075 Bacteria 2731
932 Ga0207702_10037324 3300026078 Bacteria 4067
933 Ga0207702_10043777 3300026078 Bacteria 3760
934 Ga0207641_10115657 3300026088 Bacteria 2385
935 Ga0207641_10260963 3300026088 Bacteria 1622
936 Ga0207648_10016021 3300026089 Bacteria 6868
937 Ga0207648_10032863 3300026089 Bacteria 4578
938 Ga0207648_10057593 3300026089 Bacteria 3390
939 Ga0207648_10067490 3300026089 Bacteria 3118
940 Ga0207648_10087247 3300026089 Bacteria 2723
941 Ga0207676_10008805 3300026095 Bacteria 7183
942 Ga0207674_10002024 3300026116 Bacteria 25725
943 Ga0207674_10002250 3300026116 Bacteria 24454
944 Ga0207674_10094081 3300026116 Bacteria 2984
945 Ga0207675_100001407 3300026118 Bacteria 24062
946 Ga0207675_100005904 3300026118 Bacteria 11686
947 Ga0207675_100009658 3300026118 Bacteria 9029
948 Ga0207675_100012896 3300026118 Bacteria 7805
949 Ga0207675_100062485 3300026118 Bacteria 3478
950 Ga0207675_100165773 3300026118 Bacteria 2110
951 Ga0207683_10002972 3300026121 Bacteria 14788
952 Ga0207683_10014576 3300026121 Bacteria 6696
953 Ga0207683_10053659 3300026121 Bacteria 3535
954 Ga0207683_10056116 3300026121 Bacteria 3454
955 Ga0207683_10067158 3300026121 Bacteria 3163
956 Ga0207683_10080062 3300026121 Bacteria 2897
957 Ga0207683_10140734 3300026121 Bacteria 2174
958 Ga0207683_10239291 3300026121 Bacteria 1656
959 Ga0207698_10037929 3300026142 Bacteria 3555
960 Ga0207698_10136506 3300026142 Bacteria 2105
961 Ga0209281_1000007 3300027111 Bacteria 938265
962 Ga0209281_1000070 3300027111 Bacteria 277098
963 Ga0209281_1000093 3300027111 Bacteria 240724
964 Ga0209281_1000098 3300027111 Bacteria 226641
965 Ga0209281_1000107 3300027111 Bacteria 218397
966 Ga0209281_1000135 3300027111 Bacteria 183462
967 Ga0209281_1000301 3300027111 Bacteria 89469
968 Ga0209281_1001036 3300027111 Bacteria 21249
969 Ga0209281_1001082 3300027111 Bacteria 20169
970 Ga0209281_1002130 3300027111 Bacteria 8735
971 Ga0209281_1005510 3300027111 Bacteria 3499
972 Ga0209281_1008970 3300027111 Bacteria 2379
973 Ga0209389_1000125 3300027296 Bacteria 68494
974 Ga0209371_1000001 3300027312 Bacteria 2771503
975 Ga0209371_1000002 3300027312 Bacteria 1551985
976 Ga0209371_1000040 3300027312 Bacteria 340804
977 Ga0209371_1000041 3300027312 Bacteria 340377
978 Ga0209371_1000094 3300027312 Bacteria 170815
979 Ga0209371_1000490 3300027312 Bacteria 38556
980 Ga0209371_1001739 3300027312 Bacteria 13722
981 Ga0209371_1005701 3300027312 Bacteria 4862
982 Ga0209371_1006795 3300027312 Bacteria 4143
983 Ga0209371_1008635 3300027312 Bacteria 3351
984 Ga0209996_1000755 3300027395 Bacteria 3848
985 Ga0209984_1000679 3300027424 Bacteria 3629
986 Ga0209995_1000473 3300027471 Bacteria 6139
987 Ga0209982_1004664 3300027552 Bacteria 1969
988 Ga0209970_1001714 3300027614 Bacteria 3803
989 Ga0209983_1001801 3300027665 Bacteria 4761
990 Ga0209588_1000014 3300027671 Bacteria 133062
991 Ga0209971_1000661 3300027682 Bacteria 8976
992 Ga0209974_10003919 3300027876 Bacteria 5322
993 Ga0209974_10011922 3300027876 Bacteria 2913
994 Ga0209974_10018719 3300027876 Bacteria 2297
995 Ga0207428_10004245 3300027907 Bacteria 13710
996 Ga0207428_10006542 3300027907 Bacteria 10745
997 Ga0207428_10017900 3300027907 Bacteria 6072
998 Ga0207428_10020519 3300027907 Bacteria 5612
999 Ga0207428_10021061 3300027907 Bacteria 5525
1000 Ga0207428_10030787 3300027907 Bacteria 4434
1001 Ga0207428_10037408 3300027907 Bacteria 3948
1002 Ga0207428_10037783 3300027907 Bacteria 3928
1003 Ga0207428_10066986 3300027907 Bacteria 2828
1004 Ga0207428_10095668 3300027907 Bacteria 2301
1005 Ga0207428_10150176 3300027907 Bacteria 1774
1006 Ga0265354_1001582 3300028016 Bacteria 3189
1007 Ga0268266_10009768 3300028379 Bacteria 8441
1008 Ga0268266_10055749 3300028379 Bacteria 3398
1009 Ga0268266_10175103 3300028379 Bacteria 1950
1010 Ga0268266_10187158 3300028379 Bacteria 1888
1011 Ga0268266_10233738 3300028379 Bacteria 1694
1012 Ga0268265_10000318 3300028380 Bacteria 53047
1013 Ga0268265_10024035 3300028380 Bacteria 4305
1014 Ga0268265_10035784 3300028380 Bacteria 3632
1015 Ga0268265_10122787 3300028380 Bacteria 2143
1016 Ga0268264_10044510 3300028381 Bacteria 3683
1017 Ga0268264_10159370 3300028381 Bacteria 2031
1018 Ga0265337_1009007 3300028556 Bacteria 3590
1019 Ga0265326_10000971 3300028558 Bacteria 10376
1020 Ga0265326_10002053 3300028558 Bacteria 6866
1021 Ga0265326_10002876 3300028558 Bacteria 5751
1022 Ga0265319_1004177 3300028563 Bacteria 7232
1023 Ga0265319_1012546 3300028563 Bacteria 3421
1024 Ga0265334_10003307 3300028573 Bacteria 7352
1025 Ga0265334_10003641 3300028573 Bacteria 6978
1026 Ga0265334_10038425 3300028573 Bacteria 1883
1027 Ga0265318_10000575 3300028577 Bacteria 25839
1028 Ga0265318_10004127 3300028577 Bacteria 7108
1029 Ga0265318_10009692 3300028577 Bacteria 4226
1030 Ga0265323_10000281 3300028653 Bacteria 29505
1031 Ga0265323_10000425 3300028653 Bacteria 24197
1032 Ga0265323_10001023 3300028653 Bacteria 14563
1033 Ga0265323_10037598 3300028653 Bacteria 1773
1034 Ga0265323_10048090 3300028653 Bacteria 1524
1035 Ga0265322_10000028 3300028654 Bacteria 85065
1036 Ga0265322_10000391 3300028654 Bacteria 18201
1037 Ga0265322_10000555 3300028654 Bacteria 14264
1038 Ga0265336_10008113 3300028666 Bacteria 3698
1039 Ga0307515_10010058 3300028794 Bacteria 18195
1040 Ga0307515_10096936 3300028794 Bacteria 3610
1041 Ga0265338_10000517 3300028800 Bacteria 68028
1042 Ga0265338_10001557 3300028800 Bacteria 37035
1043 Ga0265338_10003121 3300028800 Bacteria 23686
1044 Ga0265338_10009321 3300028800 Bacteria 11728
1045 Ga0265338_10012144 3300028800 Bacteria 9842
1046 Ga0265338_10013341 3300028800 Bacteria 9282
1047 Ga0265338_10017026 3300028800 Bacteria 7861
1048 Ga0265338_10047408 3300028800 Bacteria 3925
1049 Ga0265338_10060625 3300028800 Bacteria 3322
1050 Ga0265338_10195697 3300028800 Bacteria 1528
1051 Ga0265324_10000405 3300029957 Bacteria 31070
1052 Ga0265324_10004925 3300029957 Bacteria 5872
1053 Ga0268256_1000001 3300030500 Bacteria 2771065
1054 Ga0268256_1000002 3300030500 Bacteria 1535763
1055 Ga0268256_1000003 3300030500 Bacteria 1289401
1056 Ga0268256_1000041 3300030500 Bacteria 340725
1057 Ga0268256_1000083 3300030500 Bacteria 170829
1058 Ga0268256_1000419 3300030500 Bacteria 38396
1059 Ga0268256_1001517 3300030500 Bacteria 13722
1060 Ga0268256_1006908 3300030500 Bacteria 4143
1061 Ga0268256_1009041 3300030500 Bacteria 3352
1062 Ga0268256_1013462 3300030500 Bacteria 2478
1063 Ga0307511_10072128 3300030521 Bacteria 2511
1064 Ga0316177_1111270 3300030731 Bacteria 9887
1065 Ga0316176_1067105 3300030732 Bacteria 11975
1066 Ga0316178_1096781 3300030735 Bacteria 8104
1067 Ga0316181_1228898 3300030744 Bacteria 15959
1068 Ga0265760_10000424 3300031090 Bacteria 11855
1069 Ga0265330_10000033 3300031235 Bacteria 126931
1070 Ga0265330_10002028 3300031235 Bacteria 11240
1071 Ga0265330_10002320 3300031235 Bacteria 10444
1072 Ga0265330_10002893 3300031235 Bacteria 9164
1073 Ga0265330_10003332 3300031235 Bacteria 8432
1074 Ga0265330_10004778 3300031235 Bacteria 6843
1075 Ga0265330_10005377 3300031235 Bacteria 6382
1076 Ga0265330_10012975 3300031235 Bacteria 3890
1077 Ga0265330_10038142 3300031235 Bacteria 2136
1078 Ga0265332_10000001 3300031238 Bacteria 863783
1079 Ga0265332_10000005 3300031238 Bacteria 377525
1080 Ga0265332_10000013 3300031238 Bacteria 250095
1081 Ga0265332_10001515 3300031238 Bacteria 12907
1082 Ga0265332_10013361 3300031238 Bacteria 3640
1083 Ga0265332_10020571 3300031238 Bacteria 2913
1084 Ga0265328_10002877 3300031239 Bacteria 7679
1085 Ga0265320_10006958 3300031240 Bacteria 7055
1086 Ga0265320_10007370 3300031240 Bacteria 6830
1087 Ga0265325_10000285 3300031241 Bacteria 35898
1088 Ga0265325_10003374 3300031241 Bacteria 10459
1089 Ga0265325_10004570 3300031241 Bacteria 8705
1090 Ga0265325_10004660 3300031241 Bacteria 8605
1091 Ga0265325_10007190 3300031241 Bacteria 6697
1092 Ga0265325_10027145 3300031241 Bacteria 3096
1093 Ga0265329_10000141 3300031242 Bacteria 34866
1094 Ga0265329_10003627 3300031242 Bacteria 6665
1095 Ga0265329_10017969 3300031242 Bacteria 2425
1096 Ga0265340_10000051 3300031247 Bacteria 54481
1097 Ga0265340_10006001 3300031247 Bacteria 6714
1098 Ga0265340_10009806 3300031247 Bacteria 5132
1099 Ga0265340_10010639 3300031247 Bacteria 4918
1100 Ga0265340_10011128 3300031247 Bacteria 4793
1101 Ga0265339_10000154 3300031249 Bacteria 56572
1102 Ga0265339_10030329 3300031249 Bacteria 3062
1103 Ga0265339_10031326 3300031249 Bacteria 3006
1104 Ga0265339_10050630 3300031249 Bacteria 2271
1105 Ga0265331_10006784 3300031250 Bacteria 6708
1106 Ga0265331_10013649 3300031250 Bacteria 4360
1107 Ga0265327_10000293 3300031251 Bacteria 96862
1108 Ga0265327_10000935 3300031251 Bacteria 42778
1109 Ga0265327_10002931 3300031251 Bacteria 17082
1110 Ga0265327_10003245 3300031251 Bacteria 15790
1111 Ga0265327_10009260 3300031251 Bacteria 7142
1112 Ga0265327_10019296 3300031251 Bacteria 4196
1113 Ga0265316_10000073 3300031344 Bacteria 103125
1114 Ga0265316_10000442 3300031344 Bacteria 47118
1115 Ga0265316_10000823 3300031344 Bacteria 34334
1116 Ga0265316_10001627 3300031344 Bacteria 23924
1117 Ga0265316_10003656 3300031344 Bacteria 15481
1118 Ga0265316_10005031 3300031344 Bacteria 12969
1119 Ga0265316_10005290 3300031344 Bacteria 12589
1120 Ga0265316_10012651 3300031344 Bacteria 7554
1121 Ga0265316_10016937 3300031344 Bacteria 6310
1122 Ga0265316_10024038 3300031344 Bacteria 5115
1123 Ga0265316_10051037 3300031344 Bacteria 3250
1124 Ga0265316_10099083 3300031344 Bacteria 2217
1125 Ga0265316_10121393 3300031344 Bacteria 1973
1126 Ga0265316_10157657 3300031344 Bacteria 1698
1127 Ga0265316_10191706 3300031344 Bacteria 1518
1128 Ga0307513_10006370 3300031456 Bacteria 15433
1129 Ga0307513_10033515 3300031456 Bacteria 5772
1130 Ga0307513_10077780 3300031456 Bacteria 3434
1131 Ga0307509_10089224 3300031507 Bacteria 3162
1132 Ga0307509_10137139 3300031507 Bacteria 2390
1133 Ga0307408_100000079 3300031548 Bacteria 108053
1134 Ga0307408_100000178 3300031548 Bacteria 71389
1135 Ga0307408_100000273 3300031548 Bacteria 51911
1136 Ga0307408_100000717 3300031548 Bacteria 26926
1137 Ga0307408_100017915 3300031548 Bacteria 4748
1138 Ga0307408_100018543 3300031548 Bacteria 4673
1139 Ga0307408_100077015 3300031548 Bacteria 2482
1140 Ga0307408_100109746 3300031548 Bacteria 2117
1141 Ga0265313_10004857 3300031595 Bacteria 10100
1142 Ga0265313_10007425 3300031595 Bacteria 7497
1143 Ga0265313_10008077 3300031595 Bacteria 7048
1144 Ga0307508_10033363 3300031616 Bacteria 4646
1145 Ga0316575_10000506 3300031665 Bacteria 11280
1146 Ga0316575_10005591 3300031665 Bacteria 4484
1147 Ga0316579_10002847 3300031691 Bacteria 6619
1148 Ga0316579_10004434 3300031691 Bacteria 5570
1149 Ga0316579_10005421 3300031691 Bacteria 5148
1150 Ga0316579_10008552 3300031691 Bacteria 4273
1151 Ga0316579_10011147 3300031691 Bacteria 3816
1152 Ga0316579_10017282 3300031691 Bacteria 3161
1153 Ga0316579_10029579 3300031691 Bacteria 2500
1154 Ga0316579_10037501 3300031691 Bacteria 2239
1155 Ga0316579_10054146 3300031691 Bacteria 1881
1156 Ga0265314_10000022 3300031711 Bacteria 297299
1157 Ga0265314_10000381 3300031711 Bacteria 60782
1158 Ga0265314_10003723 3300031711 Bacteria 14590
1159 Ga0265314_10008473 3300031711 Bacteria 8802
1160 Ga0265314_10051574 3300031711 Bacteria 2865
1161 Ga0265342_10000202 3300031712 Bacteria 66840
1162 Ga0265342_10001559 3300031712 Bacteria 21200
1163 Ga0265342_10003464 3300031712 Bacteria 12927
1164 Ga0265342_10006108 3300031712 Bacteria 9024
1165 Ga0265342_10008635 3300031712 Bacteria 7282
1166 Ga0265342_10020801 3300031712 Bacteria 4198
1167 Ga0265342_10026904 3300031712 Bacteria 3601
1168 Ga0265342_10033445 3300031712 Bacteria 3161
1169 Ga0265342_10077763 3300031712 Bacteria 1921
1170 Ga0316576_10000753 3300031727 Bacteria 16136
1171 Ga0316576_10002667 3300031727 Bacteria 10207
1172 Ga0316576_10004357 3300031727 Bacteria 8475
1173 Ga0316576_10005272 3300031727 Bacteria 7873
1174 Ga0316576_10006703 3300031727 Bacteria 7196
1175 Ga0316576_10013343 3300031727 Bacteria 5457
1176 Ga0316576_10015060 3300031727 Bacteria 5179
1177 Ga0316576_10015734 3300031727 Bacteria 5085
1178 Ga0316576_10016646 3300031727 Bacteria 4973
1179 Ga0316576_10021425 3300031727 Bacteria 4470
1180 Ga0316576_10025171 3300031727 Bacteria 4163
1181 Ga0316576_10026661 3300031727 Bacteria 4057
1182 Ga0316576_10030660 3300031727 Bacteria 3810
1183 Ga0316576_10033635 3300031727 Bacteria 3651
1184 Ga0316576_10034671 3300031727 Bacteria 3598
1185 Ga0316576_10051745 3300031727 Bacteria 2990
1186 Ga0316576_10066715 3300031727 Bacteria 2647
1187 Ga0316576_10070104 3300031727 Bacteria 2586
1188 Ga0316576_10073820 3300031727 Bacteria 2521
1189 Ga0316576_10076125 3300031727 Bacteria 2483
1190 Ga0316576_10102220 3300031727 Bacteria 2143
1191 Ga0316576_10110847 3300031727 Bacteria 2057
1192 Ga0316576_10137265 3300031727 Bacteria 1840
1193 Ga0316576_10143472 3300031727 Bacteria 1798
1194 Ga0316576_10223752 3300031727 Bacteria 1415
1195 Ga0316578_10000018 3300031728 Bacteria 35033
1196 Ga0316578_10000388 3300031728 Bacteria 14128
1197 Ga0316578_10000482 3300031728 Bacteria 13401
1198 Ga0316578_10001002 3300031728 Bacteria 10799
1199 Ga0316578_10001316 3300031728 Bacteria 9954
1200 Ga0316578_10006072 3300031728 Bacteria 5923
1201 Ga0316578_10016385 3300031728 Bacteria 4010
1202 Ga0316578_10022033 3300031728 Bacteria 3546
1203 Ga0316578_10034918 3300031728 Bacteria 2889
1204 Ga0316578_10039540 3300031728 Bacteria 2724
1205 Ga0316578_10075721 3300031728 Bacteria 1997
1206 Ga0316578_10122308 3300031728 Bacteria 1565
1207 Ga0316578_10132270 3300031728 Bacteria 1501
1208 Ga0316578_10133079 3300031728 Bacteria 1497
1209 Ga0316578_10134419 3300031728 Bacteria 1489
1210 Ga0307405_10007374 3300031731 Bacteria 5493
1211 Ga0316577_10000594 3300031733 Bacteria 14896
1212 Ga0316577_10000999 3300031733 Bacteria 12656
1213 Ga0316577_10001322 3300031733 Bacteria 11615
1214 Ga0316577_10003794 3300031733 Bacteria 7699
1215 Ga0316577_10004155 3300031733 Bacteria 7436
1216 Ga0316577_10005455 3300031733 Bacteria 6672
1217 Ga0316577_10007638 3300031733 Bacteria 5771
1218 Ga0316577_10024994 3300031733 Bacteria 3322
1219 Ga0316577_10026820 3300031733 Bacteria 3210
1220 Ga0316577_10034825 3300031733 Bacteria 2814
1221 Ga0316577_10053732 3300031733 Bacteria 2248
1222 Ga0316577_10067929 3300031733 Bacteria 1990
1223 Ga0316577_10076942 3300031733 Bacteria 1863
1224 Ga0316577_10086345 3300031733 Bacteria 1756
1225 Ga0316577_10103052 3300031733 Bacteria 1600
1226 Ga0307413_10139457 3300031824 Bacteria 1673
1227 Ga0307410_10000031 3300031852 Bacteria 49813
1228 Ga0307406_10000132 3300031901 Bacteria 44227
1229 Ga0307406_10000743 3300031901 Bacteria 18273
1230 Ga0307407_10015746 3300031903 Bacteria 3748
1231 Ga0307412_10000023 3300031911 Bacteria 237005
1232 Ga0307412_10000162 3300031911 Bacteria 47157
1233 Ga0307412_10033731 3300031911 Bacteria 3256
1234 Ga0307412_10047110 3300031911 Bacteria 2829
1235 Ga0307412_10054740 3300031911 Bacteria 2650
1236 Ga0307412_10067954 3300031911 Bacteria 2421
1237 Ga0307409_100050670 3300031995 Bacteria 3172
1238 Ga0307409_100093051 3300031995 Bacteria 2476
1239 Ga0307409_100104524 3300031995 Bacteria 2359
1240 Ga0307416_100004592 3300032002 Bacteria 8353
1241 Ga0307416_100015361 3300032002 Bacteria 5287
1242 Ga0307414_10000064 3300032004 Bacteria 106601
1243 Ga0307414_10000666 3300032004 Bacteria 17595
1244 Ga0307414_10051308 3300032004 Bacteria 2863
1245 Ga0307411_10000009 3300032005 Bacteria 319906
1246 Ga0307411_10098410 3300032005 Bacteria 2061
1247 Ga0307411_10167076 3300032005 Bacteria 1655
1248 Ga0307415_100010246 3300032126 Bacteria 5299
1249 Ga0307415_100146739 3300032126 Bacteria 1810
1250 Ga0316583_10000190 3300032133 Bacteria 15861
1251 Ga0316583_10000700 3300032133 Bacteria 10357
1252 Ga0316583_10001533 3300032133 Bacteria 7749
1253 Ga0316583_10002466 3300032133 Bacteria 6427
1254 Ga0316583_10003925 3300032133 Bacteria 5285
1255 Ga0316583_10006815 3300032133 Bacteria 4116
1256 Ga0316583_10008589 3300032133 Bacteria 3684
1257 Ga0316583_10018032 3300032133 Bacteria 2535
1258 Ga0316583_10040740 3300032133 Bacteria 1644
1259 Ga0316585_10000558 3300032137 Bacteria 9071
1260 Ga0316585_10007713 3300032137 Bacteria 3109
1261 Ga0316585_10023575 3300032137 Bacteria 1899
1262 Ga0316580_10001423 3300032139 Bacteria 6238
1263 Ga0316580_10001520 3300032139 Bacteria 6093
1264 Ga0316580_10002031 3300032139 Bacteria 5485
1265 Ga0316580_10010770 3300032139 Bacteria 2769
1266 Ga0316580_10024878 3300032139 Bacteria 1850
1267 Ga0316593_10038181 3300032168 Bacteria 1589
1268 Ga0307510_10038191 3300033180 Bacteria 5312
1269 Ga0307510_10082397 3300033180 Bacteria 3112
1270 Ga0316587_1002649 3300033529 Bacteria 2417
1271 Ga0373926_0025920 3300035083 Bacteria 2049
1272 Ga0373934_0000687 3300035086 Bacteria 12026
1273 Ga0373934_0000741 3300035086 Bacteria 11676
1274 Ga0373949_0000198 3300035090 Bacteria 23288
1275 Ga0373951_0002387 3300035091 Bacteria 4743
1276 Ga0373923_0002316 3300035111 Bacteria 5827
1277 Ga0373923_0025021 3300035111 Bacteria 2362
1278 Ga0373936_0014976 3300035113 Bacteria 2969
1279 Ga0373945_0002779 3300035116 Bacteria 5494
1280 Ga0373953_0005532 3300035117 Bacteria 4107
1281 Ga0373956_0000757 3300035119 Bacteria 13374
1282 Ga0373956_0002802 3300035119 Bacteria 7046
1283 Ga0373960_0011752 3300035121 Bacteria 2163
1284 Ga0373943_0112437 3300035170 Bacteria 1438
1285 Ga0373946_0028796 3300035171 Bacteria 2206
1286 Ga0373955_0000226 3300035172 Bacteria 23629
1287 Ga0373955_0025135 3300035172 Bacteria 3055
1288 Ga0373961_0000014 3300035241 Bacteria 111529
1289 Ga0373961_0000948 3300035241 Bacteria 9631
1290 Ga0316574_0001001 3300035398 Bacteria 12724
1291 Ga0316574_0001207 3300035398 Bacteria 11999
1292 Ga0316574_0001667 3300035398 Bacteria 10702
1293 Ga0316574_0003253 3300035398 Bacteria 8337
1294 Ga0316574_0008740 3300035398 Bacteria 5639
1295 Ga0316574_0011531 3300035398 Bacteria 5026
1296 Ga0316574_0012596 3300035398 Bacteria 4841
1297 Ga0316574_0023928 3300035398 Bacteria 3652
1298 Ga0316574_0027059 3300035398 Bacteria 3453
1299 Ga0316574_0031028 3300035398 Bacteria 3240
1300 Ga0316574_0034241 3300035398 Bacteria 3096
1301 Ga0316574_0038544 3300035398 Bacteria 2934
1302 Ga0316574_0055698 3300035398 Bacteria 2472
1303 Ga0316574_0058577 3300035398 Bacteria 2413
1304 Ga0316574_0080414 3300035398 Bacteria 2068
1305 Ga0316574_0102916 3300035398 Bacteria 1828
1306 Ga0316574_0109931 3300035398 Bacteria 1766
1307 Ga0373935_0001300 3300035692 Bacteria 13781
1308 Ga0373935_0010391 3300035692 Bacteria 5582
1309 Ga0373935_0022153 3300035692 Bacteria 3893
1310 Ga0373927_0001907 3300035695 Bacteria 15406
1311 Ga0373927_0005146 3300035695 Bacteria 9047
1312 Ga0373927_0025912 3300035695 Bacteria 3832
1313 Ga0373927_0117175 3300035695 Bacteria 1737
1314 Ga0373927_0161969 3300035695 Bacteria 1466
1315 Ga0373933_0000772 3300035724 Bacteria 19513
1316 Ga0373933_0005458 3300035724 Bacteria 6923
1317 Ga0373947_0004919 3300035725 Bacteria 7812
1318 Ga0373947_0008485 3300035725 Bacteria 5918
1319 Ga0373947_0016063 3300035725 Bacteria 4302
1320 Ga0373947_0018745 3300035725 Bacteria 3985
1321 Ga0373937_0000890 3300036401 Bacteria 25608
1322 Ga0373937_0157469 3300036401 Bacteria 2129
1323 Ga0316582_0001543 3300036647 Bacteria 10205
1324 Ga0316582_0006253 3300036647 Bacteria 6232
1325 Ga0316582_0006723 3300036647 Bacteria 6068
1326 Ga0316582_0007635 3300036647 Bacteria 5768
1327 Ga0316582_0008435 3300036647 Bacteria 5539
1328 Ga0316582_0019625 3300036647 Bacteria 3962
1329 Ga0316582_0019801 3300036647 Bacteria 3945
1330 Ga0316582_0020648 3300036647 Bacteria 3877
1331 Ga0316582_0022862 3300036647 Bacteria 3719
1332 Ga0316582_0023699 3300036647 Bacteria 3662
1333 Ga0316582_0033416 3300036647 Bacteria 3160
1334 Ga0316582_0039239 3300036647 Bacteria 2947
1335 Ga0316582_0056789 3300036647 Bacteria 2499
1336 Ga0316582_0060821 3300036647 Bacteria 2422
1337 Ga0316582_0087847 3300036647 Bacteria 2041
1338 Ga0316582_0092088 3300036647 Bacteria 1997
1339 Ga0316582_0109045 3300036647 Bacteria 1841
1340 Ga0316582_0119707 3300036647 Bacteria 1761
1341 Ga0316582_0173291 3300036647 Bacteria 1466
1342 Ga0316584_0000012 3300036712 Bacteria 63927
1343 Ga0316584_0000143 3300036712 Bacteria 32105
1344 Ga0316584_0000613 3300036712 Bacteria 19357
1345 Ga0316584_0002523 3300036712 Bacteria 11602
1346 Ga0316584_0006454 3300036712 Bacteria 7941
1347 Ga0316584_0010505 3300036712 Bacteria 6473
1348 Ga0316584_0016955 3300036712 Bacteria 5227
1349 Ga0316584_0022924 3300036712 Bacteria 4557
1350 Ga0316584_0027667 3300036712 Bacteria 4174
1351 Ga0316584_0032080 3300036712 Bacteria 3886
1352 Ga0316584_0043632 3300036712 Bacteria 3344
1353 Ga0316584_0082825 3300036712 Bacteria 2403
1354 Ga0316584_0083921 3300036712 Bacteria 2386
1355 Ga0316584_0088550 3300036712 Bacteria 2318
1356 Ga0316584_0090352 3300036712 Bacteria 2292
1357 Ga0316584_0092943 3300036712 Unclassified 2258
1358 Ga0316584_0111885 3300036712 Bacteria 2043
1359 Ga0316584_0138321 3300036712 Bacteria 1817
1360 Ga0316584_0169047 3300036712 Bacteria 1623
1361 Ga0316584_0171414 3300036712 Bacteria 1609
1362 Ga0316584_0210360 3300036712 Bacteria 1432
1363 Ga0316584_0214376 3300036712 Bacteria 1416
1364 Ga0373925_0051326 3300037068 Bacteria 3079
1365 Ga0373925_0088118 3300037068 Bacteria 2370
1366 Ga0395899_0005950 3300037312 Bacteria 9474
1367 Ga0395899_0019992 3300037312 Bacteria 5081
1368 Ga0395900_0002207 3300037418 Bacteria 21753
1369 Ga0395900_0070096 3300037418 Bacteria 3604
1370 Ga0395900_0080554 3300037418 Bacteria 3346
1371 Ga0395898_0001975 3300037466 Bacteria 25800
1372 Ga0395905_0004379 3300037471 Bacteria 14697
1373 Ga0395905_0036458 3300037471 Bacteria 4619
1374 Ga0395905_0042134 3300037471 Bacteria 4283
1375 Ga0395905_0089928 3300037471 Bacteria 2878
1376 Ga0316581_0008714 3300037588 Bacteria 2771
1377 Ga0316581_0011615 3300037588 Bacteria 2466
1378 Ga0436364_0855899 3300037853 Bacteria 18206
1379 Ga0395901_0002134 3300038443 Bacteria 20258
1380 Ga0395901_0004888 3300038443 Bacteria 13521
1381 Ga0395901_0008049 3300038443 Bacteria 10647
1382 Ga0395901_0109739 3300038443 Bacteria 2897
1383 Ga0395901_0125849 3300038443 Bacteria 2693
1384 Ga0395901_0172788 3300038443 Bacteria 2267
1385 Ga0395901_0321446 3300038443 Bacteria 1601
1386 Ga0237819_02469 3300038705 Bacteria 3704
1387 Ga0237819_03446 3300038705 Bacteria 2802
1388 Ga0400484_00611 3300038725 Bacteria 14568
1389 Ga0400484_03648 3300038725 Bacteria 7194
1390 Ga0400484_26818 3300038725 Bacteria 9273
1391 Ga0400484_33081 3300038725 Bacteria 3277
1392 Ga0400484_38520 3300038725 Bacteria 13078
1393 Ga0400490_03382 3300038726 Bacteria 17260
1394 Ga0400490_03872 3300038726 Bacteria 23989
1395 Ga0400490_16399 3300038726 Bacteria 2030
1396 Ga0400490_20164 3300038726 Bacteria 20003
1397 Ga0400490_26103 3300038726 Bacteria 26327
1398 Ga0400490_31755 3300038726 Bacteria 9493
1399 Ga0400490_43299 3300038726 Bacteria 5427
1400 Ga0400490_47884 3300038726 Bacteria 4406
1401 Ga0400490_49878 3300038726 Bacteria 2045
1402 Ga0400490_50905 3300038726 Bacteria 65742
1403 Ga0400491_01864 3300038727 Bacteria 5197
1404 Ga0400491_17037 3300038727 Bacteria 1884
1405 Ga0400491_24444 3300038727 Bacteria 1656
1406 Ga0400485_02682 3300038735 Bacteria 38427
1407 Ga0400485_09566 3300038735 Bacteria 11998
1408 Ga0400485_12529 3300038735 Bacteria 52876
1409 Ga0400485_14551 3300038735 Bacteria 14286
1410 Ga0400485_16497 3300038735 Bacteria 5670
1411 Ga0400485_17143 3300038735 Bacteria 18739
1412 Ga0400488_22426 3300038741 Bacteria 11673
1413 Ga0400488_47901 3300038741 Bacteria 2565
1414 Ga0400488_54281 3300038741 Bacteria 2196
1415 Ga0400488_56508 3300038741 Bacteria 7637
1416 Ga0400488_62343 3300038741 Bacteria 2180
1417 Ga0400486_06036 3300038742 Bacteria 20431
1418 Ga0400486_08234 3300038742 Bacteria 5257
1419 Ga0400486_16402 3300038742 Bacteria 35543
1420 Ga0400486_16511 3300038742 Bacteria 11583
1421 Ga0400486_18734 3300038742 Bacteria 45001
1422 Ga0400486_20299 3300038742 Bacteria 15103
1423 Ga0400483_006940 3300039062 Bacteria 2471
1424 Ga0400483_015191 3300039062 Bacteria 15402
1425 Ga0400483_063982 3300039062 Bacteria 2674
1426 Ga0400483_068767 3300039062 Bacteria 84641
1427 Ga0400483_110321 3300039062 Bacteria 12617
1428 Ga0400483_112260 3300039062 Bacteria 6192
1429 Ga0400483_120530 3300039062 Bacteria 1690
1430 Ga0400483_126084 3300039062 Bacteria 8937
1431 Ga0400483_134788 3300039062 Bacteria 1523
1432 Ga0400483_143368 3300039062 Bacteria 16289
1433 Ga0400483_173481 3300039062 Bacteria 60352
1434 Ga0400483_202610 3300039062 Bacteria 1511
1435 Ga0400483_218987 3300039062 Bacteria 1886
1436 Ga0400483_233352 3300039062 Bacteria 2530
1437 Ga0400483_242137 3300039062 Bacteria 2516
1438 Ga0400483_280457 3300039062 Bacteria 17471
1439 Ga0400483_286886 3300039062 Bacteria 3840
1440 Ga0400483_291297 3300039062 Bacteria 5122
1441 Ga0400489_01228 3300039093 Bacteria 3720
1442 Ga0400489_18992 3300039093 Bacteria 15158
1443 Ga0400489_21683 3300039093 Bacteria 11621
1444 Ga0400489_25826 3300039093 Bacteria 5566
1445 Ga0400489_29768 3300039093 Bacteria 87186
1446 Ga0400489_35047 3300039093 Bacteria 73845
1447 Ga0400489_45196 3300039093 Bacteria 7459
1448 Ga0400489_50224 3300039093 Bacteria 2912
1449 Ga0400489_52808 3300039093 Bacteria 13287
1450 Ga0400489_68266 3300039093 Bacteria 3723
1451 Ga0400489_69212 3300039093 Bacteria 2942
1452 Ga0400489_72172 3300039093 Bacteria 21942
1453 Ga0400489_73307 3300039093 Bacteria 22895
1454 Ga0400489_84719 3300039093 Bacteria 2609
1455 Ga0400487_10399 3300039110 Bacteria 2229
1456 Ga0400487_56498 3300039110 Bacteria 53998
1457 Ga0436365_1037676 3300039437 Bacteria 170132
1458 Ga0436365_1337717 3300039437 Bacteria 2256
1459 Ga0436361_0210320 3300039447 Bacteria 6994
1460 Ga0436361_0250104 3300039447 Bacteria 4601
1461 Ga0436361_1107681 3300039447 Bacteria 6320
1462 Ga0439436_0006308 3300041404 Bacteria 3641
1463 Ga0439438_000215 3300041405 Bacteria 26522
1464 Ga0439438_006180 3300041405 Bacteria 4265
1465 Ga0439438_006308 3300041405 Bacteria 4209
1466 Ga0439447_000076 3300041407 Bacteria 34578
1467 Ga0439447_003000 3300041407 Bacteria 6040
1468 Ga0439447_003632 3300041407 Bacteria 5445
1469 Ga0439447_005707 3300041407 Bacteria 4116
1470 Ga0439447_011486 3300041407 Bacteria 2581
1471 Ga0439466_0000784 3300041411 Bacteria 12045
1472 Ga0439466_0007042 3300041411 Bacteria 4260
1473 Ga0439466_0014154 3300041411 Bacteria 2909
1474 Ga0439466_0024629 3300041411 Bacteria 2108
1475 Ga0439465_0000001 3300041413 Bacteria 82718
1476 Ga0451852_27934 3300041508 Bacteria 1430
1477 Ga0439445_0014607 3300042004 Bacteria 1914
1478 Ga0439432_000305 3300042006 Bacteria 17677
1479 Ga0439432_003746 3300042006 Bacteria 5611
1480 Ga0439432_007277 3300042006 Bacteria 3929
1481 Ga0439432_022239 3300042006 Bacteria 2094
1482 Ga0439452_000002 3300042010 Bacteria 1377577
1483 Ga0439452_000008 3300042010 Bacteria 569877
1484 Ga0439452_002710 3300042010 Bacteria 6422
1485 Ga0439452_003663 3300042010 Bacteria 5326
1486 Ga0439452_003877 3300042010 Bacteria 5129
1487 Ga0439452_004760 3300042010 Bacteria 4484
1488 Ga0439452_007031 3300042010 Bacteria 3474
1489 Ga0439452_016691 3300042010 Bacteria 1989
1490 Ga0439456_000475 3300042013 Bacteria 8767
1491 Ga0439456_003873 3300042013 Bacteria 3037
1492 Ga0439456_007062 3300042013 Bacteria 2300
1493 Ga0439463_003270 3300042016 Bacteria 4113
1494 Ga0450911_000790 3300042115 Bacteria 8852
1495 Ga0450911_001274 3300042115 Bacteria 6021
1496 Ga0450920_002487 3300042122 Bacteria 3139
1497 Ga0450923_007695 3300042125 Bacteria 1831
1498 Ga0450902_000703 3300042137 Bacteria 4274
1499 Ga0450902_002473 3300042137 Bacteria 2622
1500 Ga0450903_002126 3300042138 Bacteria 3556
1501 Ga0450907_001138 3300042146 Bacteria 6041
1502 Ga0450907_007951 3300042146 Bacteria 1765
1503 Ga0450910_001712 3300042147 Bacteria 2813
1504 Ga0439446_0005663 3300042156 Bacteria 3220
1505 Ga0439434_0000357 3300042435 Bacteria 13113
1506 Ga0439434_0002560 3300042435 Bacteria 5292
1507 Ga0439435_0006362 3300042436 Bacteria 2651
1508 Ga0439464_0000037 3300042439 Bacteria 16759
1509 Ga0439460_0005120 3300042461 Bacteria 3208
1510 Ga0451577_0000030 3300042876 Bacteria 391423
1511 Ga0451577_0000033 3300042876 Bacteria 378714
1512 Ga0451577_0000037 3300042876 Bacteria 360162
1513 Ga0451577_0000112 3300042876 Bacteria 177581
1514 Ga0451577_0000393 3300042876 Bacteria 80362
1515 Ga0451577_0000866 3300042876 Bacteria 45041
1516 Ga0451577_0001296 3300042876 Bacteria 34405
1517 Ga0451577_0001566 3300042876 Bacteria 29973
1518 Ga0451577_0002979 3300042876 Bacteria 19372
1519 Ga0451577_0006392 3300042876 Bacteria 11760
1520 Ga0451577_0007142 3300042876 Bacteria 11015
1521 Ga0451577_0008077 3300042876 Bacteria 10267
1522 Ga0451577_0008256 3300042876 Bacteria 10143
1523 Ga0451577_0014190 3300042876 Bacteria 7427
1524 Ga0451577_0014601 3300042876 Bacteria 7318
1525 Ga0451577_0028842 3300042876 Bacteria 5019
1526 Ga0451577_0029119 3300042876 Bacteria 4993
1527 Ga0451577_0030167 3300042876 Bacteria 4900
1528 Ga0451577_0030261 3300042876 Bacteria 4892
1529 Ga0451577_0033460 3300042876 Bacteria 4634
1530 Ga0451577_0036504 3300042876 Bacteria 4424
1531 Ga0451577_0038874 3300042876 Bacteria 4278
1532 Ga0451577_0039911 3300042876 Bacteria 4216
1533 Ga0451577_0043362 3300042876 Bacteria 4029
1534 Ga0451577_0043383 3300042876 Bacteria 4029
1535 Ga0451577_0043661 3300042876 Bacteria 4016
1536 Ga0451577_0050652 3300042876 Bacteria 3707
1537 Ga0451577_0070533 3300042876 Bacteria 3116
1538 Ga0451577_0073372 3300042876 Bacteria 3053
1539 Ga0451577_0080389 3300042876 Bacteria 2907
1540 Ga0451577_0083806 3300042876 Bacteria 2844
1541 Ga0451577_0088373 3300042876 Bacteria 2765
1542 Ga0451577_0089277 3300042876 Bacteria 2750
1543 Ga0451577_0099459 3300042876 Bacteria 2598
1544 Ga0451577_0159040 3300042876 Bacteria 2034
1545 Ga0451577_0165854 3300042876 Bacteria 1990
1546 Ga0451577_0203484 3300042876 Bacteria 1787
1547 Ga0451577_0210759 3300042876 Bacteria 1755
1548 Ga0451577_0402802 3300042876 Bacteria 1242
1549 Ga0439440_0003630 3300042993 Bacteria 2990
1550 Ga0439440_0007062 3300042993 Bacteria 2275
1551 Ga0466977_0001752 3300044666 Bacteria 9324
1552 Ga0453683_0000010 3300044673 Bacteria 470890
1553 Ga0453683_0000021 3300044673 Bacteria 284502
1554 Ga0453683_0000082 3300044673 Bacteria 143197
1555 Ga0453683_0000538 3300044673 Bacteria 42284
1556 Ga0453683_0001314 3300044673 Bacteria 21925
1557 Ga0453683_0003752 3300044673 Bacteria 11084
1558 Ga0453683_0003785 3300044673 Bacteria 11023
1559 Ga0453683_0014411 3300044673 Bacteria 5133
1560 Ga0453683_0017683 3300044673 Bacteria 4588
1561 Ga0453683_0019328 3300044673 Bacteria 4366
1562 Ga0453683_0024988 3300044673 Bacteria 3796
1563 Ga0453683_0029763 3300044673 Bacteria 3451
1564 Ga0453683_0030066 3300044673 Bacteria 3434
1565 Ga0453683_0031936 3300044673 Bacteria 3325
1566 Ga0453683_0060920 3300044673 Bacteria 2359
1567 Ga0453683_0123420 3300044673 Bacteria 1630
1568 Ga0466965_0000007 3300044683 Bacteria 131940
1569 Ga0453684_0000109 3300044712 Bacteria 361015
1570 Ga0453684_0000110 3300044712 Bacteria 360542
1571 Ga0453684_0000118 3300044712 Bacteria 346595
1572 Ga0453684_0000143 3300044712 Bacteria 315998
1573 Ga0453684_0000190 3300044712 Bacteria 269203
1574 Ga0453684_0000199 3300044712 Bacteria 264155
1575 Ga0453684_0000202 3300044712 Bacteria 261894
1576 Ga0453684_0000334 3300044712 Bacteria 196444
1577 Ga0453684_0000398 3300044712 Bacteria 178891
1578 Ga0453684_0000433 3300044712 Bacteria 170341
1579 Ga0453684_0000461 3300044712 Bacteria 162371
1580 Ga0453684_0000523 3300044712 Bacteria 146814
1581 Ga0453684_0000547 3300044712 Bacteria 142253
1582 Ga0453684_0000662 3300044712 Bacteria 123698
1583 Ga0453684_0000766 3300044712 Bacteria 111429
1584 Ga0453684_0001189 3300044712 Bacteria 80442
1585 Ga0453684_0001191 3300044712 Bacteria 80362
1586 Ga0453684_0001326 3300044712 Bacteria 73118
1587 Ga0453684_0001522 3300044712 Bacteria 64945
1588 Ga0453684_0001620 3300044712 Bacteria 61605
1589 Ga0453684_0002060 3300044712 Bacteria 51082
1590 Ga0453684_0002074 3300044712 Bacteria 50909
1591 Ga0453684_0002091 3300044712 Bacteria 50553
1592 Ga0453684_0003476 3300044712 Bacteria 35373
1593 Ga0453684_0004507 3300044712 Bacteria 29242
1594 Ga0453684_0004932 3300044712 Bacteria 27213
1595 Ga0453684_0005619 3300044712 Bacteria 24659
1596 Ga0453684_0007194 3300044712 Bacteria 20652
1597 Ga0453684_0008024 3300044712 Bacteria 19107
1598 Ga0453684_0008925 3300044712 Bacteria 17749
1599 Ga0453684_0009951 3300044712 Bacteria 16401
1600 Ga0453684_0011638 3300044712 Bacteria 14689
1601 Ga0453684_0012386 3300044712 Bacteria 14078
1602 Ga0453684_0014214 3300044712 Bacteria 12779
1603 Ga0453684_0016192 3300044712 Bacteria 11685
1604 Ga0453684_0018043 3300044712 Bacteria 10864
1605 Ga0453684_0018414 3300044712 Bacteria 10718
1606 Ga0453684_0020816 3300044712 Bacteria 9856
1607 Ga0453684_0020890 3300044712 Bacteria 9826
1608 Ga0453684_0022434 3300044712 Bacteria 9362
1609 Ga0453684_0023381 3300044712 Bacteria 9109
1610 Ga0453684_0026533 3300044712 Bacteria 8359
1611 Ga0453684_0029463 3300044712 Bacteria 7791
1612 Ga0453684_0029789 3300044712 Bacteria 7734
1613 Ga0453684_0029976 3300044712 Bacteria 7701
1614 Ga0453684_0031511 3300044712 Bacteria 7449
1615 Ga0453684_0033231 3300044712 Bacteria 7195
1616 Ga0453684_0033826 3300044712 Bacteria 7112
1617 Ga0453684_0034083 3300044712 Bacteria 7078
1618 Ga0453684_0035840 3300044712 Bacteria 6848
1619 Ga0453684_0036809 3300044712 Bacteria 6735
1620 Ga0453684_0041770 3300044712 Bacteria 6193
1621 Ga0453684_0044999 3300044712 Bacteria 5893
1622 Ga0453684_0050510 3300044712 Bacteria 5469
1623 Ga0453684_0053415 3300044712 Bacteria 5274
1624 Ga0453684_0055727 3300044712 Bacteria 5137
1625 Ga0453684_0057256 3300044712 Bacteria 5046
1626 Ga0453684_0064284 3300044712 Bacteria 4688
1627 Ga0453684_0064387 3300044712 Bacteria 4684
1628 Ga0453684_0067901 3300044712 Bacteria 4531
1629 Ga0453684_0072636 3300044712 Bacteria 4342
1630 Ga0453684_0074325 3300044712 Bacteria 4280
1631 Ga0453684_0085995 3300044712 Bacteria 3904
1632 Ga0453684_0091920 3300044712 Bacteria 3743
1633 Ga0453684_0096590 3300044712 Bacteria 3629
1634 Ga0453684_0105824 3300044712 Bacteria 3430
1635 Ga0453684_0114846 3300044712 Bacteria 3263
1636 Ga0453684_0132760 3300044712 Bacteria 2986
1637 Ga0453684_0144627 3300044712 Bacteria 2834
1638 Ga0453684_0150975 3300044712 Bacteria 2761
1639 Ga0453684_0157143 3300044712 Bacteria 2694
1640 Ga0453684_0175112 3300044712 Bacteria 2524
1641 Ga0453684_0207395 3300044712 Bacteria 2280
1642 Ga0453684_0213178 3300044712 Bacteria 2243
1643 Ga0453684_0229166 3300044712 Bacteria 2146
1644 Ga0453684_0237542 3300044712 Bacteria 2100
1645 Ga0453684_0273429 3300044712 Bacteria 1929
1646 Ga0453684_0289658 3300044712 Bacteria 1865
1647 Ga0453684_0304556 3300044712 Bacteria 1810
1648 Ga0453684_0351888 3300044712 Bacteria 1661
1649 Ga0451576_0000039 3300045051 Bacteria 360162
1650 Ga0451576_0000052 3300045051 Bacteria 310414
1651 Ga0451576_0000150 3300045051 Bacteria 177361
1652 Ga0451576_0000172 3300045051 Bacteria 162376
1653 Ga0451576_0000232 3300045051 Bacteria 135846
1654 Ga0451576_0000279 3300045051 Bacteria 125074
1655 Ga0451576_0000551 3300045051 Bacteria 80362
1656 Ga0451576_0000729 3300045051 Bacteria 66020
1657 Ga0451576_0001465 3300045051 Bacteria 40000
1658 Ga0451576_0003401 3300045051 Bacteria 21934
1659 Ga0451576_0004777 3300045051 Bacteria 17367
1660 Ga0451576_0007719 3300045051 Bacteria 12784
1661 Ga0451576_0008966 3300045051 Bacteria 11659
1662 Ga0451576_0009750 3300045051 Bacteria 11102
1663 Ga0451576_0010696 3300045051 Bacteria 10507
1664 Ga0451576_0010870 3300045051 Bacteria 10415
1665 Ga0451576_0011533 3300045051 Bacteria 10029
1666 Ga0451576_0014979 3300045051 Bacteria 8613
1667 Ga0451576_0018888 3300045051 Bacteria 7535
1668 Ga0451576_0023935 3300045051 Bacteria 6602
1669 Ga0451576_0025802 3300045051 Bacteria 6330
1670 Ga0451576_0026656 3300045051 Bacteria 6214
1671 Ga0451576_0029479 3300045051 Bacteria 5871
1672 Ga0451576_0031038 3300045051 Bacteria 5699
1673 Ga0451576_0034343 3300045051 Bacteria 5387
1674 Ga0451576_0036078 3300045051 Bacteria 5244
1675 Ga0451576_0039402 3300045051 Bacteria 5001
1676 Ga0451576_0041929 3300045051 Bacteria 4834
1677 Ga0451576_0042296 3300045051 Bacteria 4811
1678 Ga0451576_0052583 3300045051 Bacteria 4268
1679 Ga0451576_0052961 3300045051 Bacteria 4253
1680 Ga0451576_0066910 3300045051 Bacteria 3740
1681 Ga0451576_0082397 3300045051 Bacteria 3346
1682 Ga0451576_0083978 3300045051 Bacteria 3313
1683 Ga0451576_0092807 3300045051 Bacteria 3140
1684 Ga0451576_0094150 3300045051 Bacteria 3115
1685 Ga0451576_0119761 3300045051 Bacteria 2740
1686 Ga0451576_0132490 3300045051 Bacteria 2599
1687 Ga0451576_0182435 3300045051 Bacteria 2191
1688 Ga0451576_0244077 3300045051 Bacteria 1876
1689 Ga0451576_0275088 3300045051 Bacteria 1760
1690 Ga0451576_0477319 3300045051 Bacteria 1310
1691 Ga0466967_0015704 3300045976 Bacteria 5946
1692 Ga0495617_004008 3300046452 Bacteria 5411
1693 Ga0495617_005953 3300046452 Bacteria 4302
1694 Ga0495617_006874 3300046452 Bacteria 3970
1695 Ga0495627_000100 3300046453 Bacteria 106276
1696 Ga0495627_004378 3300046453 Bacteria 5927
1697 Ga0495627_006122 3300046453 Bacteria 4747
1698 Ga0495627_018961 3300046453 Bacteria 2312
1699 Ga0495592_0064374 3300046454 Bacteria 2687
1700 Ga0495603_0005075 3300046455 Bacteria 7864
1701 Ga0495603_0028510 3300046455 Bacteria 3368
1702 Ga0495603_0039995 3300046455 Bacteria 2808
1703 Ga0495603_0044712 3300046455 Bacteria 2642
1704 Ga0495590_0027541 3300046457 Bacteria 1993
1705 Ga0495590_0038853 3300046457 Bacteria 1660
1706 Ga0495591_001456 3300046458 Bacteria 14667
1707 Ga0495591_002164 3300046458 Bacteria 11258
1708 Ga0495591_004279 3300046458 Bacteria 7054
1709 Ga0495591_004387 3300046458 Bacteria 6928
1710 Ga0495591_005738 3300046458 Bacteria 5660
1711 Ga0495591_006124 3300046458 Bacteria 5394
1712 Ga0495591_010220 3300046458 Bacteria 3655
1713 Ga0495591_011055 3300046458 Bacteria 3442
1714 Ga0495591_013285 3300046458 Bacteria 3023
1715 Ga0495629_0004663 3300046459 Bacteria 10262
1716 Ga0495629_0006556 3300046459 Bacteria 8620
1717 Ga0495638_0006392 3300046460 Bacteria 8579
1718 Ga0495638_0006949 3300046460 Bacteria 8168
1719 Ga0495638_0012535 3300046460 Bacteria 5804
1720 Ga0495638_0014166 3300046460 Bacteria 5398
1721 Ga0495638_0015816 3300046460 Bacteria 5055
1722 Ga0495638_0017804 3300046460 Bacteria 4730
1723 Ga0495638_0018086 3300046460 Bacteria 4686
1724 Ga0495638_0046420 3300046460 Bacteria 2728
1725 Ga0495638_0052079 3300046460 Bacteria 2551
1726 Ga0495638_0086592 3300046460 Bacteria 1893
1727 Ga0495641_0014063 3300046461 Bacteria 4351
1728 Ga0495651_0026464 3300046462 Bacteria 4519
1729 Ga0495650_0000120 3300046471 Bacteria 184191
1730 Ga0495650_0007633 3300046471 Bacteria 6458
1731 Ga0495650_0008301 3300046471 Bacteria 6082
1732 Ga0495650_0022496 3300046471 Bacteria 3022
1733 Ga0495650_0024421 3300046471 Bacteria 2854
1734 Ga0495580_0000830 3300046472 Bacteria 26783
1735 Ga0495580_0001031 3300046472 Bacteria 24463
1736 Ga0495580_0003619 3300046472 Bacteria 13093
1737 Ga0495580_0005406 3300046472 Bacteria 10558
1738 Ga0495580_0070641 3300046472 Bacteria 2439
1739 Ga0495582_0000300 3300046473 Bacteria 27352
1740 Ga0495582_0003289 3300046473 Bacteria 9081
1741 Ga0495582_0004324 3300046473 Bacteria 7987
1742 Ga0495605_0009840 3300046474 Bacteria 5363
1743 Ga0495605_0020139 3300046474 Bacteria 3548
1744 Ga0495605_0040674 3300046474 Bacteria 2319
1745 Ga0495639_0003081 3300046475 Bacteria 7253
1746 Ga0495639_0038073 3300046475 Bacteria 2158
1747 Ga0495662_0010418 3300046476 Bacteria 4553
1748 Ga0495584_0010170 3300046491 Bacteria 4830
1749 Ga0495584_0012240 3300046491 Bacteria 4383
1750 Ga0495584_0015199 3300046491 Bacteria 3921
1751 Ga0495584_0026064 3300046491 Bacteria 2962
1752 Ga0495584_0048307 3300046491 Bacteria 2145
1753 Ga0495584_0054098 3300046491 Bacteria 2020
1754 Ga0495585_0009805 3300046492 Bacteria 5728
1755 Ga0495585_0011502 3300046492 Bacteria 5237
1756 Ga0495585_0018945 3300046492 Bacteria 3970
1757 Ga0495585_0055350 3300046492 Bacteria 2192
1758 Ga0495585_0092072 3300046492 Bacteria 1632
1759 Ga0495594_0003270 3300046499 Bacteria 8398
1760 Ga0495594_0042200 3300046499 Bacteria 2498
1761 Ga0495594_0084470 3300046499 Bacteria 1775
1762 Ga0495596_0000189 3300046500 Bacteria 42603
1763 Ga0495596_0014927 3300046500 Bacteria 3264
1764 Ga0495607_0013741 3300046501 Bacteria 5292
1765 Ga0495607_0013932 3300046501 Bacteria 5250
1766 Ga0495607_0014107 3300046501 Bacteria 5214
1767 Ga0495607_0014234 3300046501 Bacteria 5186
1768 Ga0495607_0044852 3300046501 Bacteria 2603
1769 Ga0495607_0044918 3300046501 Bacteria 2601
1770 Ga0495607_0061555 3300046501 Bacteria 2132
1771 Ga0495583_0014711 3300046506 Bacteria 4299
1772 Ga0495583_0015910 3300046506 Bacteria 4068
1773 Ga0495583_0025972 3300046506 Bacteria 2914
1774 Ga0495606_0015488 3300046507 Bacteria 5870
1775 Ga0495606_0019262 3300046507 Bacteria 5084
1776 Ga0495606_0020260 3300046507 Bacteria 4911
1777 Ga0495606_0024485 3300046507 Bacteria 4348
1778 Ga0495606_0027345 3300046507 Bacteria 4047
1779 Ga0495606_0027439 3300046507 Bacteria 4038
1780 Ga0495606_0082900 3300046507 Bacteria 1989
1781 Ga0495608_0016743 3300046511 Bacteria 5072
1782 Ga0495610_0010946 3300046512 Bacteria 5588
1783 Ga0495610_0011169 3300046512 Bacteria 5508
1784 Ga0495610_0012817 3300046512 Bacteria 5015
1785 Ga0495610_0020240 3300046512 Bacteria 3698
1786 Ga0495610_0020280 3300046512 Bacteria 3693
1787 Ga0495610_0028860 3300046512 Bacteria 2929
1788 Ga0495610_0033496 3300046512 Bacteria 2655
1789 Ga0495610_0039843 3300046512 Bacteria 2372
1790 Ga0495610_0049983 3300046512 Bacteria 2043
1791 Ga0495616_0010570 3300046513 Bacteria 5336
1792 Ga0495616_0013655 3300046513 Bacteria 4574
1793 Ga0495616_0024816 3300046513 Bacteria 3210
1794 Ga0495616_0024968 3300046513 Bacteria 3198
1795 Ga0495616_0025984 3300046513 Bacteria 3122
1796 Ga0495616_0034999 3300046513 Bacteria 2602
1797 Ga0495620_0000124 3300046515 Bacteria 62374
1798 Ga0495620_0001973 3300046515 Bacteria 12003
1799 Ga0495620_0003286 3300046515 Bacteria 9271
1800 Ga0495620_0007645 3300046515 Bacteria 5851
1801 Ga0495620_0010587 3300046515 Bacteria 4860
1802 Ga0495620_0013554 3300046515 Bacteria 4171
1803 Ga0495620_0014551 3300046515 Bacteria 3996
1804 Ga0495620_0027450 3300046515 Bacteria 2663
1805 Ga0495630_0000441 3300046517 Bacteria 31615
1806 Ga0495630_0001682 3300046517 Bacteria 15412
1807 Ga0495630_0019865 3300046517 Bacteria 4945
1808 Ga0495630_0080862 3300046517 Bacteria 2452
1809 Ga0495631_0007856 3300046518 Bacteria 5407
1810 Ga0495632_0003308 3300046519 Bacteria 11498
1811 Ga0495632_0009698 3300046519 Bacteria 5779
1812 Ga0495632_0011458 3300046519 Bacteria 5171
1813 Ga0495632_0011514 3300046519 Bacteria 5156
1814 Ga0495632_0070091 3300046519 Bacteria 1686
1815 Ga0495637_0006263 3300046520 Bacteria 5987
1816 Ga0495637_0006861 3300046520 Bacteria 5691
1817 Ga0495637_0008460 3300046520 Bacteria 5052
1818 Ga0495637_0011940 3300046520 Bacteria 4163
1819 Ga0495637_0015289 3300046520 Bacteria 3600
1820 Ga0495637_0018625 3300046520 Bacteria 3218
1821 Ga0495637_0037963 3300046520 Bacteria 2087
1822 Ga0495643_0001239 3300046522 Bacteria 24515
1823 Ga0495643_0007977 3300046522 Bacteria 6751
1824 Ga0495643_0046740 3300046522 Bacteria 2345
1825 Ga0495644_0009846 3300046523 Bacteria 3679
1826 Ga0495644_0010573 3300046523 Bacteria 3556
1827 Ga0495648_0003311 3300046524 Bacteria 14213
1828 Ga0495648_0003771 3300046524 Bacteria 13187
1829 Ga0495648_0014963 3300046524 Bacteria 5651
1830 Ga0495648_0015207 3300046524 Bacteria 5601
1831 Ga0495648_0018204 3300046524 Bacteria 4988
1832 Ga0495648_0040970 3300046524 Bacteria 2930
1833 Ga0495648_0046055 3300046524 Bacteria 2707
1834 Ga0495666_0003807 3300046526 Bacteria 7632
1835 Ga0495666_0004391 3300046526 Bacteria 7128
1836 Ga0495666_0007527 3300046526 Bacteria 5447
1837 Ga0495666_0026280 3300046526 Bacteria 2871
1838 Ga0495642_0003988 3300046528 Bacteria 5768
1839 Ga0495642_0004409 3300046528 Bacteria 5463
1840 Ga0495642_0005976 3300046528 Bacteria 4671
1841 Ga0495654_0000754 3300046530 Bacteria 25055
1842 Ga0495654_0004201 3300046530 Bacteria 8614
1843 Ga0495654_0009595 3300046530 Bacteria 5300
1844 Ga0495654_0009815 3300046530 Bacteria 5231
1845 Ga0495654_0010507 3300046530 Bacteria 5035
1846 Ga0495654_0013668 3300046530 Bacteria 4338
1847 Ga0495654_0017308 3300046530 Bacteria 3791
1848 Ga0495654_0018828 3300046530 Bacteria 3613
1849 Ga0495654_0019548 3300046530 Bacteria 3542
1850 Ga0495654_0027732 3300046530 Bacteria 2899
1851 Ga0495654_0028995 3300046530 Bacteria 2826
1852 Ga0495654_0030987 3300046530 Bacteria 2716
1853 Ga0495654_0032368 3300046530 Bacteria 2651
1854 Ga0495654_0032711 3300046530 Bacteria 2635
1855 Ga0495654_0034108 3300046530 Bacteria 2570
1856 Ga0495665_0009575 3300046531 Bacteria 5249
1857 Ga0495665_0065228 3300046531 Bacteria 1922
1858 Ga0495586_0000729 3300046535 Bacteria 18807
1859 Ga0495586_0041438 3300046535 Bacteria 2480
1860 Ga0495586_0065830 3300046535 Bacteria 1975
1861 Ga0495586_0115384 3300046535 Bacteria 1497
1862 Ga0495587_0000724 3300046536 Bacteria 22064
1863 Ga0495587_0033172 3300046536 Bacteria 3118
1864 Ga0495609_0005656 3300046538 Bacteria 6515
1865 Ga0495609_0006985 3300046538 Bacteria 5691
1866 Ga0495609_0021605 3300046538 Bacteria 2969
1867 Ga0495597_0000129 3300046542 Bacteria 68183
1868 Ga0495597_0009227 3300046542 Bacteria 4888
1869 Ga0495597_0009986 3300046542 Bacteria 4662
1870 Ga0495597_0012580 3300046542 Bacteria 4079
1871 Ga0495597_0016830 3300046542 Bacteria 3449
1872 Ga0495597_0032995 3300046542 Bacteria 2347
1873 Ga0495597_0041344 3300046542 Bacteria 2059
1874 Ga0495645_0043733 3300046543 Bacteria 3268
1875 Ga0495645_0140182 3300046543 Bacteria 1688
1876 Ga0495622_0006735 3300046557 Bacteria 5327
1877 Ga0495622_0007671 3300046557 Bacteria 5012
1878 Ga0495622_0011721 3300046557 Bacteria 4053
1879 Ga0495633_0000708 3300046558 Bacteria 30329
1880 Ga0495633_0010283 3300046558 Bacteria 5115
1881 Ga0495633_0012099 3300046558 Bacteria 4607
1882 Ga0495633_0051083 3300046558 Bacteria 1948
1883 Ga0495667_0013486 3300046559 Bacteria 5531
1884 Ga0495656_0003367 3300046615 Bacteria 5404
1885 Ga0495656_0019046 3300046615 Bacteria 2644
1886 Ga0495656_0036721 3300046615 Bacteria 2019
1887 Ga0495668_0017652 3300046616 Bacteria 4134
1888 Ga0495634_0011875 3300046642 Bacteria 6329
1889 Ga0495634_0017439 3300046642 Bacteria 5122
1890 Ga0495634_0034069 3300046642 Bacteria 3496
1891 Ga0495611_0005437 3300046648 Bacteria 5446
1892 Ga0495625_0014420 3300046660 Bacteria 6309
1893 Ga0495625_0024527 3300046660 Bacteria 4589
1894 Ga0495635_0003892 3300046663 Bacteria 10375
1895 Ga0495635_0076796 3300046663 Bacteria 2289
1896 Ga0495659_0000082 3300046664 Bacteria 40924
1897 Ga0495659_0001726 3300046664 Bacteria 7278
1898 Ga0495659_0015357 3300046664 Bacteria 2516
1899 Ga0495661_0002392 3300046665 Bacteria 14484
1900 Ga0495661_0011545 3300046665 Bacteria 5990
1901 Ga0495661_0021816 3300046665 Bacteria 4169
1902 Ga0495661_0078505 3300046665 Bacteria 1909
1903 Ga0495661_0107267 3300046665 Bacteria 1562
1904 Ga0495588_0010933 3300046674 Bacteria 4245
1905 Ga0495588_0054002 3300046674 Bacteria 2072
1906 Ga0495588_0062744 3300046674 Bacteria 1926
1907 Ga0495623_0035250 3300046679 Bacteria 3207
1908 Ga0495623_0044633 3300046679 Bacteria 2816
1909 Ga0495647_0009939 3300046681 Bacteria 3232
1910 Ga0495658_0000299 3300046683 Bacteria 28208
1911 Ga0495658_0001247 3300046683 Bacteria 13368
1912 Ga0495658_0021292 3300046683 Bacteria 3417
1913 Ga0495669_0009461 3300046684 Bacteria 4110
1914 Ga0495669_0013927 3300046684 Bacteria 3433
1915 Ga0495669_0029949 3300046684 Bacteria 2388
1916 Ga0495613_0002159 3300046689 Bacteria 14909
1917 Ga0495613_0023475 3300046689 Bacteria 4595
1918 Ga0495613_0032446 3300046689 Bacteria 3880
1919 Ga0495613_0157621 3300046689 Bacteria 1616
1920 Ga0495624_0012163 3300046690 Bacteria 5892
1921 Ga0495624_0051867 3300046690 Bacteria 2594
1922 Ga0495624_0112761 3300046690 Bacteria 1672
1923 Ga0495670_0007380 3300046691 Bacteria 5404
1924 Ga0495670_0008272 3300046691 Bacteria 5115
1925 Ga0495670_0012800 3300046691 Bacteria 4124
1926 Ga0495670_0019417 3300046691 Bacteria 3349
1927 Ga0495670_0054752 3300046691 Bacteria 1999
1928 Ga0495671_0011821 3300046692 Bacteria 4784
1929 Ga0495671_0013997 3300046692 Bacteria 4325
1930 Ga0495671_0033202 3300046692 Bacteria 2630
1931 Ga0495671_0039266 3300046692 Bacteria 2391
1932 Ga0495649_0000337 3300046694 Bacteria 40360
1933 Ga0495649_0000416 3300046694 Bacteria 37037
1934 Ga0495649_0008493 3300046694 Bacteria 6172
1935 Ga0495649_0015174 3300046694 Bacteria 4386
1936 Ga0495649_0017485 3300046694 Bacteria 4044
1937 Ga0495649_0023160 3300046694 Bacteria 3469
1938 Ga0495649_0029626 3300046694 Bacteria 3026
1939 Ga0495649_0038945 3300046694 Bacteria 2606
1940 Ga0495589_0000010 3300046794 Bacteria 250407
1941 Ga0495589_0006890 3300046794 Bacteria 5972
1942 Ga0495589_0010897 3300046794 Bacteria 4723
1943 Ga0495660_0000036 3300046810 Bacteria 197450
1944 Ga0495660_0006210 3300046810 Bacteria 7088
1945 Ga0495660_0011059 3300046810 Bacteria 5241
1946 Ga0495660_0020075 3300046810 Bacteria 3832
1947 Ga0495660_0027645 3300046810 Bacteria 3209
1948 Ga0495660_0047263 3300046810 Bacteria 2357
1949 Ga0495581_0003329 3300047315 Bacteria 9229
1950 Ga0495604_0001001 3300047317 Bacteria 23511
1951 Ga0495674_0000587 3300047319 Bacteria 34072
1952 Ga0495674_0005858 3300047319 Bacteria 11788
1953 Ga0495674_0015082 3300047319 Bacteria 7232
1954 Ga0495674_0046877 3300047319 Bacteria 3835
1955 Ga0495674_0046911 3300047319 Bacteria 3833
1956 Ga0495674_0070431 3300047319 Bacteria 3022
1957 Ga0495672_0000027 3300047320 Bacteria 325651
1958 Ga0495672_0015582 3300047320 Bacteria 5156
1959 Ga0495672_0021526 3300047320 Bacteria 4204
1960 Ga0495672_0022548 3300047320 Bacteria 4090
1961 Ga0495672_0024245 3300047320 Bacteria 3912
1962 Ga0495672_0024662 3300047320 Bacteria 3869
1963 Ga0495672_0024897 3300047320 Bacteria 3844
1964 Ga0495672_0034358 3300047320 Bacteria 3133
1965 Ga0495672_0041329 3300047320 Bacteria 2789
1966 Ga0495672_0068591 3300047320 Bacteria 2015
1967 Ga0495676_0027015 3300047321 Bacteria 4930
1968 Ga0495676_0043153 3300047321 Bacteria 3694
1969 Ga0495676_0075211 3300047321 Bacteria 2584
1970 Ga0495680_0012958 3300047322 Bacteria 7301
1971 Ga0495680_0028168 3300047322 Bacteria 4608
1972 Ga0495680_0050624 3300047322 Bacteria 3246
1973 Ga0495680_0137510 3300047322 Bacteria 1790
1974 Ga0495683_0017310 3300047323 Bacteria 3738
1975 Ga0495683_0030474 3300047323 Bacteria 2751
1976 Ga0495683_0052295 3300047323 Bacteria 2039
1977 Ga0495687_009508 3300047443 Bacteria 5426
1978 Ga0495687_009631 3300047443 Bacteria 5380
1979 Ga0495675_0017338 3300047444 Bacteria 4563
1980 Ga0495675_0030782 3300047444 Bacteria 3424
1981 Ga0495677_0021241 3300047445 Bacteria 2352
1982 Ga0495679_000019 3300047446 Bacteria 231072
1983 Ga0495679_001498 3300047446 Bacteria 13187
1984 Ga0495679_005362 3300047446 Bacteria 5693
1985 Ga0495679_030774 3300047446 Bacteria 1738
1986 Ga0495673_0009235 3300047469 Bacteria 5471
1987 Ga0495673_0009240 3300047469 Bacteria 5469
1988 Ga0495673_0009939 3300047469 Bacteria 5215
1989 Ga0495673_0010243 3300047469 Bacteria 5114
1990 Ga0495673_0010973 3300047469 Bacteria 4900
1991 Ga0495673_0017918 3300047469 Bacteria 3583
1992 Ga0495673_0018453 3300047469 Bacteria 3516
1993 Ga0495673_0029145 3300047469 Bacteria 2608
1994 Ga0495673_0037046 3300047469 Bacteria 2231
1995 Ga0495681_0003395 3300047470 Bacteria 11088
1996 Ga0495681_0005954 3300047470 Bacteria 8088
1997 Ga0495681_0009718 3300047470 Bacteria 5895
1998 Ga0495681_0010523 3300047470 Bacteria 5596
1999 Ga0495681_0010998 3300047470 Bacteria 5428
2000 Ga0495681_0012145 3300047470 Bacteria 5074
2001 Ga0495681_0013501 3300047470 Bacteria 4733
2002 Ga0495681_0013679 3300047470 Bacteria 4695
2003 Ga0495681_0018169 3300047470 Bacteria 3881
2004 Ga0495681_0018998 3300047470 Bacteria 3767
2005 Ga0495681_0020977 3300047470 Bacteria 3530
2006 Ga0495681_0024404 3300047470 Bacteria 3187
2007 Ga0495681_0025844 3300047470 Bacteria 3067
2008 Ga0495684_0017361 3300047471 Bacteria 5539
2009 Ga0495684_0161494 3300047471 Bacteria 1671
2010 Ga0495686_0016545 3300047472 Bacteria 4999
2011 Ga0495686_0018995 3300047472 Bacteria 4598
2012 Ga0495593_0005574 3300047673 Bacteria 7434
2013 Ga0495593_0008906 3300047673 Bacteria 5824
2014 Ga0495593_0061352 3300047673 Bacteria 1966
2015 Ga0495602_0018454 3300048088 Bacteria 6967
2016 Ga0495602_0024479 3300048088 Bacteria 5856
2017 Ga0495602_0047607 3300048088 Bacteria 3862
2018 Ga0495614_0005873 3300048089 Bacteria 5530
2019 Ga0495626_0001279 3300048091 Bacteria 20538
2020 Ga0495626_0007774 3300048091 Bacteria 5941
2021 Ga0495626_0007837 3300048091 Bacteria 5915
2022 Ga0495626_0007975 3300048091 Bacteria 5850
2023 Ga0495626_0025223 3300048091 Bacteria 2908
2024 Ga0496100_0008015 3300048903 Bacteria 5869
2025 Ga0496100_0020495 3300048903 Bacteria 3965
2026 Ga0496101_0005879 3300048904 Bacteria 7856
2027 Ga0496101_0029344 3300048904 Bacteria 3846
2028 Ga0496101_0061519 3300048904 Bacteria 2727
2029 Ga0496101_0069223 3300048904 Bacteria 2581
2030 Ga0496102_0017528 3300048905 Bacteria 6272
2031 Ga0496102_0023148 3300048905 Bacteria 5513
2032 Ga0496102_0028405 3300048905 Bacteria 4996
2033 Ga0496102_0033956 3300048905 Bacteria 4587
2034 Ga0496102_0083735 3300048905 Bacteria 2943
2035 Ga0496103_0008474 3300048906 Bacteria 6108
2036 Ga0496103_0025431 3300048906 Bacteria 3579
2037 Ga0496103_0030251 3300048906 Bacteria 3295
2038 Ga0496103_0056365 3300048906 Bacteria 2439
2039 Ga0496103_0156066 3300048906 Bacteria 1463
2040 Ga0496104_0001118 3300048907 Bacteria 22956
2041 Ga0496104_0003113 3300048907 Bacteria 14308
2042 Ga0496104_0008000 3300048907 Bacteria 9374
2043 Ga0496104_0030612 3300048907 Bacteria 5002
2044 Ga0496104_0049314 3300048907 Bacteria 3971
2045 Ga0496104_0077858 3300048907 Bacteria 3159
2046 Ga0496104_0261113 3300048907 Bacteria 1645
2047 Ga0496105_0001878 3300048908 Bacteria 15073
2048 Ga0496105_0031254 3300048908 Bacteria 4365
2049 Ga0496105_0132219 3300048908 Bacteria 2057
2050 Ga0496106_0003524 3300048909 Bacteria 11661
2051 Ga0496106_0017299 3300048909 Bacteria 5337
2052 Ga0496106_0019949 3300048909 Bacteria 4971
2053 Ga0496106_0024654 3300048909 Bacteria 4473
2054 Ga0496106_0039521 3300048909 Bacteria 3533
2055 Ga0496107_0001542 3300048910 Bacteria 14312
2056 Ga0496107_0002329 3300048910 Bacteria 12260
2057 Ga0496107_0047532 3300048910 Bacteria 3090
2058 Ga0496107_0049763 3300048910 Bacteria 3020
2059 Ga0496108_0042068 3300048911 Bacteria 3813
2060 Ga0496108_0044548 3300048911 Bacteria 3703
2061 Ga0496108_0054847 3300048911 Bacteria 3345
2062 Ga0496108_0164942 3300048911 Bacteria 1915
2063 Ga0496109_0035058 3300048912 Bacteria 4524
2064 Ga0496109_0109184 3300048912 Bacteria 2571
2065 Ga0496109_0244626 3300048912 Bacteria 1689
2066 Ga0496110_0014135 3300048913 Bacteria 6620
2067 Ga0496110_0023376 3300048913 Bacteria 5255
2068 Ga0496110_0026357 3300048913 Bacteria 4973
2069 Ga0496110_0046454 3300048913 Bacteria 3799
2070 Ga0496110_0070048 3300048913 Bacteria 3106
2071 Ga0496110_0083396 3300048913 Bacteria 2851
2072 Ga0496110_0161388 3300048913 Bacteria 2032
2073 Ga0496110_0232403 3300048913 Bacteria 1677
2074 Ga0496111_0010757 3300048914 Bacteria 6151
2075 Ga0496111_0024059 3300048914 Bacteria 4283
2076 Ga0496111_0037096 3300048914 Bacteria 3488
2077 Ga0496111_0218646 3300048914 Bacteria 1415
2078 Ga0496112_0039999 3300048915 Bacteria 4584
2079 Ga0496112_0159814 3300048915 Bacteria 2219
2080 Ga0496112_0199197 3300048915 Bacteria 1962
2081 Ga0496113_0018647 3300048916 Bacteria 4837
2082 Ga0496113_0023346 3300048916 Bacteria 4386
2083 Ga0496113_0052537 3300048916 Bacteria 3044
2084 Ga0496113_0060347 3300048916 Bacteria 2859
2085 Ga0496113_0063545 3300048916 Bacteria 2790
2086 Ga0496113_0066451 3300048916 Bacteria 2731
2087 Ga0496114_0001722 3300048917 Bacteria 16602
2088 Ga0496114_0079460 3300048917 Bacteria 2768
2089 Ga0496114_0081556 3300048917 Bacteria 2733
2090 Ga0496115_0000563 3300048918 Bacteria 28787
2091 Ga0496115_0000589 3300048918 Bacteria 27866
2092 Ga0496115_0009252 3300048918 Bacteria 7319
2093 Ga0496115_0015282 3300048918 Bacteria 5821
2094 Ga0496115_0071595 3300048918 Bacteria 2812
2095 Ga0496115_0202228 3300048918 Bacteria 1641
2096 Ga0496116_0000051 3300048919 Bacteria 305038
2097 Ga0496116_0000075 3300048919 Bacteria 231674
2098 Ga0496116_0000077 3300048919 Bacteria 227959
2099 Ga0496116_0000096 3300048919 Bacteria 202230
2100 Ga0496116_0000181 3300048919 Bacteria 126124
2101 Ga0496116_0003506 3300048919 Bacteria 15451
2102 Ga0496116_0005939 3300048919 Bacteria 11197
2103 Ga0496116_0010913 3300048919 Bacteria 7569
2104 Ga0496116_0014431 3300048919 Bacteria 6308
2105 Ga0496116_0016278 3300048919 Bacteria 5827
2106 Ga0496116_0027419 3300048919 Bacteria 4147
2107 Ga0496116_0038970 3300048919 Bacteria 3291
2108 Ga0496116_0075287 3300048919 Bacteria 2119
2109 Ga0496116_0082396 3300048919 Bacteria 1990
2110 Ga0496117_0000005 3300048920 Bacteria 777468
2111 Ga0496117_0000007 3300048920 Bacteria 720505
2112 Ga0496117_0001792 3300048920 Bacteria 29238
2113 Ga0496117_0002904 3300048920 Bacteria 20735
2114 Ga0496117_0003141 3300048920 Bacteria 19694
2115 Ga0496117_0004669 3300048920 Bacteria 14887
2116 Ga0496117_0006894 3300048920 Bacteria 11271
2117 Ga0496117_0006961 3300048920 Bacteria 11212
2118 Ga0496117_0007471 3300048920 Bacteria 10664
2119 Ga0496117_0007796 3300048920 Bacteria 10315
2120 Ga0496117_0009888 3300048920 Bacteria 8781
2121 Ga0496117_0011818 3300048920 Bacteria 7771
2122 Ga0496117_0014842 3300048920 Bacteria 6684
2123 Ga0496117_0028413 3300048920 Bacteria 4331
2124 Ga0496117_0035280 3300048920 Bacteria 3755
2125 Ga0496117_0039136 3300048920 Bacteria 3503
2126 Ga0496117_0054119 3300048920 Bacteria 2814
2127 Ga0496117_0098861 3300048920 Bacteria 1854
2128 Ga0496118_0000031 3300048921 Bacteria 339329
2129 Ga0496118_0000140 3300048921 Bacteria 128335
2130 Ga0496118_0000767 3300048921 Bacteria 51508
2131 Ga0496118_0001845 3300048921 Bacteria 30340
2132 Ga0496118_0004066 3300048921 Bacteria 17735
2133 Ga0496118_0009800 3300048921 Bacteria 9602
2134 Ga0496118_0010081 3300048921 Bacteria 9400
2135 Ga0496118_0012713 3300048921 Bacteria 8048
2136 Ga0496118_0014028 3300048921 Bacteria 7525
2137 Ga0496118_0016470 3300048921 Bacteria 6780
2138 Ga0496118_0022406 3300048921 Bacteria 5521
2139 Ga0496118_0039714 3300048921 Bacteria 3752
2140 Ga0496118_0039971 3300048921 Bacteria 3735
2141 Ga0496118_0085899 3300048921 Bacteria 2188
2142 Ga0496118_0089177 3300048921 Bacteria 2130
2143 Ga0496118_0116090 3300048921 Bacteria 1760
2144 Ga0496118_0155707 3300048921 Bacteria 1422
2145 Ga0496119_0000007 3300048922 Bacteria 475920
2146 Ga0496119_0000066 3300048922 Bacteria 162680
2147 Ga0496119_0000069 3300048922 Bacteria 155265
2148 Ga0496119_0000160 3300048922 Bacteria 93515
2149 Ga0496119_0000759 3300048922 Bacteria 43300
2150 Ga0496119_0001223 3300048922 Bacteria 31981
2151 Ga0496119_0008246 3300048922 Bacteria 9207
2152 Ga0496119_0010770 3300048922 Bacteria 7656
2153 Ga0496119_0033494 3300048922 Bacteria 3404
2154 Ga0496119_0038070 3300048922 Bacteria 3113
2155 Ga0496120_0000038 3300048923 Bacteria 204168
2156 Ga0496120_0000112 3300048923 Bacteria 136735
2157 Ga0496120_0000139 3300048923 Bacteria 120489
2158 Ga0496120_0000192 3300048923 Bacteria 104239
2159 Ga0496120_0000243 3300048923 Bacteria 92536
2160 Ga0496120_0001402 3300048923 Bacteria 29168
2161 Ga0496120_0013007 3300048923 Bacteria 5628
2162 Ga0496120_0019386 3300048923 Bacteria 4352
2163 Ga0496120_0019523 3300048923 Bacteria 4333
2164 Ga0496120_0036780 3300048923 Bacteria 2909
2165 Ga0496120_0106176 3300048923 Bacteria 1475
2166 Ga0496121_0000195 3300048924 Bacteria 136162
2167 Ga0496121_0002186 3300048924 Bacteria 30608
2168 Ga0496121_0006282 3300048924 Bacteria 14853
2169 Ga0496121_0008513 3300048924 Bacteria 12038
2170 Ga0496121_0011352 3300048924 Bacteria 9903
2171 Ga0496121_0014973 3300048924 Bacteria 8167
2172 Ga0496121_0016438 3300048924 Bacteria 7643
2173 Ga0496121_0020957 3300048924 Bacteria 6432
2174 Ga0496121_0021741 3300048924 Bacteria 6268
2175 Ga0496121_0024685 3300048924 Bacteria 5737
2176 Ga0496121_0030925 3300048924 Bacteria 4906
2177 Ga0496121_0041719 3300048924 Bacteria 4006
2178 Ga0496121_0059953 3300048924 Bacteria 3134
2179 Ga0496121_0060172 3300048924 Bacteria 3126
2180 Ga0496121_0074555 3300048924 Bacteria 2713
2181 Ga0496122_0000237 3300048925 Bacteria 123935
2182 Ga0496122_0000280 3300048925 Bacteria 113606
2183 Ga0496122_0000291 3300048925 Bacteria 111096
2184 Ga0496122_0000416 3300048925 Bacteria 90497
2185 Ga0496122_0000588 3300048925 Bacteria 74588
2186 Ga0496122_0001745 3300048925 Bacteria 33579
2187 Ga0496122_0009251 3300048925 Bacteria 10423
2188 Ga0496122_0018025 3300048925 Bacteria 6547
2189 Ga0496122_0019412 3300048925 Bacteria 6210
2190 Ga0496122_0022915 3300048925 Bacteria 5529
2191 Ga0496122_0070124 3300048925 Bacteria 2506
2192 Ga0496123_0000078 3300048926 Bacteria 191819
2193 Ga0496123_0000104 3300048926 Bacteria 168230
2194 Ga0496123_0000229 3300048926 Bacteria 113606
2195 Ga0496123_0000790 3300048926 Bacteria 51132
2196 Ga0496123_0001434 3300048926 Bacteria 33265
2197 Ga0496123_0001470 3300048926 Bacteria 32701
2198 Ga0496123_0003754 3300048926 Bacteria 16653
2199 Ga0496123_0003867 3300048926 Bacteria 16291
2200 Ga0496123_0004168 3300048926 Bacteria 15462
2201 Ga0496123_0006711 3300048926 Bacteria 11079
2202 Ga0496123_0011646 3300048926 Bacteria 7592
2203 Ga0496123_0016608 3300048926 Bacteria 5964
2204 Ga0496123_0018797 3300048926 Bacteria 5475
2205 Ga0496123_0058495 3300048926 Bacteria 2499
2206 Ga0496123_0060014 3300048926 Bacteria 2454
2207 Ga0496124_0000026 3300048927 Bacteria 385387
2208 Ga0496124_0000100 3300048927 Bacteria 181404
2209 Ga0496124_0002438 3300048927 Bacteria 24375
2210 Ga0496124_0002570 3300048927 Bacteria 23528
2211 Ga0496124_0004397 3300048927 Bacteria 16453
2212 Ga0496124_0004407 3300048927 Bacteria 16429
2213 Ga0496124_0005203 3300048927 Bacteria 14774
2214 Ga0496124_0009296 3300048927 Bacteria 10133
2215 Ga0496124_0014416 3300048927 Bacteria 7643
2216 Ga0496124_0022157 3300048927 Bacteria 5831
2217 Ga0496124_0028884 3300048927 Bacteria 4951
2218 Ga0496124_0052243 3300048927 Bacteria 3472
2219 Ga0496124_0052313 3300048927 Bacteria 3469
2220 Ga0496124_0066797 3300048927 Bacteria 2994
2221 Ga0496124_0077974 3300048927 Bacteria 2731
2222 Ga0496124_0083586 3300048927 Bacteria 2618
2223 Ga0496124_0088808 3300048927 Bacteria 2525
2224 Ga0496124_0145000 3300048927 Bacteria 1869
2225 Ga0496125_0000024 3300048928 Bacteria 442149
2226 Ga0496125_0000070 3300048928 Bacteria 245793
2227 Ga0496125_0000226 3300048928 Bacteria 115358
2228 Ga0496125_0000364 3300048928 Bacteria 85440
2229 Ga0496125_0001029 3300048928 Bacteria 43266
2230 Ga0496125_0003184 3300048928 Bacteria 20311
2231 Ga0496125_0004744 3300048928 Bacteria 15491
2232 Ga0496125_0006488 3300048928 Bacteria 12634
2233 Ga0496125_0008479 3300048928 Bacteria 10756
2234 Ga0496125_0009455 3300048928 Bacteria 10010
2235 Ga0496125_0010323 3300048928 Bacteria 9455
2236 Ga0496125_0017357 3300048928 Bacteria 6865
2237 Ga0496125_0017588 3300048928 Bacteria 6810
2238 Ga0496125_0018023 3300048928 Bacteria 6712
2239 Ga0496125_0021748 3300048928 Bacteria 5970
2240 Ga0496125_0029031 3300048928 Bacteria 4979
2241 Ga0496125_0050170 3300048928 Bacteria 3458
2242 Ga0496125_0088607 3300048928 Bacteria 2331
2243 Ga0496126_0001297 3300048929 Bacteria 39818
2244 Ga0496126_0002437 3300048929 Bacteria 25124
2245 Ga0496126_0004899 3300048929 Bacteria 15641
2246 Ga0496126_0007430 3300048929 Bacteria 12018
2247 Ga0496126_0008317 3300048929 Bacteria 11204
2248 Ga0496126_0010844 3300048929 Bacteria 9502
2249 Ga0496126_0024727 3300048929 Bacteria 5794
2250 Ga0496126_0071011 3300048929 Bacteria 3101
2251 Ga0496126_0141242 3300048929 Bacteria 2072
2252 Ga0496126_0141525 3300048929 Bacteria 2070
2253 Ga0496126_0163117 3300048929 Bacteria 1903
2254 Ga0495678_008428 3300049459 Bacteria 5200
2255 Ga0495678_013561 3300049459 Bacteria 3820
2256 Ga0495678_020866 3300049459 Bacteria 2892
2257 Ga0495678_022516 3300049459 Bacteria 2753
2258 Ga0495682_0000174 3300049460 Bacteria 54279
2259 Ga0495682_0002927 3300049460 Bacteria 7820
2260 Ga0495682_0009057 3300049460 Bacteria 3903
2261 Ga0495682_0016005 3300049460 Bacteria 2838
2262 Ga0501031_0001325 3300049568 Bacteria 15233
2263 Ga0501031_0005851 3300049568 Bacteria 8014
2264 Ga0501031_0025303 3300049568 Bacteria 3872
2265 Ga0501031_0093645 3300049568 Bacteria 1960
2266 Ga0501031_0112069 3300049568 Bacteria 1781
2267 Ga0501031_0154283 3300049568 Bacteria 1501
2268 Ga0501032_0000445 3300049569 Bacteria 33791
2269 Ga0501032_0003475 3300049569 Bacteria 12061
2270 Ga0501032_0004498 3300049569 Bacteria 10495
2271 Ga0501032_0011737 3300049569 Bacteria 6281
2272 Ga0501032_0036144 3300049569 Bacteria 3373
2273 Ga0501032_0055175 3300049569 Bacteria 2673
2274 Ga0501032_0061670 3300049569 Bacteria 2513
2275 Ga0501032_0075830 3300049569 Bacteria 2239
2276 Ga0501032_0084985 3300049569 Bacteria 2104
2277 Ga0501032_0095117 3300049569 Bacteria 1975
2278 Ga0501033_0000336 3300049570 Bacteria 44898
2279 Ga0501033_0001087 3300049570 Bacteria 24599
2280 Ga0501033_0003106 3300049570 Bacteria 13783
2281 Ga0501033_0038813 3300049570 Bacteria 3557
2282 Ga0501033_0051034 3300049570 Bacteria 3066
2283 Ga0501034_0000131 3300049571 Bacteria 139479
2284 Ga0501034_0000548 3300049571 Bacteria 59619
2285 Ga0501034_0001019 3300049571 Bacteria 40140
2286 Ga0501034_0001617 3300049571 Bacteria 29242
2287 Ga0501034_0015924 3300049571 Bacteria 7717
2288 Ga0501034_0031493 3300049571 Bacteria 5386
2289 Ga0501034_0036253 3300049571 Bacteria 4996
2290 Ga0501034_0038453 3300049571 Bacteria 4844
2291 Ga0501034_0041254 3300049571 Bacteria 4669
2292 Ga0501034_0090297 3300049571 Bacteria 3061
2293 Ga0501034_0162502 3300049571 Bacteria 2203
2294 Ga0501034_0163817 3300049571 Bacteria 2193
2295 Ga0501034_0209669 3300049571 Bacteria 1904
2296 Ga0501034_0216823 3300049571 Bacteria 1867
2297 Ga0501036_0002923 3300049572 Bacteria 13569
2298 Ga0501036_0008830 3300049572 Bacteria 8274
2299 Ga0501036_0009281 3300049572 Bacteria 8085
2300 Ga0501036_0019941 3300049572 Bacteria 5629
2301 Ga0501036_0024204 3300049572 Bacteria 5118
2302 Ga0501036_0033632 3300049572 Bacteria 4335
2303 Ga0501036_0065007 3300049572 Bacteria 3087
2304 Ga0501036_0156047 3300049572 Bacteria 1925
2305 Ga0501036_0282770 3300049572 Bacteria 1388
2306 Ga0501037_0002801 3300049573 Bacteria 12633
2307 Ga0501037_0017651 3300049573 Bacteria 5253
2308 Ga0501037_0022108 3300049573 Bacteria 4706
2309 Ga0501037_0026946 3300049573 Bacteria 4246
2310 Ga0501037_0041557 3300049573 Bacteria 3381
2311 Ga0501037_0071651 3300049573 Bacteria 2521
2312 Ga0501038_0001663 3300049574 Bacteria 20620
2313 Ga0501038_0002148 3300049574 Bacteria 18309
2314 Ga0501038_0003198 3300049574 Bacteria 15280
2315 Ga0501038_0003797 3300049574 Bacteria 14059
2316 Ga0501038_0013910 3300049574 Bacteria 7334
2317 Ga0501038_0027577 3300049574 Bacteria 5052
2318 Ga0501038_0028765 3300049574 Bacteria 4934
2319 Ga0501038_0037237 3300049574 Bacteria 4266
2320 Ga0501038_0138724 3300049574 Bacteria 1991
2321 Ga0501038_0148614 3300049574 Bacteria 1911
2322 Ga0501039_0014159 3300049575 Bacteria 6107
2323 Ga0501039_0035046 3300049575 Bacteria 3873
2324 Ga0501039_0043620 3300049575 Bacteria 3464
2325 Ga0501039_0057060 3300049575 Bacteria 3025
2326 Ga0501039_0175473 3300049575 Bacteria 1685
2327 Ga0501040_0003730 3300049576 Bacteria 9875
2328 Ga0501040_0007334 3300049576 Bacteria 7141
2329 Ga0501040_0068964 3300049576 Bacteria 2439
2330 Ga0501041_0013008 3300049577 Bacteria 4929
2331 Ga0501041_0126008 3300049577 Bacteria 1594
2332 Ga0501042_0002736 3300049578 Bacteria 10875
2333 Ga0501042_0007788 3300049578 Bacteria 7039
2334 Ga0501042_0022536 3300049578 Bacteria 4399
2335 Ga0501042_0031755 3300049578 Bacteria 3736
2336 Ga0501042_0221007 3300049578 Bacteria 1366
2337 Ga0501043_0000018 3300049579 Bacteria 161101
2338 Ga0501043_0004020 3300049579 Bacteria 12023
2339 Ga0501043_0011974 3300049579 Bacteria 6785
2340 Ga0501043_0015548 3300049579 Bacteria 5964
2341 Ga0501043_0039870 3300049579 Bacteria 3692
2342 Ga0501046_0000042 3300049580 Bacteria 151850
2343 Ga0501046_0002908 3300049580 Bacteria 15880
2344 Ga0501046_0006873 3300049580 Bacteria 10032
2345 Ga0501046_0044594 3300049580 Bacteria 3526
2346 Ga0501046_0176577 3300049580 Bacteria 1600
2347 Ga0501047_0000047 3300049581 Bacteria 168242
2348 Ga0501047_0000052 3300049581 Bacteria 153448
2349 Ga0501047_0024356 3300049581 Bacteria 5811
2350 Ga0501047_0032402 3300049581 Bacteria 5045
2351 Ga0501047_0090693 3300049581 Bacteria 2933
2352 Ga0501047_0161863 3300049581 Bacteria 2109
2353 Ga0501048_0000459 3300049582 Bacteria 28550
2354 Ga0501048_0010416 3300049582 Bacteria 6943
2355 Ga0501048_0016477 3300049582 Bacteria 5448
2356 Ga0501048_0031426 3300049582 Bacteria 3840
2357 Ga0501048_0032987 3300049582 Bacteria 3742
2358 Ga0501048_0038268 3300049582 Bacteria 3442
2359 Ga0501067_0017430 3300049583 Bacteria 3970
2360 Ga0501068_0005998 3300049584 Bacteria 6673
2361 Ga0501068_0015768 3300049584 Bacteria 4347
2362 Ga0501069_0036462 3300049585 Bacteria 2712
2363 Ga0501069_0080689 3300049585 Bacteria 1832
2364 Ga0501070_0016000 3300049586 Bacteria 6304
2365 Ga0501070_0020320 3300049586 Bacteria 5571
2366 Ga0501070_0034633 3300049586 Bacteria 4220
2367 Ga0501070_0260804 3300049586 Bacteria 1416
2368 Ga0501071_0002077 3300049587 Bacteria 12006
2369 Ga0501072_0064796 3300049588 Bacteria 2881
2370 Ga0501072_0069734 3300049588 Bacteria 2775
2371 Ga0501074_0004078 3300049590 Bacteria 10424
2372 Ga0501074_0189071 3300049590 Bacteria 1468
2373 Ga0501074_0193386 3300049590 Bacteria 1450
2374 Ga0501075_0000261 3300049591 Bacteria 28643
2375 Ga0501075_0004727 3300049591 Bacteria 9254
2376 Ga0501075_0013701 3300049591 Bacteria 5794
2377 Ga0501075_0018650 3300049591 Bacteria 5024
2378 Ga0501076_0072219 3300049592 Bacteria 2761
2379 Ga0501076_0116128 3300049592 Bacteria 2166
2380 Ga0501077_0002214 3300049593 Bacteria 11722
2381 Ga0501077_0005964 3300049593 Bacteria 7442
2382 Ga0501223_000485 3300049663 Bacteria 9597
2383 Ga0501238_000050 3300049671 Bacteria 19623
2384 Ga0501242_000458 3300049674 Bacteria 3553
2385 Ga0501249_000007 3300049679 Bacteria 198318
2386 Ga0501249_003071 3300049679 Bacteria 3357
2387 Ga0501225_0002034 3300049705 Bacteria 6293
2388 Ga0501079_0027813 3300049741 Bacteria 4337
2389 Ga0501079_0072467 3300049741 Bacteria 2662
2390 Ga0501079_0103836 3300049741 Bacteria 2205
2391 Ga0501079_0117663 3300049741 Bacteria 2066
2392 Ga0501080_0010735 3300049742 Bacteria 8378
2393 Ga0501080_0018399 3300049742 Bacteria 6467
2394 Ga0501080_0306575 3300049742 Bacteria 1439
2395 Ga0501081_0004957 3300049743 Bacteria 8564
2396 Ga0501081_0040821 3300049743 Bacteria 3176
2397 Ga0501083_0005941 3300049744 Bacteria 8638
2398 Ga0501241_001008 3300049758 Bacteria 5929
2399 Ga0501241_002000 3300049758 Bacteria 3997
2400 Ga0501241_003386 3300049758 Bacteria 3009
2401 Ga0501266_000018 3300049763 Bacteria 135236
2402 Ga0501269_000002 3300049766 Bacteria 118370
2403 Ga0501280_000506 3300049776 Bacteria 9203
2404 Ga0501035_0001410 3300049822 Bacteria 24651
2405 Ga0501035_0004116 3300049822 Bacteria 13822
2406 Ga0501035_0008857 3300049822 Bacteria 9363
2407 Ga0501035_0035070 3300049822 Bacteria 4555
2408 Ga0501035_0064043 3300049822 Bacteria 3268
2409 Ga0501035_0216777 3300049822 Bacteria 1636
2410 Ga0501044_0000455 3300049823 Bacteria 49850
2411 Ga0501044_0001189 3300049823 Bacteria 30850
2412 Ga0501044_0003592 3300049823 Bacteria 17453
2413 Ga0501044_0003750 3300049823 Bacteria 17079
2414 Ga0501044_0012073 3300049823 Bacteria 9357
2415 Ga0501044_0034791 3300049823 Bacteria 5281
2416 Ga0501044_0061250 3300049823 Bacteria 3850
2417 Ga0501044_0099800 3300049823 Bacteria 2921
2418 Ga0501044_0109621 3300049823 Bacteria 2769
2419 Ga0501044_0213320 3300049823 Bacteria 1884
2420 Ga0501045_0006811 3300049824 Bacteria 7917
2421 Ga0501045_0034838 3300049824 Bacteria 3654
2422 Ga0501045_0040309 3300049824 Bacteria 3399
2423 Ga0501045_0076025 3300049824 Bacteria 2474
2424 Ga0501045_0099230 3300049824 Bacteria 2155
2425 nmdc:mga03683_49956_c1 3300050489 Bacteria 1743
2426 nmdc:mga00v17_53670_c1 3300050491 Bacteria 2457
2427 nmdc:mga00v17_844_c1 3300050491 Bacteria 16611
2428 nmdc:mga07m45_16413_c1 3300050496 Bacteria 3965
2429 nmdc:mga05p37_105663_c1 3300050507 Bacteria 3463
2430 nmdc:mga05p37_12638_c1 3300050507 Bacteria 10084
2431 nmdc:mga05p37_13094_c1 3300050507 Bacteria 9926
2432 nmdc:mga05p37_163367_c1 3300050507 Bacteria 2718
2433 nmdc:mga05p37_29036_c2 3300050507 Bacteria 4128
2434 nmdc:mga05p37_330_c1 3300050507 Bacteria 50725
2435 nmdc:mga05p37_343480_c1 3300050507 Bacteria 1759
2436 nmdc:mga05p37_50528_c1 3300050507 Bacteria 5113
2437 nmdc:mga05p37_65821_c1 3300050507 Bacteria 4459
2438 nmdc:mga05p37_68193_c1 3300050507 Bacteria 4375
2439 nmdc:mga05p37_71694_c1 3300050507 Bacteria 4262
2440 nmdc:mga09592_144047_c1 3300050508 Bacteria 2054
2441 nmdc:mga09592_236270_c1 3300050508 Bacteria 1583
2442 nmdc:mga09592_3709_c1 3300050508 Bacteria 12313
2443 nmdc:mga0qj67_174233_c1 3300050509 Bacteria 1747
2444 nmdc:mga0qj67_178283_c1 3300050509 Bacteria 1726
2445 nmdc:mga0qj67_210207_c1 3300050509 Bacteria 1581
2446 nmdc:mga0qj67_21372_c1 3300050509 Bacteria 4965
2447 nmdc:mga0qj67_27538_c1 3300050509 Bacteria 4407
2448 nmdc:mga06r32_169822_c1 3300050510 Bacteria 2165
2449 nmdc:mga06r32_25301_c1 3300050510 Bacteria 5522
2450 nmdc:mga06r32_27670_c1 3300050510 Bacteria 5299
2451 nmdc:mga06r32_297242_c1 3300050510 Bacteria 1601
2452 nmdc:mga06r32_32416_c1 3300050510 Bacteria 4916
2453 nmdc:mga06r32_74846_c1 3300050510 Bacteria 3284
2454 nmdc:mga08y16_120853_c1 3300050511 Bacteria 2726
2455 nmdc:mga08y16_16966_c1 3300050511 Bacteria 7667
2456 nmdc:mga08y16_221477_c1 3300050511 Bacteria 1959
2457 nmdc:mga08y16_2422_c1 3300050511 Bacteria 19162
2458 nmdc:mga08y16_303358_c1 3300050511 Bacteria 1646
2459 nmdc:mga08y16_341015_c1 3300050511 Bacteria 1540
2460 nmdc:mga08y16_354501_c1 3300050511 Bacteria 1507
2461 nmdc:mga08y16_9087_c1 3300050511 Bacteria 10433
2462 nmdc:mga0n895_118814_c1 3300050512 Bacteria 2664
2463 nmdc:mga0n895_1992_c1 3300050512 Bacteria 15671
2464 nmdc:mga0n895_245_c1 3300050512 Bacteria 34670
2465 nmdc:mga0n895_85408_c1 3300050512 Bacteria 3151
2466 nmdc:mga0n895_86088_c1 3300050512 Bacteria 3139
2467 nmdc:mga0rr50_123089_c1 3300050513 Bacteria 2067
2468 nmdc:mga0rr50_131928_c1 3300050513 Bacteria 2001
2469 nmdc:mga0rr50_153510_c1 3300050513 Bacteria 1863
2470 nmdc:mga0rr50_3942_c1 3300050513 Bacteria 8633
2471 nmdc:mga0rr50_75335_c1 3300050513 Bacteria 2586
2472 nmdc:mga08x19_19782_c1 3300050514 Bacteria 4137
2473 nmdc:mga08x19_30553_c1 3300050514 Bacteria 3385
2474 nmdc:mga08x19_96135_c1 3300050514 Bacteria 1960
2475 nmdc:mga0a205_20587_c1 3300050515 Bacteria 6227
2476 nmdc:mga0a205_233616_c1 3300050515 Bacteria 1721
2477 nmdc:mga0a205_321_c1 3300050515 Bacteria 35828
2478 nmdc:mga0a205_6744_c1 3300050515 Bacteria 8461
2479 nmdc:mga0a205_7958_c1 3300050515 Bacteria 9629
2480 nmdc:mga0a205_8110_c1 3300050515 Bacteria 9545
2481 nmdc:mga0a205_8280_c1 3300050515 Bacteria 9454
2482 nmdc:mga0sz30_4776_c1 3300050516 Bacteria 4926
2483 Ga0495655_0013096 3300053083 Bacteria 1707
2484 Ga0495619_0007786 3300053085 Bacteria 6782
2485 Ga0500646_0000532 3300053090 Bacteria 11160
2486 Ga0500651_0000253 3300053093 Bacteria 32192
2487 Ga0500641_0000012 3300053096 Bacteria 164908
2488 Ga0500641_0000164 3300053096 Bacteria 24825
2489 Ga0500641_0000293 3300053096 Bacteria 18720
2490 Ga0500658_0000005 3300053134 Bacteria 369268
2491 Ga0500634_0030676 3300053161 Bacteria 2929
2492 Ga0501084_0006998 3300054114 Bacteria 9295
2493 Ga0501082_0004682 3300060353 Bacteria 11930
2494 Ga0501082_0043387 3300060353 Bacteria 3878
2495 Ga0501082_0070194 3300060353 Bacteria 3017
2496 Ga0501082_0169480 3300060353 Bacteria 1898
2497 Ga0530510_0006988 3300061734 Bacteria 7862
2498 2506580899 2506520007 Bacteria 5442880
2499 2506586038 2506520008 Bacteria 5443009
2500 2508854700 2508501071 Bacteria 5454741
2501 2511233647 2511231000 Bacteria 4488346
2502 2511265000 2511231006 Bacteria 6794709
2503 2511276337 2511231008 Bacteria 6624100
2504 2511287761 2511231010 Bacteria 6373152
2505 2511295291 2511231011 Bacteria 6149768
2506 2511299616 2511231012 Bacteria 6738011
2507 2511315849 2511231014 Bacteria 6462302
2508 2511323229 2511231015 Bacteria 6598026
2509 2511335015 2511231017 Bacteria 6503007
2510 2511338309 2511231018 Bacteria 6436256
2511 2511343096 2511231019 Bacteria 6520662
2512 2511351663 2511231020 Bacteria 6115223
2513 2511356023 2511231021 Bacteria 7302637
2514 2511367318 2511231023 Bacteria 6808468
2515 2511374088 2511231024 Bacteria 5835885
2516 2511411458 2511231031 Bacteria 6558529
2517 2512324668 2512047018 Bacteria 6663241
2518 2513234026 2513020052 Bacteria 5120511
2519 2513955353 2513237150 Bacteria 6553639
2520 2514040681 2513237165 Bacteria 6771773
2521 2524000831 2523533628 Bacteria 4098242
2522 2526213468 2526164512 Bacteria 4025691
2523 2538424584 2537561728 Bacteria 5149301
2524 2547695109 2547132181 Bacteria 4945084
2525 2548500085 2547132374 Bacteria 5530232
2526 2548648835 2547132416 Bacteria 4633861
2527 2548846075 2547132512 Bacteria 3416496
2528 2550901297 2548877040 Bacteria 7507281
2529 2552746275 2551306352 Bacteria 3873115
2530 2554817561 2554235132 Bacteria 6772433
2531 2555245668 2554235231 Bacteria 5215788
2532 2555672260 2554235341 Bacteria 6867980
2533 2562463025 2561511199 Bacteria 5155034
2534 2571528154 2571042143 Bacteria 6986194
2535 2574431783 2574179768 Bacteria 4907129
2536 2578457085 2576861471 Bacteria 4648976
2537 2583794773 2582580891 Bacteria 6800976
2538 2585141201 2582581278 Bacteria 5296881
2539 2585426165 2582581873 Bacteria 3032664
2540 2585825999 2585427591 Bacteria 5482980
2541 2585831783 2585427592 Bacteria 5370892
2542 2588211164 2585428182 Bacteria 5007281
2543 2588215547 2585428183 Bacteria 5166119
2544 2588218969 2585428184 Bacteria 4978681
2545 2588224461 2585428185 Bacteria 4969476
2546 2597860339 2597489887 Bacteria 6666321
2547 2597866072 2597489888 Bacteria 6179543
2548 2597871906 2597489889 Bacteria 6297495
2549 2599358304 2599185160 Bacteria 6844013
2550 2599364653 2599185161 Bacteria 6960462
2551 2599370811 2599185162 Bacteria 6957254
2552 2599376833 2599185163 Bacteria 6995158
2553 2599383469 2599185164 Bacteria 6841688
2554 2599389916 2599185165 Bacteria 6843250
2555 2599396199 2599185166 Bacteria 6959206
2556 2599401459 2599185167 Bacteria 6353609
2557 2599408039 2599185168 Bacteria 6997636
2558 2599410951 2599185169 Bacteria 5441380
2559 2599453146 2599185179 Bacteria 6611171
2560 2599465119 2599185181 Bacteria 6844519
2561 2599471428 2599185182 Bacteria 6883168
2562 2599486819 2599185185 Bacteria 6652270
2563 2599493966 2599185186 Bacteria 6831633
2564 2599509900 2599185189 Bacteria 5862825
2565 2599515149 2599185190 Bacteria 6285678
2566 2599520315 2599185191 Bacteria 6297582
2567 2599807057 2599185257 Bacteria 6492581
2568 2599881751 2599185288 Bacteria 6666191
2569 2599894529 2599185290 Bacteria 6289611
2570 2599904262 2599185292 Bacteria 6290804
2571 2599949376 2599185303 Bacteria 6512725
2572 2600217853 2599185356 Bacteria 6843884
2573 2600367147 2600254931 Bacteria 6734225
2574 2600445494 2600254954 Bacteria 5100516
2575 2601521581 2600255254 Bacteria 5281859
2576 2601526606 2600255255 Bacteria 5282785
2577 2601535199 2600255256 Bacteria 5597742
2578 2601540762 2600255257 Bacteria 5597196
2579 2601613436 2600255280 Bacteria 5292309
2580 2601622339 2600255281 Bacteria 5288753
2581 2601643146 2600255287 Bacteria 5210468
2582 2601650375 2600255288 Bacteria 5282738
2583 2601655664 2600255289 Bacteria 5281907
2584 2601656911 2600255290 Bacteria 5282218
2585 2601662967 2600255291 Bacteria 5217298
2586 2601672246 2600255292 Bacteria 6300551
2587 2601693993 2600255296 Bacteria 5784754
2588 2601695926 2600255298 Bacteria 5215185
2589 2601700600 2600255299 Bacteria 5218662
2590 2601704708 2600255300 Bacteria 5287774
2591 2601709737 2600255301 Bacteria 5280532
2592 2601714749 2600255302 Bacteria 5288235
2593 2601720951 2600255303 Bacteria 5219315
2594 2601725155 2600255304 Bacteria 5283973
2595 2601729697 2600255305 Bacteria 5282329
2596 2601734714 2600255306 Bacteria 5281613
2597 2601743660 2600255307 Bacteria 5439064
2598 2601753208 2600255309 Bacteria 5431045
2599 2601758381 2600255310 Bacteria 5600903
2600 2601764490 2600255311 Bacteria 5598766
2601 2601778020 2600255313 Bacteria 6842543
2602 2601800438 2600255318 Bacteria 6383414
2603 2602009903 2600255389 Bacteria 5275336
2604 2602020943 2600255392 Bacteria 5437392
2605 2603638259 2602042046 Bacteria 5483348
2606 2603642783 2602042047 Bacteria 4697674
2607 2603660341 2602042052 Bacteria 5215873
2608 2603665616 2602042053 Bacteria 5214361
2609 2603698174 2602042066 Bacteria 4423871
2610 2603703385 2602042067 Bacteria 4863713
2611 2603837070 2602042103 Bacteria 5284714
2612 2603842146 2602042104 Bacteria 5281639
2613 2603847219 2602042105 Bacteria 5282303
2614 2603852289 2602042106 Bacteria 5282744
2615 2603864507 2602042109 Bacteria 5152801
2616 2603870343 2602042110 Bacteria 5283285
2617 2603875357 2602042111 Bacteria 5212080
2618 2606047534 2603880178 Bacteria 5283018
2619 2606070047 2603880184 Bacteria 5217896
2620 2606078754 2603880185 Bacteria 6379190
2621 2606125586 2603880199 Bacteria 6377649
2622 2606145963 2603880202 Bacteria 5284684
2623 2606174935 2603880211 Bacteria 5284226
2624 2608382766 2606217733 Bacteria 6360972
2625 2609910176 2609459761 Bacteria 5513740
2626 2621297385 2619619299 Bacteria 6649820
2627 2624482853 2623620443 Bacteria 6427864
2628 2637225797 2636415599 Bacteria 5718434
2629 2640733423 2639762793 Bacteria 3943681
2630 2643844773 2643221565 Bacteria 6216018
2631 2643859411 2643221569 Bacteria 6064337
2632 2643869668 2643221571 Bacteria 6228673
2633 2643957539 2643221589 Bacteria 6250934
2634 2643979682 2643221594 Bacteria 5811388
2635 2643991236 2643221596 Bacteria 5006805
2636 2643997954 2643221598 Bacteria 4578346
2637 2644025653 2643221602 Bacteria 6249926
2638 2644028419 2643221603 Bacteria 6147767
2639 2644059856 2643221609 Bacteria 6756331
2640 2644074514 2643221611 Bacteria 6820941
2641 2644123172 2643221621 Bacteria 6212786
2642 2644293889 2643221652 Bacteria 5140275
2643 2644365284 2643221665 Bacteria 4699229
2644 2644371872 2643221667 Bacteria 5627472
2645 2644468948 2643221683 Bacteria 5749203
2646 2644625378 2643221713 Bacteria 6554480
2647 2644644597 2643221717 Bacteria 5676132
2648 2656276733 2654587920 Bacteria 5475511
2649 2671100825 2667528171 Bacteria 6900659
2650 2671103315 2667528172 Bacteria 5170840
2651 2671109515 2667528173 Bacteria 5375747
2652 2671585358 2671180115 Bacteria 5353919
2653 2671773385 2671180172 Bacteria 6495783
2654 2676407944 2675903046 Bacteria 5451247
2655 2677895792 2675903420 Bacteria 6247433
2656 2678230459 2675903507 Bacteria 3737791
2657 2681997550 2681812866 Bacteria 4552357
2658 2682006940 2681812869 Bacteria 5014465
2659 2689447450 2687453601 Bacteria 5546041
2660 2712469617 2711768156 Bacteria 4471618
2661 2715752288 2713897148 Bacteria 5883533
2662 2715759028 2713897149 Bacteria 6506249
2663 2718636067 2718217725 Bacteria 5758958
2664 2722728454 2721755487 Bacteria 6357185
2665 2722882349 2721755523 Bacteria 6430384
2666 2723250808 2721755607 Bacteria 5841722
2667 2728534705 2728368933 Bacteria 7044283
2668 2729144979 2728369097 Bacteria 4333476
2669 2738672890 2738541265 Bacteria 6594665
2670 2738719715 2738541277 Bacteria 7458140
2671 2738735575 2738541279 Bacteria 6149495
2672 2738751283 2738541282 Bacteria 6593925
2673 2738760550 2738541284 Bacteria 5199923
2674 2738810303 2738541294 Bacteria 6925949
2675 2738860324 2738541303 Bacteria 6591772
2676 2738879867 2738541307 Bacteria 8606193
2677 2738897663 2738541309 Bacteria 6926455
2678 2739198207 2738543004 Bacteria 6381073
2679 2739241390 2738543012 Bacteria 7115078
2680 2739260971 2738543015 Bacteria 6750701
2681 2739278914 2738543019 Bacteria 7459457
2682 2739316406 2738543025 Bacteria 6600348
2683 2739609964 2739367655 Bacteria 4051151
2684 2740003672 2739367857 Bacteria 5433684
2685 2740008489 2739367858 Bacteria 5432813
2686 2740991516 2740891818 Bacteria 6711283
2687 2743739881 2740892503 Bacteria 6855563
2688 2745161558 2744054655 Bacteria 3552603
2689 2747949200 2747842428 Bacteria 4689383
2690 2753673910 2751185877 Bacteria 4921427
2691 2753855628 2751185917 Bacteria 4551186
2692 2765575329 2765235839 Bacteria 5314748
2693 2765580410 2765235840 Bacteria 4663337
2694 2765581874 2765235841 Bacteria 6137024
2695 2765588610 2765235842 Bacteria 4799256
2696 2772441264 2772190666 Bacteria 5117644
2697 2772603365 2772190705 Bacteria 4666226
2698 2774137004 2773857673 Bacteria 6513460
2699 2774388990 2773857761 Bacteria 3837365
2700 2774439187 2773857770 Bacteria 3911866
2701 2775538616 2775506706 Bacteria 4873073
2702 2775674624 2775506739 Bacteria 3855222
2703 2777023647 2775507074 Bacteria 5532402
2704 2784262367 2784132063 Bacteria 6262788
2705 2792311384 2791355010 Bacteria 4864581
2706 2793405811 2791355275 Bacteria 4429597
2707 2807410270 2806310737 Bacteria 5751088
2708 2807458618 2806310745 Bacteria 5742165
2709 2808906636 2808606373 Bacteria 4423627
2710 2808959267 2808606382 Bacteria 6841132
2711 2808977663 2808606385 Bacteria 6711065
2712 2808992679 2808606388 Bacteria 6706662
2713 2809033587 2808606395 Bacteria 6020352
2714 2809219325 2808606445 Bacteria 6057339
2715 2812368737 2811994881 Bacteria 6298475
2716 2813729293 2811995292 Bacteria 5303342
2717 2814696803 2814123068 Bacteria 5687681
2718 2816473554 2816332133 Bacteria 7249298
2719 2816875185 2816332188 Bacteria 5133218
2720 2817493506 2816332298 Bacteria 6852809
2721 2819659143 2818991456 Bacteria 6123676
2722 2819706493 2818991464 Bacteria 6907494
2723 2821119433 2821118458 Bacteria 4714306
2724 2823374398 2823373977 Bacteria 4779415
2725 2823424253 2823421272 Bacteria 5372474
2726 2833641470 2833640130 Bacteria 4858325
2727 2834033291 2834028612 Bacteria 6354979
2728 2834642450 2834641062 Bacteria 5559922
2729 2839138204 2839138175 Bacteria 6549354
2730 2842719116 2842718218 Bacteria 4560148
2731 2842735747 2842733646 Bacteria 5716726
2732 2842831553 2842826826 Bacteria 5974129
2733 2842837014 2842832357 Bacteria 5959113
2734 2842840376 2842837860 Bacteria 6066181
2735 2842847753 2842843487 Bacteria 6004777
2736 2842906550 2842903701 Bacteria 6986368
2737 2844427170 2844425489 Bacteria 4854065
2738 2844666432 2844665904 Bacteria 6817974
2739 2846540833 2846540461 Bacteria 5471451
2740 2847089452 2847085930 Bacteria 5070450
2741 2852105597 2852103415 Bacteria 5193810
2742 2852618200 2852612431 Bacteria 6885235
2743 2852629990 2852627209 Bacteria 5896285
2744 2852652221 2852649853 Bacteria 4036942
2745 2852660978 2852657418 Bacteria 6472974
2746 2852673258 2852667396 Bacteria 6885555
2747 2855196763 2855195626 Bacteria 4927512
2748 2857537930 2857537821 Bacteria 5248181
2749 2857549278 2857547612 Bacteria 6179999
2750 2857622345 2857618242 Bacteria 5635925
2751 2858468271 2858466076 Bacteria 4722413
2752 2858689645 2858688981 Bacteria 8184122
2753 2858954321 2858950400 Bacteria 6783797
2754 2860872492 2860867994 Bacteria 5645326
2755 2869556885 2869551831 Bacteria 5474685
2756 2871277102 2871272651 Bacteria 5042015
2757 2871284203 2871282230 Bacteria 4917173
2758 2871723260 2871720351 Bacteria 4862476
2759 2878034786 2878029506 Bacteria 6418441
2760 2880235435 2880230671 Bacteria 6140320
2761 2881102121 2881101125 Bacteria 4590519
2762 2881930877 2881927736 Bacteria 3993927
2763 2884089295 2884086401 Bacteria 5005459
2764 2885083344 2885080285 Bacteria 6355622
2765 2887378546 2887375801 Bacteria 5334027
2766 2888371384 2888366609 Bacteria 5155009
2767 2888375968 2888373701 Bacteria 5098052
2768 2889294133 2889290771 Bacteria 5530962
2769 2890738535 2890737413 Bacteria 4269751
2770 2891637377 2891633521 Bacteria 4602265
2771 2891674988 2891670763 Bacteria 4967099
2772 2894024503 2894023352 Bacteria 5167372
2773 2895499680 2895498888 Bacteria 5283788
2774 2895512704 2895511927 Bacteria 6802080
2775 2895522718 2895522137 Bacteria 3284416
2776 2895525520 2895525241 Bacteria 3388457
2777 2896317870 2896317667 Bacteria 4606601
2778 2896344954 2896344016 Bacteria 3811746
2779 2898715498 2898713307 Bacteria 4110805
2780 2900055155 2900051742 Bacteria 4985156
2781 2901312169 2901300506 Bacteria 8463898
2782 2902683152 2902682994 Bacteria 8951596
2783 2904477933 2904474040 Bacteria 5504324
2784 2904482524 2904479285 Bacteria 5073931
2785 2904513349 2904513164 Bacteria 5476410
2786 2904523003 2904518522 Bacteria 6068986
2787 2904548827 2904541872 Bacteria 8915136
2788 2904785224 2904780799 Bacteria 5840761
2789 2908452014 2908446538 Bacteria 6829095
2790 2908671584 2908669403 Bacteria 5740494
2791 2912964494 2912963787 Bacteria 5646108
2792 2916701642 2916699645 Bacteria 3568996
2793 2917076141 2917070673 Bacteria 6868303
2794 2919067833 2919063839 Bacteria 6302690
2795 2919098240 2919097161 Bacteria 3860339
2796 2919112104 2919108558 Bacteria 5897419
2797 2919154103 2919150387 Bacteria 5500879
2798 2919159419 2919155634 Bacteria 4860545
2799 2919181034 2919177583 Bacteria 5641607
2800 2919185246 2919182534 Bacteria 3907101
2801 2919390720 2919385768 Bacteria 5897293
2802 2919401571 2919399522 Bacteria 5164947
2803 2919491000 2919487758 Bacteria 5929766
2804 2919496084 2919493220 Bacteria 4598500
2805 2919503980 2919501602 Bacteria 5286340
2806 2919509409 2919506607 Bacteria 3392955
2807 2919512668 2919509842 Bacteria 4104664
2808 2919544362 2919543075 Bacteria 4728703
2809 2919685232 2919683626 Bacteria 5534354
2810 2919705080 2919704043 Bacteria 5560311
2811 2923158971 2923153595 Bacteria 6870622
2812 2923522802 2923519811 Bacteria 6298479
2813 2923527880 2923525760 Bacteria 4472324
2814 2923634494 2923634449 Bacteria 4753480
2815 2926065447 2926063275 Bacteria 5285848
2816 2927147640 2927143783 Bacteria 5504251
2817 2927834449 2927833300 Bacteria 4923934
2818 2928515810 2928515477 Bacteria 4448421
2819 2929150956 2929150217 Bacteria 5462483
2820 2929166756 2929160207 Bacteria 9075316
2821 2929194597 2929189879 Bacteria 5930554
2822 2931395881 2931390751 Bacteria 6273349
2823 2932416325 2932410948 Bacteria 6312192
2824 2932422282 2932416698 Bacteria 6315112
2825 2935359565 2935353572 Unclassified 6955622
2826 2935626959 2935625433 Bacteria 5042964
2827 2937543091 2937539931 Bacteria 4639830
2828 2937968928 2937967321 Bacteria 5094075
2829 2939573926 2939573065 Bacteria 4926053
2830 2939607787 2939607340 Bacteria 4719256
2831 2939619297 2939617950 Bacteria 4820956
2832 2939635087 2939631187 Bacteria 6118131
2833 2939641778 2939636861 Bacteria 6297853
2834 2939644127 2939642701 Bacteria 4475280
2835 2939652002 2939651529 Bacteria 5895393
2836 2939661793 2939660829 Bacteria 3784848
2837 2941478844 2941475908 Bacteria 4145589
2838 2941484157
2839 2945877378 2945874760 Bacteria 5527237
2840 2945931444 2945928738 Bacteria 6053221
2841 2945966234 2945961074 Bacteria 7342064
2842 2946007504 2946006987 Bacteria 6705746
2843 2946033093 2946027586 Bacteria 6049274
2844 2947233862 2947233263 Bacteria 6439278
2845 2969082795 2969079654 Bacteria 5439582
2846 2969309604 2969304461 Bacteria 6601805
2847 2971824133 2971820967 Bacteria 5823634
2848 2974294664 2974289157 Bacteria 6080362
2849 2974312472 2974310843 Bacteria 4947816
2850 2974324244 2974320154 Bacteria 4571377
2851 2974438174 2974435778 Bacteria 4876478
2852 2984287197 2984286254 Bacteria 6702062
2853 2984559860 2984559226 Bacteria 5683096
2854 2984568936 2984568884 Bacteria 3884413
2855 2984597941 2984595703 Bacteria 5682994
2856 2987608694 2987605356 Bacteria 4187822
2857 2990198084 2990196909 Bacteria 4054280
2858 2990711680 2990710928 Bacteria 5002431
2859 2998144854 2998139840 Bacteria 6073514
2860 3000378672 3000376612 Bacteria 4705565
2861 3003235361 3003233435 Bacteria 4458031
2862 3007254234 3007252601 Bacteria 4559114
2863 3007317024 3007315729 Bacteria 5076637
2864 3007398595 3007395558 Bacteria 6755444
2865 3007420407 3007419365 Bacteria 7026924
2866 3007615241 3007614139 Bacteria 6053559
2867 3007621071 3007619802 Bacteria 6411688
2868 3007722243 3007718800 Bacteria 5971527
2869 3007806442 3007803356 Bacteria 5931491
2870 3007860062 3007855910 Bacteria 5637581
2871 3007866312 3007861166 Bacteria 6045338
2872 3007876176 3007872151 Bacteria 5268868
2873 640486892 640427133 Bacteria 4567418
2874 640940258 640753048 Bacteria 5495657
2875 644751668 644736347 Bacteria 6476522
2876 651174748 651053060 Bacteria 4689946
2877 8002394749 8002392321 Bacteria 4159911
2878 8003403436 8003400568 Bacteria 5535898
2879 8004593943 8004592986 Bacteria 5122074
2880 8011353816 8011350971 Bacteria 6158957
2881 8015395120 8015394850 Bacteria 5064660
2882 8015693057 8015687852 Bacteria 6613826
2883 8018408501 8018405270 Bacteria 4978981
2884 8019506181 8019504834 Bacteria 4819156
2885 8019771408 8019769354 Bacteria 6924660
2886 8029996041 8029995093 Bacteria 5990776
2887 8033233816 8033232454 Bacteria 3202805
2888 8034965719 8034962539 Bacteria 4884839
2889 8048747787 8048746797 Bacteria 3557226
2890 8052499273 8052494512 Bacteria 5765634
2891 8054288887 8054285046 Bacteria 6919322
2892 8054353067 8054347763 Bacteria 5901107
2893 8054468194 8054465665 Bacteria 7323556
2894 8054508386 8054503363 Bacteria 6101651
2895 8054847276 8054844752 Bacteria 4450330
2896 8054854220 8054849141 Bacteria 5232694
2897 8054932309 8054929484 Bacteria 5599761
2898 8055091117 8055087960 Bacteria 4784273
2899 8055094385 8055092621 Bacteria 4873875
2900 8055099799 8055097453 Bacteria 4865496
2901 8055229119 8055225921 Bacteria 3341787
2902 8055698154 8055693939 Bacteria 4772047
2903 8055776304 8055770955 Bacteria 6827675
2904 8055823339 8055817908 Bacteria 6609162
2905 8055882715 8055878733 Bacteria 5907058
2906 8056120617 8056115690 Bacteria 5527654
2907 8056121557 8056120720 Bacteria 5758328
2908 8056131068 8056125926 Bacteria 6228218
2909 8056136744 8056131705 Bacteria 6107031
2910 8056142261 8056137416 Bacteria 6147080
2911 8056150567 8056148874 Bacteria 6479865
2912 8056163052 8056161164 Bacteria 6106669
2913 8056171714 8056166840 Bacteria 5820959
2914 8056179129 8056177738 Bacteria 6748268
2915 8056440793 8056440228 Bacteria 4946504
2916 8056571882 8056569372 Bacteria 5997322
2917 8057308943 8057304971 Bacteria 4649742
2918 8057805142 8057798959 Bacteria 6713499
2919 Ga0496114_0000009
2920 SwRhRL2b_contig_1215741
2921 MBSR1b_contig_7611668
2922 CNXas_1000011
2923 JGI24741J21665_1000421
2924 JGI24033J26618_1000723
2925 JGI24751J29686_10001414
2926 JGI24751J29686_10007421
2927 JGI25162J39368_1001029
2928 JGI25163J39215_1000205
2929 JGI25163J39215_1000395
2930 JGI25164J39214_1000008
2931 JGI25164J39214_1000550
2932 JGI25406J46586_10013161
2933 JGI25406J46586_10015249
2934 JGI25165J46597_1000391
2935 rootH2_10055948
2936 rootL2_10170469
2937 Ga0006562J51391_1009174
2938 Ga0006562J51391_1013379
2939 Ga0055538_1000014
2940 Ga0055538_1000065
2941 Ga0055539_1000020
2942 Ga0055539_1000099
2943 Ga0055533_1000027
2944 Ga0055533_1000109
2945 Ga0055532_1000094
2946 Ga0055525_1000032
2947 Ga0055525_1000143
2948 Ga0055535_1005097
2949 Ga0055526_1000233
2950 Ga0055526_1002689
2951 Ga0055524_1000159
2952 Ga0055536_1000059
2953 Ga0055536_1001131
2954 Ga0055536_1004497
2955 Ga0055536_1004850
2956 Ga0055534_1009665
2957 Ga0055530_10001818
2958 Ga0055530_10002957
2959 Ga0055530_10005896
2960 Ga0055540_1000023
2961 Ga0055540_1000084
2962 Ga0055540_1003017
2963 Ga0055540_1005110
2964 Ga0055531_10000213
2965 Ga0055531_10005322
2966 Ga0055541_1000014
2967 Ga0055541_1000066
2968 Ga0058692_1000014
2969 Ga0058692_1000796
2970 Ga0058692_1001239
2971 Ga0058692_1003345
2972 Ga0058692_1003397
2973 Ga0058692_1003486
2974 Ga0058692_1004114
2975 Ga0065165_1000539
2976 Ga0065703_1018772
2977 Ga0065703_1019024
2978 Ga0065714_10002224
2979 Ga0065714_10002661
2980 Ga0065714_10002760
2981 Ga0065714_10003556
2982 Ga0065714_10064639
2983 Ga0065714_10067571
2984 Ga0065714_10068318
2985 Ga0065714_10070672
2986 Ga0065714_10084095
2987 Ga0065714_10100057
2988 Ga0065714_10101317
2989 Ga0065704_10000562
2990 Ga0065704_10002082
2991 Ga0065704_10003382
2992 Ga0065704_10078770
2993 Ga0065704_10082107
2994 Ga0065704_10084957
2995 Ga0065704_10135794
2996 Ga0065712_10117391
2997 Ga0065715_10001484
2998 Ga0065715_10019057
2999 Ga0065715_10026204
3000 Ga0065715_10126408
3001 Ga0065707_10008614
3002 Ga0065707_10121134
3003 Ga0065707_10136519
3004 Ga0065707_10144561
3005 Ga0070676_10003061
3006 Ga0070676_10015658
3007 Ga0070676_10050231
3008 Ga0070676_10093862
3009 Ga0070683_100037047
3010 Ga0070683_100087539
3011 Ga0070683_100140797
3012 Ga0070690_100009715
3013 Ga0070690_100080595
3014 Ga0070690_100125984
3015 Ga0070670_100000189
3016 Ga0070670_100007325
3017 Ga0070670_100009786
3018 Ga0070670_100017994
3019 Ga0070670_100019496
3020 Ga0070670_100081900
3021 Ga0070670_100101339
3022 Ga0070670_100149293
3023 Ga0068869_100101382
3024 Ga0070666_10006496
3025 Ga0070666_10048619
3026 Ga0070680_100004033
3027 Ga0070680_100076216
3028 Ga0070682_100000015
3029 Ga0070682_100001862
3030 Ga0070682_100014412
3031 Ga0070682_100028533
3032 Ga0068868_100002429
3033 Ga0068868_100054873
3034 Ga0070660_100008148
3035 Ga0070660_100143983
3036 Ga0070689_100006764
3037 Ga0070689_100045716
3038 Ga0070689_100054345
3039 Ga0070689_100079510
3040 Ga0070689_100119361
3041 Ga0070689_100149461
3042 Ga0070691_10029888
3043 Ga0070687_100059499
3044 Ga0070661_100001680
3045 Ga0070692_10083966
3046 Ga0070668_100020911
3047 Ga0070668_100185899
3048 Ga0070669_100000002
3049 Ga0070669_100002540
3050 Ga0070669_100005374
3051 Ga0070669_100007453
3052 Ga0070669_100010572
3053 Ga0070669_100038114
3054 Ga0070675_100021663
3055 Ga0070675_100033490
3056 Ga0070675_100034683
3057 Ga0070675_100059434
3058 Ga0070675_100147001
3059 Ga0070671_100002469
3060 Ga0070671_100012326
3061 Ga0070671_100025279
3062 Ga0070671_100045314
3063 Ga0070671_100068159
3064 Ga0070671_100083951
3065 Ga0070671_100086392
3066 Ga0070674_100003746
3067 Ga0070674_100008167
3068 Ga0070674_100085340
3069 Ga0070673_100027228
3070 Ga0070673_100029158
3071 Ga0070673_100033180
3072 Ga0070673_100057777
3073 Ga0070673_100153400
3074 Ga0070688_100008929
3075 Ga0070688_100110024
3076 Ga0070659_100025516
3077 Ga0070659_100027673
3078 Ga0070659_100034003
3079 Ga0070667_100035493
3080 Ga0070667_100052614
3081 Ga0070703_10020319
3082 Ga0070709_10001725
3083 Ga0070709_10002168
3084 Ga0070709_10103649
3085 Ga0070714_100000060
3086 Ga0070714_100000531
3087 Ga0070714_100004116
3088 Ga0070713_100001174
3089 Ga0070713_100007027
3090 Ga0070713_100023927
3091 Ga0070713_100027544
3092 Ga0070713_100047633
3093 Ga0070713_100171450
3094 Ga0070710_10005313
3095 Ga0070701_10004411
3096 Ga0070701_10006353
3097 Ga0070711_100005895
3098 Ga0070711_100158986
3099 Ga0070705_100056768
3100 Ga0070700_100004050
3101 Ga0070700_100088227
3102 Ga0070694_100020058
3103 Ga0070708_100018696
3104 Ga0070708_100019125
3105 Ga0070708_100021917
3106 Ga0070708_100032717
3107 Ga0070708_100079345
3108 Ga0070708_100090608
3109 Ga0070708_100291261
3110 Ga0070663_100070110
3111 Ga0070678_100023462
3112 Ga0070678_100081831
3113 Ga0070678_100089453
3114 Ga0070662_100001386
3115 Ga0070662_100026299
3116 Ga0070662_100105116
3117 Ga0070681_10000172
3118 Ga0070681_10000495
3119 Ga0070681_10022247
3120 Ga0070681_10027448
3121 Ga0070681_10085711
3122 Ga0070681_10124630
3123 Ga0068867_100026060
3124 Ga0070685_10003429
3125 Ga0070706_100000060
3126 Ga0070706_100001072
3127 Ga0070706_100007318
3128 Ga0070706_100008244
3129 Ga0070706_100011145
3130 Ga0070706_100025389
3131 Ga0070706_100033458
3132 Ga0070706_100035898
3133 Ga0070706_100060806
3134 Ga0070706_100062989
3135 Ga0070707_100034163
3136 Ga0070707_100036019
3137 Ga0070707_100038068
3138 Ga0070707_100042560
3139 Ga0070707_100048349
3140 Ga0070707_100049763
3141 Ga0070707_100061094
3142 Ga0070707_100109597
3143 Ga0070698_100001426
3144 Ga0070698_100005312
3145 Ga0070698_100008064
3146 Ga0070698_100008930
3147 Ga0070698_100014479
3148 Ga0070698_100025959
3149 Ga0070698_100027732
3150 Ga0070698_100034898
3151 Ga0070698_100199202
3152 Ga0070699_100006077
3153 Ga0070699_100006860
3154 Ga0070699_100011665
3155 Ga0070699_100043920
3156 Ga0070699_100051172
3157 Ga0070699_100091272
3158 Ga0070699_100103345
3159 Ga0070699_100210724
3160 Ga0070699_100243734
3161 Ga0070684_100002299
3162 Ga0070697_100002882
3163 Ga0070697_100012468
3164 Ga0070697_100129784
3165 Ga0070697_100134395
3166 Ga0070697_100214454
3167 Ga0068853_100001735
3168 Ga0068853_100117004
3169 Ga0070672_100003894
3170 Ga0070672_100005318
3171 Ga0070672_100028350
3172 Ga0070686_100065481
3173 Ga0070696_100028410
3174 Ga0070696_100111662
3175 Ga0070693_100011413
3176 Ga0070665_100005369
3177 Ga0070665_100096789
3178 Ga0070665_100235460
3179 Ga0070704_100000472
3180 Ga0070704_100174140
3181 Ga0068855_100026120
3182 Ga0068855_100090625
3183 Ga0068855_100113023
3184 Ga0068855_100194281
3185 Ga0068855_100335573
3186 Ga0070664_100000749
3187 Ga0070664_100002405
3188 Ga0068857_100003295
3189 Ga0068857_100074806
3190 Ga0068854_100004716
3191 Ga0068854_100146062
3192 Ga0068856_100001235
3193 Ga0068856_100062067
3194 Ga0068856_100068869
3195 Ga0068856_100224725
3196 Ga0068852_100103199
3197 Ga0068859_100000021
3198 Ga0068859_100026993
3199 Ga0068859_100036793
3200 Ga0068859_100053293
3201 Ga0068859_100168190
3202 Ga0068864_100038194
3203 Ga0068861_100009201
3204 Ga0068851_10000002
3205 Ga0068863_100004355
3206 Ga0068863_100138624
3207 Ga0068863_100173707
3208 Ga0068858_100001664
3209 Ga0068858_100192582
3210 Ga0068860_100011657
3211 Ga0068860_100094445
3212 Ga0068860_100145563
3213 Ga0068862_100000907
3214 Ga0068862_100016065
3215 Ga0068862_100064830
3216 Ga0068862_100073044
3217 Ga0081455_10005178
3218 Ga0081455_10006550
3219 Ga0081455_10011929
3220 Ga0081455_10014792
3221 Ga0081455_10065679
3222 Ga0081538_10039199
3223 Ga0081539_10000403
3224 Ga0081539_10001964
3225 Ga0081539_10007470
3226 Ga0081539_10034847
3227 Ga0081539_10043424
3228 Ga0070717_10008912
3229 Ga0070717_10044430
3230 Ga0070717_10061999
3231 Ga0075368_10000340
3232 Ga0075364_10011474
3233 Ga0075364_10018889
3234 Ga0075364_10058625
3235 Ga0075432_10001455
3236 Ga0075432_10003602
3237 Ga0075432_10023012
3238 Ga0075432_10023990
3239 Ga0075432_10024517
3240 Ga0070715_10003585
3241 Ga0070716_100000137
3242 Ga0070716_100017145
3243 Ga0070716_100026127
3244 Ga0070716_100041663
3245 Ga0070716_100042413
3246 Ga0070716_100074147
3247 Ga0070716_100136924
3248 Ga0070712_100000057
3249 Ga0070712_100000154
3250 Ga0070712_100001792
3251 Ga0070712_100004923
3252 Ga0070712_100006229
3253 Ga0075362_10003824
3254 Ga0075362_10038665
3255 Ga0075369_10010212
3256 Ga0075427_10002640
3257 Ga0097621_100005910
3258 Ga0068871_100015542
3259 Ga0068871_100209699
3260 Ga0075428_100001508
3261 Ga0075428_100004126
3262 Ga0075428_100006849
3263 Ga0075428_100024446
3264 Ga0075428_100049140
3265 Ga0075428_100077354
3266 Ga0075428_100107266
3267 Ga0075430_100004750
3268 Ga0075430_100045750
3269 Ga0075431_100004236
3270 Ga0075431_100015576
3271 Ga0075431_100016188
3272 Ga0075431_100016399
3273 Ga0075431_100190491
3274 Ga0075431_100194569
3275 Ga0075433_10000856
3276 Ga0075433_10002698
3277 Ga0075433_10014389
3278 Ga0075433_10032336
3279 Ga0075433_10152001
3280 Ga0075433_10168316
3281 Ga0075433_10232388
3282 Ga0075434_100001763
3283 Ga0075434_100003148
3284 Ga0075434_100007797
3285 Ga0075434_100020162
3286 Ga0075434_100043160
3287 Ga0075429_100001560
3288 Ga0075429_100128339
3289 Ga0068865_100155757
3290 Ga0075436_100016359
3291 Ga0075436_100123164
3292 Ga0097620_100000021
3293 Ga0097620_100026994
3294 Ga0097620_100036795
3295 Ga0097620_100053296
3296 Ga0097620_100168190
3297 Ga0099823_1003937
3298 Ga0079104_1000002
3299 Ga0079104_1000071
3300 Ga0079104_1000156
3301 Ga0079104_1000157
3302 Ga0079104_1000707
3303 Ga0079104_1000804
3304 Ga0079104_1001098
3305 Ga0079104_1005686
3306 Ga0075435_100006566
3307 Ga0075435_100010771
3308 Ga0075435_100014550
3309 Ga0075435_100060378
3310 Ga0075435_100075483
3311 Ga0099794_10000025
3312 Ga0105251_10000230
3313 Ga0105251_10000713
3314 Ga0105251_10002968
3315 Ga0105251_10005208
3316 Ga0105251_10006896
3317 Ga0105251_10007894
3318 Ga0105251_10010179
3319 Ga0105251_10020652
3320 Ga0105244_10000005
3321 Ga0105244_10000038
3322 Ga0105244_10000287
3323 Ga0105244_10000380
3324 Ga0105244_10000900
3325 Ga0105244_10001172
3326 Ga0105244_10002028
3327 Ga0105244_10006729
3328 Ga0105244_10008634
3329 Ga0105244_10018941
3330 Ga0105244_10029149
3331 Ga0105244_10029411
3332 Ga0105244_10031344
3333 Ga0105250_10002294
3334 Ga0105250_10004947
3335 Ga0105250_10005194
3336 Ga0105250_10009457
3337 Ga0105250_10013887
3338 Ga0105250_10026095
3339 Ga0105250_10031892
3340 Ga0105240_10029012
3341 Ga0105240_10058712
3342 Ga0105240_10157301
3343 Ga0111539_10001894
3344 Ga0111539_10003743
3345 Ga0111539_10009531
3346 Ga0111539_10012199
3347 Ga0111539_10027092
3348 Ga0111539_10058473
3349 Ga0111539_10110048
3350 Ga0111539_10114668
3351 Ga0111539_10168462
3352 Ga0105245_10011710
3353 Ga0105245_10082913
3354 Ga0105245_10111168
3355 Ga0105245_10116985
3356 Ga0105245_10158585
3357 Ga0105245_10179920
3358 Ga0105245_10184047
3359 Ga0105247_10001413
3360 Ga0105247_10006981
3361 Ga0114129_10005945
3362 Ga0114129_10008249
3363 Ga0114129_10018324
3364 Ga0114129_10026057
3365 Ga0114129_10038347
3366 Ga0114129_10050450
3367 Ga0114129_10069504
3368 Ga0114129_10106461
3369 Ga0114129_10464939
3370 Ga0114129_10475494
3371 Ga0105243_10000007
3372 Ga0105243_10000048
3373 Ga0105243_10001529
3374 Ga0105243_10002094
3375 Ga0105243_10002720
3376 Ga0105243_10004604
3377 Ga0105243_10015831
3378 Ga0105243_10042741
3379 Ga0105243_10046667
3380 Ga0105243_10053681
3381 Ga0105243_10075822
3382 Ga0105243_10116769
3383 Ga0105243_10186576
3384 Ga0105241_10000013
3385 Ga0105241_10030979
3386 Ga0105241_10050628
3387 Ga0105241_10193482
3388 Ga0105242_10007107
3389 Ga0105242_10008850
3390 Ga0105242_10015408
3391 Ga0105242_10019091
3392 Ga0105242_10024669
3393 Ga0105242_10084905
3394 Ga0105242_10155692
3395 Ga0105242_10157935
3396 Ga0105248_10002310
3397 Ga0105248_10004739
3398 Ga0105248_10027355
3399 Ga0105248_10038991
3400 Ga0105248_10090133
3401 Ga0105248_10189276
3402 Ga0105248_10272889
3403 Ga0105237_10004364
3404 Ga0105237_10011045
3405 Ga0105237_10018913
3406 Ga0105237_10131801
3407 Ga0105237_10138542
3408 Ga0105238_10068203
3409 Ga0105238_10094839
3410 Ga0105238_10204885
3411 Ga0105249_10001559
3412 Ga0105249_10013235
3413 Ga0105239_10166554
3414 Ga0105246_10001472
3415 Ga0105246_10001828
3416 Ga0105246_10006800
3417 Ga0157345_1000341
3418 Ga0157373_10000016
3419 Ga0157373_10000094
3420 Ga0157373_10000158
3421 Ga0157373_10003540
3422 Ga0157373_10005904
3423 Ga0157373_10013594
3424 Ga0157373_10017496
3425 Ga0157373_10017678
3426 Ga0157373_10020808
3427 Ga0157373_10022021
3428 Ga0157373_10023034
3429 Ga0157373_10044939
3430 Ga0157373_10108123
3431 Ga0157371_10000056
3432 Ga0157371_10003173
3433 Ga0157371_10003333
3434 Ga0157371_10017174
3435 Ga0157371_10018757
3436 Ga0157371_10023729
3437 Ga0157371_10030734
3438 Ga0157371_10035887
3439 Ga0157371_10063603
3440 Ga0157370_10002149
3441 Ga0157370_10002520
3442 Ga0157370_10004138
3443 Ga0157370_10006949
3444 Ga0157370_10022805
3445 Ga0157370_10039461
3446 Ga0157370_10067570
3447 Ga0157370_10088769
3448 Ga0157370_10092036
3449 Ga0157370_10093062
3450 Ga0157369_10002012
3451 Ga0157369_10007119
3452 Ga0157369_10007270
3453 Ga0157369_10026460
3454 Ga0157369_10031368
3455 Ga0157369_10038599
3456 Ga0157369_10070399
3457 Ga0157369_10091905
3458 Ga0157369_10112452
3459 Ga0157369_10137644
3460 Ga0157369_10313026
3461 Ga0157374_10013735
3462 Ga0157374_10049162
3463 Ga0157374_10056586
3464 Ga0157374_10086823
3465 Ga0157374_10094321
3466 Ga0157374_10107312
3467 Ga0157378_10030675
3468 Ga0157378_10038076
3469 Ga0163162_10003825
3470 Ga0163162_10003912
3471 Ga0163162_10004734
3472 Ga0163162_10012289
3473 Ga0163162_10021609
3474 Ga0163162_10026444
3475 Ga0163162_10033999
3476 Ga0163162_10103350
3477 Ga0163162_10115192
3478 Ga0163162_10151284
3479 Ga0163162_10165119
3480 Ga0157372_10019838
3481 Ga0157372_10029402
3482 Ga0157372_10051174
3483 Ga0157372_10051427
3484 Ga0157372_10092413
3485 Ga0157372_10092620
3486 Ga0157372_10151887
3487 Ga0157372_10156663
3488 Ga0157375_10000576
3489 Ga0157375_10024997
3490 Ga0157375_10060947
3491 Ga0157375_10072977
3492 Ga0157375_10354262
3493 Ga0157375_10442899
3494 Ga0163163_10000071
3495 Ga0163163_10006618
3496 Ga0163163_10011041
3497 Ga0163163_10052418
3498 Ga0157380_10000020
3499 Ga0182008_10000005
3500 Ga0182008_10000008
3501 Ga0182008_10000287
3502 Ga0182008_10001232
3503 Ga0182008_10001739
3504 Ga0182008_10002163
3505 Ga0182008_10006185
3506 Ga0182008_10008061
3507 Ga0182008_10008200
3508 Ga0182008_10012007
3509 Ga0182008_10021111
3510 Ga0182008_10023807
3511 Ga0182008_10034808
3512 Ga0182008_10035331
3513 Ga0157377_10046203
3514 Ga0157377_10080988
3515 Ga0157379_10003726
3516 Ga0157379_10149854
3517 Ga0157379_10265055
3518 Ga0157376_10023599
3519 Ga0157376_10094358
3520 Ga0157376_10141868
3521 Ga0182006_1000033
3522 Ga0182006_1000047
3523 Ga0182006_1002152
3524 Ga0182006_1003239
3525 Ga0182006_1004345
3526 Ga0182006_1007907
3527 Ga0182006_1014114
3528 Ga0182006_1028816
3529 Ga0182007_10000042
3530 Ga0182007_10007143
3531 Ga0182007_10008911
3532 Ga0182007_10013674
3533 Ga0182007_10024410
3534 Ga0182005_1000024
3535 Ga0182005_1006401
3536 Ga0183366_1001
3537 Ga0183370_1001
3538 Ga0183362_10001
3539 Ga0183369_1001
3540 Ga0183368_1001
3541 Ga0163161_10000019
3542 Ga0163161_10000028
3543 Ga0163161_10001759
3544 Ga0163161_10016644
3545 Ga0163161_10062002
3546 Ga0163161_10088082
3547 Ga0163161_10089081
3548 Ga0163161_10090177
3549 Ga0163161_10098387
3550 Ga0163161_10104171
3551 Ga0163161_10119078
3552 Ga0163161_10124234
3553 Ga0213872_10011172
3554 Ga0213872_10054637
3555 Ga0213874_10024427
3556 Ga0213876_10000191
3557 Ga0209435_100675
3558 Ga0209760_100010
3559 Ga0209760_100157
3560 Ga0209784_100030
3561 Ga0209784_100101
3562 Ga0209566_100034
3563 Ga0209566_100123
3564 Ga0209674_100052
3565 Ga0209674_100145
3566 Ga0209147_100151
3567 Ga0209563_100054
3568 Ga0209563_100128
3569 Ga0209563_100722
3570 Ga0207427_100035
3571 Ga0207427_100092
3572 Ga0209437_100065
3573 Ga0209437_100068
3574 Ga0209258_100241
3575 Ga0209646_1000354
3576 Ga0209677_100032
3577 Ga0209677_100094
3578 Ga0209129_1000004
3579 Ga0209233_1000085
3580 Ga0209130_1004205
3581 Ga0209675_1000022
3582 Ga0209675_1000394
3583 Ga0209675_1007953
3584 Ga0209675_1009523
3585 Ga0209675_1010696
3586 Ga0209676_1000076
3587 Ga0209676_1000264
3588 Ga0209676_1000313
3589 Ga0209676_1000396
3590 Ga0209676_1000505
3591 Ga0209676_1000788
3592 Ga0209676_1003014
3593 Ga0209676_1005425
3594 Ga0209025_1000098
3595 Ga0209025_1000548
3596 Ga0209564_1000159
3597 Ga0209564_1000615
3598 Ga0209050_1000063
3599 Ga0209050_1000106
3600 Ga0209050_1001298
3601 Ga0209050_1005444
3602 Ga0209050_1005921
3603 Ga0209050_1008240
3604 Ga0209256_1000051
3605 Ga0209051_1000045
3606 Ga0209051_1000079
3607 Ga0209051_1000139
3608 Ga0209051_1000331
3609 Ga0209051_1017155
3610 Ga0209257_1000183
3611 Ga0209257_1000539
3612 Ga0209257_1010097
3613 Ga0209257_1021461
3614 Ga0207697_10000347
3615 Ga0207697_10002263
3616 Ga0207697_10005474
3617 Ga0207656_10000045
3618 Ga0207696_1000047
3619 Ga0207696_1000068
3620 Ga0207696_1000172
3621 Ga0207696_1000269
3622 Ga0207696_1000318
3623 Ga0207696_1002729
3624 Ga0207696_1003699
3625 Ga0207696_1003984
3626 Ga0207696_1005607
3627 Ga0207696_1006843
3628 Ga0207696_1007853
3629 Ga0207696_1015484
3630 Ga0207655_1000009
3631 Ga0207655_1000015
3632 Ga0207655_1000016
3633 Ga0207655_1000034
3634 Ga0207655_1000106
3635 Ga0207655_1000319
3636 Ga0207655_1000369
3637 Ga0207655_1000643
3638 Ga0207655_1001130
3639 Ga0207655_1001199
3640 Ga0207655_1001598
3641 Ga0207655_1001764
3642 Ga0207655_1002617
3643 Ga0207655_1002619
3644 Ga0207655_1002932
3645 Ga0207655_1003139
3646 Ga0207655_1004288
3647 Ga0207655_1008136
3648 Ga0207655_1008866
3649 Ga0207655_1010022
3650 Ga0207655_1010352
3651 Ga0207655_1012920
3652 Ga0207655_1035837
3653 Ga0207655_1038469
3654 Ga0207655_1049497
3655 Ga0207713_1000044
3656 Ga0207713_1000062
3657 Ga0207713_1000229
3658 Ga0207713_1000233
3659 Ga0207713_1002181
3660 Ga0207713_1002375
3661 Ga0207713_1002651
3662 Ga0207713_1003200
3663 Ga0207713_1003495
3664 Ga0207713_1003620
3665 Ga0207713_1004042
3666 Ga0207713_1005776
3667 Ga0207713_1006553
3668 Ga0207713_1007437
3669 Ga0207713_1010892
3670 Ga0207713_1011189
3671 Ga0207713_1011446
3672 Ga0207713_1020822
3673 Ga0207653_10000001
3674 Ga0207653_10004737
3675 Ga0207692_10010710
3676 Ga0207692_10014599
3677 Ga0207692_10026636
3678 Ga0207710_10000009
3679 Ga0207710_10000145
3680 Ga0207688_10001511
3681 Ga0207680_10017992
3682 Ga0207647_10029870
3683 Ga0207685_10004107
3684 Ga0207699_10003261
3685 Ga0207699_10003871
3686 Ga0207699_10013239
3687 Ga0207645_10000980
3688 Ga0207645_10006530
3689 Ga0207643_10000852
3690 Ga0207684_10000078
3691 Ga0207684_10000118
3692 Ga0207684_10003435
3693 Ga0207684_10012551
3694 Ga0207684_10018065
3695 Ga0207684_10019367
3696 Ga0207684_10024000
3697 Ga0207684_10028722
3698 Ga0207684_10043425
3699 Ga0207684_10148839
3700 Ga0207684_10177523
3701 Ga0207684_10193470
3702 Ga0207654_10000016
3703 Ga0207707_10009245
3704 Ga0207707_10086628
3705 Ga0207707_10139202
3706 Ga0207707_10169731
3707 Ga0207695_10015038
3708 Ga0207695_10018475
3709 Ga0207695_10070045
3710 Ga0207671_10000060
3711 Ga0207671_10071563
3712 Ga0207693_10000004
3713 Ga0207693_10000865
3714 Ga0207693_10001961
3715 Ga0207693_10013105
3716 Ga0207693_10018332
3717 Ga0207663_10001502
3718 Ga0207663_10005395
3719 Ga0207663_10068825
3720 Ga0207660_10014965
3721 Ga0207660_10121757
3722 Ga0207662_10083306
3723 Ga0207657_10001299
3724 Ga0207657_10015750
3725 Ga0207657_10033112
3726 Ga0207649_10000023
3727 Ga0207652_10077936
3728 Ga0207652_10133892
3729 Ga0207646_10003069
3730 Ga0207646_10003650
3731 Ga0207646_10003906
3732 Ga0207646_10008498
3733 Ga0207646_10026374
3734 Ga0207646_10026869
3735 Ga0207646_10035115
3736 Ga0207646_10037053
3737 Ga0207646_10061856
3738 Ga0207646_10076287
3739 Ga0207646_10106525
3740 Ga0207646_10117025
3741 Ga0207646_10144294
3742 Ga0207681_10000009
3743 Ga0207681_10000386
3744 Ga0207681_10007464
3745 Ga0207681_10008588
3746 Ga0207681_10012579
3747 Ga0207650_10000100
3748 Ga0207650_10000153
3749 Ga0207650_10003497
3750 Ga0207650_10012446
3751 Ga0207650_10025430
3752 Ga0207650_10055081
3753 Ga0207650_10196851
3754 Ga0207659_10066368
3755 Ga0207659_10189277
3756 Ga0207659_10201365
3757 Ga0207659_10250918
3758 Ga0207687_10044133
3759 Ga0207687_10048049
3760 Ga0207687_10092088
3761 Ga0207700_10000307
3762 Ga0207700_10001040
3763 Ga0207700_10049630
3764 Ga0207700_10129471
3765 Ga0207700_10190936
3766 Ga0207664_10000017
3767 Ga0207664_10007838
3768 Ga0207664_10008414
3769 Ga0207664_10044193
3770 Ga0207644_10005441
3771 Ga0207644_10014353
3772 Ga0207690_10040715
3773 Ga0207706_10000056
3774 Ga0207706_10059433
3775 Ga0207706_10228080
3776 Ga0207686_10006992
3777 Ga0207686_10010448
3778 Ga0207686_10011276
3779 Ga0207686_10150193
3780 Ga0207709_10000001
3781 Ga0207709_10000015
3782 Ga0207709_10000030
3783 Ga0207709_10000049
3784 Ga0207709_10000127
3785 Ga0207709_10000341
3786 Ga0207709_10003847
3787 Ga0207709_10006788
3788 Ga0207709_10010578
3789 Ga0207709_10010641
3790 Ga0207709_10017129
3791 Ga0207709_10038468
3792 Ga0207709_10070895
3793 Ga0207670_10016816
3794 Ga0207670_10019786
3795 Ga0207670_10033966
3796 Ga0207670_10044429
3797 Ga0207670_10045672
3798 Ga0207670_10056996
3799 Ga0207669_10003974
3800 Ga0207669_10006610
3801 Ga0207704_10189624
3802 Ga0207665_10000140
3803 Ga0207665_10003302
3804 Ga0207665_10012711
3805 Ga0207665_10024962
3806 Ga0207665_10035011
3807 Ga0207665_10061302
3808 Ga0207665_10132772
3809 Ga0207665_10192861
3810 Ga0207691_10000134
3811 Ga0207691_10001773
3812 Ga0207691_10037115
3813 Ga0207711_10023686
3814 Ga0207711_10044011
3815 Ga0207711_10077688
3816 Ga0207689_10021059
3817 Ga0207689_10070462
3818 Ga0207689_10072516
3819 Ga0207689_10103054
3820 Ga0207679_10000017
3821 Ga0207679_10011798
3822 Ga0207667_10214985
3823 Ga0207651_10002173
3824 Ga0207651_10014874
3825 Ga0207651_10018076
3826 Ga0207651_10077769
3827 Ga0207712_10001050
3828 Ga0207712_10091843
3829 Ga0207712_10125224
3830 Ga0207712_10128155
3831 Ga0207668_10021030
3832 Ga0207640_10043338
3833 Ga0207658_10022478
3834 Ga0207658_10063388
3835 Ga0207658_10169709
3836 Ga0207658_10248311
3837 Ga0207677_10000010
3838 Ga0207677_10006394
3839 Ga0207677_10009167
3840 Ga0207677_10060250
3841 Ga0207703_10000269
3842 Ga0207703_10238652
3843 Ga0207639_10006403
3844 Ga0207639_10069300
3845 Ga0207639_10122499
3846 Ga0207678_10036919
3847 Ga0207708_10002865
3848 Ga0207708_10009116
3849 Ga0207708_10067740
3850 Ga0207702_10037324
3851 Ga0207702_10043777
3852 Ga0207641_10115657
3853 Ga0207641_10260963
3854 Ga0207648_10016021
3855 Ga0207648_10032863
3856 Ga0207648_10057593
3857 Ga0207648_10067490
3858 Ga0207648_10087247
3859 Ga0207676_10008805
3860 Ga0207674_10002024
3861 Ga0207674_10002250
3862 Ga0207674_10094081
3863 Ga0207675_100001407
3864 Ga0207675_100005904
3865 Ga0207675_100009658
3866 Ga0207675_100012896
3867 Ga0207675_100062485
3868 Ga0207675_100165773
3869 Ga0207683_10002972
3870 Ga0207683_10014576
3871 Ga0207683_10053659
3872 Ga0207683_10056116
3873 Ga0207683_10067158
3874 Ga0207683_10080062
3875 Ga0207683_10140734
3876 Ga0207683_10239291
3877 Ga0207698_10037929
3878 Ga0207698_10136506
3879 Ga0209281_1000007
3880 Ga0209281_1000070
3881 Ga0209281_1000093
3882 Ga0209281_1000098
3883 Ga0209281_1000107
3884 Ga0209281_1000135
3885 Ga0209281_1000301
3886 Ga0209281_1001036
3887 Ga0209281_1001082
3888 Ga0209281_1002130
3889 Ga0209281_1005510
3890 Ga0209281_1008970
3891 Ga0209389_1000125
3892 Ga0209371_1000001
3893 Ga0209371_1000002
3894 Ga0209371_1000040
3895 Ga0209371_1000041
3896 Ga0209371_1000094
3897 Ga0209371_1000490
3898 Ga0209371_1001739
3899 Ga0209371_1005701
3900 Ga0209371_1006795
3901 Ga0209371_1008635
3902 Ga0209996_1000755
3903 Ga0209984_1000679
3904 Ga0209995_1000473
3905 Ga0209982_1004664
3906 Ga0209970_1001714
3907 Ga0209983_1001801
3908 Ga0209588_1000014
3909 Ga0209971_1000661
3910 Ga0209974_10003919
3911 Ga0209974_10011922
3912 Ga0209974_10018719
3913 Ga0207428_10004245
3914 Ga0207428_10006542
3915 Ga0207428_10017900
3916 Ga0207428_10020519
3917 Ga0207428_10021061
3918 Ga0207428_10030787
3919 Ga0207428_10037408
3920 Ga0207428_10037783
3921 Ga0207428_10066986
3922 Ga0207428_10095668
3923 Ga0207428_10150176
3924 Ga0265354_1001582
3925 Ga0268266_10009768
3926 Ga0268266_10055749
3927 Ga0268266_10175103
3928 Ga0268266_10187158
3929 Ga0268266_10233738
3930 Ga0268265_10000318
3931 Ga0268265_10024035
3932 Ga0268265_10035784
3933 Ga0268265_10122787
3934 Ga0268264_10044510
3935 Ga0268264_10159370
3936 Ga0265337_1009007
3937 Ga0265326_10000971
3938 Ga0265326_10002053
3939 Ga0265326_10002876
3940 Ga0265319_1004177
3941 Ga0265319_1012546
3942 Ga0265334_10003307
3943 Ga0265334_10003641
3944 Ga0265334_10038425
3945 Ga0265318_10000575
3946 Ga0265318_10004127
3947 Ga0265318_10009692
3948 Ga0265323_10000281
3949 Ga0265323_10000425
3950 Ga0265323_10001023
3951 Ga0265323_10037598
3952 Ga0265323_10048090
3953 Ga0265322_10000028
3954 Ga0265322_10000391
3955 Ga0265322_10000555
3956 Ga0265336_10008113
3957 Ga0307515_10010058
3958 Ga0307515_10096936
3959 Ga0265338_10000517
3960 Ga0265338_10001557
3961 Ga0265338_10003121
3962 Ga0265338_10009321
3963 Ga0265338_10012144
3964 Ga0265338_10013341
3965 Ga0265338_10017026
3966 Ga0265338_10047408
3967 Ga0265338_10060625
3968 Ga0265338_10195697
3969 Ga0265324_10000405
3970 Ga0265324_10004925
3971 Ga0268256_1000001
3972 Ga0268256_1000002
3973 Ga0268256_1000003
3974 Ga0268256_1000041
3975 Ga0268256_1000083
3976 Ga0268256_1000419
3977 Ga0268256_1001517
3978 Ga0268256_1006908
3979 Ga0268256_1009041
3980 Ga0268256_1013462
3981 Ga0307511_10072128
3982 Ga0316177_1111270
3983 Ga0316176_1067105
3984 Ga0316178_1096781
3985 Ga0316181_1228898
3986 Ga0265760_10000424
3987 Ga0265330_10000033
3988 Ga0265330_10002028
3989 Ga0265330_10002320
3990 Ga0265330_10002893
3991 Ga0265330_10003332
3992 Ga0265330_10004778
3993 Ga0265330_10005377
3994 Ga0265330_10012975
3995 Ga0265330_10038142
3996 Ga0265332_10000001
3997 Ga0265332_10000005
3998 Ga0265332_10000013
3999 Ga0265332_10001515
4000 Ga0265332_10013361
4001 Ga0265332_10020571
4002 Ga0265328_10002877
4003 Ga0265320_10006958
4004 Ga0265320_10007370
4005 Ga0265325_10000285
4006 Ga0265325_10003374
4007 Ga0265325_10004570
4008 Ga0265325_10004660
4009 Ga0265325_10007190
4010 Ga0265325_10027145
4011 Ga0265329_10000141
4012 Ga0265329_10003627
4013 Ga0265329_10017969
4014 Ga0265340_10000051
4015 Ga0265340_10006001
4016 Ga0265340_10009806
4017 Ga0265340_10010639
4018 Ga0265340_10011128
4019 Ga0265339_10000154
4020 Ga0265339_10030329
4021 Ga0265339_10031326
4022 Ga0265339_10050630
4023 Ga0265331_10006784
4024 Ga0265331_10013649
4025 Ga0265327_10000293
4026 Ga0265327_10000935
4027 Ga0265327_10002931
4028 Ga0265327_10003245
4029 Ga0265327_10009260
4030 Ga0265327_10019296
4031 Ga0265316_10000073
4032 Ga0265316_10000442
4033 Ga0265316_10000823
4034 Ga0265316_10001627
4035 Ga0265316_10003656
4036 Ga0265316_10005031
4037 Ga0265316_10005290
4038 Ga0265316_10012651
4039 Ga0265316_10016937
4040 Ga0265316_10024038
4041 Ga0265316_10051037
4042 Ga0265316_10099083
4043 Ga0265316_10121393
4044 Ga0265316_10157657
4045 Ga0265316_10191706
4046 Ga0307513_10006370
4047 Ga0307513_10033515
4048 Ga0307513_10077780
4049 Ga0307509_10089224
4050 Ga0307509_10137139
4051 Ga0307408_100000079
4052 Ga0307408_100000178
4053 Ga0307408_100000273
4054 Ga0307408_100000717
4055 Ga0307408_100017915
4056 Ga0307408_100018543
4057 Ga0307408_100077015
4058 Ga0307408_100109746
4059 Ga0265313_10004857
4060 Ga0265313_10007425
4061 Ga0265313_10008077
4062 Ga0307508_10033363
4063 Ga0316575_10000506
4064 Ga0316575_10005591
4065 Ga0316579_10002847
4066 Ga0316579_10004434
4067 Ga0316579_10005421
4068 Ga0316579_10008552
4069 Ga0316579_10011147
4070 Ga0316579_10017282
4071 Ga0316579_10029579
4072 Ga0316579_10037501
4073 Ga0316579_10054146
4074 Ga0265314_10000022
4075 Ga0265314_10000381
4076 Ga0265314_10003723
4077 Ga0265314_10008473
4078 Ga0265314_10051574
4079 Ga0265342_10000202
4080 Ga0265342_10001559
4081 Ga0265342_10003464
4082 Ga0265342_10006108
4083 Ga0265342_10008635
4084 Ga0265342_10020801
4085 Ga0265342_10026904
4086 Ga0265342_10033445
4087 Ga0265342_10077763
4088 Ga0316576_10000753
4089 Ga0316576_10002667
4090 Ga0316576_10004357
4091 Ga0316576_10005272
4092 Ga0316576_10006703
4093 Ga0316576_10013343
4094 Ga0316576_10015060
4095 Ga0316576_10015734
4096 Ga0316576_10016646
4097 Ga0316576_10021425
4098 Ga0316576_10025171
4099 Ga0316576_10026661
4100 Ga0316576_10030660
4101 Ga0316576_10033635
4102 Ga0316576_10034671
4103 Ga0316576_10051745
4104 Ga0316576_10066715
4105 Ga0316576_10070104
4106 Ga0316576_10073820
4107 Ga0316576_10076125
4108 Ga0316576_10102220
4109 Ga0316576_10110847
4110 Ga0316576_10137265
4111 Ga0316576_10143472
4112 Ga0316576_10223752
4113 Ga0316578_10000018
4114 Ga0316578_10000388
4115 Ga0316578_10000482
4116 Ga0316578_10001002
4117 Ga0316578_10001316
4118 Ga0316578_10006072
4119 Ga0316578_10016385
4120 Ga0316578_10022033
4121 Ga0316578_10034918
4122 Ga0316578_10039540
4123 Ga0316578_10075721
4124 Ga0316578_10122308
4125 Ga0316578_10132270
4126 Ga0316578_10133079
4127 Ga0316578_10134419
4128 Ga0307405_10007374
4129 Ga0316577_10000594
4130 Ga0316577_10000999
4131 Ga0316577_10001322
4132 Ga0316577_10003794
4133 Ga0316577_10004155
4134 Ga0316577_10005455
4135 Ga0316577_10007638
4136 Ga0316577_10024994
4137 Ga0316577_10026820
4138 Ga0316577_10034825
4139 Ga0316577_10053732
4140 Ga0316577_10067929
4141 Ga0316577_10076942
4142 Ga0316577_10086345
4143 Ga0316577_10103052
4144 Ga0307413_10139457
4145 Ga0307410_10000031
4146 Ga0307406_10000132
4147 Ga0307406_10000743
4148 Ga0307407_10015746
4149 Ga0307412_10000023
4150 Ga0307412_10000162
4151 Ga0307412_10033731
4152 Ga0307412_10047110
4153 Ga0307412_10054740
4154 Ga0307412_10067954
4155 Ga0307409_100050670
4156 Ga0307409_100093051
4157 Ga0307409_100104524
4158 Ga0307416_100004592
4159 Ga0307416_100015361
4160 Ga0307414_10000064
4161 Ga0307414_10000666
4162 Ga0307414_10051308
4163 Ga0307411_10000009
4164 Ga0307411_10098410
4165 Ga0307411_10167076
4166 Ga0307415_100010246
4167 Ga0307415_100146739
4168 Ga0316583_10000190
4169 Ga0316583_10000700
4170 Ga0316583_10001533
4171 Ga0316583_10002466
4172 Ga0316583_10003925
4173 Ga0316583_10006815
4174 Ga0316583_10008589
4175 Ga0316583_10018032
4176 Ga0316583_10040740
4177 Ga0316585_10000558
4178 Ga0316585_10007713
4179 Ga0316585_10023575
4180 Ga0316580_10001423
4181 Ga0316580_10001520
4182 Ga0316580_10002031
4183 Ga0316580_10010770
4184 Ga0316580_10024878
4185 Ga0316593_10038181
4186 Ga0307510_10038191
4187 Ga0307510_10082397
4188 Ga0316587_1002649
4189 Ga0373926_0025920
4190 Ga0373934_0000687
4191 Ga0373934_0000741
4192 Ga0373949_0000198
4193 Ga0373951_0002387
4194 Ga0373923_0002316
4195 Ga0373923_0025021
4196 Ga0373936_0014976
4197 Ga0373945_0002779
4198 Ga0373953_0005532
4199 Ga0373956_0000757
4200 Ga0373956_0002802
4201 Ga0373960_0011752
4202 Ga0373943_0112437
4203 Ga0373946_0028796
4204 Ga0373955_0000226
4205 Ga0373955_0025135
4206 Ga0373961_0000014
4207 Ga0373961_0000948
4208 Ga0316574_0001001
4209 Ga0316574_0001207
4210 Ga0316574_0001667
4211 Ga0316574_0003253
4212 Ga0316574_0008740
4213 Ga0316574_0011531
4214 Ga0316574_0012596
4215 Ga0316574_0023928
4216 Ga0316574_0027059
4217 Ga0316574_0031028
4218 Ga0316574_0034241
4219 Ga0316574_0038544
4220 Ga0316574_0055698
4221 Ga0316574_0058577
4222 Ga0316574_0080414
4223 Ga0316574_0102916
4224 Ga0316574_0109931
4225 Ga0373935_0001300
4226 Ga0373935_0010391
4227 Ga0373935_0022153
4228 Ga0373927_0001907
4229 Ga0373927_0005146
4230 Ga0373927_0025912
4231 Ga0373927_0117175
4232 Ga0373927_0161969
4233 Ga0373933_0000772
4234 Ga0373933_0005458
4235 Ga0373947_0004919
4236 Ga0373947_0008485
4237 Ga0373947_0016063
4238 Ga0373947_0018745
4239 Ga0373937_0000890
4240 Ga0373937_0157469
4241 Ga0316582_0001543
4242 Ga0316582_0006253
4243 Ga0316582_0006723
4244 Ga0316582_0007635
4245 Ga0316582_0008435
4246 Ga0316582_0019625
4247 Ga0316582_0019801
4248 Ga0316582_0020648
4249 Ga0316582_0022862
4250 Ga0316582_0023699
4251 Ga0316582_0033416
4252 Ga0316582_0039239
4253 Ga0316582_0056789
4254 Ga0316582_0060821
4255 Ga0316582_0087847
4256 Ga0316582_0092088
4257 Ga0316582_0109045
4258 Ga0316582_0119707
4259 Ga0316582_0173291
4260 Ga0316584_0000012
4261 Ga0316584_0000143
4262 Ga0316584_0000613
4263 Ga0316584_0002523
4264 Ga0316584_0006454
4265 Ga0316584_0010505
4266 Ga0316584_0016955
4267 Ga0316584_0022924
4268 Ga0316584_0027667
4269 Ga0316584_0032080
4270 Ga0316584_0043632
4271 Ga0316584_0082825
4272 Ga0316584_0083921
4273 Ga0316584_0088550
4274 Ga0316584_0090352
4275 Ga0316584_0092943
4276 Ga0316584_0111885
4277 Ga0316584_0138321
4278 Ga0316584_0169047
4279 Ga0316584_0171414
4280 Ga0316584_0210360
4281 Ga0316584_0214376
4282 Ga0373925_0051326
4283 Ga0373925_0088118
4284 Ga0395899_0005950
4285 Ga0395899_0019992
4286 Ga0395900_0002207
4287 Ga0395900_0070096
4288 Ga0395900_0080554
4289 Ga0395898_0001975
4290 Ga0395905_0004379
4291 Ga0395905_0036458
4292 Ga0395905_0042134
4293 Ga0395905_0089928
4294 Ga0316581_0008714
4295 Ga0316581_0011615
4296 Ga0436364_0855899
4297 Ga0395901_0002134
4298 Ga0395901_0004888
4299 Ga0395901_0008049
4300 Ga0395901_0109739
4301 Ga0395901_0125849
4302 Ga0395901_0172788
4303 Ga0395901_0321446
4304 Ga0237819_02469
4305 Ga0237819_03446
4306 Ga0400484_00611
4307 Ga0400484_03648
4308 Ga0400484_26818
4309 Ga0400484_33081
4310 Ga0400484_38520
4311 Ga0400490_03382
4312 Ga0400490_03872
4313 Ga0400490_16399
4314 Ga0400490_20164
4315 Ga0400490_26103
4316 Ga0400490_31755
4317 Ga0400490_43299
4318 Ga0400490_47884
4319 Ga0400490_49878
4320 Ga0400490_50905
4321 Ga0400491_01864
4322 Ga0400491_17037
4323 Ga0400491_24444
4324 Ga0400485_02682
4325 Ga0400485_09566
4326 Ga0400485_12529
4327 Ga0400485_14551
4328 Ga0400485_16497
4329 Ga0400485_17143
4330 Ga0400488_22426
4331 Ga0400488_47901
4332 Ga0400488_54281
4333 Ga0400488_56508
4334 Ga0400488_62343
4335 Ga0400486_06036
4336 Ga0400486_08234
4337 Ga0400486_16402
4338 Ga0400486_16511
4339 Ga0400486_18734
4340 Ga0400486_20299
4341 Ga0400483_006940
4342 Ga0400483_015191
4343 Ga0400483_063982
4344 Ga0400483_068767
4345 Ga0400483_110321
4346 Ga0400483_112260
4347 Ga0400483_120530
4348 Ga0400483_126084
4349 Ga0400483_134788
4350 Ga0400483_143368
4351 Ga0400483_173481
4352 Ga0400483_202610
4353 Ga0400483_218987
4354 Ga0400483_233352
4355 Ga0400483_242137
4356 Ga0400483_280457
4357 Ga0400483_286886
4358 Ga0400483_291297
4359 Ga0400489_01228
4360 Ga0400489_18992
4361 Ga0400489_21683
4362 Ga0400489_25826
4363 Ga0400489_29768
4364 Ga0400489_35047
4365 Ga0400489_45196
4366 Ga0400489_50224
4367 Ga0400489_52808
4368 Ga0400489_68266
4369 Ga0400489_69212
4370 Ga0400489_72172
4371 Ga0400489_73307
4372 Ga0400489_84719
4373 Ga0400487_10399
4374 Ga0400487_56498
4375 Ga0436365_1037676
4376 Ga0436365_1337717
4377 Ga0436361_0210320
4378 Ga0436361_0250104
4379 Ga0436361_1107681
4380 Ga0439436_0006308
4381 Ga0439438_000215
4382 Ga0439438_006180
4383 Ga0439438_006308
4384 Ga0439447_000076
4385 Ga0439447_003000
4386 Ga0439447_003632
4387 Ga0439447_005707
4388 Ga0439447_011486
4389 Ga0439466_0000784
4390 Ga0439466_0007042
4391 Ga0439466_0014154
4392 Ga0439466_0024629
4393 Ga0439465_0000001
4394 Ga0451852_27934
4395 Ga0439445_0014607
4396 Ga0439432_000305
4397 Ga0439432_003746
4398 Ga0439432_007277
4399 Ga0439432_022239
4400 Ga0439452_000002
4401 Ga0439452_000008
4402 Ga0439452_002710
4403 Ga0439452_003663
4404 Ga0439452_003877
4405 Ga0439452_004760
4406 Ga0439452_007031
4407 Ga0439452_016691
4408 Ga0439456_000475
4409 Ga0439456_003873
4410 Ga0439456_007062
4411 Ga0439463_003270
4412 Ga0450911_000790
4413 Ga0450911_001274
4414 Ga0450920_002487
4415 Ga0450923_007695
4416 Ga0450902_000703
4417 Ga0450902_002473
4418 Ga0450903_002126
4419 Ga0450907_001138
4420 Ga0450907_007951
4421 Ga0450910_001712
4422 Ga0439446_0005663
4423 Ga0439434_0000357
4424 Ga0439434_0002560
4425 Ga0439435_0006362
4426 Ga0439464_0000037
4427 Ga0439460_0005120
4428 Ga0451577_0000030
4429 Ga0451577_0000033
4430 Ga0451577_0000037
4431 Ga0451577_0000112
4432 Ga0451577_0000393
4433 Ga0451577_0000866
4434 Ga0451577_0001296
4435 Ga0451577_0001566
4436 Ga0451577_0002979
4437 Ga0451577_0006392
4438 Ga0451577_0007142
4439 Ga0451577_0008077
4440 Ga0451577_0008256
4441 Ga0451577_0014190
4442 Ga0451577_0014601
4443 Ga0451577_0028842
4444 Ga0451577_0029119
4445 Ga0451577_0030167
4446 Ga0451577_0030261
4447 Ga0451577_0033460
4448 Ga0451577_0036504
4449 Ga0451577_0038874
4450 Ga0451577_0039911
4451 Ga0451577_0043362
4452 Ga0451577_0043383
4453 Ga0451577_0043661
4454 Ga0451577_0050652
4455 Ga0451577_0070533
4456 Ga0451577_0073372
4457 Ga0451577_0080389
4458 Ga0451577_0083806
4459 Ga0451577_0088373
4460 Ga0451577_0089277
4461 Ga0451577_0099459
4462 Ga0451577_0159040
4463 Ga0451577_0165854
4464 Ga0451577_0203484
4465 Ga0451577_0210759
4466 Ga0451577_0402802
4467 Ga0439440_0003630
4468 Ga0439440_0007062
4469 Ga0466977_0001752
4470 Ga0453683_0000010
4471 Ga0453683_0000021
4472 Ga0453683_0000082
4473 Ga0453683_0000538
4474 Ga0453683_0001314
4475 Ga0453683_0003752
4476 Ga0453683_0003785
4477 Ga0453683_0014411
4478 Ga0453683_0017683
4479 Ga0453683_0019328
4480 Ga0453683_0024988
4481 Ga0453683_0029763
4482 Ga0453683_0030066
4483 Ga0453683_0031936
4484 Ga0453683_0060920
4485 Ga0453683_0123420
4486 Ga0466965_0000007
4487 Ga0453684_0000109
4488 Ga0453684_0000110
4489 Ga0453684_0000118
4490 Ga0453684_0000143
4491 Ga0453684_0000190
4492 Ga0453684_0000199
4493 Ga0453684_0000202
4494 Ga0453684_0000334
4495 Ga0453684_0000398
4496 Ga0453684_0000433
4497 Ga0453684_0000461
4498 Ga0453684_0000523
4499 Ga0453684_0000547
4500 Ga0453684_0000662
4501 Ga0453684_0000766
4502 Ga0453684_0001189
4503 Ga0453684_0001191
4504 Ga0453684_0001326
4505 Ga0453684_0001522
4506 Ga0453684_0001620
4507 Ga0453684_0002060
4508 Ga0453684_0002074
4509 Ga0453684_0002091
4510 Ga0453684_0003476
4511 Ga0453684_0004507
4512 Ga0453684_0004932
4513 Ga0453684_0005619
4514 Ga0453684_0007194
4515 Ga0453684_0008024
4516 Ga0453684_0008925
4517 Ga0453684_0009951
4518 Ga0453684_0011638
4519 Ga0453684_0012386
4520 Ga0453684_0014214
4521 Ga0453684_0016192
4522 Ga0453684_0018043
4523 Ga0453684_0018414
4524 Ga0453684_0020816
4525 Ga0453684_0020890
4526 Ga0453684_0022434
4527 Ga0453684_0023381
4528 Ga0453684_0026533
4529 Ga0453684_0029463
4530 Ga0453684_0029789
4531 Ga0453684_0029976
4532 Ga0453684_0031511
4533 Ga0453684_0033231
4534 Ga0453684_0033826
4535 Ga0453684_0034083
4536 Ga0453684_0035840
4537 Ga0453684_0036809
4538 Ga0453684_0041770
4539 Ga0453684_0044999
4540 Ga0453684_0050510
4541 Ga0453684_0053415
4542 Ga0453684_0055727
4543 Ga0453684_0057256
4544 Ga0453684_0064284
4545 Ga0453684_0064387
4546 Ga0453684_0067901
4547 Ga0453684_0072636
4548 Ga0453684_0074325
4549 Ga0453684_0085995
4550 Ga0453684_0091920
4551 Ga0453684_0096590
4552 Ga0453684_0105824
4553 Ga0453684_0114846
4554 Ga0453684_0132760
4555 Ga0453684_0144627
4556 Ga0453684_0150975
4557 Ga0453684_0157143
4558 Ga0453684_0175112
4559 Ga0453684_0207395
4560 Ga0453684_0213178
4561 Ga0453684_0229166
4562 Ga0453684_0237542
4563 Ga0453684_0273429
4564 Ga0453684_0289658
4565 Ga0453684_0304556
4566 Ga0453684_0351888
4567 Ga0451576_0000039
4568 Ga0451576_0000052
4569 Ga0451576_0000150
4570 Ga0451576_0000172
4571 Ga0451576_0000232
4572 Ga0451576_0000279
4573 Ga0451576_0000551
4574 Ga0451576_0000729
4575 Ga0451576_0001465
4576 Ga0451576_0003401
4577 Ga0451576_0004777
4578 Ga0451576_0007719
4579 Ga0451576_0008966
4580 Ga0451576_0009750
4581 Ga0451576_0010696
4582 Ga0451576_0010870
4583 Ga0451576_0011533
4584 Ga0451576_0014979
4585 Ga0451576_0018888
4586 Ga0451576_0023935
4587 Ga0451576_0025802
4588 Ga0451576_0026656
4589 Ga0451576_0029479
4590 Ga0451576_0031038
4591 Ga0451576_0034343
4592 Ga0451576_0036078
4593 Ga0451576_0039402
4594 Ga0451576_0041929
4595 Ga0451576_0042296
4596 Ga0451576_0052583
4597 Ga0451576_0052961
4598 Ga0451576_0066910
4599 Ga0451576_0082397
4600 Ga0451576_0083978
4601 Ga0451576_0092807
4602 Ga0451576_0094150
4603 Ga0451576_0119761
4604 Ga0451576_0132490
4605 Ga0451576_0182435
4606 Ga0451576_0244077
4607 Ga0451576_0275088
4608 Ga0451576_0477319
4609 Ga0466967_0015704
4610 Ga0495617_004008
4611 Ga0495617_005953
4612 Ga0495617_006874
4613 Ga0495627_000100
4614 Ga0495627_004378
4615 Ga0495627_006122
4616 Ga0495627_018961
4617 Ga0495592_0064374
4618 Ga0495603_0005075
4619 Ga0495603_0028510
4620 Ga0495603_0039995
4621 Ga0495603_0044712
4622 Ga0495590_0027541
4623 Ga0495590_0038853
4624 Ga0495591_001456
4625 Ga0495591_002164
4626 Ga0495591_004279
4627 Ga0495591_004387
4628 Ga0495591_005738
4629 Ga0495591_006124
4630 Ga0495591_010220
4631 Ga0495591_011055
4632 Ga0495591_013285
4633 Ga0495629_0004663
4634 Ga0495629_0006556
4635 Ga0495638_0006392
4636 Ga0495638_0006949
4637 Ga0495638_0012535
4638 Ga0495638_0014166
4639 Ga0495638_0015816
4640 Ga0495638_0017804
4641 Ga0495638_0018086
4642 Ga0495638_0046420
4643 Ga0495638_0052079
4644 Ga0495638_0086592
4645 Ga0495641_0014063
4646 Ga0495651_0026464
4647 Ga0495650_0000120
4648 Ga0495650_0007633
4649 Ga0495650_0008301
4650 Ga0495650_0022496
4651 Ga0495650_0024421
4652 Ga0495580_0000830
4653 Ga0495580_0001031
4654 Ga0495580_0003619
4655 Ga0495580_0005406
4656 Ga0495580_0070641
4657 Ga0495582_0000300
4658 Ga0495582_0003289
4659 Ga0495582_0004324
4660 Ga0495605_0009840
4661 Ga0495605_0020139
4662 Ga0495605_0040674
4663 Ga0495639_0003081
4664 Ga0495639_0038073
4665 Ga0495662_0010418
4666 Ga0495584_0010170
4667 Ga0495584_0012240
4668 Ga0495584_0015199
4669 Ga0495584_0026064
4670 Ga0495584_0048307
4671 Ga0495584_0054098
4672 Ga0495585_0009805
4673 Ga0495585_0011502
4674 Ga0495585_0018945
4675 Ga0495585_0055350
4676 Ga0495585_0092072
4677 Ga0495594_0003270
4678 Ga0495594_0042200
4679 Ga0495594_0084470
4680 Ga0495596_0000189
4681 Ga0495596_0014927
4682 Ga0495607_0013741
4683 Ga0495607_0013932
4684 Ga0495607_0014107
4685 Ga0495607_0014234
4686 Ga0495607_0044852
4687 Ga0495607_0044918
4688 Ga0495607_0061555
4689 Ga0495583_0014711
4690 Ga0495583_0015910
4691 Ga0495583_0025972
4692 Ga0495606_0015488
4693 Ga0495606_0019262
4694 Ga0495606_0020260
4695 Ga0495606_0024485
4696 Ga0495606_0027345
4697 Ga0495606_0027439
4698 Ga0495606_0082900
4699 Ga0495608_0016743
4700 Ga0495610_0010946
4701 Ga0495610_0011169
4702 Ga0495610_0012817
4703 Ga0495610_0020240
4704 Ga0495610_0020280
4705 Ga0495610_0028860
4706 Ga0495610_0033496
4707 Ga0495610_0039843
4708 Ga0495610_0049983
4709 Ga0495616_0010570
4710 Ga0495616_0013655
4711 Ga0495616_0024816
4712 Ga0495616_0024968
4713 Ga0495616_0025984
4714 Ga0495616_0034999
4715 Ga0495620_0000124
4716 Ga0495620_0001973
4717 Ga0495620_0003286
4718 Ga0495620_0007645
4719 Ga0495620_0010587
4720 Ga0495620_0013554
4721 Ga0495620_0014551
4722 Ga0495620_0027450
4723 Ga0495630_0000441
4724 Ga0495630_0001682
4725 Ga0495630_0019865
4726 Ga0495630_0080862
4727 Ga0495631_0007856
4728 Ga0495632_0003308
4729 Ga0495632_0009698
4730 Ga0495632_0011458
4731 Ga0495632_0011514
4732 Ga0495632_0070091
4733 Ga0495637_0006263
4734 Ga0495637_0006861
4735 Ga0495637_0008460
4736 Ga0495637_0011940
4737 Ga0495637_0015289
4738 Ga0495637_0018625
4739 Ga0495637_0037963
4740 Ga0495643_0001239
4741 Ga0495643_0007977
4742 Ga0495643_0046740
4743 Ga0495644_0009846
4744 Ga0495644_0010573
4745 Ga0495648_0003311
4746 Ga0495648_0003771
4747 Ga0495648_0014963
4748 Ga0495648_0015207
4749 Ga0495648_0018204
4750 Ga0495648_0040970
4751 Ga0495648_0046055
4752 Ga0495666_0003807
4753 Ga0495666_0004391
4754 Ga0495666_0007527
4755 Ga0495666_0026280
4756 Ga0495642_0003988
4757 Ga0495642_0004409
4758 Ga0495642_0005976
4759 Ga0495654_0000754
4760 Ga0495654_0004201
4761 Ga0495654_0009595
4762 Ga0495654_0009815
4763 Ga0495654_0010507
4764 Ga0495654_0013668
4765 Ga0495654_0017308
4766 Ga0495654_0018828
4767 Ga0495654_0019548
4768 Ga0495654_0027732
4769 Ga0495654_0028995
4770 Ga0495654_0030987
4771 Ga0495654_0032368
4772 Ga0495654_0032711
4773 Ga0495654_0034108
4774 Ga0495665_0009575
4775 Ga0495665_0065228
4776 Ga0495586_0000729
4777 Ga0495586_0041438
4778 Ga0495586_0065830
4779 Ga0495586_0115384
4780 Ga0495587_0000724
4781 Ga0495587_0033172
4782 Ga0495609_0005656
4783 Ga0495609_0006985
4784 Ga0495609_0021605
4785 Ga0495597_0000129
4786 Ga0495597_0009227
4787 Ga0495597_0009986
4788 Ga0495597_0012580
4789 Ga0495597_0016830
4790 Ga0495597_0032995
4791 Ga0495597_0041344
4792 Ga0495645_0043733
4793 Ga0495645_0140182
4794 Ga0495622_0006735
4795 Ga0495622_0007671
4796 Ga0495622_0011721
4797 Ga0495633_0000708
4798 Ga0495633_0010283
4799 Ga0495633_0012099
4800 Ga0495633_0051083
4801 Ga0495667_0013486
4802 Ga0495656_0003367
4803 Ga0495656_0019046
4804 Ga0495656_0036721
4805 Ga0495668_0017652
4806 Ga0495634_0011875
4807 Ga0495634_0017439
4808 Ga0495634_0034069
4809 Ga0495611_0005437
4810 Ga0495625_0014420
4811 Ga0495625_0024527
4812 Ga0495635_0003892
4813 Ga0495635_0076796
4814 Ga0495659_0000082
4815 Ga0495659_0001726
4816 Ga0495659_0015357
4817 Ga0495661_0002392
4818 Ga0495661_0011545
4819 Ga0495661_0021816
4820 Ga0495661_0078505
4821 Ga0495661_0107267
4822 Ga0495588_0010933
4823 Ga0495588_0054002
4824 Ga0495588_0062744
4825 Ga0495623_0035250
4826 Ga0495623_0044633
4827 Ga0495647_0009939
4828 Ga0495658_0000299
4829 Ga0495658_0001247
4830 Ga0495658_0021292
4831 Ga0495669_0009461
4832 Ga0495669_0013927
4833 Ga0495669_0029949
4834 Ga0495613_0002159
4835 Ga0495613_0023475
4836 Ga0495613_0032446
4837 Ga0495613_0157621
4838 Ga0495624_0012163
4839 Ga0495624_0051867
4840 Ga0495624_0112761
4841 Ga0495670_0007380
4842 Ga0495670_0008272
4843 Ga0495670_0012800
4844 Ga0495670_0019417
4845 Ga0495670_0054752
4846 Ga0495671_0011821
4847 Ga0495671_0013997
4848 Ga0495671_0033202
4849 Ga0495671_0039266
4850 Ga0495649_0000337
4851 Ga0495649_0000416
4852 Ga0495649_0008493
4853 Ga0495649_0015174
4854 Ga0495649_0017485
4855 Ga0495649_0023160
4856 Ga0495649_0029626
4857 Ga0495649_0038945
4858 Ga0495589_0000010
4859 Ga0495589_0006890
4860 Ga0495589_0010897
4861 Ga0495660_0000036
4862 Ga0495660_0006210
4863 Ga0495660_0011059
4864 Ga0495660_0020075
4865 Ga0495660_0027645
4866 Ga0495660_0047263
4867 Ga0495581_0003329
4868 Ga0495604_0001001
4869 Ga0495674_0000587
4870 Ga0495674_0005858
4871 Ga0495674_0015082
4872 Ga0495674_0046877
4873 Ga0495674_0046911
4874 Ga0495674_0070431
4875 Ga0495672_0000027
4876 Ga0495672_0015582
4877 Ga0495672_0021526
4878 Ga0495672_0022548
4879 Ga0495672_0024245
4880 Ga0495672_0024662
4881 Ga0495672_0024897
4882 Ga0495672_0034358
4883 Ga0495672_0041329
4884 Ga0495672_0068591
4885 Ga0495676_0027015
4886 Ga0495676_0043153
4887 Ga0495676_0075211
4888 Ga0495680_0012958
4889 Ga0495680_0028168
4890 Ga0495680_0050624
4891 Ga0495680_0137510
4892 Ga0495683_0017310
4893 Ga0495683_0030474
4894 Ga0495683_0052295
4895 Ga0495687_009508
4896 Ga0495687_009631
4897 Ga0495675_0017338
4898 Ga0495675_0030782
4899 Ga0495677_0021241
4900 Ga0495679_000019
4901 Ga0495679_001498
4902 Ga0495679_005362
4903 Ga0495679_030774
4904 Ga0495673_0009235
4905 Ga0495673_0009240
4906 Ga0495673_0009939
4907 Ga0495673_0010243
4908 Ga0495673_0010973
4909 Ga0495673_0017918
4910 Ga0495673_0018453
4911 Ga0495673_0029145
4912 Ga0495673_0037046
4913 Ga0495681_0003395
4914 Ga0495681_0005954
4915 Ga0495681_0009718
4916 Ga0495681_0010523
4917 Ga0495681_0010998
4918 Ga0495681_0012145
4919 Ga0495681_0013501
4920 Ga0495681_0013679
4921 Ga0495681_0018169
4922 Ga0495681_0018998
4923 Ga0495681_0020977
4924 Ga0495681_0024404
4925 Ga0495681_0025844
4926 Ga0495684_0017361
4927 Ga0495684_0161494
4928 Ga0495686_0016545
4929 Ga0495686_0018995
4930 Ga0495593_0005574
4931 Ga0495593_0008906
4932 Ga0495593_0061352
4933 Ga0495602_0018454
4934 Ga0495602_0024479
4935 Ga0495602_0047607
4936 Ga0495614_0005873
4937 Ga0495626_0001279
4938 Ga0495626_0007774
4939 Ga0495626_0007837
4940 Ga0495626_0007975
4941 Ga0495626_0025223
4942 Ga0496100_0008015
4943 Ga0496100_0020495
4944 Ga0496101_0005879
4945 Ga0496101_0029344
4946 Ga0496101_0061519
4947 Ga0496101_0069223
4948 Ga0496102_0017528
4949 Ga0496102_0023148
4950 Ga0496102_0028405
4951 Ga0496102_0033956
4952 Ga0496102_0083735
4953 Ga0496103_0008474
4954 Ga0496103_0025431
4955 Ga0496103_0030251
4956 Ga0496103_0056365
4957 Ga0496103_0156066
4958 Ga0496104_0001118
4959 Ga0496104_0003113
4960 Ga0496104_0008000
4961 Ga0496104_0030612
4962 Ga0496104_0049314
4963 Ga0496104_0077858
4964 Ga0496104_0261113
4965 Ga0496105_0001878
4966 Ga0496105_0031254
4967 Ga0496105_0132219
4968 Ga0496106_0003524
4969 Ga0496106_0017299
4970 Ga0496106_0019949
4971 Ga0496106_0024654
4972 Ga0496106_0039521
4973 Ga0496107_0001542
4974 Ga0496107_0002329
4975 Ga0496107_0047532
4976 Ga0496107_0049763
4977 Ga0496108_0042068
4978 Ga0496108_0044548
4979 Ga0496108_0054847
4980 Ga0496108_0164942
4981 Ga0496109_0035058
4982 Ga0496109_0109184
4983 Ga0496109_0244626
4984 Ga0496110_0014135
4985 Ga0496110_0023376
4986 Ga0496110_0026357
4987 Ga0496110_0046454
4988 Ga0496110_0070048
4989 Ga0496110_0083396
4990 Ga0496110_0161388
4991 Ga0496110_0232403
4992 Ga0496111_0010757
4993 Ga0496111_0024059
4994 Ga0496111_0037096
4995 Ga0496111_0218646
4996 Ga0496112_0039999
4997 Ga0496112_0159814
4998 Ga0496112_0199197
4999 Ga0496113_0018647
5000 Ga0496113_0023346
5001 Ga0496113_0052537
5002 Ga0496113_0060347
5003 Ga0496113_0063545
5004 Ga0496113_0066451
5005 Ga0496114_0001722
5006 Ga0496114_0079460
5007 Ga0496114_0081556
5008 Ga0496115_0000563
5009 Ga0496115_0000589
5010 Ga0496115_0009252
5011 Ga0496115_0015282
5012 Ga0496115_0071595
5013 Ga0496115_0202228
5014 Ga0496116_0000051
5015 Ga0496116_0000075
5016 Ga0496116_0000077
5017 Ga0496116_0000096
5018 Ga0496116_0000181
5019 Ga0496116_0003506
5020 Ga0496116_0005939
5021 Ga0496116_0010913
5022 Ga0496116_0014431
5023 Ga0496116_0016278
5024 Ga0496116_0027419
5025 Ga0496116_0038970
5026 Ga0496116_0075287
5027 Ga0496116_0082396
5028 Ga0496117_0000005
5029 Ga0496117_0000007
5030 Ga0496117_0001792
5031 Ga0496117_0002904
5032 Ga0496117_0003141
5033 Ga0496117_0004669
5034 Ga0496117_0006894
5035 Ga0496117_0006961
5036 Ga0496117_0007471
5037 Ga0496117_0007796
5038 Ga0496117_0009888
5039 Ga0496117_0011818
5040 Ga0496117_0014842
5041 Ga0496117_0028413
5042 Ga0496117_0035280
5043 Ga0496117_0039136
5044 Ga0496117_0054119
5045 Ga0496117_0098861
5046 Ga0496118_0000031
5047 Ga0496118_0000140
5048 Ga0496118_0000767
5049 Ga0496118_0001845
5050 Ga0496118_0004066
5051 Ga0496118_0009800
5052 Ga0496118_0010081
5053 Ga0496118_0012713
5054 Ga0496118_0014028
5055 Ga0496118_0016470
5056 Ga0496118_0022406
5057 Ga0496118_0039714
5058 Ga0496118_0039971
5059 Ga0496118_0085899
5060 Ga0496118_0089177
5061 Ga0496118_0116090
5062 Ga0496118_0155707
5063 Ga0496119_0000007
5064 Ga0496119_0000066
5065 Ga0496119_0000069
5066 Ga0496119_0000160
5067 Ga0496119_0000759
5068 Ga0496119_0001223
5069 Ga0496119_0008246
5070 Ga0496119_0010770
5071 Ga0496119_0033494
5072 Ga0496119_0038070
5073 Ga0496120_0000038
5074 Ga0496120_0000112
5075 Ga0496120_0000139
5076 Ga0496120_0000192
5077 Ga0496120_0000243
5078 Ga0496120_0001402
5079 Ga0496120_0013007
5080 Ga0496120_0019386
5081 Ga0496120_0019523
5082 Ga0496120_0036780
5083 Ga0496120_0106176
5084 Ga0496121_0000195
5085 Ga0496121_0002186
5086 Ga0496121_0006282
5087 Ga0496121_0008513
5088 Ga0496121_0011352
5089 Ga0496121_0014973
5090 Ga0496121_0016438
5091 Ga0496121_0020957
5092 Ga0496121_0021741
5093 Ga0496121_0024685
5094 Ga0496121_0030925
5095 Ga0496121_0041719
5096 Ga0496121_0059953
5097 Ga0496121_0060172
5098 Ga0496121_0074555
5099 Ga0496122_0000237
5100 Ga0496122_0000280
5101 Ga0496122_0000291
5102 Ga0496122_0000416
5103 Ga0496122_0000588
5104 Ga0496122_0001745
5105 Ga0496122_0009251
5106 Ga0496122_0018025
5107 Ga0496122_0019412
5108 Ga0496122_0022915
5109 Ga0496122_0070124
5110 Ga0496123_0000078
5111 Ga0496123_0000104
5112 Ga0496123_0000229
5113 Ga0496123_0000790
5114 Ga0496123_0001434
5115 Ga0496123_0001470
5116 Ga0496123_0003754
5117 Ga0496123_0003867
5118 Ga0496123_0004168
5119 Ga0496123_0006711
5120 Ga0496123_0011646
5121 Ga0496123_0016608
5122 Ga0496123_0018797
5123 Ga0496123_0058495
5124 Ga0496123_0060014
5125 Ga0496124_0000026
5126 Ga0496124_0000100
5127 Ga0496124_0002438
5128 Ga0496124_0002570
5129 Ga0496124_0004397
5130 Ga0496124_0004407
5131 Ga0496124_0005203
5132 Ga0496124_0009296
5133 Ga0496124_0014416
5134 Ga0496124_0022157
5135 Ga0496124_0028884
5136 Ga0496124_0052243
5137 Ga0496124_0052313
5138 Ga0496124_0066797
5139 Ga0496124_0077974
5140 Ga0496124_0083586
5141 Ga0496124_0088808
5142 Ga0496124_0145000
5143 Ga0496125_0000024
5144 Ga0496125_0000070
5145 Ga0496125_0000226
5146 Ga0496125_0000364
5147 Ga0496125_0001029
5148 Ga0496125_0003184
5149 Ga0496125_0004744
5150 Ga0496125_0006488
5151 Ga0496125_0008479
5152 Ga0496125_0009455
5153 Ga0496125_0010323
5154 Ga0496125_0017357
5155 Ga0496125_0017588
5156 Ga0496125_0018023
5157 Ga0496125_0021748
5158 Ga0496125_0029031
5159 Ga0496125_0050170
5160 Ga0496125_0088607
5161 Ga0496126_0001297
5162 Ga0496126_0002437
5163 Ga0496126_0004899
5164 Ga0496126_0007430
5165 Ga0496126_0008317
5166 Ga0496126_0010844
5167 Ga0496126_0024727
5168 Ga0496126_0071011
5169 Ga0496126_0141242
5170 Ga0496126_0141525
5171 Ga0496126_0163117
5172 Ga0495678_008428
5173 Ga0495678_013561
5174 Ga0495678_020866
5175 Ga0495678_022516
5176 Ga0495682_0000174
5177 Ga0495682_0002927
5178 Ga0495682_0009057
5179 Ga0495682_0016005
5180 Ga0501031_0001325
5181 Ga0501031_0005851
5182 Ga0501031_0025303
5183 Ga0501031_0093645
5184 Ga0501031_0112069
5185 Ga0501031_0154283
5186 Ga0501032_0000445
5187 Ga0501032_0003475
5188 Ga0501032_0004498
5189 Ga0501032_0011737
5190 Ga0501032_0036144
5191 Ga0501032_0055175
5192 Ga0501032_0061670
5193 Ga0501032_0075830
5194 Ga0501032_0084985
5195 Ga0501032_0095117
5196 Ga0501033_0000336
5197 Ga0501033_0001087
5198 Ga0501033_0003106
5199 Ga0501033_0038813
5200 Ga0501033_0051034
5201 Ga0501034_0000131
5202 Ga0501034_0000548
5203 Ga0501034_0001019
5204 Ga0501034_0001617
5205 Ga0501034_0015924
5206 Ga0501034_0031493
5207 Ga0501034_0036253
5208 Ga0501034_0038453
5209 Ga0501034_0041254
5210 Ga0501034_0090297
5211 Ga0501034_0162502
5212 Ga0501034_0163817
5213 Ga0501034_0209669
5214 Ga0501034_0216823
5215 Ga0501036_0002923
5216 Ga0501036_0008830
5217 Ga0501036_0009281
5218 Ga0501036_0019941
5219 Ga0501036_0024204
5220 Ga0501036_0033632
5221 Ga0501036_0065007
5222 Ga0501036_0156047
5223 Ga0501036_0282770
5224 Ga0501037_0002801
5225 Ga0501037_0017651
5226 Ga0501037_0022108
5227 Ga0501037_0026946
5228 Ga0501037_0041557
5229 Ga0501037_0071651
5230 Ga0501038_0001663
5231 Ga0501038_0002148
5232 Ga0501038_0003198
5233 Ga0501038_0003797
5234 Ga0501038_0013910
5235 Ga0501038_0027577
5236 Ga0501038_0028765
5237 Ga0501038_0037237
5238 Ga0501038_0138724
5239 Ga0501038_0148614
5240 Ga0501039_0014159
5241 Ga0501039_0035046
5242 Ga0501039_0043620
5243 Ga0501039_0057060
5244 Ga0501039_0175473
5245 Ga0501040_0003730
5246 Ga0501040_0007334
5247 Ga0501040_0068964
5248 Ga0501041_0013008
5249 Ga0501041_0126008
5250 Ga0501042_0002736
5251 Ga0501042_0007788
5252 Ga0501042_0022536
5253 Ga0501042_0031755
5254 Ga0501042_0221007
5255 Ga0501043_0000018
5256 Ga0501043_0004020
5257 Ga0501043_0011974
5258 Ga0501043_0015548
5259 Ga0501043_0039870
5260 Ga0501046_0000042
5261 Ga0501046_0002908
5262 Ga0501046_0006873
5263 Ga0501046_0044594
5264 Ga0501046_0176577
5265 Ga0501047_0000047
5266 Ga0501047_0000052
5267 Ga0501047_0024356
5268 Ga0501047_0032402
5269 Ga0501047_0090693
5270 Ga0501047_0161863
5271 Ga0501048_0000459
5272 Ga0501048_0010416
5273 Ga0501048_0016477
5274 Ga0501048_0031426
5275 Ga0501048_0032987
5276 Ga0501048_0038268
5277 Ga0501067_0017430
5278 Ga0501068_0005998
5279 Ga0501068_0015768
5280 Ga0501069_0036462
5281 Ga0501069_0080689
5282 Ga0501070_0016000
5283 Ga0501070_0020320
5284 Ga0501070_0034633
5285 Ga0501070_0260804
5286 Ga0501071_0002077
5287 Ga0501072_0064796
5288 Ga0501072_0069734
5289 Ga0501074_0004078
5290 Ga0501074_0189071
5291 Ga0501074_0193386
5292 Ga0501075_0000261
5293 Ga0501075_0004727
5294 Ga0501075_0013701
5295 Ga0501075_0018650
5296 Ga0501076_0072219
5297 Ga0501076_0116128
5298 Ga0501077_0002214
5299 Ga0501077_0005964
5300 Ga0501223_000485
5301 Ga0501238_000050
5302 Ga0501242_000458
5303 Ga0501249_000007
5304 Ga0501249_003071
5305 Ga0501225_0002034
5306 Ga0501079_0027813
5307 Ga0501079_0072467
5308 Ga0501079_0103836
5309 Ga0501079_0117663
5310 Ga0501080_0010735
5311 Ga0501080_0018399
5312 Ga0501080_0306575
5313 Ga0501081_0004957
5314 Ga0501081_0040821
5315 Ga0501083_0005941
5316 Ga0501241_001008
5317 Ga0501241_002000
5318 Ga0501241_003386
5319 Ga0501266_000018
5320 Ga0501269_000002
5321 Ga0501280_000506
5322 Ga0501035_0001410
5323 Ga0501035_0004116
5324 Ga0501035_0008857
5325 Ga0501035_0035070
5326 Ga0501035_0064043
5327 Ga0501035_0216777
5328 Ga0501044_0000455
5329 Ga0501044_0001189
5330 Ga0501044_0003592
5331 Ga0501044_0003750
5332 Ga0501044_0012073
5333 Ga0501044_0034791
5334 Ga0501044_0061250
5335 Ga0501044_0099800
5336 Ga0501044_0109621
5337 Ga0501044_0213320
5338 Ga0501045_0006811
5339 Ga0501045_0034838
5340 Ga0501045_0040309
5341 Ga0501045_0076025
5342 Ga0501045_0099230
5343 nmdc:mga03683_49956_c1
5344 nmdc:mga00v17_53670_c1
5345 nmdc:mga00v17_844_c1
5346 nmdc:mga07m45_16413_c1
5347 nmdc:mga05p37_105663_c1
5348 nmdc:mga05p37_12638_c1
5349 nmdc:mga05p37_13094_c1
5350 nmdc:mga05p37_163367_c1
5351 nmdc:mga05p37_29036_c2
5352 nmdc:mga05p37_330_c1
5353 nmdc:mga05p37_343480_c1
5354 nmdc:mga05p37_50528_c1
5355 nmdc:mga05p37_65821_c1
5356 nmdc:mga05p37_68193_c1
5357 nmdc:mga05p37_71694_c1
5358 nmdc:mga09592_144047_c1
5359 nmdc:mga09592_236270_c1
5360 nmdc:mga09592_3709_c1
5361 nmdc:mga0qj67_174233_c1
5362 nmdc:mga0qj67_178283_c1
5363 nmdc:mga0qj67_210207_c1
5364 nmdc:mga0qj67_21372_c1
5365 nmdc:mga0qj67_27538_c1
5366 nmdc:mga06r32_169822_c1
5367 nmdc:mga06r32_25301_c1
5368 nmdc:mga06r32_27670_c1
5369 nmdc:mga06r32_297242_c1
5370 nmdc:mga06r32_32416_c1
5371 nmdc:mga06r32_74846_c1
5372 nmdc:mga08y16_120853_c1
5373 nmdc:mga08y16_16966_c1
5374 nmdc:mga08y16_221477_c1
5375 nmdc:mga08y16_2422_c1
5376 nmdc:mga08y16_303358_c1
5377 nmdc:mga08y16_341015_c1
5378 nmdc:mga08y16_354501_c1
5379 nmdc:mga08y16_9087_c1
5380 nmdc:mga0n895_118814_c1
5381 nmdc:mga0n895_1992_c1
5382 nmdc:mga0n895_245_c1
5383 nmdc:mga0n895_85408_c1
5384 nmdc:mga0n895_86088_c1
5385 nmdc:mga0rr50_123089_c1
5386 nmdc:mga0rr50_131928_c1
5387 nmdc:mga0rr50_153510_c1
5388 nmdc:mga0rr50_3942_c1
5389 nmdc:mga0rr50_75335_c1
5390 nmdc:mga08x19_19782_c1
5391 nmdc:mga08x19_30553_c1
5392 nmdc:mga08x19_96135_c1
5393 nmdc:mga0a205_20587_c1
5394 nmdc:mga0a205_233616_c1
5395 nmdc:mga0a205_321_c1
5396 nmdc:mga0a205_6744_c1
5397 nmdc:mga0a205_7958_c1
5398 nmdc:mga0a205_8110_c1
5399 nmdc:mga0a205_8280_c1
5400 nmdc:mga0sz30_4776_c1
5401 Ga0495655_0013096
5402 Ga0495619_0007786
5403 Ga0500646_0000532
5404 Ga0500651_0000253
5405 Ga0500641_0000012
5406 Ga0500641_0000164
5407 Ga0500641_0000293
5408 Ga0500658_0000005
5409 Ga0500634_0030676
5410 Ga0501084_0006998
5411 Ga0501082_0004682
5412 Ga0501082_0043387
5413 Ga0501082_0070194
5414 Ga0501082_0169480
5415 Ga0530510_0006988
5416 2506580899
5417 2506586038
5418 2508854700
5419 2511233647
5420 2511265000
5421 2511276337
5422 2511287761
5423 2511295291
5424 2511299616
5425 2511315849
5426 2511323229
5427 2511335015
5428 2511338309
5429 2511343096
5430 2511351663
5431 2511356023
5432 2511367318
5433 2511374088
5434 2511411458
5435 2512324668
5436 2513234026
5437 2513955353
5438 2514040681
5439 2524000831
5440 2526213468
5441 2538424584
5442 2547695109
5443 2548500085
5444 2548648835
5445 2548846075
5446 2550901297
5447 2552746275
5448 2554817561
5449 2555245668
5450 2555672260
5451 2562463025
5452 2571528154
5453 2574431783
5454 2578457085
5455 2583794773
5456 2585141201
5457 2585426165
5458 2585825999
5459 2585831783
5460 2588211164
5461 2588215547
5462 2588218969
5463 2588224461
5464 2597860339
5465 2597866072
5466 2597871906
5467 2599358304
5468 2599364653
5469 2599370811
5470 2599376833
5471 2599383469
5472 2599389916
5473 2599396199
5474 2599401459
5475 2599408039
5476 2599410951
5477 2599453146
5478 2599465119
5479 2599471428
5480 2599486819
5481 2599493966
5482 2599509900
5483 2599515149
5484 2599520315
5485 2599807057
5486 2599881751
5487 2599894529
5488 2599904262
5489 2599949376
5490 2600217853
5491 2600367147
5492 2600445494
5493 2601521581
5494 2601526606
5495 2601535199
5496 2601540762
5497 2601613436
5498 2601622339
5499 2601643146
5500 2601650375
5501 2601655664
5502 2601656911
5503 2601662967
5504 2601672246
5505 2601693993
5506 2601695926
5507 2601700600
5508 2601704708
5509 2601709737
5510 2601714749
5511 2601720951
5512 2601725155
5513 2601729697
5514 2601734714
5515 2601743660
5516 2601753208
5517 2601758381
5518 2601764490
5519 2601778020
5520 2601800438
5521 2602009903
5522 2602020943
5523 2603638259
5524 2603642783
5525 2603660341
5526 2603665616
5527 2603698174
5528 2603703385
5529 2603837070
5530 2603842146
5531 2603847219
5532 2603852289
5533 2603864507
5534 2603870343
5535 2603875357
5536 2606047534
5537 2606070047
5538 2606078754
5539 2606125586
5540 2606145963
5541 2606174935
5542 2608382766
5543 2609910176
5544 2621297385
5545 2624482853
5546 2637225797
5547 2640733423
5548 2643844773
5549 2643859411
5550 2643869668
5551 2643957539
5552 2643979682
5553 2643991236
5554 2643997954
5555 2644025653
5556 2644028419
5557 2644059856
5558 2644074514
5559 2644123172
5560 2644293889
5561 2644365284
5562 2644371872
5563 2644468948
5564 2644625378
5565 2644644597
5566 2656276733
5567 2671100825
5568 2671103315
5569 2671109515
5570 2671585358
5571 2671773385
5572 2676407944
5573 2677895792
5574 2678230459
5575 2681997550
5576 2682006940
5577 2689447450
5578 2712469617
5579 2715752288
5580 2715759028
5581 2718636067
5582 2722728454
5583 2722882349
5584 2723250808
5585 2728534705
5586 2729144979
5587 2738672890
5588 2738719715
5589 2738735575
5590 2738751283
5591 2738760550
5592 2738810303
5593 2738860324
5594 2738879867
5595 2738897663
5596 2739198207
5597 2739241390
5598 2739260971
5599 2739278914
5600 2739316406
5601 2739609964
5602 2740003672
5603 2740008489
5604 2740991516
5605 2743739881
5606 2745161558
5607 2747949200
5608 2753673910
5609 2753855628
5610 2765575329
5611 2765580410
5612 2765581874
5613 2765588610
5614 2772441264
5615 2772603365
5616 2774137004
5617 2774388990
5618 2774439187
5619 2775538616
5620 2775674624
5621 2777023647
5622 2784262367
5623 2792311384
5624 2793405811
5625 2807410270
5626 2807458618
5627 2808906636
5628 2808959267
5629 2808977663
5630 2808992679
5631 2809033587
5632 2809219325
5633 2812368737
5634 2813729293
5635 2814696803
5636 2816473554
5637 2816875185
5638 2817493506
5639 2819659143
5640 2819706493
5641 2821119433
5642 2823374398
5643 2823424253
5644 2833641470
5645 2834033291
5646 2834642450
5647 2839138204
5648 2842719116
5649 2842735747
5650 2842831553
5651 2842837014
5652 2842840376
5653 2842847753
5654 2842906550
5655 2844427170
5656 2844666432
5657 2846540833
5658 2847089452
5659 2852105597
5660 2852618200
5661 2852629990
5662 2852652221
5663 2852660978
5664 2852673258
5665 2855196763
5666 2857537930
5667 2857549278
5668 2857622345
5669 2858468271
5670 2858689645
5671 2858954321
5672 2860872492
5673 2869556885
5674 2871277102
5675 2871284203
5676 2871723260
5677 2878034786
5678 2880235435
5679 2881102121
5680 2881930877
5681 2884089295
5682 2885083344
5683 2887378546
5684 2888371384
5685 2888375968
5686 2889294133
5687 2890738535
5688 2891637377
5689 2891674988
5690 2894024503
5691 2895499680
5692 2895512704
5693 2895522718
5694 2895525520
5695 2896317870
5696 2896344954
5697 2898715498
5698 2900055155
5699 2901312169
5700 2902683152
5701 2904477933
5702 2904482524
5703 2904513349
5704 2904523003
5705 2904548827
5706 2904785224
5707 2908452014
5708 2908671584
5709 2912964494
5710 2916701642
5711 2917076141
5712 2919067833
5713 2919098240
5714 2919112104
5715 2919154103
5716 2919159419
5717 2919181034
5718 2919185246
5719 2919390720
5720 2919401571
5721 2919491000
5722 2919496084
5723 2919503980
5724 2919509409
5725 2919512668
5726 2919544362
5727 2919685232
5728 2919705080
5729 2923158971
5730 2923522802
5731 2923527880
5732 2923634494
5733 2926065447
5734 2927147640
5735 2927834449
5736 2928515810
5737 2929150956
5738 2929166756
5739 2929194597
5740 2931395881
5741 2932416325
5742 2932422282
5743 2935359565
5744 2935626959
5745 2937543091
5746 2937968928
5747 2939573926
5748 2939607787
5749 2939619297
5750 2939635087
5751 2939641778
5752 2939644127
5753 2939652002
5754 2939661793
5755 2941478844
5756 2941484157
5757 2945877378
5758 2945931444
5759 2945966234
5760 2946007504
5761 2946033093
5762 2947233862
5763 2969082795
5764 2969309604
5765 2971824133
5766 2974294664
5767 2974312472
5768 2974324244
5769 2974438174
5770 2984287197
5771 2984559860
5772 2984568936
5773 2984597941
5774 2987608694
5775 2990198084
5776 2990711680
5777 2998144854
5778 3000378672
5779 3003235361
5780 3007254234
5781 3007317024
5782 3007398595
5783 3007420407
5784 3007615241
5785 3007621071
5786 3007722243
5787 3007806442
5788 3007860062
5789 3007866312
5790 3007876176
5791 640486892
5792 640940258
5793 644751668
5794 651174748
5795 8002394749
5796 8003403436
5797 8004593943
5798 8011353816
5799 8015395120
5800 8015693057
5801 8018408501
5802 8019506181
5803 8019771408
5804 8029996041
5805 8033233816
5806 8034965719
5807 8048747787
5808 8052499273
5809 8054288887
5810 8054353067
5811 8054468194
5812 8054508386
5813 8054847276
5814 8054854220
5815 8054932309
5816 8055091117
5817 8055094385
5818 8055099799
5819 8055229119
5820 8055698154
5821 8055776304
5822 8055823339
5823 8055882715
5824 8056120617
5825 8056121557
5826 8056131068
5827 8056136744
5828 8056142261
5829 8056150567
5830 8056163052
5831 8056171714
5832 8056179129
5833 8056440793
5834 8056571882
5835 8057308943
5836 8057805142

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02812

ELFV_dehydrog_N

Glu/Leu/Phe/Val dehydrogenase, dimerisation domain

112

240

0.99

PF00208

ELFV_dehydrog

Glutamate/Leucine/Phenylalanine/Valine dehydrogenase

257

508

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4fcc-assembly2.cif.gz_H glutamate dehydrogenase from e. coli 0.9917 2 438
3sbo-assembly1.cif.gz_A structure of e.coli gdh from native source 0.99 3 438
4fcc-assembly1.cif.gz_F glutamate dehydrogenase from e. coli 0.9885 2 438
3sbo-assembly1.cif.gz_D structure of e.coli gdh from native source 0.9856 2 438
3sbo-assembly1.cif.gz_B structure of e.coli gdh from native source 0.9819 2 438
ID Description Score Start End Superfamily
1aupA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.9969 46 180 3.40.50.10860
2yfhF03 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9824 200 363 3.40.50.720
1aupA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.9824 46 180 3.40.50.10860
2yfhF03 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9707 200 363 3.40.50.720
1b26A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.9681 49 190 3.40.50.10860
ID Description Score Start End GO Terms
AF-A0A448QPU3-F1-model_v4 deleted 1.003 65 177
AF-A0A4Y5LSJ0-F1-model_v4 Glutamate dehydrogenase 1.002 51 176 GO:0004354
GO:0005829
GO:0006537
AF-A0A8A3WQ59-F1-model_v4 glutamate dehydrogenase (NADP(+)) (EC 1.4.1.4) 1.001 75 192 GO:0004354
GO:0005829
GO:0006537
AF-A0A7G7WZQ1-F1-model_v4 glutamate dehydrogenase (NADP(+)) (EC 1.4.1.4) 1.001 79 189 GO:0004354
GO:0005829
GO:0006537
AF-A0A3D0FH88-F1-model_v4 deleted 1.001 55 158

Map