F497282

General Info

Members Datasets Scaffolds Average Seq Length
3308 1006 2945 284

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0301448|Ga0451577_0301448_61_1056
Length 331
Sequence MRTMTETGMSSSKPNSTDDRVQAAGRLPFLVRMNLLPAAWRGRQREGMVENRPLLSFVSHLALMIGIAIVALPIYITFVASTLAPDEVLQSPMPMRPGSHLVENYRQVLEQGATGTNVTSAPVGRMMFNSLVTALLIAFGKIAISLLSAFAIVYFRXXXXALAFWMIFVTLMLPVEVRILPSYKVVSDLHLIDTYAGLTLPLIASATATFLFRQFFLTIPDELAEAARIDGAGPMRFFRDVVIPLSRPNIAALFVILFIFGWNQYLWPLLVTTDESMYTTVIGIKRMIAGGEAATEWNLVMATAILALVPPALVVVLMQKWFVKGLVDTEK

Samples

Sample ID Description Type Environment
1 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
4 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
5 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
6 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
7 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
8 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
9 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
10 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
11 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
12 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
13 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
14 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
15 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
16 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
17 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
18 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
19 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
20 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
21 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
22 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
23 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
24 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
25 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
26 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
27 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
28 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
29 2519103095 Burkholderia sp. KJ006 Isolate Nodule
30 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
31 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
32 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
33 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
34 2547132181 Kosakonia sacchari SP1 Isolate Stem
35 2547132374 Acidovorax radicis N35 Isolate Unclassified
36 2547132416 Enterobacter sp. MR1 Isolate Rhizoplane
37 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
38 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
39 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
40 2561511199 Enterobacter sp. R4-368 Isolate Nodule
41 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
42 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
43 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
44 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
45 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
46 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
47 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
48 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
49 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
50 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
51 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
52 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
53 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
54 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
55 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
56 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
57 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
58 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
59 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
60 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
61 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
62 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
63 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
64 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
65 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
66 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
67 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
68 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
69 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
70 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
71 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
72 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
73 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
74 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
75 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
76 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
77 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
78 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
79 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
80 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
81 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
82 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
83 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
84 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
85 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
86 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
87 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
88 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
89 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
90 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
91 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
92 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
93 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
94 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
95 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
96 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
97 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
98 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
99 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
100 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
101 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
102 2636415599 Klebsiella variicola DX120E Isolate Unclassified
103 2643221569 Achromobacter sp. Root565 Isolate Unclassified
104 2643221570 Acidovorax sp. Root568 Isolate Unclassified
105 2643221594 Achromobacter sp. Root170 Isolate Unclassified
106 2643221596 Acidovorax sp. Root70 Isolate Unclassified
107 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
108 2643221621 Achromobacter sp. Root83 Isolate Unclassified
109 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
110 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
111 2643221652 Acidovorax sp. Root402 Isolate Unclassified
112 2643221658 Variovorax sp. Root411 Isolate Unclassified
113 2643221672 Variovorax sp. Root434 Isolate Unclassified
114 2643221683 Variovorax sp. Root473 Isolate Unclassified
115 2643221717 Acidovorax sp. Root267 Isolate Unclassified
116 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
117 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
118 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
119 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
120 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
121 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
122 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
123 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
124 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
125 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
126 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
127 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
128 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
129 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
130 2721755523 Delftia sp. HK171 Isolate Unclassified
131 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
132 2738541277 Variovorax sp. GV051 Isolate Unclassified
133 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
134 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
135 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
136 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
137 2738541307 Variovorax sp. GV008 Isolate Unclassified
138 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
139 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
140 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
141 2738543013 Variovorax sp. BT01 Isolate Unclassified
142 2738543019 Variovorax sp. GV040 Isolate Unclassified
143 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
144 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
145 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
146 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
147 2751185917 Enterobacter sp. HK169 Isolate Unclassified
148 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
149 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
150 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
151 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
152 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
153 2775507074 Klebsiella sp. D5A Isolate Unclassified
154 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
155 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
156 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
157 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
158 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
159 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
160 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
161 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
162 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
163 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
164 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
165 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
166 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
167 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
168 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
169 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
170 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
171 2818991436 Collimonas arenae 515 Isolate Unclassified
172 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
173 2818991446 Variovorax sp. 1180 Isolate Unclassified
174 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
175 2818991450 Burkholderia sp. 604 Isolate Unclassified
176 2818991452 Burkholderia cepacia 561 Isolate Unclassified
177 2821118458 Enterobacter asburiae 609 Isolate Unclassified
178 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
179 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
180 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
181 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
182 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
183 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
184 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
185 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
186 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
187 2842677519 Variovorax sp. R-72495 Isolate Unclassified
188 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
189 2842733646 Variovorax sp. R-72446 Isolate Unclassified
190 2842747753 Variovorax sp. R-72060 Isolate Unclassified
191 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
192 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
193 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
194 2847085930 Erwinia persicina B64 Isolate Bulb
195 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
196 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
197 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
198 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
199 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
200 2855730933 Achromobacter sp. HZ28 Isolate Nodule
201 2855767633 Achromobacter sp. HZ34 Isolate Nodule
202 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
203 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
204 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
205 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
206 2858950400 Achromobacter sp. K91 Isolate Unclassified
207 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
208 2865014394 Pantoea sp. R-71966 Isolate Unclassified
209 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
210 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
211 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
212 2876601092 Pantoea endophytica 596 Isolate Unclassified
213 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
214 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
215 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
216 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
217 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
218 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
219 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
220 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
221 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
222 2885198086 Variovorax sp. 679 Isolate Unclassified
223 2885211737 Variovorax sp. 553 Isolate Unclassified
224 2885266251 Ralstonia sp. SET104 Isolate Nodule
225 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
226 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
227 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
228 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
229 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
230 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
231 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
232 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
233 2899259804 Paracoccus aeridis JC501 Isolate Rhizosphere
234 2899924645 Variovorax sp. 369 Isolate Unclassified
235 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
236 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
237 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
238 2902330777 Methylobacterium sp. 2A Isolate Unclassified
239 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
240 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
241 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
242 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
243 2904456579 Variovorax sp. 2002 Isolate Unclassified
244 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
245 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
246 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
247 2904504865 Serratia marcescens 1822 Isolate Unclassified
248 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
249 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
250 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
251 2904564687 Burkholderia sp. 571 Isolate Unclassified
252 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
253 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
254 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
255 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
256 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
257 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
258 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
259 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
260 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
261 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
262 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
263 2919150387 Rahnella aceris 1817 Isolate Unclassified
264 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
265 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
266 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
267 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
268 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
269 2927143783 Rahnella sp. 2050 Isolate Unclassified
270 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
271 2928037797 Variovorax sp. 1126 Isolate Unclassified
272 2928044640 Variovorax sp. 1128 Isolate Unclassified
273 2928051484 Variovorax sp. 1133 Isolate Unclassified
274 2928058823 Ralstonia sp. 1138 Isolate Unclassified
275 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
276 2928070936 Variovorax gossypii 1167 Isolate Unclassified
277 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
278 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
279 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
280 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
281 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
282 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
283 2928163908 Burkholderia sp. 567 Isolate Unclassified
284 2928170801 Burkholderia sp. 572 Isolate Unclassified
285 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
286 2928536128 Burkholderia sola 565 Isolate Unclassified
287 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
288 2929520902 Variovorax beijingensis 502 Isolate Unclassified
289 2932406140 Serratia sp. 2723 Isolate Rhizosphere
290 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
291 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
292 2937539931 Pantoea sp. LS15 Isolate Unclassified
293 2937967321 Serratia sp. YC16 Isolate Unclassified
294 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
295 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
296 2939577877 Serratia sp. 509 Isolate Rhizosphere
297 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
298 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
299 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
300 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
301 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
302 2941479691
303 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
304 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
305 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
306 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
307 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
308 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
309 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
310 2952252522 Salinicola sp. DM10 Isolate Unclassified
311 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
312 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
313 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
314 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
315 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
316 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
317 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
318 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
319 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
320 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
321 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
322 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
323 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
324 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
325 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
326 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
327 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
328 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
329 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
330 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
331 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
332 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
333 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
334 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
335 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
336 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
337 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
338 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
339 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
340 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
341 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
342 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
343 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
344 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
345 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
346 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
347 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
348 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
349 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
350 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
351 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
352 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
353 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
354 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
355 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
356 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
357 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
358 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
359 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
360 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
361 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
362 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
363 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
364 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
365 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
366 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
367 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
368 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
369 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
370 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
371 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
372 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
373 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
374 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
375 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
376 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
377 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
378 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
379 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
380 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
381 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
382 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
383 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
384 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
385 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
386 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
387 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
388 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
389 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
390 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
391 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
392 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
393 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
394 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
395 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
396 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
397 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
398 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
399 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
400 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
401 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
402 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
403 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
404 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
405 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
406 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
407 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
408 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
409 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
410 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
411 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
412 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
413 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
414 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
415 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
416 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
417 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
418 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
419 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
420 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
421 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
422 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
423 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
424 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
425 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
426 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
427 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
428 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
429 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
430 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
431 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
432 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
433 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
434 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
435 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
436 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
437 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
438 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
439 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
440 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
441 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
442 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
443 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
444 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
445 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
446 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
447 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
448 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
449 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
450 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
451 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
452 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
453 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
454 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
455 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
456 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
457 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
458 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
459 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
460 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
461 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
462 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
463 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
464 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
465 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
466 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
467 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
468 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
469 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
470 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
471 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
472 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
473 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
474 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
475 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
476 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
477 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
478 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
479 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
480 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
481 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
482 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
483 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
484 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
485 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
486 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
487 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
488 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
489 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
490 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
491 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
492 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
493 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
494 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
495 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
496 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
497 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
498 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
499 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
500 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
501 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
502 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
503 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
504 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
505 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
506 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
507 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
508 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
509 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
510 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
511 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
512 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
513 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
514 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
515 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
516 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
517 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
518 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
519 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
520 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
521 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
522 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
523 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
524 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
525 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
526 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
527 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
528 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
529 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
530 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
531 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
532 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
533 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
534 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
535 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
536 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
537 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
538 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
539 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
540 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
541 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
542 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
543 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
544 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
545 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
546 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
547 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
548 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
549 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
550 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
551 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
552 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
553 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
554 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
555 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
556 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
557 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
558 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
559 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
560 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
561 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
562 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
563 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
564 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
565 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
566 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
567 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
568 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
569 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
570 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
571 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
572 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
573 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
574 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
575 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
576 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
577 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
578 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
579 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
580 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
581 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
582 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
583 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
584 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
585 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
586 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
587 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
588 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
589 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
590 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
591 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
592 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
593 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
594 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
595 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
596 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
597 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
598 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
599 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
600 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
601 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
602 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
603 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
604 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
605 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
606 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
607 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
608 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
609 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
610 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
611 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
612 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
613 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
614 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
615 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
616 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
617 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
618 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
619 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
620 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
621 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
622 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
623 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
624 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
625 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
626 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
627 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
628 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
629 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
630 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
631 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
632 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
633 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
634 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
635 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
636 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
637 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
638 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
639 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
640 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
641 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
642 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
643 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
644 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
645 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
646 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
647 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
648 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
649 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
650 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
651 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
652 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
653 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
654 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
655 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
656 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
657 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
658 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
659 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
660 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
661 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
662 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
663 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
664 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
665 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
666 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
667 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
668 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
669 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
670 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
671 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
672 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
673 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
674 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
675 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
676 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
677 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
678 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
679 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
680 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
681 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
682 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
683 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
684 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
685 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
686 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
687 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
688 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
689 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
690 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
691 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
692 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
693 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
694 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
695 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
696 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
697 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
698 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
699 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
700 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
701 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
702 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
703 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
704 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
705 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
706 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
707 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
708 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
709 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
710 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
711 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
712 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
713 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
714 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
715 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
716 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
717 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
718 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
719 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
720 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
721 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
722 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
723 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
724 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
725 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
726 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
727 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
728 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
729 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
730 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
731 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
732 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
733 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
734 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
735 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
736 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
737 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
738 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
739 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
740 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
741 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
742 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
743 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
744 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
745 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
746 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
747 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
748 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
749 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
750 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
751 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
752 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
753 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
754 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
755 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
756 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
757 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
758 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
759 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
760 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
761 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
762 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
763 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
764 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
765 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
766 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
767 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
768 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
769 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
770 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
771 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
772 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
773 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
774 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
775 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
776 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
777 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
778 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
779 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
780 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
781 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
782 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
783 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
784 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
785 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
786 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
787 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
788 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
789 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
790 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
791 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
792 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
793 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
794 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
795 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
796 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
797 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
798 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
799 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
800 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
801 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
802 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
803 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
804 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
805 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
806 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
807 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
808 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
809 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
810 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
811 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
812 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
813 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
814 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
815 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
816 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
817 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
818 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
819 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
820 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
821 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
822 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
823 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
824 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
825 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
826 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
827 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
828 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
829 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
830 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
831 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
832 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
833 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
834 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
835 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
836 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
837 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
838 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
839 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
840 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
841 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
842 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
843 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
844 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
845 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
846 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
847 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
848 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
849 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
850 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
851 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
852 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
853 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
854 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
855 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
856 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
857 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
858 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
859 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
860 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
861 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
862 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
863 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
864 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
865 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
866 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
867 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
868 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
869 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
870 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
871 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
872 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
873 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
874 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
875 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
876 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
877 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
878 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
879 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
880 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
881 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
882 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
883 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
884 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
885 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
886 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
887 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
888 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
889 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
890 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
891 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
892 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
893 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
894 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
895 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
896 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
897 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
898 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
899 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
900 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
901 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
902 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
903 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
904 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
905 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
906 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
907 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
908 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
909 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
910 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
911 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
912 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
913 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
914 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
915 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
916 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
917 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
918 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
919 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
920 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
921 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
922 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
923 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
924 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
925 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
926 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
927 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
928 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
929 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
930 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
931 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
932 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
933 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
934 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
935 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
936 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
937 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
938 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
939 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
940 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
941 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
942 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
943 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
944 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
945 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
946 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
947 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
948 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
949 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
950 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
951 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
952 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
953 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
954 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
955 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
956 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
957 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
958 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
959 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
960 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
961 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
962 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
963 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
964 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
965 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
966 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
967 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
968 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
969 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
970 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
971 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
972 641522639 Methylobacterium sp. 4-46 Isolate Nodule
973 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
974 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
975 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
976 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
977 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
978 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
979 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
980 8004592986 Serratia sp. S119 Isolate Unclassified
981 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
982 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
983 8018221730 Enterobacter sp. CM29 Isolate Unclassified
984 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
985 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
986 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
987 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
988 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
989 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
990 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
991 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
992 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
993 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
994 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
995 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
996 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified
997 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
998 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
999 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
1000 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
1001 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
1002 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
1003 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
1004 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule
1005 8055693939 Hafnia alvei A23BA Isolate Rhizosphere
1006 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.97
Metatranscriptomes 0.06
Isolates 10.97

Biome Distribution

Category Percentage (%)
Aerial Root 0.18
Bulb 0.03
Endosphere 10.55
Nodule 1.66
Rhizoplane 3.99
Rhizosphere 72.46
Stem 0.03
Stem Tuber 0.18
Unclassified 10.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 RicEn_C429 2010549000 Bacteria 10444
2 SwRhRL2b_contig_2732836 2162886007 Bacteria 2587
3 SwRhRL2b_contig_2885856 2162886007 Bacteria 7484
4 SwRhRL2b_contig_3499265 2162886007 Bacteria 4086
5 SwRhRL2b_contig_567942 2162886007 Bacteria 1237
6 JGI24736J21556_1010718 3300001904 Bacteria 1496
7 JGI24741J21665_1000541 3300001915 Bacteria 11539
8 JGI24740J21852_10002256 3300001979 Bacteria 8792
9 JGI24740J21852_10002326 3300001979 Bacteria 8647
10 JGI24740J21852_10004219 3300001979 Bacteria 6208
11 JGI24740J21852_10010978 3300001979 Bacteria 3463
12 JGI24739J22299_10000107 3300001989 Bacteria 25402
13 JGI24739J22299_10003223 3300001989 Bacteria 6226
14 JGI24739J22299_10003444 3300001989 Bacteria 6033
15 JGI24739J22299_10010422 3300001989 Bacteria 3452
16 JGI24739J22299_10014707 3300001989 Bacteria 2845
17 JGI24739J22299_10015174 3300001989 Bacteria 2799
18 JGI24739J22299_10021360 3300001989 Bacteria 2305
19 JGI24737J22298_10012591 3300001990 Bacteria 2756
20 JGI24735J21928_10000085 3300002067 Bacteria 35313
21 JGI24735J21928_10000389 3300002067 Bacteria 15310
22 JGI24735J21928_10018754 3300002067 Bacteria 2131
23 JGI24735J21928_10022708 3300002067 Bacteria 1907
24 JGI24735J21928_10024721 3300002067 Bacteria 1815
25 JGI25155J39150_1000022 3300002704 Bacteria 142950
26 JGI25156J39149_1000005 3300002705 Bacteria 263980
27 JGI25156J39149_1000985 3300002705 Bacteria 13512
28 JGI25156J39149_1001813 3300002705 Bacteria 8379
29 JGI25156J39149_1002127 3300002705 Bacteria 7480
30 JGI25156J39149_1003520 3300002705 Bacteria 5097
31 JGI25156J39149_1004341 3300002705 Bacteria 4349
32 JGI25156J39149_1007169 3300002705 Bacteria 2962
33 JGI25162J39368_1000001 3300002737 Bacteria 740113
34 JGI25162J39368_1002554 3300002737 Bacteria 6924
35 JGI25162J39368_1006422 3300002737 Bacteria 2036
36 JGI25154J39366_1000017 3300002738 Bacteria 252448
37 JGI25157J39369_1000003 3300002741 Bacteria 274935
38 JGI25157J39369_1000747 3300002741 Bacteria 17104
39 JGI25163J39215_1000052 3300002771 Bacteria 51761
40 JGI25164J39214_1000095 3300002772 Bacteria 87499
41 JGI25152J39213_1000722 3300002773 Bacteria 17031
42 JGI25150J39212_1001994 3300002774 Bacteria 5335
43 JGI25159J45721_1001646 3300002987 Bacteria 9081
44 JGI25159J45721_1001983 3300002987 Bacteria 8149
45 JGI25159J45721_1011053 3300002987 Bacteria 2243
46 JGI25151J46595_10002224 3300003187 Bacteria 11981
47 JGI25151J46595_10002783 3300003187 Bacteria 10136
48 JGI25151J46595_10005185 3300003187 Bacteria 6760
49 JGI25151J46595_10019135 3300003187 Bacteria 2917
50 JGI25165J46597_1000001 3300003214 Bacteria 1111887
51 JGI25165J46597_1002016 3300003214 Bacteria 7754
52 rootH1_10025483 3300003323 Bacteria 1198
53 JGI25160J50197_1000273 3300003354 Bacteria 38119
54 JGI25160J50197_1000412 3300003354 Bacteria 27298
55 JGI25161J50226_1000095 3300003374 Bacteria 72343
56 Ga0055538_1000001 3300003751 Bacteria 1111887
57 Ga0055538_1000077 3300003751 Bacteria 87507
58 Ga0055538_1000141 3300003751 Bacteria 50563
59 Ga0055538_1002889 3300003751 Bacteria 2341
60 Ga0055539_1000001 3300003752 Bacteria 1111887
61 Ga0055539_1000114 3300003752 Bacteria 89618
62 Ga0055539_1000192 3300003752 Bacteria 50563
63 Ga0055533_1000003 3300003756 Bacteria 1111887
64 Ga0055533_1000122 3300003756 Bacteria 89163
65 Ga0055533_1000192 3300003756 Bacteria 50563
66 Ga0055533_1000272 3300003756 Bacteria 28248
67 Ga0055533_1002282 3300003756 Bacteria 4455
68 Ga0055532_1000002 3300003758 Bacteria 576000
69 Ga0055532_1000029 3300003758 Bacteria 232900
70 Ga0055532_1000092 3300003758 Bacteria 103243
71 Ga0055532_1000271 3300003758 Bacteria 33888
72 Ga0055532_1004381 3300003758 Bacteria 2148
73 Ga0055525_1000003 3300003759 Bacteria 962094
74 Ga0055525_1000155 3300003759 Bacteria 91530
75 Ga0055525_1000260 3300003759 Bacteria 50563
76 Ga0055527_1000035 3300003760 Bacteria 138481
77 Ga0055527_1000913 3300003760 Bacteria 7390
78 Ga0055527_1000981 3300003760 Bacteria 6942
79 Ga0055527_1001088 3300003760 Bacteria 6375
80 Ga0055535_1000050 3300003761 Bacteria 138481
81 Ga0055535_1000380 3300003761 Bacteria 42008
82 Ga0055535_1002482 3300003761 Bacteria 6375
83 Ga0055535_1002486 3300003761 Bacteria 6362
84 Ga0055535_1006572 3300003761 Bacteria 2331
85 Ga0055542_1000062 3300003762 Bacteria 161494
86 Ga0055542_1000120 3300003762 Bacteria 103243
87 Ga0055542_1002079 3300003762 Bacteria 7460
88 Ga0055542_1003286 3300003762 Bacteria 4491
89 Ga0055529_1000062 3300003763 Bacteria 183782
90 Ga0055529_1000089 3300003763 Bacteria 138481
91 Ga0055529_1000604 3300003763 Bacteria 27748
92 Ga0055526_1005266 3300003771 Bacteria 7494
93 Ga0055526_1010582 3300003771 Bacteria 4272
94 Ga0055526_1028546 3300003771 Bacteria 1684
95 Ga0055537_1000483 3300003773 Bacteria 24708
96 Ga0055537_1000677 3300003773 Bacteria 17891
97 Ga0055537_1000717 3300003773 Bacteria 17146
98 Ga0055524_1000073 3300003775 Bacteria 123033
99 Ga0055536_1004647 3300003781 Bacteria 6945
100 Ga0055536_1007734 3300003781 Bacteria 4755
101 Ga0055536_1008270 3300003781 Bacteria 4503
102 Ga0055536_1014872 3300003781 Bacteria 2700
103 Ga0055534_1000337 3300003784 Bacteria 30592
104 Ga0055534_1000467 3300003784 Bacteria 22933
105 Ga0055534_1000548 3300003784 Bacteria 20007
106 Ga0055534_1013385 3300003784 Bacteria 1578
107 Ga0055534_1013418 3300003784 Bacteria 1575
108 Ga0055528_1001984 3300003790 Bacteria 11532
109 Ga0055528_1007433 3300003790 Bacteria 4844
110 Ga0055528_1030303 3300003790 Bacteria 1439
111 Ga0055530_10001136 3300003791 Bacteria 20712
112 Ga0055530_10001548 3300003791 Bacteria 16519
113 Ga0055530_10027339 3300003791 Bacteria 1560
114 Ga0055540_1000037 3300003792 Bacteria 162957
115 Ga0055540_1000202 3300003792 Bacteria 57757
116 Ga0055540_1006735 3300003792 Bacteria 4496
117 Ga0055531_10000112 3300003794 Bacteria 89016
118 Ga0055531_10001286 3300003794 Bacteria 18915
119 Ga0055531_10002327 3300003794 Bacteria 12826
120 Ga0055541_1000001 3300003841 Bacteria 1111887
121 Ga0055541_1000078 3300003841 Bacteria 88505
122 Ga0055541_1000127 3300003841 Bacteria 50563
123 Ga0055541_1014898 3300003841 Bacteria 1047
124 Ga0058692_1000039 3300003856 Bacteria 133315
125 Ga0058692_1000291 3300003856 Bacteria 25903
126 Ga0058692_1000442 3300003856 Bacteria 18875
127 Ga0058692_1000709 3300003856 Bacteria 13656
128 Ga0058692_1001289 3300003856 Bacteria 9523
129 Ga0058692_1002728 3300003856 Bacteria 5808
130 Ga0058692_1003453 3300003856 Bacteria 4872
131 Ga0058692_1007004 3300003856 Bacteria 3034
132 Ga0058692_1008157 3300003856 Bacteria 2714
133 Ga0058692_1009172 3300003856 Bacteria 2509
134 Ga0058692_1014082 3300003856 Bacteria 1842
135 Ga0055543_1000218 3300004625 Bacteria 46120
136 Ga0055543_1001979 3300004625 Bacteria 7289
137 Ga0065165_1001344 3300005262 Bacteria 27213
138 Ga0065165_1006946 3300005262 Bacteria 5740
139 Ga0065165_1021206 3300005262 Bacteria 2263
140 Ga0065714_10012771 3300005288 Bacteria 3360
141 Ga0065714_10112520 3300005288 Bacteria 1444
142 Ga0065704_10000716 3300005289 Bacteria 13341
143 Ga0065704_10001392 3300005289 Bacteria 10240
144 Ga0065704_10004338 3300005289 Bacteria 5501
145 Ga0065704_10072179 3300005289 Bacteria 9000
146 Ga0065704_10074644 3300005289 Bacteria 6090
147 Ga0065704_10079023 3300005289 Bacteria 4279
148 Ga0065704_10152386 3300005289 Bacteria 1418
149 Ga0065704_10173348 3300005289 Bacteria 1278
150 Ga0065712_10142020 3300005290 Bacteria 1442
151 Ga0065715_10128737 3300005293 Bacteria 2060
152 Ga0065715_10163950 3300005293 Bacteria 1603
153 Ga0065707_10010916 3300005295 Bacteria 2712
154 Ga0065707_10131877 3300005295 Bacteria 1906
155 Ga0065707_10174260 3300005295 Bacteria 1462
156 Ga0065707_10179063 3300005295 Bacteria 1430
157 Ga0070658_10003011 3300005327 Bacteria 13938
158 Ga0070658_10003070 3300005327 Bacteria 13784
159 Ga0070658_10009688 3300005327 Bacteria 7735
160 Ga0070658_10078984 3300005327 Bacteria 2701
161 Ga0070658_10083909 3300005327 Bacteria 2619
162 Ga0070658_10302069 3300005327 Bacteria 1365
163 Ga0070676_10008354 3300005328 Bacteria 5579
164 Ga0070676_10142800 3300005328 Bacteria 1526
165 Ga0070676_10201166 3300005328 Bacteria 1306
166 Ga0070676_10238008 3300005328 Bacteria 1209
167 Ga0070683_100048450 3300005329 Bacteria 3929
168 Ga0070683_100166675 3300005329 Bacteria 2090
169 Ga0070683_100251524 3300005329 Bacteria 1681
170 Ga0070690_100003946 3300005330 Bacteria 8191
171 Ga0070690_100026479 3300005330 Bacteria 3577
172 Ga0070690_100052025 3300005330 Bacteria 2617
173 Ga0070670_100003522 3300005331 Bacteria 13011
174 Ga0070670_100009835 3300005331 Bacteria 8170
175 Ga0070670_100056008 3300005331 Bacteria 3384
176 Ga0070670_100077996 3300005331 Bacteria 2846
177 Ga0070670_100137669 3300005331 Bacteria 2110
178 Ga0070677_10053009 3300005333 Bacteria 1647
179 Ga0068869_100001725 3300005334 Bacteria 13059
180 Ga0068869_100005071 3300005334 Bacteria 8256
181 Ga0068869_100028095 3300005334 Bacteria 3927
182 Ga0068869_100059897 3300005334 Bacteria 2789
183 Ga0068869_100237820 3300005334 Bacteria 1450
184 Ga0068869_100305374 3300005334 Bacteria 1286
185 Ga0070666_10004005 3300005335 Bacteria 8943
186 Ga0070666_10005999 3300005335 Bacteria 7465
187 Ga0070666_10027838 3300005335 Bacteria 3705
188 Ga0070666_10055036 3300005335 Bacteria 2685
189 Ga0070666_10109761 3300005335 Bacteria 1907
190 Ga0070666_10122835 3300005335 Bacteria 1801
191 Ga0070666_10257948 3300005335 Bacteria 1235
192 Ga0070680_100000926 3300005336 Bacteria 20771
193 Ga0070680_100011091 3300005336 Bacteria 6966
194 Ga0070680_100144589 3300005336 Bacteria 1995
195 Ga0070680_100178941 3300005336 Bacteria 1786
196 Ga0070680_100186700 3300005336 Bacteria 1746
197 Ga0070680_100252884 3300005336 Bacteria 1490
198 Ga0070680_100420803 3300005336 Bacteria 1140
199 Ga0070680_100481560 3300005336 Bacteria 1061
200 Ga0070682_100067176 3300005337 Bacteria 2283
201 Ga0068868_100004295 3300005338 Bacteria 9979
202 Ga0068868_100015506 3300005338 Bacteria 5638
203 Ga0068868_100019381 3300005338 Bacteria 5097
204 Ga0068868_100110631 3300005338 Bacteria 2232
205 Ga0068868_100169376 3300005338 Bacteria 1808
206 Ga0070660_100000025 3300005339 Bacteria 90277
207 Ga0070660_100002704 3300005339 Bacteria 12173
208 Ga0070660_100003261 3300005339 Bacteria 11132
209 Ga0070660_100030267 3300005339 Bacteria 4061
210 Ga0070660_100172702 3300005339 Bacteria 1746
211 Ga0070660_100183302 3300005339 Bacteria 1695
212 Ga0070660_100184472 3300005339 Bacteria 1689
213 Ga0070660_100214965 3300005339 Bacteria 1561
214 Ga0070660_100232680 3300005339 Bacteria 1499
215 Ga0070660_100245769 3300005339 Bacteria 1458
216 Ga0070689_100012094 3300005340 Bacteria 6205
217 Ga0070689_100127769 3300005340 Bacteria 2036
218 Ga0070689_100224880 3300005340 Bacteria 1541
219 Ga0070691_10006998 3300005341 Bacteria 5169
220 Ga0070661_100000077 3300005344 Bacteria 77659
221 Ga0070661_100001413 3300005344 Bacteria 16755
222 Ga0070661_100017823 3300005344 Bacteria 5040
223 Ga0070661_100067884 3300005344 Bacteria 2621
224 Ga0070661_100083144 3300005344 Bacteria 2364
225 Ga0070661_100195483 3300005344 Bacteria 1544
226 Ga0070661_100197347 3300005344 Bacteria 1536
227 Ga0070661_100205370 3300005344 Bacteria 1506
228 Ga0070661_100333418 3300005344 Bacteria 1187
229 Ga0070661_100420036 3300005344 Bacteria 1060
230 Ga0070692_10000466 3300005345 Bacteria 12396
231 Ga0070692_10028699 3300005345 Bacteria 2767
232 Ga0070692_10085997 3300005345 Bacteria 1701
233 Ga0070692_10095069 3300005345 Bacteria 1625
234 Ga0070668_100010679 3300005347 Bacteria 6828
235 Ga0070668_100019151 3300005347 Bacteria 5147
236 Ga0070668_100036477 3300005347 Bacteria 3752
237 Ga0070668_100188905 3300005347 Bacteria 1686
238 Ga0070669_100073948 3300005353 Bacteria 2526
239 Ga0070669_100093894 3300005353 Bacteria 2254
240 Ga0070669_100145895 3300005353 Bacteria 1829
241 Ga0070675_100025547 3300005354 Bacteria 4735
242 Ga0070675_100031854 3300005354 Bacteria 4265
243 Ga0070675_100035472 3300005354 Bacteria 4053
244 Ga0070675_100037288 3300005354 Bacteria 3959
245 Ga0070675_100156515 3300005354 Bacteria 1957
246 Ga0070675_100209527 3300005354 Bacteria 1694
247 Ga0070675_100300364 3300005354 Bacteria 1414
248 Ga0070675_100394181 3300005354 Bacteria 1234
249 Ga0070675_100529622 3300005354 Bacteria 1064
250 Ga0070675_100557702 3300005354 Bacteria 1036
251 Ga0070675_100560516 3300005354 Bacteria 1034
252 Ga0070671_100016334 3300005355 Bacteria 6002
253 Ga0070671_100026912 3300005355 Bacteria 4731
254 Ga0070674_100038940 3300005356 Bacteria 3207
255 Ga0070674_100042873 3300005356 Bacteria 3076
256 Ga0070674_100209603 3300005356 Bacteria 1509
257 Ga0070674_100278682 3300005356 Bacteria 1324
258 Ga0070673_100022597 3300005364 Bacteria 4582
259 Ga0070673_100064583 3300005364 Bacteria 2917
260 Ga0070673_100106446 3300005364 Bacteria 2319
261 Ga0070673_100118956 3300005364 Bacteria 2200
262 Ga0070673_100469855 3300005364 Bacteria 1134
263 Ga0070688_100023345 3300005365 Bacteria 3637
264 Ga0070688_100101736 3300005365 Bacteria 1896
265 Ga0070688_100130439 3300005365 Bacteria 1695
266 Ga0070688_100207608 3300005365 Bacteria 1373
267 Ga0070659_100000642 3300005366 Bacteria 25585
268 Ga0070659_100018465 3300005366 Bacteria 5263
269 Ga0070659_100047862 3300005366 Bacteria 3356
270 Ga0070659_100052631 3300005366 Bacteria 3203
271 Ga0070659_100054288 3300005366 Bacteria 3156
272 Ga0070659_100123635 3300005366 Bacteria 2098
273 Ga0070659_100130229 3300005366 Bacteria 2043
274 Ga0070659_100135197 3300005366 Bacteria 2005
275 Ga0070659_100138483 3300005366 Bacteria 1980
276 Ga0070659_100154116 3300005366 Bacteria 1876
277 Ga0070659_100600432 3300005366 Bacteria 946
278 Ga0070667_100004686 3300005367 Bacteria 11474
279 Ga0070667_100024560 3300005367 Bacteria 5006
280 Ga0070667_100046106 3300005367 Bacteria 3666
281 Ga0070667_100098947 3300005367 Bacteria 2517
282 Ga0070667_100145749 3300005367 Bacteria 2077
283 Ga0070667_100213821 3300005367 Bacteria 1714
284 Ga0070667_100635658 3300005367 Bacteria 985
285 Ga0070703_10044034 3300005406 Bacteria 1402
286 Ga0070709_10023108 3300005434 Bacteria 3646
287 Ga0070709_10144152 3300005434 Bacteria 1639
288 Ga0070714_100005684 3300005435 Bacteria 9547
289 Ga0070714_100009252 3300005435 Bacteria 7741
290 Ga0070714_100105328 3300005435 Bacteria 2490
291 Ga0070714_100149591 3300005435 Bacteria 2103
292 Ga0070714_100222057 3300005435 Bacteria 1737
293 Ga0070714_100296999 3300005435 Bacteria 1505
294 Ga0070713_100000045 3300005436 Bacteria 77398
295 Ga0070713_100028021 3300005436 Bacteria 4443
296 Ga0070713_100346055 3300005436 Bacteria 1378
297 Ga0070710_10066861 3300005437 Bacteria 2061
298 Ga0070710_10099053 3300005437 Bacteria 1733
299 Ga0070701_10046778 3300005438 Bacteria 2226
300 Ga0070701_10057448 3300005438 Bacteria 2040
301 Ga0070701_10108013 3300005438 Bacteria 1551
302 Ga0070701_10118689 3300005438 Bacteria 1487
303 Ga0070705_100009640 3300005440 Bacteria 4807
304 Ga0070705_100082987 3300005440 Bacteria 1973
305 Ga0070705_100129920 3300005440 Bacteria 1641
306 Ga0070705_100145374 3300005440 Bacteria 1566
307 Ga0070700_100000839 3300005441 Bacteria 15145
308 Ga0070700_100006753 3300005441 Bacteria 6147
309 Ga0070700_100039918 3300005441 Bacteria 2870
310 Ga0070700_100077894 3300005441 Bacteria 2133
311 Ga0070700_100114998 3300005441 Bacteria 1794
312 Ga0070700_100127895 3300005441 Bacteria 1710
313 Ga0070694_100000826 3300005444 Bacteria 17365
314 Ga0070694_100014909 3300005444 Bacteria 4869
315 Ga0070694_100027045 3300005444 Bacteria 3722
316 Ga0070694_100042777 3300005444 Bacteria 3027
317 Ga0070708_100000371 3300005445 Bacteria 33951
318 Ga0070708_100077599 3300005445 Bacteria 3002
319 Ga0070708_100128321 3300005445 Bacteria 2346
320 Ga0070708_100351189 3300005445 Bacteria 1390
321 Ga0070663_100000011 3300005455 Bacteria 146097
322 Ga0070663_100010000 3300005455 Bacteria 5897
323 Ga0070663_100051160 3300005455 Bacteria 2942
324 Ga0070663_100075734 3300005455 Bacteria 2460
325 Ga0070663_100124093 3300005455 Bacteria 1954
326 Ga0070663_100136535 3300005455 Bacteria 1868
327 Ga0070663_100181372 3300005455 Bacteria 1634
328 Ga0070663_100267243 3300005455 Bacteria 1358
329 Ga0070663_100302292 3300005455 Bacteria 1281
330 Ga0070678_100001525 3300005456 Bacteria 12365
331 Ga0070678_100002784 3300005456 Bacteria 9665
332 Ga0070678_100022766 3300005456 Bacteria 4160
333 Ga0070678_100074180 3300005456 Bacteria 2556
334 Ga0070678_100092488 3300005456 Bacteria 2323
335 Ga0070678_100097502 3300005456 Bacteria 2270
336 Ga0070678_100135102 3300005456 Bacteria 1966
337 Ga0070678_100455021 3300005456 Bacteria 1122
338 Ga0070662_100015748 3300005457 Bacteria 5069
339 Ga0070662_100020556 3300005457 Bacteria 4497
340 Ga0070662_100024044 3300005457 Bacteria 4193
341 Ga0070662_100048302 3300005457 Bacteria 3065
342 Ga0070662_100221517 3300005457 Bacteria 1510
343 Ga0070662_100288375 3300005457 Bacteria 1330
344 Ga0070662_100291680 3300005457 Bacteria 1323
345 Ga0070662_100400403 3300005457 Bacteria 1133
346 Ga0070662_100437345 3300005457 Bacteria 1084
347 Ga0070681_10015201 3300005458 Bacteria 7656
348 Ga0070681_10028617 3300005458 Bacteria 5603
349 Ga0070681_10035599 3300005458 Bacteria 5001
350 Ga0070681_10041429 3300005458 Bacteria 4615
351 Ga0070681_10079093 3300005458 Bacteria 3245
352 Ga0070681_10307947 3300005458 Bacteria 1493
353 Ga0068867_100000081 3300005459 Bacteria 59361
354 Ga0068867_100001697 3300005459 Bacteria 15357
355 Ga0068867_100002737 3300005459 Bacteria 12428
356 Ga0068867_100005994 3300005459 Bacteria 8617
357 Ga0068867_100014474 3300005459 Bacteria 5590
358 Ga0068867_100027466 3300005459 Bacteria 4091
359 Ga0068867_100047301 3300005459 Bacteria 3162
360 Ga0068867_100071657 3300005459 Bacteria 2593
361 Ga0068867_100316556 3300005459 Bacteria 1291
362 Ga0068867_100493226 3300005459 Bacteria 1051
363 Ga0070706_100000463 3300005467 Bacteria 48079
364 Ga0070706_100025322 3300005467 Bacteria 5460
365 Ga0070706_100160895 3300005467 Bacteria 2096
366 Ga0070706_100411718 3300005467 Bacteria 1259
367 Ga0070707_100014407 3300005468 Bacteria 7412
368 Ga0070707_100016835 3300005468 Bacteria 6864
369 Ga0070707_100120098 3300005468 Bacteria 2552
370 Ga0070707_100519028 3300005468 Bacteria 1153
371 Ga0070698_100063925 3300005471 Bacteria 3710
372 Ga0070698_100114841 3300005471 Bacteria 2657
373 Ga0070698_100368870 3300005471 Bacteria 1368
374 Ga0070699_100012659 3300005518 Bacteria 7276
375 Ga0070699_100019325 3300005518 Bacteria 5865
376 Ga0070699_100037364 3300005518 Bacteria 4201
377 Ga0070699_100043010 3300005518 Bacteria 3910
378 Ga0070699_100267640 3300005518 Bacteria 1529
379 Ga0070699_100280745 3300005518 Bacteria 1492
380 Ga0070679_100006481 3300005530 Bacteria 10910
381 Ga0070679_100027239 3300005530 Bacteria 5623
382 Ga0070679_100068292 3300005530 Bacteria 3546
383 Ga0070679_100196836 3300005530 Bacteria 1982
384 Ga0070679_100225656 3300005530 Bacteria 1833
385 Ga0070679_100431033 3300005530 Bacteria 1264
386 Ga0070679_100437035 3300005530 Bacteria 1253
387 Ga0070684_100019385 3300005535 Bacteria 5626
388 Ga0070684_100130506 3300005535 Bacteria 2266
389 Ga0070684_100191449 3300005535 Bacteria 1861
390 Ga0070684_100262902 3300005535 Bacteria 1579
391 Ga0070697_100033017 3300005536 Bacteria 4167
392 Ga0070697_100036372 3300005536 Bacteria 3977
393 Ga0070697_100038701 3300005536 Bacteria 3854
394 Ga0070697_100192702 3300005536 Bacteria 1730
395 Ga0068853_100001296 3300005539 Bacteria 17963
396 Ga0068853_100020012 3300005539 Bacteria 5561
397 Ga0068853_100020194 3300005539 Bacteria 5538
398 Ga0068853_100082163 3300005539 Bacteria 2822
399 Ga0068853_100102306 3300005539 Bacteria 2535
400 Ga0068853_100127565 3300005539 Bacteria 2274
401 Ga0068853_100211249 3300005539 Bacteria 1769
402 Ga0068853_100264422 3300005539 Bacteria 1582
403 Ga0068853_100412992 3300005539 Bacteria 1265
404 Ga0070672_100005265 3300005543 Bacteria 8557
405 Ga0070672_100045833 3300005543 Bacteria 3385
406 Ga0070672_100099627 3300005543 Bacteria 2355
407 Ga0070672_100155725 3300005543 Bacteria 1892
408 Ga0070672_100224506 3300005543 Bacteria 1576
409 Ga0070686_100035845 3300005544 Bacteria 3066
410 Ga0070686_100146440 3300005544 Bacteria 1649
411 Ga0070686_100330231 3300005544 Bacteria 1140
412 Ga0070695_100000012 3300005545 Bacteria 69784
413 Ga0070695_100061703 3300005545 Bacteria 2432
414 Ga0070695_100086398 3300005545 Bacteria 2084
415 Ga0070695_100093576 3300005545 Bacteria 2011
416 Ga0070695_100128366 3300005545 Bacteria 1744
417 Ga0070695_100268192 3300005545 Bacteria 1249
418 Ga0070696_100002468 3300005546 Bacteria 12256
419 Ga0070696_100005059 3300005546 Bacteria 8806
420 Ga0070696_100011875 3300005546 Bacteria 5838
421 Ga0070696_100057905 3300005546 Bacteria 2705
422 Ga0070696_100064246 3300005546 Bacteria 2571
423 Ga0070696_100107167 3300005546 Bacteria 2009
424 Ga0070696_100168979 3300005546 Bacteria 1615
425 Ga0070696_100211850 3300005546 Bacteria 1451
426 Ga0070693_100000113 3300005547 Bacteria 35972
427 Ga0070693_100023547 3300005547 Bacteria 3293
428 Ga0070665_100000117 3300005548 Bacteria 149831
429 Ga0070665_100028323 3300005548 Bacteria 5643
430 Ga0070665_100030015 3300005548 Bacteria 5472
431 Ga0070665_100037150 3300005548 Bacteria 4899
432 Ga0070665_100047026 3300005548 Bacteria 4331
433 Ga0070665_100054874 3300005548 Bacteria 3996
434 Ga0070665_100266465 3300005548 Bacteria 1714
435 Ga0070665_100274127 3300005548 Bacteria 1689
436 Ga0070704_100000059 3300005549 Bacteria 35749
437 Ga0070704_100010208 3300005549 Bacteria 5712
438 Ga0070704_100010359 3300005549 Bacteria 5670
439 Ga0070704_100066502 3300005549 Bacteria 2599
440 Ga0070704_100219893 3300005549 Bacteria 1544
441 Ga0070704_100461191 3300005549 Bacteria 1096
442 Ga0068855_100000651 3300005563 Bacteria 42448
443 Ga0068855_100002969 3300005563 Bacteria 20734
444 Ga0068855_100003799 3300005563 Bacteria 18464
445 Ga0068855_100016883 3300005563 Bacteria 8778
446 Ga0068855_100020624 3300005563 Bacteria 7902
447 Ga0068855_100036519 3300005563 Bacteria 5848
448 Ga0068855_100067427 3300005563 Bacteria 4169
449 Ga0068855_100076357 3300005563 Bacteria 3889
450 Ga0068855_100080806 3300005563 Bacteria 3769
451 Ga0068855_100133389 3300005563 Bacteria 2834
452 Ga0068855_100177365 3300005563 Bacteria 2410
453 Ga0068855_100194088 3300005563 Bacteria 2288
454 Ga0068855_100316998 3300005563 Bacteria 1724
455 Ga0068855_100479300 3300005563 Bacteria 1354
456 Ga0068855_100492947 3300005563 Bacteria 1332
457 Ga0070664_100000002 3300005564 Bacteria 458815
458 Ga0070664_100003038 3300005564 Bacteria 13572
459 Ga0070664_100023069 3300005564 Bacteria 5136
460 Ga0070664_100028363 3300005564 Bacteria 4656
461 Ga0070664_100065448 3300005564 Bacteria 3101
462 Ga0070664_100083711 3300005564 Bacteria 2752
463 Ga0070664_100199924 3300005564 Bacteria 1783
464 Ga0070664_100218858 3300005564 Bacteria 1703
465 Ga0068857_100000017 3300005577 Bacteria 97445
466 Ga0068857_100000810 3300005577 Bacteria 23378
467 Ga0068857_100002261 3300005577 Bacteria 15660
468 Ga0068857_100006146 3300005577 Bacteria 10261
469 Ga0068857_100077975 3300005577 Bacteria 2957
470 Ga0068857_100141742 3300005577 Bacteria 2173
471 Ga0068857_100166089 3300005577 Bacteria 2004
472 Ga0068857_100198883 3300005577 Bacteria 1827
473 Ga0068857_100201006 3300005577 Bacteria 1817
474 Ga0068857_100238205 3300005577 Bacteria 1665
475 Ga0068857_100309183 3300005577 Bacteria 1458
476 Ga0068857_100361859 3300005577 Bacteria 1345
477 Ga0068854_100000043 3300005578 Bacteria 92551
478 Ga0068854_100000572 3300005578 Bacteria 22058
479 Ga0068854_100006155 3300005578 Bacteria 7617
480 Ga0068854_100016437 3300005578 Bacteria 4933
481 Ga0068854_100017824 3300005578 Bacteria 4759
482 Ga0068854_100026698 3300005578 Bacteria 3971
483 Ga0068854_100242754 3300005578 Bacteria 1435
484 Ga0068854_100354060 3300005578 Bacteria 1202
485 Ga0068854_100482182 3300005578 Bacteria 1041
486 Ga0068856_100000009 3300005614 Bacteria 181448
487 Ga0068856_100003497 3300005614 Bacteria 15861
488 Ga0068856_100014288 3300005614 Bacteria 7678
489 Ga0068856_100052020 3300005614 Bacteria 4038
490 Ga0068856_100079148 3300005614 Bacteria 3259
491 Ga0068856_100086034 3300005614 Bacteria 3123
492 Ga0068856_100227250 3300005614 Bacteria 1882
493 Ga0068856_100283983 3300005614 Bacteria 1672
494 Ga0068856_100302699 3300005614 Bacteria 1617
495 Ga0068856_100333356 3300005614 Bacteria 1535
496 Ga0068856_100455965 3300005614 Bacteria 1299
497 Ga0070702_100000275 3300005615 Bacteria 17550
498 Ga0068852_100001129 3300005616 Bacteria 17663
499 Ga0068852_100023990 3300005616 Bacteria 4921
500 Ga0068852_100042062 3300005616 Bacteria 3867
501 Ga0068852_100045092 3300005616 Bacteria 3748
502 Ga0068852_100056504 3300005616 Bacteria 3392
503 Ga0068852_100060146 3300005616 Bacteria 3297
504 Ga0068852_100153013 3300005616 Bacteria 2147
505 Ga0068852_100204780 3300005616 Bacteria 1868
506 Ga0068852_100375982 3300005616 Bacteria 1393
507 Ga0068852_100617358 3300005616 Bacteria 1090
508 Ga0068859_100000466 3300005617 Bacteria 40002
509 Ga0068859_100003563 3300005617 Bacteria 15860
510 Ga0068859_100106044 3300005617 Bacteria 2869
511 Ga0068859_100113078 3300005617 Bacteria 2779
512 Ga0068859_100249859 3300005617 Bacteria 1864
513 Ga0068859_100614459 3300005617 Bacteria 1180
514 Ga0068864_100001455 3300005618 Bacteria 19514
515 Ga0068864_100023957 3300005618 Bacteria 5130
516 Ga0068864_100025485 3300005618 Bacteria 4981
517 Ga0068864_100062146 3300005618 Bacteria 3236
518 Ga0068864_100111774 3300005618 Bacteria 2434
519 Ga0068864_100250307 3300005618 Bacteria 1645
520 Ga0068866_10000122 3300005718 Bacteria 34190
521 Ga0068866_10017127 3300005718 Bacteria 3254
522 Ga0068866_10024274 3300005718 Bacteria 2832
523 Ga0068861_100027781 3300005719 Bacteria 4125
524 Ga0068861_100031998 3300005719 Bacteria 3869
525 Ga0068861_100072778 3300005719 Bacteria 2667
526 Ga0068861_100111133 3300005719 Bacteria 2195
527 Ga0068861_100118506 3300005719 Bacteria 2132
528 Ga0068861_100280100 3300005719 Bacteria 1435
529 Ga0068861_100438212 3300005719 Bacteria 1168
530 Ga0068851_10001481 3300005834 Bacteria 10307
531 Ga0068851_10001662 3300005834 Bacteria 9748
532 Ga0068851_10041779 3300005834 Bacteria 2306
533 Ga0068851_10077192 3300005834 Bacteria 1733
534 Ga0068851_10126862 3300005834 Bacteria 1376
535 Ga0068870_10171361 3300005840 Bacteria 1296
536 Ga0068863_100080889 3300005841 Bacteria 3078
537 Ga0068863_100090892 3300005841 Bacteria 2895
538 Ga0068863_100102350 3300005841 Bacteria 2723
539 Ga0068863_100168584 3300005841 Bacteria 2100
540 Ga0068863_100249671 3300005841 Bacteria 1714
541 Ga0068863_100271788 3300005841 Bacteria 1641
542 Ga0068863_100284228 3300005841 Bacteria 1603
543 Ga0068863_100496319 3300005841 Bacteria 1202
544 Ga0068858_100000624 3300005842 Bacteria 36860
545 Ga0068858_100005397 3300005842 Bacteria 12526
546 Ga0068858_100008387 3300005842 Bacteria 9941
547 Ga0068858_100025937 3300005842 Bacteria 5450
548 Ga0068858_100028584 3300005842 Bacteria 5178
549 Ga0068858_100095282 3300005842 Bacteria 2773
550 Ga0068858_100374558 3300005842 Bacteria 1366
551 Ga0068858_100381023 3300005842 Bacteria 1353
552 Ga0068860_100000782 3300005843 Bacteria 35765
553 Ga0068860_100004659 3300005843 Bacteria 14002
554 Ga0068860_100005775 3300005843 Bacteria 12470
555 Ga0068860_100156620 3300005843 Bacteria 2196
556 Ga0068860_100171100 3300005843 Bacteria 2098
557 Ga0068860_100304720 3300005843 Bacteria 1561
558 Ga0068860_100367618 3300005843 Bacteria 1418
559 Ga0068862_100004876 3300005844 Bacteria 11296
560 Ga0068862_100005868 3300005844 Bacteria 10231
561 Ga0068862_100007370 3300005844 Bacteria 9127
562 Ga0068862_100008013 3300005844 Bacteria 8743
563 Ga0068862_100020843 3300005844 Bacteria 5475
564 Ga0068862_100096088 3300005844 Bacteria 2586
565 Ga0068862_100197222 3300005844 Bacteria 1814
566 Ga0068862_100249904 3300005844 Bacteria 1616
567 Ga0081455_10000690 3300005937 Bacteria 43802
568 Ga0081455_10003413 3300005937 Bacteria 18272
569 Ga0081455_10114530 3300005937 Bacteria 2136
570 Ga0081538_10005156 3300005981 Bacteria 11841
571 Ga0081539_10000917 3300005985 Bacteria 55614
572 Ga0081539_10106945 3300005985 Bacteria 1415
573 Ga0070717_10253298 3300006028 Bacteria 1556
574 Ga0075365_10006309 3300006038 Bacteria 6511
575 Ga0075365_10010701 3300006038 Bacteria 5358
576 Ga0075365_10154818 3300006038 Bacteria 1595
577 Ga0075365_10157954 3300006038 Bacteria 1579
578 Ga0075368_10004485 3300006042 Bacteria 4737
579 Ga0075368_10022247 3300006042 Bacteria 2413
580 Ga0075363_100057248 3300006048 Bacteria 2091
581 Ga0075363_100146863 3300006048 Bacteria 1330
582 Ga0075363_100248052 3300006048 Bacteria 1025
583 Ga0075364_10000908 3300006051 Bacteria 15616
584 Ga0075364_10022112 3300006051 Bacteria 4013
585 Ga0075364_10048630 3300006051 Bacteria 2764
586 Ga0075364_10058124 3300006051 Bacteria 2534
587 Ga0075364_10090235 3300006051 Bacteria 2033
588 Ga0075364_10161768 3300006051 Bacteria 1511
589 Ga0075364_10167547 3300006051 Bacteria 1484
590 Ga0075432_10016158 3300006058 Bacteria 2549
591 Ga0070715_10038932 3300006163 Bacteria 1977
592 Ga0070716_100014589 3300006173 Bacteria 4027
593 Ga0075362_10005983 3300006177 Bacteria 4499
594 Ga0075362_10010722 3300006177 Bacteria 3587
595 Ga0075362_10093971 3300006177 Bacteria 1395
596 Ga0075367_10013296 3300006178 Bacteria 4420
597 Ga0075367_10118264 3300006178 Bacteria 1631
598 Ga0075369_10018308 3300006186 Bacteria 2850
599 Ga0075369_10025320 3300006186 Bacteria 2466
600 Ga0075366_10003522 3300006195 Bacteria 8269
601 Ga0075366_10007433 3300006195 Bacteria 6054
602 Ga0075366_10008592 3300006195 Bacteria 5685
603 Ga0075366_10012017 3300006195 Bacteria 4904
604 Ga0075366_10026377 3300006195 Bacteria 3403
605 Ga0075366_10027555 3300006195 Bacteria 3334
606 Ga0075366_10033284 3300006195 Bacteria 3036
607 Ga0075366_10054232 3300006195 Bacteria 2381
608 Ga0075366_10100175 3300006195 Bacteria 1738
609 Ga0075366_10126024 3300006195 Bacteria 1544
610 Ga0075366_10126212 3300006195 Bacteria 1543
611 Ga0075366_10136095 3300006195 Bacteria 1483
612 Ga0075366_10188066 3300006195 Bacteria 1255
613 Ga0075366_10212240 3300006195 Bacteria 1178
614 Ga0097621_100000698 3300006237 Bacteria 23572
615 Ga0097621_100011805 3300006237 Bacteria 6452
616 Ga0097621_100020606 3300006237 Bacteria 5082
617 Ga0097621_100026295 3300006237 Bacteria 4563
618 Ga0097621_100030047 3300006237 Bacteria 4298
619 Ga0097621_100107835 3300006237 Bacteria 2351
620 Ga0097621_100108562 3300006237 Bacteria 2343
621 Ga0097621_100116629 3300006237 Bacteria 2261
622 Ga0097621_100122443 3300006237 Bacteria 2207
623 Ga0097621_100183562 3300006237 Bacteria 1808
624 Ga0097621_100270202 3300006237 Bacteria 1494
625 Ga0075370_10001008 3300006353 Bacteria 11658
626 Ga0075370_10004338 3300006353 Bacteria 6875
627 Ga0075370_10012932 3300006353 Bacteria 4424
628 Ga0075370_10019534 3300006353 Bacteria 3692
629 Ga0075370_10029150 3300006353 Bacteria 3072
630 Ga0075370_10030112 3300006353 Bacteria 3027
631 Ga0075370_10058968 3300006353 Bacteria 2184
632 Ga0075370_10114693 3300006353 Bacteria 1566
633 Ga0075370_10122546 3300006353 Bacteria 1514
634 Ga0068871_100001353 3300006358 Bacteria 16419
635 Ga0068871_100002613 3300006358 Bacteria 12296
636 Ga0068871_100060549 3300006358 Bacteria 3089
637 Ga0068871_100078976 3300006358 Bacteria 2722
638 Ga0068871_100357119 3300006358 Bacteria 1294
639 Ga0075428_100000799 3300006844 Bacteria 32848
640 Ga0075428_100028500 3300006844 Bacteria 6178
641 Ga0075428_100038028 3300006844 Bacteria 5296
642 Ga0075428_100131858 3300006844 Bacteria 2718
643 Ga0075428_100205457 3300006844 Bacteria 2129
644 Ga0075428_100400369 3300006844 Bacteria 1471
645 Ga0075430_100003916 3300006846 Bacteria 12554
646 Ga0075430_100037035 3300006846 Bacteria 4135
647 Ga0075430_100037043 3300006846 Bacteria 4134
648 Ga0075430_100063673 3300006846 Bacteria 3097
649 Ga0075430_100085870 3300006846 Bacteria 2634
650 Ga0075430_100086294 3300006846 Bacteria 2627
651 Ga0075430_100089559 3300006846 Bacteria 2574
652 Ga0075431_100009882 3300006847 Bacteria 9579
653 Ga0075431_100040994 3300006847 Bacteria 4773
654 Ga0075431_100045869 3300006847 Bacteria 4505
655 Ga0075431_100051778 3300006847 Bacteria 4233
656 Ga0075431_100058672 3300006847 Bacteria 3972
657 Ga0075431_100274973 3300006847 Bacteria 1706
658 Ga0075433_10000171 3300006852 Bacteria 35683
659 Ga0075433_10073217 3300006852 Bacteria 3013
660 Ga0075433_10124994 3300006852 Bacteria 2284
661 Ga0075434_100016556 3300006871 Bacteria 7089
662 Ga0075434_100069148 3300006871 Bacteria 3520
663 Ga0075434_100080389 3300006871 Bacteria 3256
664 Ga0075429_100000463 3300006880 Bacteria 30330
665 Ga0075429_100000678 3300006880 Bacteria 26442
666 Ga0075429_100012319 3300006880 Bacteria 7418
667 Ga0075429_100060722 3300006880 Bacteria 3292
668 Ga0075429_100469973 3300006880 Bacteria 1102
669 Ga0068865_100000404 3300006881 Bacteria 24021
670 Ga0068865_100002880 3300006881 Bacteria 10253
671 Ga0068865_100004236 3300006881 Bacteria 8654
672 Ga0075436_100000153 3300006914 Bacteria 42824
673 Ga0075436_100000602 3300006914 Bacteria 23587
674 Ga0075436_100011502 3300006914 Bacteria 6071
675 Ga0075436_100021844 3300006914 Bacteria 4393
676 Ga0075436_100031066 3300006914 Bacteria 3676
677 Ga0075436_100072191 3300006914 Bacteria 2388
678 Ga0075436_100299174 3300006914 Bacteria 1153
679 Ga0097620_100000466 3300006931 Bacteria 40002
680 Ga0097620_100003563 3300006931 Bacteria 15860
681 Ga0097620_100106045 3300006931 Bacteria 2869
682 Ga0097620_100113077 3300006931 Bacteria 2779
683 Ga0097620_100249851 3300006931 Bacteria 1864
684 Ga0097620_100614470 3300006931 Bacteria 1180
685 Ga0079104_1000078 3300006946 Bacteria 141909
686 Ga0079104_1000227 3300006946 Bacteria 76897
687 Ga0079104_1000328 3300006946 Bacteria 58129
688 Ga0079104_1000892 3300006946 Bacteria 24400
689 Ga0079104_1002540 3300006946 Bacteria 9643
690 Ga0079104_1003203 3300006946 Bacteria 7892
691 Ga0079104_1003482 3300006946 Bacteria 7284
692 Ga0079104_1015841 3300006946 Bacteria 2221
693 Ga0079104_1017421 3300006946 Bacteria 2064
694 Ga0079104_1035302 3300006946 Bacteria 1207
695 Ga0099826_10001050 3300006948 Bacteria 15606
696 Ga0075435_100000824 3300007076 Bacteria 19317
697 Ga0075435_100065331 3300007076 Bacteria 2958
698 Ga0075435_100145036 3300007076 Bacteria 1994
699 Ga0075435_100177740 3300007076 Bacteria 1798
700 Ga0099794_10000552 3300007265 Bacteria 12536
701 Ga0099794_10012056 3300007265 Bacteria 3717
702 Ga0099794_10087673 3300007265 Bacteria 1542
703 Ga0099795_10000559 3300007788 Bacteria 7021
704 Ga0105251_10000475 3300009011 Bacteria 38047
705 Ga0105251_10000708 3300009011 Bacteria 30704
706 Ga0105251_10000791 3300009011 Bacteria 28655
707 Ga0105251_10001481 3300009011 Bacteria 20149
708 Ga0105251_10001513 3300009011 Bacteria 19971
709 Ga0105251_10001883 3300009011 Bacteria 17202
710 Ga0105251_10001897 3300009011 Bacteria 17142
711 Ga0105251_10003353 3300009011 Bacteria 11663
712 Ga0105251_10003631 3300009011 Bacteria 11082
713 Ga0105251_10004377 3300009011 Bacteria 9640
714 Ga0105251_10004411 3300009011 Bacteria 9589
715 Ga0105251_10004602 3300009011 Bacteria 9315
716 Ga0105251_10005801 3300009011 Bacteria 8003
717 Ga0105251_10011195 3300009011 Bacteria 5137
718 Ga0105251_10016903 3300009011 Bacteria 3923
719 Ga0105251_10024976 3300009011 Bacteria 3062
720 Ga0105244_10000017 3300009036 Bacteria 253386
721 Ga0105244_10000021 3300009036 Bacteria 238820
722 Ga0105244_10000119 3300009036 Bacteria 83366
723 Ga0105244_10000266 3300009036 Bacteria 52668
724 Ga0105244_10000314 3300009036 Bacteria 46815
725 Ga0105244_10000465 3300009036 Bacteria 37006
726 Ga0105244_10000525 3300009036 Bacteria 34196
727 Ga0105244_10002249 3300009036 Bacteria 14679
728 Ga0105244_10003993 3300009036 Bacteria 10323
729 Ga0105244_10008215 3300009036 Bacteria 6542
730 Ga0105244_10010529 3300009036 Bacteria 5603
731 Ga0105244_10010701 3300009036 Bacteria 5546
732 Ga0105244_10012089 3300009036 Bacteria 5128
733 Ga0105244_10023134 3300009036 Bacteria 3411
734 Ga0105244_10027354 3300009036 Bacteria 3075
735 Ga0105244_10053714 3300009036 Bacteria 2046
736 Ga0105244_10069621 3300009036 Bacteria 1757
737 Ga0105250_10000012 3300009092 Bacteria 274899
738 Ga0105250_10000049 3300009092 Bacteria 121303
739 Ga0105250_10000259 3300009092 Bacteria 43433
740 Ga0105250_10000295 3300009092 Bacteria 39409
741 Ga0105250_10003376 3300009092 Bacteria 7576
742 Ga0105250_10003414 3300009092 Bacteria 7530
743 Ga0105250_10003736 3300009092 Bacteria 7149
744 Ga0105250_10004653 3300009092 Bacteria 6278
745 Ga0105250_10005110 3300009092 Bacteria 5926
746 Ga0105250_10018908 3300009092 Bacteria 2786
747 Ga0105250_10022148 3300009092 Bacteria 2563
748 Ga0105250_10036432 3300009092 Bacteria 1974
749 Ga0105240_10001807 3300009093 Bacteria 36004
750 Ga0105240_10002360 3300009093 Bacteria 30437
751 Ga0105240_10003800 3300009093 Bacteria 23327
752 Ga0105240_10008046 3300009093 Bacteria 15172
753 Ga0105240_10008203 3300009093 Bacteria 14968
754 Ga0105240_10013166 3300009093 Bacteria 11377
755 Ga0105240_10038236 3300009093 Bacteria 6157
756 Ga0105240_10039064 3300009093 Bacteria 6081
757 Ga0105240_10045802 3300009093 Bacteria 5547
758 Ga0105240_10047378 3300009093 Bacteria 5439
759 Ga0105240_10056620 3300009093 Bacteria 4905
760 Ga0105240_10134703 3300009093 Bacteria 2959
761 Ga0105240_10152994 3300009093 Bacteria 2746
762 Ga0105240_10173201 3300009093 Bacteria 2554
763 Ga0105240_10189237 3300009093 Bacteria 2421
764 Ga0105240_10251144 3300009093 Bacteria 2045
765 Ga0105240_10335236 3300009093 Bacteria 1720
766 Ga0105240_10409120 3300009093 Bacteria 1526
767 Ga0105240_10414370 3300009093 Bacteria 1515
768 Ga0105240_10483546 3300009093 Bacteria 1380
769 Ga0111539_10027007 3300009094 Bacteria 7011
770 Ga0111539_10046081 3300009094 Bacteria 5218
771 Ga0111539_10076603 3300009094 Bacteria 3938
772 Ga0111539_10151211 3300009094 Bacteria 2717
773 Ga0111539_10316104 3300009094 Bacteria 1817
774 Ga0111539_10322138 3300009094 Bacteria 1799
775 Ga0111539_10560101 3300009094 Bacteria 1331
776 Ga0111539_10662938 3300009094 Bacteria 1215
777 Ga0105245_10003268 3300009098 Bacteria 14543
778 Ga0105245_10007918 3300009098 Bacteria 9292
779 Ga0105245_10096930 3300009098 Bacteria 2722
780 Ga0105247_10000171 3300009101 Bacteria 64198
781 Ga0105247_10080598 3300009101 Bacteria 2051
782 Ga0114129_10001431 3300009147 Bacteria 32239
783 Ga0114129_10005167 3300009147 Bacteria 18369
784 Ga0114129_10018075 3300009147 Bacteria 10043
785 Ga0114129_10084982 3300009147 Bacteria 4391
786 Ga0114129_10514071 3300009147 Bacteria 1562
787 Ga0114129_10958928 3300009147 Bacteria 1080
788 Ga0105243_10001640 3300009148 Bacteria 19454
789 Ga0105243_10001806 3300009148 Bacteria 18372
790 Ga0105243_10002036 3300009148 Bacteria 17143
791 Ga0105243_10002550 3300009148 Bacteria 15218
792 Ga0105243_10004191 3300009148 Bacteria 11432
793 Ga0105243_10010403 3300009148 Bacteria 7065
794 Ga0105243_10014468 3300009148 Bacteria 5972
795 Ga0105243_10043543 3300009148 Bacteria 3518
796 Ga0105243_10087159 3300009148 Bacteria 2562
797 Ga0105243_10217128 3300009148 Bacteria 1688
798 Ga0105243_10256927 3300009148 Bacteria 1563
799 Ga0105241_10000145 3300009174 Bacteria 50808
800 Ga0105241_10015247 3300009174 Bacteria 5628
801 Ga0105241_10015429 3300009174 Bacteria 5595
802 Ga0105241_10082820 3300009174 Bacteria 2516
803 Ga0105241_10104785 3300009174 Bacteria 2254
804 Ga0105241_10149694 3300009174 Bacteria 1908
805 Ga0105241_10345220 3300009174 Bacteria 1291
806 Ga0105241_10382629 3300009174 Bacteria 1230
807 Ga0105241_10385097 3300009174 Bacteria 1226
808 Ga0105241_10426728 3300009174 Bacteria 1168
809 Ga0105242_10000721 3300009176 Bacteria 25884
810 Ga0105242_10001697 3300009176 Bacteria 17431
811 Ga0105242_10002028 3300009176 Bacteria 15933
812 Ga0105242_10007843 3300009176 Bacteria 8214
813 Ga0105242_10076499 3300009176 Bacteria 2790
814 Ga0105242_10157790 3300009176 Bacteria 1983
815 Ga0105242_10161522 3300009176 Bacteria 1962
816 Ga0105242_10188246 3300009176 Bacteria 1825
817 Ga0105242_10414568 3300009176 Bacteria 1260
818 Ga0105248_10000736 3300009177 Bacteria 36816
819 Ga0105248_10002030 3300009177 Bacteria 22461
820 Ga0105248_10018046 3300009177 Bacteria 7789
821 Ga0105248_10019836 3300009177 Bacteria 7446
822 Ga0105248_10024858 3300009177 Bacteria 6658
823 Ga0105248_10044986 3300009177 Bacteria 4950
824 Ga0105248_10048035 3300009177 Bacteria 4787
825 Ga0105248_10059994 3300009177 Bacteria 4272
826 Ga0105248_10066533 3300009177 Bacteria 4046
827 Ga0105248_10097249 3300009177 Bacteria 3317
828 Ga0105248_10210259 3300009177 Bacteria 2192
829 Ga0105237_10003877 3300009545 Bacteria 17559
830 Ga0105237_10004758 3300009545 Bacteria 15608
831 Ga0105237_10008560 3300009545 Bacteria 11062
832 Ga0105237_10012592 3300009545 Bacteria 8908
833 Ga0105237_10071548 3300009545 Bacteria 3463
834 Ga0105237_10254757 3300009545 Bacteria 1757
835 Ga0105237_10294643 3300009545 Bacteria 1625
836 Ga0105237_10355761 3300009545 Bacteria 1469
837 Ga0105237_10508152 3300009545 Bacteria 1212
838 Ga0105237_10670381 3300009545 Bacteria 1044
839 Ga0105238_10000006 3300009551 Bacteria 346249
840 Ga0105238_10001317 3300009551 Bacteria 24891
841 Ga0105238_10002609 3300009551 Bacteria 17979
842 Ga0105238_10006104 3300009551 Bacteria 11950
843 Ga0105238_10009163 3300009551 Bacteria 9909
844 Ga0105238_10020927 3300009551 Bacteria 6664
845 Ga0105238_10030214 3300009551 Bacteria 5514
846 Ga0105238_10032839 3300009551 Bacteria 5283
847 Ga0105238_10218652 3300009551 Bacteria 1881
848 Ga0105238_10275235 3300009551 Bacteria 1664
849 Ga0105238_10306067 3300009551 Bacteria 1573
850 Ga0105238_10396181 3300009551 Bacteria 1373
851 Ga0105238_10599725 3300009551 Bacteria 1109
852 Ga0105238_10640464 3300009551 Bacteria 1073
853 Ga0105249_10001475 3300009553 Bacteria 20614
854 Ga0105249_10014353 3300009553 Bacteria 7004
855 Ga0105249_10046472 3300009553 Bacteria 3951
856 Ga0105249_10067250 3300009553 Bacteria 3301
857 Ga0105249_10139191 3300009553 Bacteria 2325
858 Ga0105249_10440595 3300009553 Bacteria 1340
859 Ga0105249_10669040 3300009553 Bacteria 1097
860 Ga0105249_10933152 3300009553 Bacteria 935
861 Ga0099796_10009656 3300010159 Bacteria 2620
862 Ga0105239_10000344 3300010375 Bacteria 67887
863 Ga0105239_10003435 3300010375 Bacteria 19398
864 Ga0105239_10010870 3300010375 Bacteria 10170
865 Ga0105239_10026603 3300010375 Bacteria 6367
866 Ga0105239_10068174 3300010375 Bacteria 3909
867 Ga0105239_10068280 3300010375 Bacteria 3906
868 Ga0105239_10813706 3300010375 Bacteria 1070
869 Ga0105246_10002163 3300011119 Bacteria 11864
870 Ga0105246_10064433 3300011119 Bacteria 2560
871 Ga0105246_10124686 3300011119 Bacteria 1914
872 Ga0105246_10164084 3300011119 Bacteria 1695
873 Ga0105246_10199313 3300011119 Bacteria 1555
874 Ga0105246_10205131 3300011119 Bacteria 1535
875 Ga0105246_10654397 3300011119 Bacteria 915
876 Ga0157373_10000081 3300013100 Bacteria 82343
877 Ga0157373_10000490 3300013100 Bacteria 31273
878 Ga0157373_10001424 3300013100 Bacteria 18237
879 Ga0157373_10008814 3300013100 Bacteria 7474
880 Ga0157373_10053985 3300013100 Bacteria 2856
881 Ga0157373_10056319 3300013100 Bacteria 2792
882 Ga0157373_10059145 3300013100 Bacteria 2716
883 Ga0157373_10150348 3300013100 Bacteria 1638
884 Ga0157373_10153538 3300013100 Bacteria 1620
885 Ga0157373_10162898 3300013100 Bacteria 1569
886 Ga0157373_10170199 3300013100 Bacteria 1533
887 Ga0157373_10215459 3300013100 Bacteria 1354
888 Ga0157371_10000068 3300013102 Bacteria 168110
889 Ga0157371_10000102 3300013102 Bacteria 129057
890 Ga0157371_10001010 3300013102 Bacteria 31017
891 Ga0157371_10003054 3300013102 Bacteria 15537
892 Ga0157371_10004096 3300013102 Bacteria 12881
893 Ga0157371_10010537 3300013102 Bacteria 7189
894 Ga0157371_10031184 3300013102 Bacteria 3841
895 Ga0157371_10048834 3300013102 Bacteria 3008
896 Ga0157371_10059427 3300013102 Bacteria 2710
897 Ga0157371_10099905 3300013102 Bacteria 2057
898 Ga0157371_10153074 3300013102 Bacteria 1645
899 Ga0157371_10285380 3300013102 Bacteria 1193
900 Ga0157370_10000560 3300013104 Bacteria 46440
901 Ga0157370_10000701 3300013104 Bacteria 41856
902 Ga0157370_10001168 3300013104 Bacteria 32712
903 Ga0157370_10001324 3300013104 Bacteria 30819
904 Ga0157370_10004462 3300013104 Bacteria 16033
905 Ga0157370_10011489 3300013104 Bacteria 9255
906 Ga0157370_10013205 3300013104 Bacteria 8518
907 Ga0157370_10022659 3300013104 Bacteria 6250
908 Ga0157370_10027854 3300013104 Bacteria 5568
909 Ga0157370_10043338 3300013104 Bacteria 4331
910 Ga0157370_10067954 3300013104 Bacteria 3368
911 Ga0157370_10125915 3300013104 Bacteria 2391
912 Ga0157370_10144853 3300013104 Bacteria 2212
913 Ga0157370_10194698 3300013104 Bacteria 1881
914 Ga0157370_10225281 3300013104 Bacteria 1736
915 Ga0157370_10244071 3300013104 Bacteria 1662
916 Ga0157370_10398261 3300013104 Bacteria 1267
917 Ga0157370_10428258 3300013104 Bacteria 1217
918 Ga0157370_10511344 3300013104 Bacteria 1103
919 Ga0157369_10000147 3300013105 Bacteria 100084
920 Ga0157369_10001065 3300013105 Bacteria 34435
921 Ga0157369_10001132 3300013105 Bacteria 33339
922 Ga0157369_10002069 3300013105 Bacteria 24238
923 Ga0157369_10002642 3300013105 Bacteria 21400
924 Ga0157369_10007564 3300013105 Bacteria 12501
925 Ga0157369_10011103 3300013105 Bacteria 10247
926 Ga0157369_10015583 3300013105 Bacteria 8565
927 Ga0157369_10026262 3300013105 Bacteria 6462
928 Ga0157369_10028194 3300013105 Bacteria 6215
929 Ga0157369_10045888 3300013105 Bacteria 4750
930 Ga0157369_10149671 3300013105 Bacteria 2467
931 Ga0157369_10165451 3300013105 Bacteria 2333
932 Ga0157369_10306538 3300013105 Bacteria 1651
933 Ga0157369_10359301 3300013105 Bacteria 1512
934 Ga0157369_10375987 3300013105 Bacteria 1475
935 Ga0157369_10428949 3300013105 Bacteria 1370
936 Ga0157374_10000251 3300013296 Bacteria 49614
937 Ga0157374_10044634 3300013296 Bacteria 4097
938 Ga0157374_10253522 3300013296 Bacteria 1732
939 Ga0157374_10349615 3300013296 Bacteria 1469
940 Ga0157374_10382557 3300013296 Bacteria 1402
941 Ga0157374_10405071 3300013296 Bacteria 1361
942 Ga0157374_10432812 3300013296 Bacteria 1315
943 Ga0157378_10001998 3300013297 Bacteria 18236
944 Ga0157378_10011642 3300013297 Bacteria 7698
945 Ga0157378_10086000 3300013297 Bacteria 2850
946 Ga0157378_10141869 3300013297 Bacteria 2231
947 Ga0157378_10194133 3300013297 Bacteria 1917
948 Ga0157378_10279997 3300013297 Bacteria 1607
949 Ga0157378_10425305 3300013297 Bacteria 1313
950 Ga0157378_10548138 3300013297 Bacteria 1161
951 Ga0163162_10000314 3300013306 Bacteria 44769
952 Ga0163162_10002127 3300013306 Bacteria 18607
953 Ga0163162_10016393 3300013306 Bacteria 7242
954 Ga0163162_10025748 3300013306 Bacteria 5816
955 Ga0163162_10074406 3300013306 Bacteria 3456
956 Ga0163162_10089048 3300013306 Bacteria 3166
957 Ga0163162_10102853 3300013306 Bacteria 2950
958 Ga0163162_10208711 3300013306 Bacteria 2082
959 Ga0163162_10261285 3300013306 Bacteria 1863
960 Ga0163162_10284251 3300013306 Bacteria 1786
961 Ga0163162_10323844 3300013306 Bacteria 1674
962 Ga0163162_10344959 3300013306 Bacteria 1622
963 Ga0157372_10000177 3300013307 Bacteria 70496
964 Ga0157372_10001667 3300013307 Bacteria 24062
965 Ga0157372_10002048 3300013307 Bacteria 21930
966 Ga0157372_10005585 3300013307 Bacteria 13373
967 Ga0157372_10012192 3300013307 Bacteria 9155
968 Ga0157372_10014005 3300013307 Bacteria 8567
969 Ga0157372_10015939 3300013307 Bacteria 8060
970 Ga0157372_10040709 3300013307 Bacteria 5134
971 Ga0157372_10052098 3300013307 Bacteria 4556
972 Ga0157372_10052952 3300013307 Bacteria 4521
973 Ga0157372_10117618 3300013307 Bacteria 3049
974 Ga0157372_10138633 3300013307 Bacteria 2802
975 Ga0157372_10143646 3300013307 Bacteria 2752
976 Ga0157372_10169003 3300013307 Bacteria 2529
977 Ga0157372_10202342 3300013307 Bacteria 2300
978 Ga0157372_10211295 3300013307 Bacteria 2249
979 Ga0157372_10223300 3300013307 Bacteria 2184
980 Ga0157372_10243577 3300013307 Bacteria 2086
981 Ga0157372_10378666 3300013307 Bacteria 1649
982 Ga0157372_10412157 3300013307 Bacteria 1574
983 Ga0157372_10450774 3300013307 Bacteria 1499
984 Ga0157372_10466227 3300013307 Bacteria 1472
985 Ga0157372_10595690 3300013307 Bacteria 1288
986 Ga0157372_10608539 3300013307 Bacteria 1273
987 Ga0157372_10620999 3300013307 Bacteria 1259
988 Ga0157372_10795081 3300013307 Bacteria 1099
989 Ga0157375_10004326 3300013308 Bacteria 12329
990 Ga0157375_10070100 3300013308 Bacteria 3514
991 Ga0157375_10070508 3300013308 Bacteria 3505
992 Ga0157375_10121360 3300013308 Bacteria 2723
993 Ga0157375_10264833 3300013308 Bacteria 1880
994 Ga0157375_10396054 3300013308 Bacteria 1548
995 Ga0157375_10516968 3300013308 Bacteria 1357
996 Ga0157375_10578185 3300013308 Bacteria 1284
997 Ga0157375_10677624 3300013308 Bacteria 1186
998 Ga0163163_10006579 3300014325 Bacteria 10179
999 Ga0163163_10041142 3300014325 Bacteria 4518
1000 Ga0163163_10357165 3300014325 Bacteria 1518
1001 Ga0157380_10022246 3300014326 Bacteria 4768
1002 Ga0157380_10082962 3300014326 Bacteria 2624
1003 Ga0157380_10099104 3300014326 Bacteria 2423
1004 Ga0157380_10239361 3300014326 Bacteria 1635
1005 Ga0182008_10002123 3300014497 Bacteria 12639
1006 Ga0182008_10004122 3300014497 Bacteria 8561
1007 Ga0182008_10007102 3300014497 Bacteria 6202
1008 Ga0182008_10010535 3300014497 Bacteria 4946
1009 Ga0182008_10025388 3300014497 Bacteria 3008
1010 Ga0182008_10058516 3300014497 Bacteria 1902
1011 Ga0182008_10135083 3300014497 Bacteria 1232
1012 Ga0182008_10151895 3300014497 Bacteria 1162
1013 Ga0157377_10000048 3300014745 Bacteria 94061
1014 Ga0157379_10000233 3300014968 Bacteria 43500
1015 Ga0157379_10010467 3300014968 Bacteria 8085
1016 Ga0157379_10030571 3300014968 Bacteria 4795
1017 Ga0157379_10178390 3300014968 Bacteria 1919
1018 Ga0157379_10198973 3300014968 Bacteria 1812
1019 Ga0157379_10229856 3300014968 Bacteria 1681
1020 Ga0157376_10021873 3300014969 Bacteria 4973
1021 Ga0157376_10064678 3300014969 Bacteria 3085
1022 Ga0157376_10067680 3300014969 Bacteria 3021
1023 Ga0157376_10069377 3300014969 Bacteria 2988
1024 Ga0157376_10102194 3300014969 Bacteria 2507
1025 Ga0182006_1000009 3300015261 Bacteria 438243
1026 Ga0182006_1002143 3300015261 Bacteria 10967
1027 Ga0182006_1008526 3300015261 Bacteria 4645
1028 Ga0182006_1029323 3300015261 Bacteria 2230
1029 Ga0182006_1030913 3300015261 Bacteria 2161
1030 Ga0182006_1057169 3300015261 Bacteria 1484
1031 Ga0182007_10000254 3300015262 Bacteria 35932
1032 Ga0182007_10000642 3300015262 Bacteria 20182
1033 Ga0182007_10003593 3300015262 Bacteria 7284
1034 Ga0182007_10006892 3300015262 Bacteria 4830
1035 Ga0182007_10037664 3300015262 Bacteria 1623
1036 Ga0182005_1000317 3300015265 Bacteria 28794
1037 Ga0182005_1045813 3300015265 Bacteria 1188
1038 Ga0183366_1006 3300015679 Bacteria 136391
1039 Ga0183370_1006 3300015680 Bacteria 136391
1040 Ga0183362_10003 3300015683 Bacteria 977584
1041 Ga0183369_1017 3300015685 Bacteria 136391
1042 Ga0183368_1010 3300015687 Bacteria 136391
1043 Ga0183361_10015 3300016635 Bacteria 166772
1044 Ga0163161_10000006 3300017792 Bacteria 302708
1045 Ga0163161_10001265 3300017792 Bacteria 18886
1046 Ga0163161_10025963 3300017792 Bacteria 4148
1047 Ga0163161_10027485 3300017792 Bacteria 4036
1048 Ga0163161_10043047 3300017792 Bacteria 3250
1049 Ga0163161_10078980 3300017792 Bacteria 2419
1050 Ga0163161_10151783 3300017792 Bacteria 1761
1051 Ga0163161_10186378 3300017792 Bacteria 1593
1052 Ga0163161_10300254 3300017792 Bacteria 1264
1053 Ga0154015_1105339 3300020610 Bacteria 9905
1054 Ga0213872_10000093 3300021361 Bacteria 83513
1055 Ga0213872_10000490 3300021361 Bacteria 31612
1056 Ga0213872_10003115 3300021361 Bacteria 9320
1057 Ga0213872_10005470 3300021361 Bacteria 6529
1058 Ga0213872_10013259 3300021361 Bacteria 3865
1059 Ga0213872_10015697 3300021361 Bacteria 3519
1060 Ga0213872_10040024 3300021361 Bacteria 2140
1061 Ga0213876_10000039 3300021384 Bacteria 173104
1062 Ga0213876_10158566 3300021384 Bacteria 1204
1063 Ga0213875_10061257 3300021388 Bacteria 1759
1064 Ga0213875_10091158 3300021388 Bacteria 1422
1065 Ga0224712_10000002 3300022467 Bacteria 45137
1066 Ga0209435_100002 3300025206 Bacteria 794178
1067 Ga0209435_100018 3300025206 Bacteria 274625
1068 Ga0209760_100066 3300025207 Bacteria 88259
1069 Ga0209760_100991 3300025207 Bacteria 3387
1070 Ga0209436_114206 3300025208 Bacteria 1275
1071 Ga0209784_100004 3300025224 Bacteria 1378156
1072 Ga0209784_100009 3300025224 Bacteria 688031
1073 Ga0209784_100064 3300025224 Bacteria 158058
1074 Ga0209566_100004 3300025225 Bacteria 1531866
1075 Ga0209566_100007 3300025225 Bacteria 688031
1076 Ga0209566_100079 3300025225 Bacteria 158058
1077 Ga0209566_100312 3300025225 Bacteria 43942
1078 Ga0209674_100006 3300025226 Bacteria 1531866
1079 Ga0209674_100018 3300025226 Bacteria 688031
1080 Ga0209674_100159 3300025226 Bacteria 88259
1081 Ga0209674_100259 3300025226 Bacteria 42956
1082 Ga0209674_100260 3300025226 Bacteria 42764
1083 Ga0209674_103465 3300025226 Bacteria 2889
1084 Ga0209672_100052 3300025228 Bacteria 231179
1085 Ga0209672_100054 3300025228 Bacteria 222217
1086 Ga0209672_100072 3300025228 Bacteria 167942
1087 Ga0209672_100073 3300025228 Bacteria 166621
1088 Ga0209672_100214 3300025228 Bacteria 45404
1089 Ga0209672_101322 3300025228 Bacteria 9450
1090 Ga0209672_108144 3300025228 Bacteria 1572
1091 Ga0209147_100002 3300025229 Bacteria 2158988
1092 Ga0209147_100051 3300025229 Bacteria 274605
1093 Ga0209147_100093 3300025229 Bacteria 167196
1094 Ga0209147_100100 3300025229 Bacteria 162747
1095 Ga0209147_100328 3300025229 Bacteria 35916
1096 Ga0209147_100445 3300025229 Bacteria 26092
1097 Ga0209563_100009 3300025230 Bacteria 1378156
1098 Ga0209563_100020 3300025230 Bacteria 688031
1099 Ga0209563_100135 3300025230 Bacteria 88259
1100 Ga0209563_100365 3300025230 Bacteria 16659
1101 Ga0207427_100136 3300025231 Bacteria 88259
1102 Ga0207427_100313 3300025231 Bacteria 33459
1103 Ga0207427_102368 3300025231 Bacteria 5143
1104 Ga0209437_100004 3300025233 Bacteria 1378156
1105 Ga0209437_100136 3300025233 Bacteria 176190
1106 Ga0209437_100145 3300025233 Bacteria 163138
1107 Ga0209437_100149 3300025233 Bacteria 158058
1108 Ga0209258_100002 3300025242 Bacteria 2158988
1109 Ga0209258_100140 3300025242 Bacteria 167245
1110 Ga0209258_100154 3300025242 Bacteria 158235
1111 Ga0209258_100579 3300025242 Bacteria 30754
1112 Ga0209258_100581 3300025242 Bacteria 30706
1113 Ga0209258_100760 3300025242 Bacteria 20234
1114 Ga0207425_1001617 3300025245 Bacteria 9090
1115 Ga0207425_1002168 3300025245 Bacteria 7181
1116 Ga0207425_1002353 3300025245 Bacteria 6746
1117 Ga0209646_1000001 3300025246 Bacteria 3092932
1118 Ga0209646_1000081 3300025246 Bacteria 201708
1119 Ga0209646_1000090 3300025246 Bacteria 189912
1120 Ga0209026_1000001 3300025250 Bacteria 1228671
1121 Ga0209026_1000042 3300025250 Bacteria 273111
1122 Ga0209677_100005 3300025253 Bacteria 1378156
1123 Ga0209677_100010 3300025253 Bacteria 688031
1124 Ga0209677_100110 3300025253 Bacteria 88259
1125 Ga0209148_1000119 3300025254 Bacteria 188079
1126 Ga0209148_1000140 3300025254 Bacteria 166819
1127 Ga0209148_1000145 3300025254 Bacteria 161352
1128 Ga0209148_1001374 3300025254 Bacteria 12669
1129 Ga0209148_1013067 3300025254 Bacteria 1501
1130 Ga0209759_1000001 3300025256 Bacteria 2799452
1131 Ga0209759_1000195 3300025256 Bacteria 96092
1132 Ga0209759_1000351 3300025256 Bacteria 59891
1133 Ga0209759_1000502 3300025256 Bacteria 42732
1134 Ga0209759_1005822 3300025256 Bacteria 4232
1135 Ga0209759_1015598 3300025256 Bacteria 1953
1136 Ga0209129_1000021 3300025258 Bacteria 445018
1137 Ga0209129_1000054 3300025258 Bacteria 261997
1138 Ga0209129_1002334 3300025258 Bacteria 9391
1139 Ga0209129_1002683 3300025258 Bacteria 8383
1140 Ga0209233_1000005 3300025261 Bacteria 1531866
1141 Ga0209233_1000173 3300025261 Bacteria 145995
1142 Ga0209233_1000795 3300025261 Bacteria 14146
1143 Ga0209233_1020779 3300025261 Bacteria 1714
1144 Ga0209565_1000067 3300025263 Bacteria 171247
1145 Ga0209565_1000128 3300025263 Bacteria 108959
1146 Ga0209565_1000648 3300025263 Bacteria 22443
1147 Ga0209565_1000708 3300025263 Bacteria 20409
1148 Ga0209565_1001327 3300025263 Bacteria 11327
1149 Ga0209565_1015194 3300025263 Bacteria 1742
1150 Ga0209455_1000021 3300025272 Bacteria 699993
1151 Ga0209455_1000125 3300025272 Bacteria 166819
1152 Ga0209455_1000244 3300025272 Bacteria 67136
1153 Ga0209455_1001361 3300025272 Bacteria 11209
1154 Ga0209455_1003990 3300025272 Bacteria 5002
1155 Ga0209673_1000008 3300025273 Bacteria 626013
1156 Ga0209673_1000097 3300025273 Bacteria 193482
1157 Ga0209673_1000098 3300025273 Bacteria 193352
1158 Ga0209673_1000172 3300025273 Bacteria 133472
1159 Ga0209673_1001430 3300025273 Bacteria 22800
1160 Ga0209130_1000072 3300025284 Bacteria 175726
1161 Ga0209130_1000315 3300025284 Bacteria 56958
1162 Ga0209130_1000954 3300025284 Bacteria 22871
1163 Ga0209130_1001108 3300025284 Bacteria 19845
1164 Ga0209130_1002024 3300025284 Bacteria 11039
1165 Ga0209130_1008114 3300025284 Bacteria 3140
1166 Ga0209675_1000038 3300025291 Bacteria 250481
1167 Ga0209675_1000221 3300025291 Bacteria 59141
1168 Ga0209675_1000690 3300025291 Bacteria 23483
1169 Ga0209675_1003314 3300025291 Bacteria 7734
1170 Ga0209675_1006032 3300025291 Bacteria 4951
1171 Ga0209675_1007234 3300025291 Bacteria 4296
1172 Ga0209675_1009050 3300025291 Bacteria 3564
1173 Ga0209675_1012280 3300025291 Bacteria 2772
1174 Ga0209675_1017392 3300025291 Bacteria 2055
1175 Ga0209676_1000023 3300025292 Bacteria 589732
1176 Ga0209676_1000048 3300025292 Bacteria 403716
1177 Ga0209676_1000739 3300025292 Bacteria 44487
1178 Ga0209676_1001679 3300025292 Bacteria 19202
1179 Ga0209676_1015932 3300025292 Bacteria 2742
1180 Ga0209025_1000174 3300025294 Bacteria 158915
1181 Ga0209025_1001066 3300025294 Bacteria 39849
1182 Ga0209025_1001733 3300025294 Bacteria 26305
1183 Ga0209025_1002139 3300025294 Bacteria 22147
1184 Ga0209025_1004985 3300025294 Bacteria 11107
1185 Ga0209025_1008849 3300025294 Bacteria 7141
1186 Ga0209025_1010865 3300025294 Bacteria 6101
1187 Ga0209025_1016447 3300025294 Bacteria 4362
1188 Ga0209025_1020674 3300025294 Bacteria 3585
1189 Ga0209025_1067115 3300025294 Bacteria 1298
1190 Ga0209564_1000241 3300025295 Bacteria 118237
1191 Ga0209564_1000435 3300025295 Bacteria 72434
1192 Ga0209564_1000998 3300025295 Bacteria 35364
1193 Ga0209564_1001515 3300025295 Bacteria 23174
1194 Ga0209564_1004319 3300025295 Bacteria 8779
1195 Ga0209564_1011596 3300025295 Bacteria 3932
1196 Ga0209758_1000034 3300025297 Bacteria 467637
1197 Ga0209758_1002271 3300025297 Bacteria 19909
1198 Ga0209758_1004536 3300025297 Bacteria 11484
1199 Ga0209050_1000012 3300025298 Bacteria 813717
1200 Ga0209050_1000022 3300025298 Bacteria 565239
1201 Ga0209050_1000294 3300025298 Bacteria 105705
1202 Ga0209050_1001032 3300025298 Bacteria 34539
1203 Ga0209050_1001309 3300025298 Bacteria 27980
1204 Ga0209050_1002666 3300025298 Bacteria 14582
1205 Ga0209050_1002988 3300025298 Bacteria 13162
1206 Ga0209050_1012744 3300025298 Bacteria 3820
1207 Ga0209050_1019817 3300025298 Bacteria 2535
1208 Ga0209256_1000001 3300025299 Bacteria 2166974
1209 Ga0209256_1000103 3300025299 Bacteria 193900
1210 Ga0209256_1000120 3300025299 Bacteria 167691
1211 Ga0209256_1000165 3300025299 Bacteria 135104
1212 Ga0207426_1000058 3300025302 Bacteria 363857
1213 Ga0207426_1000067 3300025302 Bacteria 342108
1214 Ga0207426_1000199 3300025302 Bacteria 145826
1215 Ga0207426_1000319 3300025302 Bacteria 92696
1216 Ga0207426_1002937 3300025302 Bacteria 10035
1217 Ga0207426_1004345 3300025302 Bacteria 6972
1218 Ga0207426_1023475 3300025302 Bacteria 2103
1219 Ga0209051_1000013 3300025303 Bacteria 565239
1220 Ga0209051_1000018 3300025303 Bacteria 527061
1221 Ga0209051_1000019 3300025303 Bacteria 511268
1222 Ga0209051_1000235 3300025303 Bacteria 92799
1223 Ga0209051_1001398 3300025303 Bacteria 20776
1224 Ga0209051_1001560 3300025303 Bacteria 18951
1225 Ga0209051_1007671 3300025303 Bacteria 5861
1226 Ga0209051_1007797 3300025303 Bacteria 5785
1227 Ga0209051_1023326 3300025303 Bacteria 2576
1228 Ga0209257_1000024 3300025304 Bacteria 726068
1229 Ga0209257_1000042 3300025304 Bacteria 537149
1230 Ga0209257_1000057 3300025304 Bacteria 396985
1231 Ga0209257_1000260 3300025304 Bacteria 121653
1232 Ga0209257_1020645 3300025304 Bacteria 2424
1233 Ga0207697_10000068 3300025315 Bacteria 44303
1234 Ga0207697_10047106 3300025315 Bacteria 1777
1235 Ga0207656_10010098 3300025321 Bacteria 3524
1236 Ga0207656_10015328 3300025321 Bacteria 2965
1237 Ga0207656_10035950 3300025321 Bacteria 2077
1238 Ga0207656_10074587 3300025321 Bacteria 1514
1239 Ga0207696_1000040 3300025711 Bacteria 318695
1240 Ga0207696_1000046 3300025711 Bacteria 291327
1241 Ga0207696_1000146 3300025711 Bacteria 121312
1242 Ga0207696_1000332 3300025711 Bacteria 49596
1243 Ga0207696_1000337 3300025711 Bacteria 48918
1244 Ga0207696_1000421 3300025711 Bacteria 38950
1245 Ga0207696_1000557 3300025711 Bacteria 29652
1246 Ga0207696_1000770 3300025711 Bacteria 21155
1247 Ga0207696_1001424 3300025711 Bacteria 13033
1248 Ga0207696_1003192 3300025711 Bacteria 7579
1249 Ga0207696_1003996 3300025711 Bacteria 6479
1250 Ga0207696_1006611 3300025711 Bacteria 4648
1251 Ga0207696_1007301 3300025711 Bacteria 4341
1252 Ga0207655_1000024 3300025728 Bacteria 459774
1253 Ga0207655_1000043 3300025728 Bacteria 332919
1254 Ga0207655_1000053 3300025728 Bacteria 284129
1255 Ga0207655_1000082 3300025728 Bacteria 213760
1256 Ga0207655_1000170 3300025728 Bacteria 119267
1257 Ga0207655_1000208 3300025728 Bacteria 102775
1258 Ga0207655_1000264 3300025728 Bacteria 82670
1259 Ga0207655_1000284 3300025728 Bacteria 77444
1260 Ga0207655_1000639 3300025728 Bacteria 41880
1261 Ga0207655_1000983 3300025728 Bacteria 29240
1262 Ga0207655_1002221 3300025728 Bacteria 16086
1263 Ga0207655_1003550 3300025728 Bacteria 11549
1264 Ga0207655_1003904 3300025728 Bacteria 10828
1265 Ga0207655_1006400 3300025728 Bacteria 7808
1266 Ga0207655_1007855 3300025728 Bacteria 6861
1267 Ga0207655_1011962 3300025728 Bacteria 5115
1268 Ga0207655_1015084 3300025728 Bacteria 4321
1269 Ga0207655_1024118 3300025728 Bacteria 2990
1270 Ga0207655_1028620 3300025728 Bacteria 2625
1271 Ga0207655_1039524 3300025728 Bacteria 2047
1272 Ga0207655_1061204 3300025728 Bacteria 1455
1273 Ga0207713_1000017 3300025735 Bacteria 394495
1274 Ga0207713_1000043 3300025735 Bacteria 241808
1275 Ga0207713_1000053 3300025735 Bacteria 222068
1276 Ga0207713_1000056 3300025735 Bacteria 217615
1277 Ga0207713_1000066 3300025735 Bacteria 195645
1278 Ga0207713_1000075 3300025735 Bacteria 179242
1279 Ga0207713_1000186 3300025735 Bacteria 87336
1280 Ga0207713_1001564 3300025735 Bacteria 17994
1281 Ga0207713_1001691 3300025735 Bacteria 17065
1282 Ga0207713_1001781 3300025735 Bacteria 16479
1283 Ga0207713_1004193 3300025735 Bacteria 9452
1284 Ga0207713_1008050 3300025735 Bacteria 6124
1285 Ga0207713_1010744 3300025735 Bacteria 5043
1286 Ga0207713_1014242 3300025735 Bacteria 4145
1287 Ga0207713_1018073 3300025735 Bacteria 3503
1288 Ga0207713_1067091 3300025735 Bacteria 1340
1289 Ga0207653_10046050 3300025885 Bacteria 1441
1290 Ga0207682_10064973 3300025893 Bacteria 1535
1291 Ga0207682_10082931 3300025893 Bacteria 1377
1292 Ga0207692_10049694 3300025898 Bacteria 2117
1293 Ga0207642_10001712 3300025899 Bacteria 6771
1294 Ga0207642_10031527 3300025899 Bacteria 2221
1295 Ga0207710_10000024 3300025900 Bacteria 319633
1296 Ga0207710_10156814 3300025900 Bacteria 1107
1297 Ga0207688_10073741 3300025901 Bacteria 1941
1298 Ga0207688_10147867 3300025901 Bacteria 1386
1299 Ga0207680_10016087 3300025903 Bacteria 3919
1300 Ga0207680_10021057 3300025903 Bacteria 3522
1301 Ga0207680_10084007 3300025903 Bacteria 2008
1302 Ga0207680_10095828 3300025903 Bacteria 1897
1303 Ga0207680_10181167 3300025903 Bacteria 1424
1304 Ga0207680_10196748 3300025903 Bacteria 1371
1305 Ga0207647_10000362 3300025904 Bacteria 36989
1306 Ga0207647_10003669 3300025904 Bacteria 11486
1307 Ga0207647_10005407 3300025904 Bacteria 9376
1308 Ga0207647_10037683 3300025904 Bacteria 3064
1309 Ga0207647_10039837 3300025904 Bacteria 2962
1310 Ga0207647_10053022 3300025904 Bacteria 2501
1311 Ga0207685_10050017 3300025905 Bacteria 1608
1312 Ga0207699_10198720 3300025906 Bacteria 1357
1313 Ga0207645_10004546 3300025907 Bacteria 10248
1314 Ga0207645_10008560 3300025907 Bacteria 7131
1315 Ga0207645_10038094 3300025907 Bacteria 3085
1316 Ga0207645_10151780 3300025907 Bacteria 1512
1317 Ga0207643_10010998 3300025908 Bacteria 4884
1318 Ga0207643_10047211 3300025908 Bacteria 2435
1319 Ga0207643_10053854 3300025908 Bacteria 2286
1320 Ga0207643_10055518 3300025908 Bacteria 2252
1321 Ga0207643_10171330 3300025908 Bacteria 1310
1322 Ga0207643_10187533 3300025908 Bacteria 1254
1323 Ga0207705_10002185 3300025909 Bacteria 15132
1324 Ga0207705_10010721 3300025909 Bacteria 6654
1325 Ga0207705_10101380 3300025909 Bacteria 2118
1326 Ga0207684_10002070 3300025910 Bacteria 20640
1327 Ga0207684_10009875 3300025910 Bacteria 8418
1328 Ga0207684_10150364 3300025910 Bacteria 2003
1329 Ga0207654_10000010 3300025911 Bacteria 304367
1330 Ga0207654_10008657 3300025911 Bacteria 5157
1331 Ga0207654_10018548 3300025911 Bacteria 3653
1332 Ga0207654_10132411 3300025911 Bacteria 1580
1333 Ga0207654_10411268 3300025911 Bacteria 942
1334 Ga0207707_10010626 3300025912 Bacteria 7996
1335 Ga0207707_10037447 3300025912 Bacteria 4240
1336 Ga0207707_10040244 3300025912 Bacteria 4082
1337 Ga0207707_10066443 3300025912 Bacteria 3141
1338 Ga0207707_10102072 3300025912 Bacteria 2507
1339 Ga0207707_10154925 3300025912 Bacteria 2004
1340 Ga0207707_10184091 3300025912 Bacteria 1823
1341 Ga0207695_10000829 3300025913 Bacteria 57299
1342 Ga0207695_10003954 3300025913 Bacteria 20489
1343 Ga0207695_10005351 3300025913 Bacteria 17072
1344 Ga0207695_10018245 3300025913 Bacteria 8119
1345 Ga0207695_10018937 3300025913 Bacteria 7943
1346 Ga0207695_10022639 3300025913 Bacteria 7124
1347 Ga0207695_10024387 3300025913 Bacteria 6809
1348 Ga0207695_10032526 3300025913 Bacteria 5707
1349 Ga0207695_10038695 3300025913 Bacteria 5131
1350 Ga0207695_10042207 3300025913 Bacteria 4875
1351 Ga0207695_10058197 3300025913 Bacteria 4012
1352 Ga0207695_10064800 3300025913 Bacteria 3760
1353 Ga0207695_10128872 3300025913 Bacteria 2489
1354 Ga0207695_10209693 3300025913 Bacteria 1859
1355 Ga0207695_10279688 3300025913 Bacteria 1563
1356 Ga0207695_10335441 3300025913 Bacteria 1400
1357 Ga0207695_10424282 3300025913 Bacteria 1214
1358 Ga0207695_10425441 3300025913 Bacteria 1212
1359 Ga0207695_10608726 3300025913 Bacteria 973
1360 Ga0207671_10004924 3300025914 Bacteria 12529
1361 Ga0207671_10017988 3300025914 Bacteria 5437
1362 Ga0207671_10018021 3300025914 Bacteria 5429
1363 Ga0207671_10025053 3300025914 Bacteria 4483
1364 Ga0207671_10081245 3300025914 Bacteria 2431
1365 Ga0207671_10128642 3300025914 Bacteria 1942
1366 Ga0207671_10281137 3300025914 Bacteria 1312
1367 Ga0207693_10004206 3300025915 Bacteria 12205
1368 Ga0207693_10324698 3300025915 Bacteria 1205
1369 Ga0207660_10027612 3300025917 Bacteria 3875
1370 Ga0207660_10035168 3300025917 Bacteria 3476
1371 Ga0207660_10035695 3300025917 Bacteria 3453
1372 Ga0207660_10048380 3300025917 Bacteria 3009
1373 Ga0207660_10068787 3300025917 Bacteria 2569
1374 Ga0207660_10083058 3300025917 Bacteria 2358
1375 Ga0207660_10203557 3300025917 Bacteria 1547
1376 Ga0207660_10330928 3300025917 Bacteria 1218
1377 Ga0207660_10384032 3300025917 Bacteria 1129
1378 Ga0207662_10067838 3300025918 Bacteria 2152
1379 Ga0207657_10000065 3300025919 Bacteria 98751
1380 Ga0207657_10000447 3300025919 Bacteria 43815
1381 Ga0207657_10002517 3300025919 Bacteria 19813
1382 Ga0207657_10003605 3300025919 Bacteria 16496
1383 Ga0207657_10027949 3300025919 Bacteria 5156
1384 Ga0207657_10050415 3300025919 Bacteria 3623
1385 Ga0207657_10104806 3300025919 Bacteria 2342
1386 Ga0207657_10141031 3300025919 Bacteria 1969
1387 Ga0207657_10141240 3300025919 Bacteria 1967
1388 Ga0207657_10196782 3300025919 Bacteria 1623
1389 Ga0207657_10236962 3300025919 Bacteria 1458
1390 Ga0207649_10000533 3300025920 Bacteria 26462
1391 Ga0207649_10046419 3300025920 Bacteria 2668
1392 Ga0207649_10056168 3300025920 Bacteria 2457
1393 Ga0207649_10071283 3300025920 Bacteria 2219
1394 Ga0207649_10303028 3300025920 Bacteria 1169
1395 Ga0207649_10321392 3300025920 Bacteria 1137
1396 Ga0207649_10365420 3300025920 Bacteria 1072
1397 Ga0207652_10025590 3300025921 Bacteria 4908
1398 Ga0207652_10051932 3300025921 Bacteria 3517
1399 Ga0207652_10064863 3300025921 Bacteria 3161
1400 Ga0207652_10101010 3300025921 Bacteria 2547
1401 Ga0207652_10173333 3300025921 Bacteria 1936
1402 Ga0207652_10268108 3300025921 Bacteria 1540
1403 Ga0207646_10002045 3300025922 Bacteria 24234
1404 Ga0207681_10002690 3300025923 Bacteria 11258
1405 Ga0207681_10054437 3300025923 Bacteria 2721
1406 Ga0207681_10063309 3300025923 Bacteria 2550
1407 Ga0207681_10080586 3300025923 Bacteria 2296
1408 Ga0207681_10115120 3300025923 Bacteria 1963
1409 Ga0207681_10251513 3300025923 Bacteria 1380
1410 Ga0207694_10000110 3300025924 Bacteria 85854
1411 Ga0207694_10008526 3300025924 Bacteria 7741
1412 Ga0207694_10017482 3300025924 Bacteria 5419
1413 Ga0207694_10027009 3300025924 Bacteria 4371
1414 Ga0207694_10047487 3300025924 Bacteria 3321
1415 Ga0207694_10047702 3300025924 Bacteria 3313
1416 Ga0207694_10060523 3300025924 Bacteria 2947
1417 Ga0207694_10111212 3300025924 Bacteria 2179
1418 Ga0207694_10209521 3300025924 Bacteria 1587
1419 Ga0207694_10290630 3300025924 Bacteria 1344
1420 Ga0207694_10392635 3300025924 Bacteria 1153
1421 Ga0207650_10008850 3300025925 Bacteria 6879
1422 Ga0207650_10023136 3300025925 Bacteria 4405
1423 Ga0207650_10056121 3300025925 Bacteria 2926
1424 Ga0207650_10072933 3300025925 Bacteria 2584
1425 Ga0207650_10107878 3300025925 Bacteria 2151
1426 Ga0207650_10195879 3300025925 Bacteria 1616
1427 Ga0207650_10199039 3300025925 Bacteria 1604
1428 Ga0207659_10049410 3300025926 Bacteria 2984
1429 Ga0207659_10085813 3300025926 Bacteria 2340
1430 Ga0207659_10108459 3300025926 Bacteria 2106
1431 Ga0207659_10112608 3300025926 Bacteria 2071
1432 Ga0207659_10124566 3300025926 Bacteria 1980
1433 Ga0207659_10175191 3300025926 Bacteria 1695
1434 Ga0207659_10236473 3300025926 Bacteria 1476
1435 Ga0207659_10264301 3300025926 Bacteria 1401
1436 Ga0207659_10355283 3300025926 Bacteria 1217
1437 Ga0207687_10022655 3300025927 Bacteria 4183
1438 Ga0207700_10000051 3300025928 Bacteria 77057
1439 Ga0207700_10091325 3300025928 Bacteria 2405
1440 Ga0207700_10399980 3300025928 Bacteria 1203
1441 Ga0207700_10552616 3300025928 Bacteria 1022
1442 Ga0207664_10011717 3300025929 Bacteria 6248
1443 Ga0207664_10068838 3300025929 Bacteria 2845
1444 Ga0207664_10083324 3300025929 Bacteria 2606
1445 Ga0207664_10107976 3300025929 Bacteria 2310
1446 Ga0207664_10471265 3300025929 Bacteria 1122
1447 Ga0207644_10000130 3300025931 Bacteria 54417
1448 Ga0207644_10002085 3300025931 Bacteria 12942
1449 Ga0207644_10069089 3300025931 Bacteria 2579
1450 Ga0207644_10214992 3300025931 Bacteria 1521
1451 Ga0207644_10322174 3300025931 Bacteria 1250
1452 Ga0207690_10000040 3300025932 Bacteria 130300
1453 Ga0207690_10003996 3300025932 Bacteria 8718
1454 Ga0207690_10005258 3300025932 Bacteria 7629
1455 Ga0207690_10017612 3300025932 Bacteria 4367
1456 Ga0207690_10039425 3300025932 Bacteria 3082
1457 Ga0207690_10060359 3300025932 Bacteria 2573
1458 Ga0207690_10381365 3300025932 Bacteria 1120
1459 Ga0207690_10401573 3300025932 Bacteria 1093
1460 Ga0207706_10000156 3300025933 Bacteria 75583
1461 Ga0207706_10010055 3300025933 Bacteria 8666
1462 Ga0207706_10025996 3300025933 Bacteria 5242
1463 Ga0207706_10071355 3300025933 Bacteria 3055
1464 Ga0207706_10134435 3300025933 Bacteria 2175
1465 Ga0207706_10175026 3300025933 Bacteria 1885
1466 Ga0207706_10320074 3300025933 Bacteria 1350
1467 Ga0207686_10003601 3300025934 Bacteria 8298
1468 Ga0207686_10010431 3300025934 Bacteria 5059
1469 Ga0207686_10022846 3300025934 Bacteria 3605
1470 Ga0207686_10104800 3300025934 Bacteria 1895
1471 Ga0207686_10145150 3300025934 Bacteria 1645
1472 Ga0207686_10177232 3300025934 Bacteria 1509
1473 Ga0207686_10184894 3300025934 Bacteria 1481
1474 Ga0207709_10000111 3300025935 Bacteria 127580
1475 Ga0207709_10000874 3300025935 Bacteria 22951
1476 Ga0207709_10001012 3300025935 Bacteria 20843
1477 Ga0207709_10001074 3300025935 Bacteria 20124
1478 Ga0207709_10001229 3300025935 Bacteria 18408
1479 Ga0207709_10010266 3300025935 Bacteria 5158
1480 Ga0207709_10088184 3300025935 Bacteria 2019
1481 Ga0207709_10215570 3300025935 Bacteria 1381
1482 Ga0207670_10002522 3300025936 Bacteria 9617
1483 Ga0207670_10076849 3300025936 Bacteria 2324
1484 Ga0207670_10109912 3300025936 Bacteria 1985
1485 Ga0207670_10121279 3300025936 Bacteria 1901
1486 Ga0207670_10163489 3300025936 Bacteria 1663
1487 Ga0207670_10325021 3300025936 Bacteria 1211
1488 Ga0207669_10018077 3300025937 Bacteria 3633
1489 Ga0207669_10042824 3300025937 Bacteria 2646
1490 Ga0207669_10045607 3300025937 Bacteria 2584
1491 Ga0207669_10051528 3300025937 Bacteria 2467
1492 Ga0207669_10070962 3300025937 Bacteria 2186
1493 Ga0207669_10085400 3300025937 Bacteria 2037
1494 Ga0207669_10187967 3300025937 Bacteria 1487
1495 Ga0207669_10226807 3300025937 Bacteria 1375
1496 Ga0207704_10003083 3300025938 Bacteria 7530
1497 Ga0207704_10005236 3300025938 Bacteria 5974
1498 Ga0207704_10178097 3300025938 Bacteria 1533
1499 Ga0207704_10197359 3300025938 Bacteria 1469
1500 Ga0207704_10215043 3300025938 Bacteria 1418
1501 Ga0207665_10002266 3300025939 Bacteria 12985
1502 Ga0207665_10010512 3300025939 Bacteria 6079
1503 Ga0207665_10205111 3300025939 Bacteria 1438
1504 Ga0207665_10241734 3300025939 Bacteria 1330
1505 Ga0207665_10247843 3300025939 Bacteria 1315
1506 Ga0207691_10000331 3300025940 Bacteria 47246
1507 Ga0207691_10002783 3300025940 Bacteria 17058
1508 Ga0207691_10014382 3300025940 Bacteria 7545
1509 Ga0207691_10022541 3300025940 Bacteria 5937
1510 Ga0207691_10025670 3300025940 Bacteria 5529
1511 Ga0207691_10030697 3300025940 Bacteria 5020
1512 Ga0207691_10058915 3300025940 Bacteria 3493
1513 Ga0207691_10061770 3300025940 Bacteria 3403
1514 Ga0207691_10122125 3300025940 Bacteria 2307
1515 Ga0207711_10010140 3300025941 Bacteria 7824
1516 Ga0207711_10017638 3300025941 Bacteria 5929
1517 Ga0207711_10020362 3300025941 Bacteria 5530
1518 Ga0207711_10021326 3300025941 Bacteria 5413
1519 Ga0207711_10105206 3300025941 Bacteria 2502
1520 Ga0207711_10132106 3300025941 Bacteria 2239
1521 Ga0207711_10139085 3300025941 Bacteria 2183
1522 Ga0207711_10342235 3300025941 Bacteria 1384
1523 Ga0207689_10000234 3300025942 Bacteria 49477
1524 Ga0207689_10000310 3300025942 Bacteria 44928
1525 Ga0207689_10028706 3300025942 Bacteria 4653
1526 Ga0207689_10052850 3300025942 Bacteria 3347
1527 Ga0207689_10073052 3300025942 Bacteria 2818
1528 Ga0207689_10116488 3300025942 Bacteria 2196
1529 Ga0207689_10172399 3300025942 Bacteria 1784
1530 Ga0207689_10220202 3300025942 Bacteria 1568
1531 Ga0207689_10226968 3300025942 Bacteria 1543
1532 Ga0207661_10034359 3300025944 Bacteria 3942
1533 Ga0207661_10042276 3300025944 Bacteria 3593
1534 Ga0207661_10135481 3300025944 Bacteria 2114
1535 Ga0207661_10146730 3300025944 Bacteria 2036
1536 Ga0207661_10160532 3300025944 Bacteria 1950
1537 Ga0207679_10000001 3300025945 Bacteria 777444
1538 Ga0207679_10005981 3300025945 Bacteria 7654
1539 Ga0207679_10013209 3300025945 Bacteria 5410
1540 Ga0207679_10015853 3300025945 Bacteria 4994
1541 Ga0207679_10078295 3300025945 Bacteria 2518
1542 Ga0207679_10152325 3300025945 Bacteria 1884
1543 Ga0207679_10163714 3300025945 Bacteria 1824
1544 Ga0207667_10000120 3300025949 Bacteria 123800
1545 Ga0207667_10005056 3300025949 Bacteria 16112
1546 Ga0207667_10010777 3300025949 Bacteria 10663
1547 Ga0207667_10010866 3300025949 Bacteria 10616
1548 Ga0207667_10016009 3300025949 Bacteria 8490
1549 Ga0207667_10019277 3300025949 Bacteria 7621
1550 Ga0207667_10023646 3300025949 Bacteria 6763
1551 Ga0207667_10033168 3300025949 Bacteria 5555
1552 Ga0207667_10044686 3300025949 Bacteria 4693
1553 Ga0207667_10055276 3300025949 Bacteria 4173
1554 Ga0207667_10061320 3300025949 Bacteria 3934
1555 Ga0207667_10145462 3300025949 Bacteria 2440
1556 Ga0207667_10169609 3300025949 Bacteria 2243
1557 Ga0207667_10253478 3300025949 Bacteria 1800
1558 Ga0207667_10289134 3300025949 Bacteria 1675
1559 Ga0207667_10386603 3300025949 Bacteria 1425
1560 Ga0207667_10396454 3300025949 Bacteria 1405
1561 Ga0207667_10739097 3300025949 Bacteria 984
1562 Ga0207651_10001420 3300025960 Bacteria 10889
1563 Ga0207651_10062370 3300025960 Bacteria 2597
1564 Ga0207651_10155681 3300025960 Bacteria 1785
1565 Ga0207651_10247489 3300025960 Bacteria 1456
1566 Ga0207651_10618368 3300025960 Bacteria 949
1567 Ga0207712_10005420 3300025961 Bacteria 8051
1568 Ga0207712_10094428 3300025961 Bacteria 2209
1569 Ga0207712_10121751 3300025961 Bacteria 1975
1570 Ga0207712_10123979 3300025961 Bacteria 1959
1571 Ga0207668_10024667 3300025972 Bacteria 3884
1572 Ga0207668_10054195 3300025972 Bacteria 2783
1573 Ga0207668_10110482 3300025972 Bacteria 2062
1574 Ga0207668_10140854 3300025972 Bacteria 1854
1575 Ga0207668_10383079 3300025972 Bacteria 1184
1576 Ga0207668_10385214 3300025972 Bacteria 1181
1577 Ga0207640_10000098 3300025981 Bacteria 66901
1578 Ga0207640_10013700 3300025981 Bacteria 4653
1579 Ga0207640_10017314 3300025981 Bacteria 4215
1580 Ga0207640_10022720 3300025981 Bacteria 3759
1581 Ga0207640_10057789 3300025981 Bacteria 2553
1582 Ga0207640_10455698 3300025981 Bacteria 1055
1583 Ga0207658_10000650 3300025986 Bacteria 30420
1584 Ga0207658_10159130 3300025986 Bacteria 1849
1585 Ga0207658_10178618 3300025986 Bacteria 1755
1586 Ga0207658_10442428 3300025986 Bacteria 1149
1587 Ga0207658_10477674 3300025986 Bacteria 1107
1588 Ga0207677_10007151 3300026023 Bacteria 6147
1589 Ga0207677_10008746 3300026023 Bacteria 5671
1590 Ga0207677_10018191 3300026023 Bacteria 4213
1591 Ga0207677_10023319 3300026023 Bacteria 3821
1592 Ga0207677_10076044 3300026023 Bacteria 2389
1593 Ga0207677_10092656 3300026023 Bacteria 2200
1594 Ga0207703_10000443 3300026035 Bacteria 43710
1595 Ga0207703_10003876 3300026035 Bacteria 12438
1596 Ga0207703_10009968 3300026035 Bacteria 7451
1597 Ga0207703_10016647 3300026035 Bacteria 5734
1598 Ga0207703_10050674 3300026035 Bacteria 3361
1599 Ga0207703_10096551 3300026035 Bacteria 2496
1600 Ga0207703_10154787 3300026035 Bacteria 2002
1601 Ga0207703_10166087 3300026035 Bacteria 1937
1602 Ga0207639_10015329 3300026041 Bacteria 5405
1603 Ga0207639_10109932 3300026041 Bacteria 2244
1604 Ga0207639_10128044 3300026041 Bacteria 2097
1605 Ga0207639_10260286 3300026041 Bacteria 1517
1606 Ga0207639_10294103 3300026041 Bacteria 1433
1607 Ga0207678_10000001 3300026067 Bacteria 433184
1608 Ga0207678_10001984 3300026067 Bacteria 18641
1609 Ga0207678_10002621 3300026067 Bacteria 16388
1610 Ga0207678_10009704 3300026067 Bacteria 8464
1611 Ga0207678_10045821 3300026067 Bacteria 3781
1612 Ga0207678_10104759 3300026067 Bacteria 2414
1613 Ga0207678_10109691 3300026067 Bacteria 2354
1614 Ga0207678_10125732 3300026067 Bacteria 2187
1615 Ga0207678_10141914 3300026067 Bacteria 2050
1616 Ga0207678_10233767 3300026067 Bacteria 1574
1617 Ga0207678_10322585 3300026067 Bacteria 1329
1618 Ga0207678_10348267 3300026067 Bacteria 1277
1619 Ga0207708_10001026 3300026075 Bacteria 20900
1620 Ga0207708_10006748 3300026075 Bacteria 8492
1621 Ga0207708_10018391 3300026075 Bacteria 5262
1622 Ga0207708_10021822 3300026075 Bacteria 4831
1623 Ga0207708_10058663 3300026075 Bacteria 2936
1624 Ga0207708_10065650 3300026075 Bacteria 2774
1625 Ga0207702_10000301 3300026078 Bacteria 57080
1626 Ga0207702_10002083 3300026078 Bacteria 19317
1627 Ga0207702_10003982 3300026078 Bacteria 13259
1628 Ga0207702_10081372 3300026078 Bacteria 2812
1629 Ga0207702_10098153 3300026078 Bacteria 2580
1630 Ga0207702_10134222 3300026078 Bacteria 2231
1631 Ga0207702_10331351 3300026078 Bacteria 1452
1632 Ga0207702_10406738 3300026078 Bacteria 1313
1633 Ga0207702_10545170 3300026078 Bacteria 1134
1634 Ga0207641_10001097 3300026088 Bacteria 27224
1635 Ga0207641_10004409 3300026088 Bacteria 12196
1636 Ga0207641_10011393 3300026088 Bacteria 7296
1637 Ga0207641_10081148 3300026088 Bacteria 2816
1638 Ga0207641_10117072 3300026088 Bacteria 2372
1639 Ga0207641_10219723 3300026088 Bacteria 1761
1640 Ga0207648_10000055 3300026089 Bacteria 106101
1641 Ga0207648_10000179 3300026089 Bacteria 66602
1642 Ga0207648_10000512 3300026089 Bacteria 43350
1643 Ga0207648_10001876 3300026089 Bacteria 22992
1644 Ga0207648_10002319 3300026089 Bacteria 20537
1645 Ga0207648_10003029 3300026089 Bacteria 17753
1646 Ga0207648_10012861 3300026089 Bacteria 7815
1647 Ga0207648_10025102 3300026089 Bacteria 5314
1648 Ga0207648_10099833 3300026089 Bacteria 2542
1649 Ga0207648_10168332 3300026089 Bacteria 1937
1650 Ga0207648_10169096 3300026089 Bacteria 1932
1651 Ga0207648_10478617 3300026089 Bacteria 1137
1652 Ga0207676_10000995 3300026095 Bacteria 21861
1653 Ga0207676_10028771 3300026095 Bacteria 4155
1654 Ga0207676_10033129 3300026095 Bacteria 3901
1655 Ga0207676_10039700 3300026095 Bacteria 3602
1656 Ga0207676_10082576 3300026095 Bacteria 2614
1657 Ga0207676_10155340 3300026095 Bacteria 1976
1658 Ga0207676_10292263 3300026095 Bacteria 1484
1659 Ga0207674_10000179 3300026116 Bacteria 77729
1660 Ga0207674_10000418 3300026116 Bacteria 55342
1661 Ga0207674_10003078 3300026116 Bacteria 20630
1662 Ga0207674_10006035 3300026116 Bacteria 14330
1663 Ga0207674_10013444 3300026116 Bacteria 9085
1664 Ga0207674_10016416 3300026116 Bacteria 8106
1665 Ga0207674_10017229 3300026116 Bacteria 7882
1666 Ga0207674_10023166 3300026116 Bacteria 6657
1667 Ga0207674_10092849 3300026116 Bacteria 3007
1668 Ga0207674_10106537 3300026116 Bacteria 2781
1669 Ga0207674_10159374 3300026116 Bacteria 2211
1670 Ga0207674_10159996 3300026116 Bacteria 2206
1671 Ga0207674_10184871 3300026116 Bacteria 2035
1672 Ga0207674_10238057 3300026116 Bacteria 1767
1673 Ga0207674_10313173 3300026116 Bacteria 1519
1674 Ga0207674_10438382 3300026116 Bacteria 1263
1675 Ga0207675_100000704 3300026118 Bacteria 33126
1676 Ga0207675_100000726 3300026118 Bacteria 32704
1677 Ga0207675_100001602 3300026118 Bacteria 22678
1678 Ga0207675_100001605 3300026118 Bacteria 22659
1679 Ga0207675_100001640 3300026118 Bacteria 22433
1680 Ga0207675_100025019 3300026118 Bacteria 5556
1681 Ga0207675_100025890 3300026118 Bacteria 5458
1682 Ga0207675_100055456 3300026118 Bacteria 3697
1683 Ga0207675_100067169 3300026118 Bacteria 3351
1684 Ga0207675_100139402 3300026118 Bacteria 2303
1685 Ga0207675_100162943 3300026118 Bacteria 2128
1686 Ga0207675_100271897 3300026118 Bacteria 1645
1687 Ga0207683_10000276 3300026121 Bacteria 45906
1688 Ga0207683_10012074 3300026121 Bacteria 7375
1689 Ga0207683_10023146 3300026121 Bacteria 5338
1690 Ga0207683_10040469 3300026121 Bacteria 4067
1691 Ga0207683_10061405 3300026121 Bacteria 3307
1692 Ga0207683_10183878 3300026121 Bacteria 1896
1693 Ga0207683_10185522 3300026121 Bacteria 1887
1694 Ga0207683_10186640 3300026121 Bacteria 1881
1695 Ga0207683_10314328 3300026121 Bacteria 1434
1696 Ga0207683_10489314 3300026121 Bacteria 1136
1697 Ga0207683_10494707 3300026121 Bacteria 1129
1698 Ga0207698_10001892 3300026142 Bacteria 12258
1699 Ga0207698_10012303 3300026142 Bacteria 5594
1700 Ga0207698_10056147 3300026142 Bacteria 3039
1701 Ga0207698_10069857 3300026142 Bacteria 2780
1702 Ga0207698_10070407 3300026142 Bacteria 2771
1703 Ga0207698_10085968 3300026142 Bacteria 2556
1704 Ga0207698_10098407 3300026142 Bacteria 2417
1705 Ga0207698_10314781 3300026142 Bacteria 1463
1706 Ga0207698_10365737 3300026142 Bacteria 1367
1707 Ga0209281_1000031 3300027111 Bacteria 422772
1708 Ga0209281_1000065 3300027111 Bacteria 285579
1709 Ga0209281_1000112 3300027111 Bacteria 213847
1710 Ga0209281_1000139 3300027111 Bacteria 179588
1711 Ga0209281_1000162 3300027111 Bacteria 159535
1712 Ga0209281_1000455 3300027111 Bacteria 58143
1713 Ga0209281_1000606 3300027111 Bacteria 40572
1714 Ga0209281_1000649 3300027111 Bacteria 37518
1715 Ga0209281_1001020 3300027111 Bacteria 21627
1716 Ga0209281_1001347 3300027111 Bacteria 15260
1717 Ga0209281_1001477 3300027111 Bacteria 13635
1718 Ga0209281_1002258 3300027111 Bacteria 8152
1719 Ga0209973_1003493 3300027252 Bacteria 1552
1720 Ga0209371_1000027 3300027312 Bacteria 448853
1721 Ga0209371_1000029 3300027312 Bacteria 424797
1722 Ga0209371_1000061 3300027312 Bacteria 223014
1723 Ga0209371_1000082 3300027312 Bacteria 184560
1724 Ga0209371_1000115 3300027312 Bacteria 137627
1725 Ga0209371_1000119 3300027312 Bacteria 133367
1726 Ga0209371_1000230 3300027312 Bacteria 71436
1727 Ga0209371_1000344 3300027312 Bacteria 50930
1728 Ga0209371_1000478 3300027312 Bacteria 38966
1729 Ga0209371_1000575 3300027312 Bacteria 33050
1730 Ga0209371_1001086 3300027312 Bacteria 20323
1731 Ga0209371_1001324 3300027312 Bacteria 17288
1732 Ga0209371_1001508 3300027312 Bacteria 15468
1733 Ga0209371_1001755 3300027312 Bacteria 13644
1734 Ga0209371_1002070 3300027312 Bacteria 11949
1735 Ga0209371_1003264 3300027312 Bacteria 8059
1736 Ga0209371_1008347 3300027312 Bacteria 3457
1737 Ga0209371_1016349 3300027312 Bacteria 1960
1738 Ga0209371_1016682 3300027312 Bacteria 1928
1739 Ga0209969_1007422 3300027360 Bacteria 1549
1740 Ga0209967_1003182 3300027364 Bacteria 2157
1741 Ga0209967_1003772 3300027364 Bacteria 2000
1742 Ga0209996_1012693 3300027395 Bacteria 1133
1743 Ga0209996_1013325 3300027395 Bacteria 1110
1744 Ga0210000_1008850 3300027462 Bacteria 1477
1745 Ga0209995_1003224 3300027471 Bacteria 2597
1746 Ga0209179_1002596 3300027512 Bacteria 2469
1747 Ga0209999_1004984 3300027543 Bacteria 2389
1748 Ga0209983_1012662 3300027665 Bacteria 1732
1749 Ga0209983_1018754 3300027665 Bacteria 1437
1750 Ga0209983_1032428 3300027665 Bacteria 1116
1751 Ga0209282_1000250 3300027666 Bacteria 26928
1752 Ga0209588_1004210 3300027671 Bacteria 4044
1753 Ga0209588_1004909 3300027671 Bacteria 3802
1754 Ga0209588_1032020 3300027671 Bacteria 1683
1755 Ga0209971_1001384 3300027682 Bacteria 6026
1756 Ga0209971_1002480 3300027682 Bacteria 4434
1757 Ga0209813_10066271 3300027866 Bacteria 1164
1758 Ga0209974_10006071 3300027876 Bacteria 4228
1759 Ga0209974_10006556 3300027876 Bacteria 4060
1760 Ga0209974_10006964 3300027876 Bacteria 3914
1761 Ga0209974_10017443 3300027876 Bacteria 2382
1762 Ga0209974_10026686 3300027876 Bacteria 1911
1763 Ga0207428_10000627 3300027907 Bacteria 41506
1764 Ga0207428_10003201 3300027907 Bacteria 16012
1765 Ga0207428_10017027 3300027907 Bacteria 6244
1766 Ga0207428_10047412 3300027907 Bacteria 3450
1767 Ga0207428_10181219 3300027907 Bacteria 1591
1768 Ga0207428_10326630 3300027907 Bacteria 1132
1769 Ga0268266_10000079 3300028379 Bacteria 213545
1770 Ga0268266_10013058 3300028379 Bacteria 7162
1771 Ga0268266_10043388 3300028379 Bacteria 3843
1772 Ga0268266_10111635 3300028379 Bacteria 2422
1773 Ga0268266_10142334 3300028379 Bacteria 2153
1774 Ga0268266_10204733 3300028379 Bacteria 1807
1775 Ga0268266_10272026 3300028379 Bacteria 1573
1776 Ga0268266_10346755 3300028379 Bacteria 1395
1777 Ga0268266_10549949 3300028379 Bacteria 1106
1778 Ga0268265_10003038 3300028380 Bacteria 12233
1779 Ga0268265_10006476 3300028380 Bacteria 7934
1780 Ga0268265_10008107 3300028380 Bacteria 7099
1781 Ga0268265_10057229 3300028380 Bacteria 2970
1782 Ga0268265_10087637 3300028380 Bacteria 2477
1783 Ga0268265_10186521 3300028380 Bacteria 1787
1784 Ga0268265_10261074 3300028380 Bacteria 1540
1785 Ga0268265_10602044 3300028380 Bacteria 1050
1786 Ga0268264_10000566 3300028381 Bacteria 45480
1787 Ga0268264_10000613 3300028381 Bacteria 42687
1788 Ga0268264_10007788 3300028381 Bacteria 8919
1789 Ga0268264_10029433 3300028381 Bacteria 4498
1790 Ga0268264_10050172 3300028381 Bacteria 3474
1791 Ga0268264_10129331 3300028381 Bacteria 2236
1792 Ga0268264_10168262 3300028381 Bacteria 1980
1793 Ga0268264_10219861 3300028381 Bacteria 1748
1794 Ga0268264_10251994 3300028381 Bacteria 1640
1795 Ga0268264_10296413 3300028381 Bacteria 1521
1796 Ga0307515_10000011 3300028794 Bacteria 633903
1797 Ga0307515_10000472 3300028794 Bacteria 96172
1798 Ga0307515_10000609 3300028794 Bacteria 83557
1799 Ga0307515_10009632 3300028794 Bacteria 18642
1800 Ga0307515_10048317 3300028794 Bacteria 6436
1801 Ga0307515_10083759 3300028794 Bacteria 4106
1802 Ga0307515_10097070 3300028794 Bacteria 3606
1803 Ga0265338_10000092 3300028800 Bacteria 168538
1804 Ga0268256_1000032 3300030500 Bacteria 424603
1805 Ga0268256_1000045 3300030500 Bacteria 330053
1806 Ga0268256_1000059 3300030500 Bacteria 223875
1807 Ga0268256_1000072 3300030500 Bacteria 184436
1808 Ga0268256_1000096 3300030500 Bacteria 139457
1809 Ga0268256_1000097 3300030500 Bacteria 137685
1810 Ga0268256_1000292 3300030500 Bacteria 50930
1811 Ga0268256_1000406 3300030500 Bacteria 39238
1812 Ga0268256_1000875 3300030500 Bacteria 20997
1813 Ga0268256_1001132 3300030500 Bacteria 17288
1814 Ga0268256_1001295 3300030500 Bacteria 15468
1815 Ga0268256_1003837 3300030500 Bacteria 6549
1816 Ga0268256_1004087 3300030500 Bacteria 6237
1817 Ga0268256_1004211 3300030500 Bacteria 6066
1818 Ga0268256_1004783 3300030500 Bacteria 5503
1819 Ga0268256_1008681 3300030500 Bacteria 3457
1820 Ga0268256_1012315 3300030500 Bacteria 2650
1821 Ga0268256_1018522 3300030500 Bacteria 1928
1822 Ga0307511_10000043 3300030521 Bacteria 101232
1823 Ga0307512_10039942 3300030522 Bacteria 3925
1824 Ga0316181_1016973 3300030744 Bacteria 8142
1825 Ga0316181_1217554 3300030744 Bacteria 3135
1826 Ga0265330_10000046 3300031235 Bacteria 108853
1827 Ga0265330_10001529 3300031235 Bacteria 13337
1828 Ga0265332_10000028 3300031238 Bacteria 184029
1829 Ga0265332_10000125 3300031238 Bacteria 63932
1830 Ga0265332_10000951 3300031238 Bacteria 17144
1831 Ga0265328_10003818 3300031239 Bacteria 6620
1832 Ga0265329_10020290 3300031242 Bacteria 2246
1833 Ga0265329_10030607 3300031242 Bacteria 1753
1834 Ga0265340_10036331 3300031247 Bacteria 2442
1835 Ga0265331_10042289 3300031250 Bacteria 2210
1836 Ga0265331_10046704 3300031250 Bacteria 2086
1837 Ga0265327_10000012 3300031251 Bacteria 530403
1838 Ga0265327_10001288 3300031251 Bacteria 32919
1839 Ga0265327_10023089 3300031251 Bacteria 3695
1840 Ga0265316_10010060 3300031344 Bacteria 8650
1841 Ga0307513_10000117 3300031456 Bacteria 110951
1842 Ga0307513_10002745 3300031456 Bacteria 24211
1843 Ga0307513_10007295 3300031456 Bacteria 14355
1844 Ga0307513_10008037 3300031456 Bacteria 13552
1845 Ga0307513_10100176 3300031456 Bacteria 2924
1846 Ga0307513_10207822 3300031456 Bacteria 1792
1847 Ga0307513_10254795 3300031456 Bacteria 1549
1848 Ga0307408_100000101 3300031548 Bacteria 94089
1849 Ga0307408_100001843 3300031548 Bacteria 15443
1850 Ga0307408_100004804 3300031548 Bacteria 9103
1851 Ga0307408_100006023 3300031548 Bacteria 8070
1852 Ga0307408_100108106 3300031548 Bacteria 2131
1853 Ga0307408_100148467 3300031548 Bacteria 1848
1854 Ga0307508_10000404 3300031616 Bacteria 51734
1855 Ga0307508_10132035 3300031616 Bacteria 2101
1856 Ga0307508_10146970 3300031616 Bacteria 1961
1857 Ga0307514_10015811 3300031649 Bacteria 6220
1858 Ga0307514_10087532 3300031649 Bacteria 2282
1859 Ga0316575_10051327 3300031665 Bacteria 1642
1860 Ga0265314_10000054 3300031711 Bacteria 184029
1861 Ga0265314_10001039 3300031711 Bacteria 32357
1862 Ga0265314_10020564 3300031711 Bacteria 5094
1863 Ga0265342_10203033 3300031712 Bacteria 1076
1864 Ga0307516_10000092 3300031730 Bacteria 100931
1865 Ga0307516_10002741 3300031730 Bacteria 23228
1866 Ga0307516_10020817 3300031730 Bacteria 6769
1867 Ga0307516_10083491 3300031730 Bacteria 3035
1868 Ga0307405_10027242 3300031731 Bacteria 3310
1869 Ga0307405_10039827 3300031731 Bacteria 2843
1870 Ga0307405_10130853 3300031731 Bacteria 1733
1871 Ga0307413_10001940 3300031824 Bacteria 8214
1872 Ga0307413_10049019 3300031824 Bacteria 2529
1873 Ga0307413_10222001 3300031824 Bacteria 1381
1874 Ga0307410_10002072 3300031852 Bacteria 9489
1875 Ga0307410_10009283 3300031852 Bacteria 5510
1876 Ga0307410_10022186 3300031852 Bacteria 3919
1877 Ga0307410_10188189 3300031852 Bacteria 1568
1878 Ga0307410_10407504 3300031852 Bacteria 1100
1879 Ga0307406_10006712 3300031901 Bacteria 6364
1880 Ga0307406_10006950 3300031901 Bacteria 6270
1881 Ga0307406_10008312 3300031901 Bacteria 5784
1882 Ga0307406_10017190 3300031901 Bacteria 4211
1883 Ga0307406_10025663 3300031901 Bacteria 3530
1884 Ga0307406_10034170 3300031901 Bacteria 3118
1885 Ga0307406_10150457 3300031901 Bacteria 1660
1886 Ga0307406_10409903 3300031901 Bacteria 1077
1887 Ga0307412_10000056 3300031911 Bacteria 145861
1888 Ga0307412_10001479 3300031911 Bacteria 13060
1889 Ga0307412_10026189 3300031911 Bacteria 3622
1890 Ga0307412_10087612 3300031911 Bacteria 2169
1891 Ga0307412_10122622 3300031911 Bacteria 1874
1892 Ga0307412_10238366 3300031911 Bacteria 1405
1893 Ga0307409_100001038 3300031995 Bacteria 13028
1894 Ga0307409_100079835 3300031995 Bacteria 2638
1895 Ga0307409_100160415 3300031995 Bacteria 1966
1896 Ga0307409_100286465 3300031995 Bacteria 1525
1897 Ga0307409_100430906 3300031995 Bacteria 1268
1898 Ga0307416_100003645 3300032002 Bacteria 9103
1899 Ga0307416_100005875 3300032002 Bacteria 7615
1900 Ga0307416_100006880 3300032002 Bacteria 7160
1901 Ga0307416_100037351 3300032002 Bacteria 3736
1902 Ga0307416_100050028 3300032002 Bacteria 3328
1903 Ga0307416_100128284 3300032002 Bacteria 2277
1904 Ga0307416_100144491 3300032002 Bacteria 2169
1905 Ga0307416_100469600 3300032002 Bacteria 1315
1906 Ga0307414_10039619 3300032004 Bacteria 3175
1907 Ga0307414_10101861 3300032004 Bacteria 2163
1908 Ga0307414_10331868 3300032004 Bacteria 1299
1909 Ga0307411_10002409 3300032005 Bacteria 8250
1910 Ga0307411_10047989 3300032005 Bacteria 2764
1911 Ga0307411_10223608 3300032005 Bacteria 1462
1912 Ga0307411_10264290 3300032005 Bacteria 1360
1913 Ga0307415_100003806 3300032126 Bacteria 7735
1914 Ga0307415_100057530 3300032126 Bacteria 2672
1915 Ga0307415_100161535 3300032126 Bacteria 1737
1916 Ga0316583_10039012 3300032133 Bacteria 1682
1917 Ga0307507_10070319 3300033179 Bacteria 3176
1918 Ga0373958_0010242 3300034819 Bacteria 1560
1919 Ga0373938_0009740 3300034957 Bacteria 1747
1920 Ga0373928_0012221 3300035084 Bacteria 1710
1921 Ga0373929_0014997 3300035085 Bacteria 1503
1922 Ga0373923_0031909 3300035111 Bacteria 2126
1923 Ga0373936_0073256 3300035113 Bacteria 1415
1924 Ga0373939_0000800 3300035114 Bacteria 7761
1925 Ga0373941_0042703 3300035115 Bacteria 1409
1926 Ga0373945_0016065 3300035116 Bacteria 2521
1927 Ga0373945_0032025 3300035116 Bacteria 1861
1928 Ga0373953_0156998 3300035117 Bacteria 977
1929 Ga0373956_0017802 3300035119 Bacteria 3002
1930 Ga0373957_0041194 3300035120 Bacteria 1739
1931 Ga0373957_0092605 3300035120 Bacteria 1203
1932 Ga0373943_0026856 3300035170 Bacteria 2701
1933 Ga0373943_0151354 3300035170 Bacteria 1257
1934 Ga0373946_0053727 3300035171 Bacteria 1693
1935 Ga0373942_0024173 3300035207 Bacteria 1556
1936 Ga0373962_0009455 3300035242 Bacteria 2417
1937 Ga0316574_0004300 3300035398 Bacteria 7441
1938 Ga0373931_0021727 3300035691 Bacteria 3222
1939 Ga0373931_0022572 3300035691 Bacteria 3168
1940 Ga0373931_0066565 3300035691 Bacteria 1955
1941 Ga0373931_0111622 3300035691 Bacteria 1552
1942 Ga0373931_0201137 3300035691 Bacteria 1190
1943 Ga0373935_0010225 3300035692 Bacteria 5622
1944 Ga0373935_0031753 3300035692 Bacteria 3279
1945 Ga0373935_0089571 3300035692 Bacteria 2012
1946 Ga0373927_0001348 3300035695 Bacteria 18517
1947 Ga0373927_0022204 3300035695 Bacteria 4157
1948 Ga0373933_0091156 3300035724 Bacteria 1881
1949 Ga0373933_0163385 3300035724 Bacteria 1415
1950 Ga0373947_0014019 3300035725 Bacteria 4595
1951 Ga0373947_0014664 3300035725 Bacteria 4495
1952 Ga0373947_0092270 3300035725 Bacteria 1891
1953 Ga0373947_0259220 3300035725 Bacteria 1152
1954 Ga0373937_0002323 3300036401 Bacteria 15894
1955 Ga0373937_0019327 3300036401 Bacteria 6096
1956 Ga0373937_0032289 3300036401 Bacteria 4749
1957 Ga0373937_0278954 3300036401 Bacteria 1578
1958 Ga0373937_0328655 3300036401 Bacteria 1447
1959 Ga0316582_0019083 3300036647 Bacteria 4006
1960 Ga0316584_0299193 3300036712 Bacteria 1165
1961 Ga0373925_0015577 3300037068 Bacteria 5501
1962 Ga0373925_0049488 3300037068 Bacteria 3132
1963 Ga0373925_0051267 3300037068 Bacteria 3080
1964 Ga0373925_0060878 3300037068 Bacteria 2835
1965 Ga0373925_0131688 3300037068 Bacteria 1950
1966 Ga0373925_0187326 3300037068 Bacteria 1641
1967 Ga0395899_0000080 3300037312 Bacteria 171568
1968 Ga0395899_0000678 3300037312 Bacteria 34486
1969 Ga0395899_0001980 3300037312 Bacteria 16847
1970 Ga0395899_0003854 3300037312 Bacteria 11827
1971 Ga0395899_0041260 3300037312 Bacteria 3448
1972 Ga0395899_0089657 3300037312 Bacteria 2230
1973 Ga0395899_0111990 3300037312 Bacteria 1961
1974 Ga0395899_0117455 3300037312 Bacteria 1908
1975 Ga0395899_0124060 3300037312 Bacteria 1848
1976 Ga0395900_0000087 3300037418 Bacteria 171568
1977 Ga0395900_0001157 3300037418 Bacteria 33062
1978 Ga0395900_0008285 3300037418 Bacteria 10700
1979 Ga0395900_0016821 3300037418 Bacteria 7460
1980 Ga0395900_0022464 3300037418 Bacteria 6452
1981 Ga0395900_0024154 3300037418 Bacteria 6223
1982 Ga0395900_0035868 3300037418 Bacteria 5109
1983 Ga0395900_0036525 3300037418 Bacteria 5065
1984 Ga0395900_0059008 3300037418 Bacteria 3950
1985 Ga0395900_0081813 3300037418 Bacteria 3317
1986 Ga0395900_0123093 3300037418 Bacteria 2660
1987 Ga0395900_0138557 3300037418 Bacteria 2492
1988 Ga0395900_0197250 3300037418 Bacteria 2039
1989 Ga0395900_0219098 3300037418 Bacteria 1919
1990 Ga0395900_0356799 3300037418 Bacteria 1434
1991 Ga0395898_0000448 3300037466 Bacteria 84953
1992 Ga0395898_0000800 3300037466 Bacteria 53180
1993 Ga0395898_0004630 3300037466 Bacteria 15004
1994 Ga0395898_0012884 3300037466 Bacteria 8626
1995 Ga0395898_0034645 3300037466 Bacteria 5028
1996 Ga0395898_0066943 3300037466 Bacteria 3479
1997 Ga0395898_0129963 3300037466 Bacteria 2412
1998 Ga0395898_0133393 3300037466 Bacteria 2378
1999 Ga0395898_0152214 3300037466 Bacteria 2213
2000 Ga0395905_0000166 3300037471 Bacteria 108507
2001 Ga0395905_0007970 3300037471 Bacteria 10471
2002 Ga0395905_0018407 3300037471 Bacteria 6629
2003 Ga0395905_0022866 3300037471 Bacteria 5910
2004 Ga0395905_0037768 3300037471 Bacteria 4532
2005 Ga0395905_0065898 3300037471 Bacteria 3391
2006 Ga0395905_0077937 3300037471 Bacteria 3105
2007 Ga0395905_0159612 3300037471 Bacteria 2120
2008 Ga0395905_0162677 3300037471 Bacteria 2097
2009 Ga0395905_0255552 3300037471 Bacteria 1636
2010 Ga0395905_0453065 3300037471 Bacteria 1181
2011 Ga0316581_0011830 3300037588 Bacteria 2448
2012 Ga0436364_0258905 3300037853 Bacteria 5845
2013 Ga0436364_1550787 3300037853 Bacteria 6938
2014 Ga0395901_0000053 3300038443 Bacteria 163807
2015 Ga0395901_0000931 3300038443 Bacteria 31795
2016 Ga0395901_0001081 3300038443 Bacteria 29114
2017 Ga0395901_0002028 3300038443 Bacteria 20821
2018 Ga0395901_0007255 3300038443 Bacteria 11185
2019 Ga0395901_0029684 3300038443 Bacteria 5630
2020 Ga0395901_0071783 3300038443 Bacteria 3608
2021 Ga0395901_0161166 3300038443 Bacteria 2356
2022 Ga0395901_0194518 3300038443 Bacteria 2127
2023 Ga0395901_0332562 3300038443 Bacteria 1570
2024 Ga0395901_0394551 3300038443 Bacteria 1422
2025 Ga0436365_0058713 3300039437 Bacteria 3550
2026 Ga0436365_0171687 3300039437 Bacteria 172237
2027 Ga0436365_0517772 3300039437 Bacteria 2850
2028 Ga0436365_0536600 3300039437 Bacteria 1729
2029 Ga0436365_1784610 3300039437 Bacteria 986
2030 Ga0436360_0113868 3300039438 Bacteria 1591
2031 Ga0436361_0054021 3300039447 Bacteria 15580
2032 Ga0436361_0069490 3300039447 Bacteria 3969
2033 Ga0436361_0101461 3300039447 Bacteria 19447
2034 Ga0436361_0289802 3300039447 Bacteria 31851
2035 Ga0436361_0487065 3300039447 Bacteria 63556
2036 Ga0436361_0493504 3300039447 Bacteria 7536
2037 Ga0436361_0523658 3300039447 Bacteria 15267
2038 Ga0436361_0991849 3300039447 Bacteria 3886
2039 Ga0436361_1098192 3300039447 Bacteria 13887
2040 Ga0436361_1214496 3300039447 Bacteria 9572
2041 Ga0436363_1642553 3300039450 Bacteria 1878
2042 Ga0436362_0053187 3300039453 Bacteria 956
2043 Ga0439436_0034772 3300041404 Bacteria 1457
2044 Ga0439436_0036824 3300041404 Bacteria 1410
2045 Ga0439438_000049 3300041405 Bacteria 57788
2046 Ga0439438_002822 3300041405 Bacteria 7248
2047 Ga0439438_010171 3300041405 Bacteria 2990
2048 Ga0439439_0010483 3300041406 Bacteria 2217
2049 Ga0439447_001003 3300041407 Bacteria 10322
2050 Ga0439447_003380 3300041407 Bacteria 5674
2051 Ga0439466_0000011 3300041411 Bacteria 221134
2052 Ga0439466_0011895 3300041411 Bacteria 3214
2053 Ga0439466_0014294 3300041411 Bacteria 2893
2054 Ga0439466_0031649 3300041411 Bacteria 1808
2055 Ga0451797_0060702 3300041453 Bacteria 1717
2056 Ga0451798_0955146 3300041458 Bacteria 1155
2057 Ga0451800_1562849 3300041459 Bacteria 837
2058 Ga0451807_0034638 3300041486 Bacteria 1224
2059 Ga0451807_1198663 3300041486 Bacteria 1212
2060 Ga0439445_0010606 3300042004 Bacteria 2184
2061 Ga0439448_0000066 3300042005 Bacteria 17566
2062 Ga0439448_0045810 3300042005 Bacteria 1424
2063 Ga0439448_0054504 3300042005 Bacteria 1314
2064 Ga0439432_001315 3300042006 Bacteria 9406
2065 Ga0439432_003882 3300042006 Bacteria 5508
2066 Ga0439432_010402 3300042006 Bacteria 3221
2067 Ga0439432_018519 3300042006 Bacteria 2326
2068 Ga0439432_021892 3300042006 Bacteria 2115
2069 Ga0439432_048349 3300042006 Bacteria 1332
2070 Ga0439432_090413 3300042006 Bacteria 921
2071 Ga0439449_0001584 3300042007 Bacteria 8924
2072 Ga0439449_0069396 3300042007 Bacteria 1299
2073 Ga0439452_000010 3300042010 Bacteria 459139
2074 Ga0439452_000012 3300042010 Bacteria 412478
2075 Ga0439452_000026 3300042010 Bacteria 223971
2076 Ga0439452_000039 3300042010 Bacteria 145243
2077 Ga0439452_000294 3300042010 Bacteria 32106
2078 Ga0439452_002955 3300042010 Bacteria 6052
2079 Ga0439452_011200 3300042010 Bacteria 2585
2080 Ga0439455_0035204 3300042012 Bacteria 1263
2081 Ga0450920_015091 3300042122 Bacteria 1467
2082 Ga0450921_001212 3300042123 Bacteria 1504
2083 Ga0450923_002065 3300042125 Bacteria 2808
2084 Ga0450890_006571 3300042127 Bacteria 1486
2085 Ga0450903_016192 3300042138 Bacteria 1170
2086 Ga0450907_000007 3300042146 Bacteria 111445
2087 Ga0450910_006503 3300042147 Bacteria 1615
2088 Ga0439446_0002089 3300042156 Bacteria 4744
2089 Ga0439446_0043871 3300042156 Bacteria 1323
2090 Ga0439446_0064394 3300042156 Bacteria 1113
2091 Ga0450908_016323 3300042184 Bacteria 1325
2092 Ga0439434_0037492 3300042435 Bacteria 1484
2093 Ga0439435_0000773 3300042436 Bacteria 5374
2094 Ga0439464_0000536 3300042439 Bacteria 7845
2095 Ga0439464_0005995 3300042439 Bacteria 3159
2096 Ga0450918_001444 3300042531 Bacteria 4715
2097 Ga0451577_0000276 3300042876 Bacteria 99531
2098 Ga0451577_0001377 3300042876 Bacteria 32574
2099 Ga0451577_0037671 3300042876 Bacteria 4352
2100 Ga0451577_0101262 3300042876 Bacteria 2574
2101 Ga0451577_0301448 3300042876 Bacteria 1452
2102 Ga0451577_0367528 3300042876 Bacteria 1305
2103 Ga0451577_0506065 3300042876 Bacteria 1097
2104 Ga0466969_0000821 3300044656 Bacteria 16881
2105 Ga0466969_0004750 3300044656 Bacteria 7230
2106 Ga0466969_0056818 3300044656 Bacteria 1909
2107 Ga0466972_0016715 3300044658 Bacteria 3669
2108 Ga0466972_0080819 3300044658 Bacteria 1548
2109 Ga0466973_0054379 3300044659 Bacteria 3673
2110 Ga0466977_0000206 3300044666 Bacteria 15672
2111 Ga0466981_0000025 3300044669 Bacteria 75290
2112 Ga0453683_0018379 3300044673 Bacteria 4488
2113 Ga0453683_0090096 3300044673 Bacteria 1923
2114 Ga0466965_0001659 3300044683 Bacteria 9128
2115 Ga0466965_0006837 3300044683 Bacteria 5210
2116 Ga0466965_0008393 3300044683 Bacteria 4779
2117 Ga0466965_0037201 3300044683 Bacteria 2389
2118 Ga0466966_0000070 3300044684 Bacteria 67510
2119 Ga0466966_0000493 3300044684 Bacteria 25302
2120 Ga0466966_0035532 3300044684 Bacteria 3218
2121 Ga0466966_0045140 3300044684 Bacteria 2818
2122 Ga0466966_0103678 3300044684 Bacteria 1758
2123 Ga0466961_0000274 3300044693 Bacteria 34505
2124 Ga0466961_0005142 3300044693 Bacteria 8230
2125 Ga0466961_0007183 3300044693 Bacteria 7086
2126 Ga0466961_0015762 3300044693 Bacteria 4849
2127 Ga0466961_0017419 3300044693 Bacteria 4614
2128 Ga0466961_0056221 3300044693 Bacteria 2507
2129 Ga0466961_0136729 3300044693 Bacteria 1535
2130 Ga0466961_0176679 3300044693 Bacteria 1326
2131 Ga0466963_0003089 3300044694 Bacteria 9440
2132 Ga0466963_0006832 3300044694 Bacteria 6789
2133 Ga0466963_0078219 3300044694 Bacteria 2236
2134 Ga0466964_0008845 3300044706 Bacteria 3785
2135 Ga0466964_0162295 3300044706 Bacteria 1045
2136 Ga0453684_0000891 3300044712 Bacteria 99637
2137 Ga0453684_0001215 3300044712 Bacteria 79022
2138 Ga0453684_0018953 3300044712 Bacteria 10517
2139 Ga0453684_0065564 3300044712 Bacteria 4631
2140 Ga0453684_0382783 3300044712 Bacteria 1579
2141 Ga0453684_0472557 3300044712 Bacteria 1392
2142 Ga0453684_0688794 3300044712 Bacteria 1112
2143 Ga0466971_0000785 3300044719 Bacteria 12797
2144 Ga0466971_0027092 3300044719 Bacteria 2566
2145 Ga0466971_0114372 3300044719 Bacteria 1247
2146 Ga0466968_0006425 3300044735 Bacteria 4432
2147 Ga0466970_0004728 3300044765 Bacteria 6727
2148 Ga0466970_0022241 3300044765 Bacteria 3309
2149 Ga0466970_0140087 3300044765 Bacteria 1332
2150 Ga0466957_0002683 3300044842 Bacteria 9614
2151 Ga0466957_0005803 3300044842 Bacteria 6945
2152 Ga0466957_0006517 3300044842 Bacteria 6593
2153 Ga0466957_0106773 3300044842 Bacteria 1771
2154 Ga0466960_0036786 3300044901 Bacteria 2294
2155 Ga0466960_0210232 3300044901 Bacteria 1066
2156 Ga0466959_0008264 3300045049 Bacteria 7349
2157 Ga0466959_0019888 3300045049 Bacteria 4941
2158 Ga0466959_0025325 3300045049 Bacteria 4396
2159 Ga0466959_0121689 3300045049 Bacteria 1855
2160 Ga0451576_0004449 3300045051 Bacteria 18194
2161 Ga0451576_0025162 3300045051 Bacteria 6417
2162 Ga0451576_0220372 3300045051 Bacteria 1981
2163 Ga0451576_0354329 3300045051 Bacteria 1536
2164 Ga0451576_0400474 3300045051 Bacteria 1439
2165 Ga0451576_0496713 3300045051 Bacteria 1282
2166 Ga0451576_0527544 3300045051 Bacteria 1240
2167 Ga0451576_0759854 3300045051 Bacteria 1018
2168 Ga0466958_0006572 3300045836 Bacteria 6337
2169 Ga0466958_0010337 3300045836 Bacteria 5226
2170 Ga0466958_0011937 3300045836 Bacteria 4907
2171 Ga0466958_0026601 3300045836 Bacteria 3420
2172 Ga0466958_0179978 3300045836 Bacteria 1341
2173 Ga0466967_0061012 3300045976 Bacteria 3344
2174 Ga0495617_007839 3300046452 Bacteria 3695
2175 Ga0495627_000200 3300046453 Bacteria 65358
2176 Ga0495627_014604 3300046453 Bacteria 2735
2177 Ga0495627_059522 3300046453 Bacteria 1133
2178 Ga0495592_0005154 3300046454 Bacteria 9632
2179 Ga0495592_0014242 3300046454 Bacteria 6041
2180 Ga0495592_0016551 3300046454 Bacteria 5597
2181 Ga0495592_0021799 3300046454 Bacteria 4874
2182 Ga0495592_0032716 3300046454 Bacteria 3921
2183 Ga0495592_0041716 3300046454 Bacteria 3439
2184 Ga0495592_0049228 3300046454 Bacteria 3133
2185 Ga0495603_0001778 3300046455 Bacteria 12707
2186 Ga0495603_0006995 3300046455 Bacteria 6771
2187 Ga0495603_0009555 3300046455 Bacteria 5860
2188 Ga0495603_0058865 3300046455 Bacteria 2271
2189 Ga0495590_0001272 3300046457 Bacteria 10960
2190 Ga0495590_0017958 3300046457 Bacteria 2537
2191 Ga0495590_0029651 3300046457 Bacteria 1917
2192 Ga0495591_000010 3300046458 Bacteria 327794
2193 Ga0495591_000029 3300046458 Bacteria 179657
2194 Ga0495591_001545 3300046458 Bacteria 14085
2195 Ga0495591_010810 3300046458 Bacteria 3504
2196 Ga0495591_012665 3300046458 Bacteria 3125
2197 Ga0495629_0000309 3300046459 Bacteria 41866
2198 Ga0495629_0000465 3300046459 Bacteria 33935
2199 Ga0495629_0002392 3300046459 Bacteria 14426
2200 Ga0495629_0013337 3300046459 Bacteria 5929
2201 Ga0495629_0025673 3300046459 Bacteria 4186
2202 Ga0495629_0240377 3300046459 Bacteria 1247
2203 Ga0495638_0033635 3300046460 Bacteria 3278
2204 Ga0495638_0041512 3300046460 Bacteria 2910
2205 Ga0495641_0141496 3300046461 Bacteria 1075
2206 Ga0495651_0061251 3300046462 Bacteria 2880
2207 Ga0495651_0067489 3300046462 Bacteria 2728
2208 Ga0495651_0079049 3300046462 Bacteria 2487
2209 Ga0495651_0090387 3300046462 Bacteria 2297
2210 Ga0495651_0137387 3300046462 Bacteria 1776
2211 Ga0495651_0168450 3300046462 Bacteria 1562
2212 Ga0495653_0008935 3300046463 Bacteria 8193
2213 Ga0495653_0017910 3300046463 Bacteria 5758
2214 Ga0495653_0021702 3300046463 Bacteria 5200
2215 Ga0495653_0026447 3300046463 Bacteria 4652
2216 Ga0495653_0056301 3300046463 Bacteria 2997
2217 Ga0495653_0115761 3300046463 Bacteria 1918
2218 Ga0495653_0124186 3300046463 Bacteria 1835
2219 Ga0495653_0159853 3300046463 Bacteria 1565
2220 Ga0495650_0000034 3300046471 Bacteria 410132
2221 Ga0495650_0000103 3300046471 Bacteria 210023
2222 Ga0495650_0000199 3300046471 Bacteria 130411
2223 Ga0495650_0011421 3300046471 Bacteria 4864
2224 Ga0495650_0011940 3300046471 Bacteria 4707
2225 Ga0495650_0017540 3300046471 Bacteria 3588
2226 Ga0495580_0001163 3300046472 Bacteria 23140
2227 Ga0495580_0002599 3300046472 Bacteria 15688
2228 Ga0495580_0011405 3300046472 Bacteria 6875
2229 Ga0495580_0021613 3300046472 Bacteria 4744
2230 Ga0495580_0026493 3300046472 Bacteria 4226
2231 Ga0495580_0038400 3300046472 Bacteria 3429
2232 Ga0495580_0039121 3300046472 Bacteria 3393
2233 Ga0495580_0046211 3300046472 Bacteria 3090
2234 Ga0495580_0064553 3300046472 Bacteria 2566
2235 Ga0495580_0094503 3300046472 Bacteria 2080
2236 Ga0495580_0106803 3300046472 Bacteria 1944
2237 Ga0495582_0012734 3300046473 Bacteria 4635
2238 Ga0495582_0133886 3300046473 Bacteria 1401
2239 Ga0495605_0006950 3300046474 Bacteria 6462
2240 Ga0495605_0008418 3300046474 Bacteria 5831
2241 Ga0495605_0016498 3300046474 Bacteria 3995
2242 Ga0495639_0031953 3300046475 Bacteria 2346
2243 Ga0495664_0024732 3300046477 Bacteria 3491
2244 Ga0495594_0277180 3300046499 Bacteria 956
2245 Ga0495596_0003690 3300046500 Bacteria 7654
2246 Ga0495596_0035504 3300046500 Bacteria 1976
2247 Ga0495596_0043681 3300046500 Bacteria 1766
2248 Ga0495607_0002446 3300046501 Bacteria 15121
2249 Ga0495583_0001367 3300046506 Bacteria 25151
2250 Ga0495606_0000511 3300046507 Bacteria 63022
2251 Ga0495606_0004590 3300046507 Bacteria 13697
2252 Ga0495606_0006813 3300046507 Bacteria 10433
2253 Ga0495606_0010602 3300046507 Bacteria 7627
2254 Ga0495606_0016546 3300046507 Bacteria 5615
2255 Ga0495606_0060173 3300046507 Bacteria 2433
2256 Ga0495608_0011755 3300046511 Bacteria 6088
2257 Ga0495608_0013275 3300046511 Bacteria 5715
2258 Ga0495608_0020368 3300046511 Bacteria 4558
2259 Ga0495608_0058846 3300046511 Bacteria 2532
2260 Ga0495610_0001399 3300046512 Bacteria 21428
2261 Ga0495610_0008257 3300046512 Bacteria 6772
2262 Ga0495610_0011733 3300046512 Bacteria 5325
2263 Ga0495616_0003177 3300046513 Bacteria 10604
2264 Ga0495618_0003505 3300046514 Bacteria 9744
2265 Ga0495618_0015530 3300046514 Bacteria 4647
2266 Ga0495618_0045726 3300046514 Bacteria 2762
2267 Ga0495618_0246691 3300046514 Bacteria 1121
2268 Ga0495618_0283893 3300046514 Bacteria 1032
2269 Ga0495620_0005020 3300046515 Bacteria 7416
2270 Ga0495620_0010395 3300046515 Bacteria 4912
2271 Ga0495620_0011504 3300046515 Bacteria 4617
2272 Ga0495620_0020260 3300046515 Bacteria 3251
2273 Ga0495628_0000707 3300046516 Bacteria 30850
2274 Ga0495628_0003737 3300046516 Bacteria 13543
2275 Ga0495628_0013265 3300046516 Bacteria 6930
2276 Ga0495628_0026331 3300046516 Bacteria 4743
2277 Ga0495628_0033891 3300046516 Bacteria 4111
2278 Ga0495628_0087172 3300046516 Bacteria 2420
2279 Ga0495628_0094648 3300046516 Bacteria 2309
2280 Ga0495628_0116933 3300046516 Bacteria 2047
2281 Ga0495628_0125292 3300046516 Bacteria 1969
2282 Ga0495630_0005486 3300046517 Bacteria 8952
2283 Ga0495630_0022086 3300046517 Bacteria 4701
2284 Ga0495630_0099797 3300046517 Bacteria 2196
2285 Ga0495631_0003505 3300046518 Bacteria 8582
2286 Ga0495631_0048223 3300046518 Bacteria 1868
2287 Ga0495631_0116050 3300046518 Bacteria 1151
2288 Ga0495637_0015265 3300046520 Bacteria 3604
2289 Ga0495637_0038702 3300046520 Bacteria 2063
2290 Ga0495637_0065779 3300046520 Bacteria 1475
2291 Ga0495643_0013531 3300046522 Bacteria 4878
2292 Ga0495643_0036223 3300046522 Bacteria 2712
2293 Ga0495643_0065213 3300046522 Bacteria 1923
2294 Ga0495644_0005352 3300046523 Bacteria 5011
2295 Ga0495644_0029303 3300046523 Bacteria 2081
2296 Ga0495648_0021096 3300046524 Bacteria 4522
2297 Ga0495648_0030108 3300046524 Bacteria 3595
2298 Ga0495648_0048223 3300046524 Bacteria 2624
2299 Ga0495648_0056071 3300046524 Bacteria 2372
2300 Ga0495666_0002075 3300046526 Bacteria 9924
2301 Ga0495666_0009566 3300046526 Bacteria 4845
2302 Ga0495666_0011675 3300046526 Bacteria 4379
2303 Ga0495642_0004800 3300046528 Bacteria 5228
2304 Ga0495642_0040514 3300046528 Bacteria 1892
2305 Ga0495642_0051349 3300046528 Bacteria 1696
2306 Ga0495642_0104393 3300046528 Bacteria 1208
2307 Ga0495652_0009439 3300046529 Bacteria 8862
2308 Ga0495652_0024360 3300046529 Bacteria 5357
2309 Ga0495652_0027427 3300046529 Bacteria 5018
2310 Ga0495652_0066778 3300046529 Bacteria 3017
2311 Ga0495652_0067129 3300046529 Bacteria 3007
2312 Ga0495652_0188171 3300046529 Bacteria 1578
2313 Ga0495652_0298077 3300046529 Bacteria 1173
2314 Ga0495654_0000151 3300046530 Bacteria 71530
2315 Ga0495654_0000549 3300046530 Bacteria 30258
2316 Ga0495654_0011899 3300046530 Bacteria 4693
2317 Ga0495654_0065786 3300046530 Bacteria 1729
2318 Ga0495665_0007232 3300046531 Bacteria 5991
2319 Ga0495665_0014053 3300046531 Bacteria 4323
2320 Ga0495665_0096158 3300046531 Bacteria 1555
2321 Ga0495640_0033174 3300046533 Bacteria 3670
2322 Ga0495640_0221690 3300046533 Bacteria 1192
2323 Ga0495586_0007786 3300046535 Bacteria 5711
2324 Ga0495587_0043895 3300046536 Bacteria 2660
2325 Ga0495587_0047158 3300046536 Bacteria 2555
2326 Ga0495587_0101495 3300046536 Bacteria 1657
2327 Ga0495621_0007024 3300046539 Bacteria 3317
2328 Ga0495621_0013316 3300046539 Bacteria 2581
2329 Ga0495621_0060758 3300046539 Bacteria 1371
2330 Ga0495597_0001315 3300046542 Bacteria 18215
2331 Ga0495597_0003381 3300046542 Bacteria 9351
2332 Ga0495597_0003748 3300046542 Bacteria 8666
2333 Ga0495597_0004771 3300046542 Bacteria 7330
2334 Ga0495597_0067209 3300046542 Bacteria 1551
2335 Ga0495597_0085167 3300046542 Bacteria 1347
2336 Ga0495645_0000393 3300046543 Bacteria 30342
2337 Ga0495645_0001757 3300046543 Bacteria 14733
2338 Ga0495645_0007581 3300046543 Bacteria 7550
2339 Ga0495645_0008090 3300046543 Bacteria 7327
2340 Ga0495645_0055442 3300046543 Bacteria 2878
2341 Ga0495645_0059253 3300046543 Bacteria 2777
2342 Ga0495622_0000968 3300046557 Bacteria 15405
2343 Ga0495667_0002589 3300046559 Bacteria 12073
2344 Ga0495667_0090070 3300046559 Bacteria 1988
2345 Ga0495667_0109994 3300046559 Bacteria 1780
2346 Ga0495656_0000090 3300046615 Bacteria 39387
2347 Ga0495634_0208830 3300046642 Bacteria 1210
2348 Ga0495634_0230205 3300046642 Bacteria 1140
2349 Ga0495611_0022841 3300046648 Bacteria 2709
2350 Ga0495611_0036477 3300046648 Bacteria 2182
2351 Ga0495625_0001055 3300046660 Bacteria 36138
2352 Ga0495625_0002257 3300046660 Bacteria 21188
2353 Ga0495625_0025375 3300046660 Bacteria 4496
2354 Ga0495625_0050158 3300046660 Bacteria 2996
2355 Ga0495635_0004221 3300046663 Bacteria 9965
2356 Ga0495635_0162929 3300046663 Bacteria 1517
2357 Ga0495635_0333152 3300046663 Bacteria 1014
2358 Ga0495661_0022257 3300046665 Bacteria 4124
2359 Ga0495661_0025624 3300046665 Bacteria 3807
2360 Ga0495588_0035060 3300046674 Bacteria 2541
2361 Ga0495588_0052721 3300046674 Bacteria 2097
2362 Ga0495657_0073063 3300046675 Bacteria 2235
2363 Ga0495657_0236501 3300046675 Bacteria 1103
2364 Ga0495599_0021474 3300046678 Bacteria 4028
2365 Ga0495599_0035702 3300046678 Bacteria 3121
2366 Ga0495599_0051035 3300046678 Bacteria 2592
2367 Ga0495599_0160208 3300046678 Bacteria 1391
2368 Ga0495599_0162714 3300046678 Bacteria 1379
2369 Ga0495599_0195839 3300046678 Bacteria 1242
2370 Ga0495599_0308798 3300046678 Bacteria 954
2371 Ga0495623_0040566 3300046679 Bacteria 2972
2372 Ga0495623_0128835 3300046679 Bacteria 1517
2373 Ga0495646_0001463 3300046680 Bacteria 14030
2374 Ga0495646_0003553 3300046680 Bacteria 9717
2375 Ga0495646_0005006 3300046680 Bacteria 8357
2376 Ga0495646_0027204 3300046680 Bacteria 3588
2377 Ga0495646_0038698 3300046680 Bacteria 2943
2378 Ga0495646_0064921 3300046680 Bacteria 2162
2379 Ga0495646_0156927 3300046680 Bacteria 1262
2380 Ga0495669_0006300 3300046684 Bacteria 4954
2381 Ga0495669_0046182 3300046684 Bacteria 1943
2382 Ga0495613_0026407 3300046689 Bacteria 4326
2383 Ga0495613_0058917 3300046689 Bacteria 2816
2384 Ga0495613_0093315 3300046689 Bacteria 2179
2385 Ga0495624_0002116 3300046690 Bacteria 15151
2386 Ga0495624_0008626 3300046690 Bacteria 7098
2387 Ga0495624_0021936 3300046690 Bacteria 4229
2388 Ga0495624_0023036 3300046690 Bacteria 4109
2389 Ga0495670_0076189 3300046691 Bacteria 1704
2390 Ga0495671_0000586 3300046692 Bacteria 26926
2391 Ga0495671_0015488 3300046692 Bacteria 4083
2392 Ga0495671_0078200 3300046692 Bacteria 1622
2393 Ga0495671_0092160 3300046692 Bacteria 1483
2394 Ga0495649_0002815 3300046694 Bacteria 12104
2395 Ga0495649_0005731 3300046694 Bacteria 7835
2396 Ga0495649_0007303 3300046694 Bacteria 6757
2397 Ga0495649_0055187 3300046694 Bacteria 2147
2398 Ga0495589_0031804 3300046794 Bacteria 2656
2399 Ga0495589_0061234 3300046794 Bacteria 1847
2400 Ga0495589_0072648 3300046794 Bacteria 1680
2401 Ga0495600_0000383 3300046809 Bacteria 22836
2402 Ga0495600_0009727 3300046809 Bacteria 5943
2403 Ga0495600_0079550 3300046809 Bacteria 2140
2404 Ga0495600_0105756 3300046809 Bacteria 1834
2405 Ga0495600_0209317 3300046809 Bacteria 1250
2406 Ga0495600_0245684 3300046809 Bacteria 1139
2407 Ga0495660_0000020 3300046810 Bacteria 304768
2408 Ga0495660_0000045 3300046810 Bacteria 150303
2409 Ga0495660_0009345 3300046810 Bacteria 5716
2410 Ga0495660_0033500 3300046810 Bacteria 2880
2411 Ga0495660_0035318 3300046810 Bacteria 2794
2412 Ga0495660_0118594 3300046810 Bacteria 1341
2413 Ga0495581_0002341 3300047315 Bacteria 10685
2414 Ga0495581_0010561 3300047315 Bacteria 5338
2415 Ga0495581_0040061 3300047315 Bacteria 2712
2416 Ga0495604_0013517 3300047317 Bacteria 6507
2417 Ga0495604_0018053 3300047317 Bacteria 5646
2418 Ga0495604_0042053 3300047317 Bacteria 3582
2419 Ga0495604_0057076 3300047317 Bacteria 3002
2420 Ga0495604_0058437 3300047317 Bacteria 2961
2421 Ga0495604_0074253 3300047317 Bacteria 2563
2422 Ga0495636_0002751 3300047318 Bacteria 6784
2423 Ga0495674_0024446 3300047319 Bacteria 5551
2424 Ga0495674_0043297 3300047319 Bacteria 4007
2425 Ga0495674_0047294 3300047319 Bacteria 3815
2426 Ga0495674_0058660 3300047319 Bacteria 3364
2427 Ga0495674_0067855 3300047319 Bacteria 3088
2428 Ga0495674_0159844 3300047319 Bacteria 1885
2429 Ga0495674_0191202 3300047319 Bacteria 1701
2430 Ga0495674_0338264 3300047319 Bacteria 1223
2431 Ga0495672_0000011 3300047320 Bacteria 535362
2432 Ga0495672_0000039 3300047320 Bacteria 272506
2433 Ga0495672_0000040 3300047320 Bacteria 268573
2434 Ga0495672_0011163 3300047320 Bacteria 6352
2435 Ga0495672_0033435 3300047320 Bacteria 3185
2436 Ga0495672_0060079 3300047320 Bacteria 2197
2437 Ga0495672_0065091 3300047320 Bacteria 2085
2438 Ga0495672_0093874 3300047320 Bacteria 1642
2439 Ga0495676_0022957 3300047321 Bacteria 5421
2440 Ga0495676_0045661 3300047321 Bacteria 3563
2441 Ga0495676_0048156 3300047321 Bacteria 3439
2442 Ga0495676_0084422 3300047321 Bacteria 2396
2443 Ga0495680_0019793 3300047322 Bacteria 5675
2444 Ga0495680_0034679 3300047322 Bacteria 4071
2445 Ga0495680_0069262 3300047322 Bacteria 2692
2446 Ga0495680_0072348 3300047322 Bacteria 2623
2447 Ga0495680_0276205 3300047322 Bacteria 1185
2448 Ga0495683_0000890 3300047323 Bacteria 21064
2449 Ga0495683_0003192 3300047323 Bacteria 9581
2450 Ga0495683_0008819 3300047323 Bacteria 5378
2451 Ga0495683_0018431 3300047323 Bacteria 3610
2452 Ga0495683_0024993 3300047323 Bacteria 3062
2453 Ga0495683_0035182 3300047323 Bacteria 2546
2454 Ga0495687_000216 3300047443 Bacteria 81734
2455 Ga0495687_001485 3300047443 Bacteria 21418
2456 Ga0495687_025438 3300047443 Bacteria 2798
2457 Ga0495687_031137 3300047443 Bacteria 2450
2458 Ga0495687_110568 3300047443 Bacteria 1011
2459 Ga0495675_0015655 3300047444 Bacteria 4794
2460 Ga0495675_0028080 3300047444 Bacteria 3586
2461 Ga0495675_0085614 3300047444 Bacteria 1982
2462 Ga0495679_000016 3300047446 Bacteria 282024
2463 Ga0495679_000271 3300047446 Bacteria 43383
2464 Ga0495679_002610 3300047446 Bacteria 9059
2465 Ga0495679_002720 3300047446 Bacteria 8815
2466 Ga0495679_003006 3300047446 Bacteria 8298
2467 Ga0495679_058619 3300047446 Bacteria 1135
2468 Ga0495685_036106 3300047447 Bacteria 1697
2469 Ga0495673_0000020 3300047469 Bacteria 548327
2470 Ga0495673_0000079 3300047469 Bacteria 202569
2471 Ga0495673_0028333 3300047469 Bacteria 2654
2472 Ga0495673_0045376 3300047469 Bacteria 1954
2473 Ga0495673_0067324 3300047469 Bacteria 1516
2474 Ga0495681_0046470 3300047470 Bacteria 2070
2475 Ga0495681_0053360 3300047470 Bacteria 1893
2476 Ga0495681_0149702 3300047470 Bacteria 980
2477 Ga0495684_0212584 3300047471 Bacteria 1421
2478 Ga0495684_0265155 3300047471 Bacteria 1245
2479 Ga0495684_0308527 3300047471 Bacteria 1135
2480 Ga0495686_0000214 3300047472 Bacteria 106493
2481 Ga0495686_0051319 3300047472 Bacteria 2588
2482 Ga0495593_0011529 3300047673 Bacteria 5074
2483 Ga0495593_0018332 3300047673 Bacteria 3934
2484 Ga0495593_0021264 3300047673 Bacteria 3626
2485 Ga0495593_0074797 3300047673 Bacteria 1756
2486 Ga0495602_0003402 3300048088 Bacteria 16455
2487 Ga0495602_0004708 3300048088 Bacteria 14264
2488 Ga0495602_0023613 3300048088 Bacteria 5987
2489 Ga0495602_0037133 3300048088 Bacteria 4525
2490 Ga0495602_0064279 3300048088 Bacteria 3173
2491 Ga0495602_0109557 3300048088 Bacteria 2246
2492 Ga0495602_0279474 3300048088 Bacteria 1230
2493 Ga0495614_0000511 3300048089 Bacteria 15910
2494 Ga0495614_0008517 3300048089 Bacteria 4558
2495 Ga0495626_0003417 3300048091 Bacteria 10208
2496 Ga0495626_0011295 3300048091 Bacteria 4729
2497 Ga0495626_0020060 3300048091 Bacteria 3336
2498 Ga0495626_0114437 3300048091 Bacteria 1165
2499 Ga0496100_0010366 3300048903 Bacteria 5273
2500 Ga0496100_0148669 3300048903 Bacteria 1668
2501 Ga0496100_0234698 3300048903 Bacteria 1351
2502 Ga0496100_0327934 3300048903 Bacteria 1151
2503 Ga0496101_0000053 3300048904 Bacteria 139859
2504 Ga0496101_0015082 3300048904 Bacteria 5201
2505 Ga0496101_0015457 3300048904 Bacteria 5145
2506 Ga0496101_0065571 3300048904 Bacteria 2647
2507 Ga0496102_0002846 3300048905 Bacteria 14701
2508 Ga0496102_0003600 3300048905 Bacteria 13123
2509 Ga0496102_0003638 3300048905 Bacteria 13035
2510 Ga0496102_0012962 3300048905 Bacteria 7219
2511 Ga0496102_0040375 3300048905 Bacteria 4221
2512 Ga0496102_0042034 3300048905 Bacteria 4142
2513 Ga0496102_0055185 3300048905 Bacteria 3623
2514 Ga0496102_0072284 3300048905 Bacteria 3169
2515 Ga0496102_0257448 3300048905 Bacteria 1645
2516 Ga0496103_0002469 3300048906 Bacteria 11615
2517 Ga0496103_0046670 3300048906 Bacteria 2675
2518 Ga0496103_0182904 3300048906 Bacteria 1347
2519 Ga0496103_0215280 3300048906 Bacteria 1235
2520 Ga0496104_0000113 3300048907 Bacteria 76556
2521 Ga0496104_0003827 3300048907 Bacteria 13029
2522 Ga0496104_0023772 3300048907 Bacteria 5635
2523 Ga0496104_0059497 3300048907 Bacteria 3617
2524 Ga0496104_0151067 3300048907 Bacteria 2229
2525 Ga0496104_0290241 3300048907 Bacteria 1548
2526 Ga0496104_0300844 3300048907 Bacteria 1516
2527 Ga0496105_0003958 3300048908 Bacteria 11086
2528 Ga0496105_0023635 3300048908 Bacteria 4987
2529 Ga0496105_0065843 3300048908 Bacteria 2991
2530 Ga0496105_0113210 3300048908 Bacteria 2239
2531 Ga0496105_0170263 3300048908 Bacteria 1786
2532 Ga0496106_0007800 3300048909 Bacteria 7918
2533 Ga0496106_0031478 3300048909 Bacteria 3953
2534 Ga0496106_0195462 3300048909 Bacteria 1609
2535 Ga0496107_0017463 3300048910 Bacteria 5047
2536 Ga0496107_0058852 3300048910 Bacteria 2779
2537 Ga0496107_0076795 3300048910 Bacteria 2433
2538 Ga0496107_0307508 3300048910 Bacteria 1180
2539 Ga0496108_0284370 3300048911 Bacteria 1440
2540 Ga0496108_0337453 3300048911 Bacteria 1315
2541 Ga0496109_0089547 3300048912 Bacteria 2845
2542 Ga0496109_0174255 3300048912 Bacteria 2019
2543 Ga0496109_0387868 3300048912 Bacteria 1320
2544 Ga0496110_0000450 3300048913 Bacteria 27963
2545 Ga0496110_0256639 3300048913 Bacteria 1591
2546 Ga0496110_0376408 3300048913 Bacteria 1294
2547 Ga0496110_0464063 3300048913 Bacteria 1154
2548 Ga0496111_0374380 3300048914 Bacteria 1053
2549 Ga0496112_0002790 3300048915 Bacteria 14183
2550 Ga0496112_0009588 3300048915 Bacteria 8733
2551 Ga0496112_0092692 3300048915 Bacteria 2991
2552 Ga0496113_0037101 3300048916 Bacteria 3574
2553 Ga0496113_0063448 3300048916 Bacteria 2792
2554 Ga0496114_0008353 3300048917 Bacteria 8201
2555 Ga0496114_0065896 3300048917 Bacteria 3035
2556 Ga0496114_0243481 3300048917 Bacteria 1582
2557 Ga0496114_0248489 3300048917 Bacteria 1565
2558 Ga0496114_0365117 3300048917 Bacteria 1277
2559 Ga0496115_0184312 3300048918 Bacteria 1725
2560 Ga0496116_0000058 3300048919 Bacteria 279767
2561 Ga0496116_0000129 3300048919 Bacteria 158284
2562 Ga0496116_0000278 3300048919 Bacteria 88946
2563 Ga0496116_0000498 3300048919 Bacteria 53958
2564 Ga0496116_0000734 3300048919 Bacteria 41881
2565 Ga0496116_0002010 3300048919 Bacteria 21868
2566 Ga0496116_0006777 3300048919 Bacteria 10309
2567 Ga0496116_0018067 3300048919 Bacteria 5450
2568 Ga0496116_0081802 3300048919 Bacteria 2000
2569 Ga0496116_0084099 3300048919 Bacteria 1961
2570 Ga0496116_0119215 3300048919 Bacteria 1531
2571 Ga0496117_0000092 3300048920 Bacteria 202608
2572 Ga0496117_0000224 3300048920 Bacteria 106727
2573 Ga0496117_0000400 3300048920 Bacteria 73656
2574 Ga0496117_0003328 3300048920 Bacteria 18771
2575 Ga0496117_0004125 3300048920 Bacteria 16268
2576 Ga0496117_0008005 3300048920 Bacteria 10139
2577 Ga0496117_0011620 3300048920 Bacteria 7869
2578 Ga0496117_0011864 3300048920 Bacteria 7753
2579 Ga0496117_0012307 3300048920 Bacteria 7562
2580 Ga0496117_0012900 3300048920 Bacteria 7326
2581 Ga0496117_0015917 3300048920 Bacteria 6372
2582 Ga0496117_0028442 3300048920 Bacteria 4328
2583 Ga0496117_0060747 3300048920 Bacteria 2602
2584 Ga0496117_0062113 3300048920 Bacteria 2562
2585 Ga0496117_0077832 3300048920 Bacteria 2192
2586 Ga0496117_0087413 3300048920 Bacteria 2021
2587 Ga0496117_0161141 3300048920 Bacteria 1314
2588 Ga0496118_0000053 3300048921 Bacteria 235810
2589 Ga0496118_0000540 3300048921 Bacteria 62183
2590 Ga0496118_0000718 3300048921 Bacteria 53459
2591 Ga0496118_0001531 3300048921 Bacteria 34420
2592 Ga0496118_0003145 3300048921 Bacteria 21123
2593 Ga0496118_0003209 3300048921 Bacteria 20873
2594 Ga0496118_0003978 3300048921 Bacteria 18021
2595 Ga0496118_0003984 3300048921 Bacteria 18005
2596 Ga0496118_0005606 3300048921 Bacteria 14180
2597 Ga0496118_0006660 3300048921 Bacteria 12604
2598 Ga0496118_0019914 3300048921 Bacteria 5973
2599 Ga0496118_0020193 3300048921 Bacteria 5917
2600 Ga0496118_0029281 3300048921 Bacteria 4621
2601 Ga0496118_0038828 3300048921 Bacteria 3809
2602 Ga0496118_0058417 3300048921 Bacteria 2882
2603 Ga0496118_0062755 3300048921 Bacteria 2739
2604 Ga0496118_0074874 3300048921 Bacteria 2417
2605 Ga0496118_0114347 3300048921 Bacteria 1779
2606 Ga0496118_0155719 3300048921 Bacteria 1422
2607 Ga0496118_0208757 3300048921 Bacteria 1148
2608 Ga0496119_0000023 3300048922 Bacteria 259882
2609 Ga0496119_0000075 3300048922 Bacteria 146247
2610 Ga0496119_0000285 3300048922 Bacteria 70929
2611 Ga0496119_0000555 3300048922 Bacteria 50572
2612 Ga0496119_0001950 3300048922 Bacteria 23502
2613 Ga0496119_0002224 3300048922 Bacteria 21627
2614 Ga0496119_0003164 3300048922 Bacteria 17283
2615 Ga0496119_0004476 3300048922 Bacteria 13894
2616 Ga0496119_0005370 3300048922 Bacteria 12319
2617 Ga0496119_0017948 3300048922 Bacteria 5293
2618 Ga0496120_0000008 3300048923 Bacteria 404544
2619 Ga0496120_0000024 3300048923 Bacteria 236853
2620 Ga0496120_0000178 3300048923 Bacteria 107847
2621 Ga0496120_0000388 3300048923 Bacteria 70929
2622 Ga0496120_0000548 3300048923 Bacteria 57387
2623 Ga0496120_0000758 3300048923 Bacteria 46757
2624 Ga0496120_0001587 3300048923 Bacteria 26441
2625 Ga0496120_0002687 3300048923 Bacteria 17470
2626 Ga0496120_0008474 3300048923 Bacteria 7458
2627 Ga0496120_0008652 3300048923 Bacteria 7346
2628 Ga0496120_0024221 3300048923 Bacteria 3787
2629 Ga0496120_0050167 3300048923 Bacteria 2390
2630 Ga0496120_0093490 3300048923 Bacteria 1602
2631 Ga0496120_0140248 3300048923 Bacteria 1228
2632 Ga0496121_0000200 3300048924 Bacteria 131314
2633 Ga0496121_0000304 3300048924 Bacteria 102259
2634 Ga0496121_0003964 3300048924 Bacteria 20424
2635 Ga0496121_0007406 3300048924 Bacteria 13262
2636 Ga0496121_0009287 3300048924 Bacteria 11343
2637 Ga0496121_0013099 3300048924 Bacteria 8951
2638 Ga0496121_0027348 3300048924 Bacteria 5338
2639 Ga0496121_0033160 3300048924 Bacteria 4679
2640 Ga0496121_0038000 3300048924 Bacteria 4270
2641 Ga0496121_0041075 3300048924 Bacteria 4049
2642 Ga0496121_0115659 3300048924 Bacteria 2036
2643 Ga0496121_0332563 3300048924 Bacteria 1018
2644 Ga0496122_0000021 3300048925 Bacteria 391363
2645 Ga0496122_0000108 3300048925 Bacteria 191029
2646 Ga0496122_0000904 3300048925 Bacteria 54728
2647 Ga0496122_0001295 3300048925 Bacteria 41340
2648 Ga0496122_0001307 3300048925 Bacteria 40980
2649 Ga0496122_0001889 3300048925 Bacteria 31699
2650 Ga0496122_0003683 3300048925 Bacteria 19870
2651 Ga0496122_0009582 3300048925 Bacteria 10158
2652 Ga0496122_0033216 3300048925 Bacteria 4249
2653 Ga0496122_0039601 3300048925 Bacteria 3756
2654 Ga0496122_0061817 3300048925 Bacteria 2746
2655 Ga0496122_0072275 3300048925 Bacteria 2453
2656 Ga0496123_0000065 3300048926 Bacteria 211758
2657 Ga0496123_0000382 3300048926 Bacteria 83286
2658 Ga0496123_0000424 3300048926 Bacteria 76245
2659 Ga0496123_0000504 3300048926 Bacteria 67871
2660 Ga0496123_0000703 3300048926 Bacteria 54728
2661 Ga0496123_0001035 3300048926 Bacteria 42221
2662 Ga0496123_0002189 3300048926 Bacteria 24885
2663 Ga0496123_0003349 3300048926 Bacteria 18135
2664 Ga0496123_0005290 3300048926 Bacteria 13078
2665 Ga0496123_0017969 3300048926 Bacteria 5659
2666 Ga0496123_0023531 3300048926 Bacteria 4712
2667 Ga0496123_0032154 3300048926 Bacteria 3805
2668 Ga0496123_0065430 3300048926 Bacteria 2311
2669 Ga0496123_0171276 3300048926 Bacteria 1145
2670 Ga0496123_0222477 3300048926 Bacteria 951
2671 Ga0496124_0000004 3300048927 Bacteria 976131
2672 Ga0496124_0000109 3300048927 Bacteria 166429
2673 Ga0496124_0000147 3300048927 Bacteria 145724
2674 Ga0496124_0000251 3300048927 Bacteria 103690
2675 Ga0496124_0000304 3300048927 Bacteria 90806
2676 Ga0496124_0000379 3300048927 Bacteria 81086
2677 Ga0496124_0001528 3300048927 Bacteria 33674
2678 Ga0496124_0001721 3300048927 Bacteria 30865
2679 Ga0496124_0004538 3300048927 Bacteria 16164
2680 Ga0496124_0009521 3300048927 Bacteria 9992
2681 Ga0496124_0013849 3300048927 Bacteria 7843
2682 Ga0496124_0036375 3300048927 Bacteria 4295
2683 Ga0496124_0056880 3300048927 Bacteria 3297
2684 Ga0496124_0058741 3300048927 Bacteria 3233
2685 Ga0496124_0064796 3300048927 Bacteria 3049
2686 Ga0496124_0080515 3300048927 Bacteria 2680
2687 Ga0496124_0109018 3300048927 Bacteria 2232
2688 Ga0496124_0120787 3300048927 Bacteria 2094
2689 Ga0496124_0121804 3300048927 Bacteria 2083
2690 Ga0496125_0000005 3300048928 Bacteria 827598
2691 Ga0496125_0000104 3300048928 Bacteria 201270
2692 Ga0496125_0000115 3300048928 Bacteria 181994
2693 Ga0496125_0000740 3300048928 Bacteria 53957
2694 Ga0496125_0001627 3300048928 Bacteria 31652
2695 Ga0496125_0003971 3300048928 Bacteria 17409
2696 Ga0496125_0004253 3300048928 Bacteria 16678
2697 Ga0496125_0005839 3300048928 Bacteria 13512
2698 Ga0496125_0007136 3300048928 Bacteria 11923
2699 Ga0496125_0028048 3300048928 Bacteria 5091
2700 Ga0496125_0052873 3300048928 Bacteria 3336
2701 Ga0496126_0000538 3300048929 Bacteria 73271
2702 Ga0496126_0001394 3300048929 Bacteria 38268
2703 Ga0496126_0001579 3300048929 Bacteria 34827
2704 Ga0496126_0003828 3300048929 Bacteria 18637
2705 Ga0496126_0006622 3300048929 Bacteria 12895
2706 Ga0496126_0017155 3300048929 Bacteria 7220
2707 Ga0496126_0028738 3300048929 Bacteria 5293
2708 Ga0496126_0043488 3300048929 Bacteria 4143
2709 Ga0496126_0100423 3300048929 Bacteria 2532
2710 Ga0496126_0183072 3300048929 Bacteria 1778
2711 Ga0496126_0200504 3300048929 Bacteria 1685
2712 Ga0496126_0370193 3300048929 Bacteria 1168
2713 Ga0496126_0457979 3300048929 Bacteria 1025
2714 Ga0495678_002665 3300049459 Bacteria 11815
2715 Ga0495678_017979 3300049459 Bacteria 3188
2716 Ga0495678_113021 3300049459 Bacteria 923
2717 Ga0495682_0000022 3300049460 Bacteria 183265
2718 Ga0495682_0012554 3300049460 Bacteria 3244
2719 Ga0495682_0061008 3300049460 Bacteria 1361
2720 Ga0501032_0000615 3300049569 Bacteria 28854
2721 Ga0501033_0052069 3300049570 Bacteria 3034
2722 Ga0501033_0142277 3300049570 Bacteria 1734
2723 Ga0501034_0005011 3300049571 Bacteria 14561
2724 Ga0501034_0008920 3300049571 Bacteria 10541
2725 Ga0501034_0021600 3300049571 Bacteria 6557
2726 Ga0501034_0034858 3300049571 Bacteria 5103
2727 Ga0501034_0074100 3300049571 Bacteria 3413
2728 Ga0501036_0005170 3300049572 Bacteria 10550
2729 Ga0501036_0033415 3300049572 Bacteria 4351
2730 Ga0501036_0207534 3300049572 Bacteria 1647
2731 Ga0501036_0360482 3300049572 Bacteria 1214
2732 Ga0501037_0011457 3300049573 Bacteria 6527
2733 Ga0501037_0039762 3300049573 Bacteria 3461
2734 Ga0501037_0141822 3300049573 Bacteria 1719
2735 Ga0501038_0025897 3300049574 Bacteria 5225
2736 Ga0501038_0286751 3300049574 Bacteria 1295
2737 Ga0501039_0044084 3300049575 Bacteria 3445
2738 Ga0501041_0011028 3300049577 Bacteria 5338
2739 Ga0501042_0091557 3300049578 Bacteria 2183
2740 Ga0501042_0122072 3300049578 Bacteria 1876
2741 Ga0501043_0006551 3300049579 Bacteria 9340
2742 Ga0501043_0047121 3300049579 Bacteria 3389
2743 Ga0501043_0114047 3300049579 Bacteria 2122
2744 Ga0501046_0018570 3300049580 Bacteria 5782
2745 Ga0501046_0035965 3300049580 Bacteria 3988
2746 Ga0501046_0148493 3300049580 Bacteria 1769
2747 Ga0501046_0158582 3300049580 Bacteria 1703
2748 Ga0501047_0012236 3300049581 Bacteria 8124
2749 Ga0501047_0021033 3300049581 Bacteria 6267
2750 Ga0501047_0117323 3300049581 Bacteria 2543
2751 Ga0501047_0119302 3300049581 Bacteria 2520
2752 Ga0501048_0042191 3300049582 Bacteria 3267
2753 Ga0501067_0027998 3300049583 Bacteria 3123
2754 Ga0501068_0028444 3300049584 Bacteria 3306
2755 Ga0501068_0191912 3300049584 Bacteria 1294
2756 Ga0501069_0002412 3300049585 Bacteria 9502
2757 Ga0501069_0204604 3300049585 Bacteria 1144
2758 Ga0501070_0002316 3300049586 Bacteria 16713
2759 Ga0501070_0042582 3300049586 Bacteria 3782
2760 Ga0501070_0058803 3300049586 Bacteria 3186
2761 Ga0501070_0075435 3300049586 Bacteria 2792
2762 Ga0501070_0109144 3300049586 Bacteria 2286
2763 Ga0501070_0312004 3300049586 Bacteria 1280
2764 Ga0501070_0327085 3300049586 Bacteria 1246
2765 Ga0501071_0001663 3300049587 Bacteria 13042
2766 Ga0501071_0029183 3300049587 Bacteria 3891
2767 Ga0501071_0055975 3300049587 Bacteria 2848
2768 Ga0501072_0017370 3300049588 Bacteria 5527
2769 Ga0501072_0113137 3300049588 Bacteria 2161
2770 Ga0501072_0116808 3300049588 Bacteria 2125
2771 Ga0501072_0136856 3300049588 Bacteria 1953
2772 Ga0501073_0011901 3300049589 Bacteria 6351
2773 Ga0501073_0052071 3300049589 Bacteria 2867
2774 Ga0501073_0058564 3300049589 Bacteria 2692
2775 Ga0501074_0002551 3300049590 Bacteria 12709
2776 Ga0501074_0012555 3300049590 Bacteria 6158
2777 Ga0501074_0024009 3300049590 Bacteria 4431
2778 Ga0501074_0113043 3300049590 Bacteria 1943
2779 Ga0501075_0001151 3300049591 Bacteria 17080
2780 Ga0501075_0023210 3300049591 Bacteria 4540
2781 Ga0501075_0070461 3300049591 Bacteria 2642
2782 Ga0501075_0076563 3300049591 Bacteria 2531
2783 Ga0501075_0201145 3300049591 Bacteria 1519
2784 Ga0501076_0000794 3300049592 Bacteria 20432
2785 Ga0501076_0056838 3300049592 Bacteria 3106
2786 Ga0501076_0101087 3300049592 Bacteria 2324
2787 Ga0501076_0192905 3300049592 Bacteria 1663
2788 Ga0501077_0016930 3300049593 Bacteria 4598
2789 Ga0501077_0080635 3300049593 Bacteria 2062
2790 Ga0501222_000664 3300049662 Bacteria 5028
2791 Ga0501240_019339 3300049673 Bacteria 1011
2792 Ga0501225_0015601 3300049705 Bacteria 2114
2793 Ga0501079_0011571 3300049741 Bacteria 6736
2794 Ga0501079_0013876 3300049741 Bacteria 6146
2795 Ga0501079_0050332 3300049741 Bacteria 3216
2796 Ga0501079_0050973 3300049741 Bacteria 3194
2797 Ga0501080_0000400 3300049742 Bacteria 33491
2798 Ga0501080_0004208 3300049742 Bacteria 12772
2799 Ga0501080_0007125 3300049742 Bacteria 10095
2800 Ga0501080_0017097 3300049742 Bacteria 6699
2801 Ga0501080_0458656 3300049742 Bacteria 1142
2802 Ga0501081_0001465 3300049743 Bacteria 14459
2803 Ga0501081_0035107 3300049743 Bacteria 3413
2804 Ga0501081_0264185 3300049743 Bacteria 1258
2805 Ga0501083_0001718 3300049744 Bacteria 14921
2806 Ga0501083_0025901 3300049744 Bacteria 4059
2807 Ga0501083_0034952 3300049744 Bacteria 3435
2808 Ga0501262_000577 3300049759 Bacteria 4369
2809 Ga0501035_0002665 3300049822 Bacteria 17367
2810 Ga0501035_0016665 3300049822 Bacteria 6775
2811 Ga0501035_0018956 3300049822 Bacteria 6337
2812 Ga0501035_0120268 3300049822 Bacteria 2297
2813 Ga0501035_0265809 3300049822 Bacteria 1453
2814 Ga0501044_0001935 3300049823 Bacteria 23949
2815 Ga0501044_0006750 3300049823 Bacteria 12652
2816 Ga0501044_0258751 3300049823 Bacteria 1679
2817 Ga0501044_0489379 3300049823 Bacteria 1132
2818 Ga0501045_0034291 3300049824 Bacteria 3684
2819 Ga0501045_0065609 3300049824 Bacteria 2665
2820 Ga0501045_0402197 3300049824 Bacteria 1019
2821 nmdc:mga03683_115990_c1 3300050489 Bacteria 1188
2822 nmdc:mga03683_4308_c1 3300050489 Bacteria 4704
2823 nmdc:mga03683_68951_c1 3300050489 Bacteria 1508
2824 nmdc:mga03n38_145766_c1 3300050490 Bacteria 1187
2825 nmdc:mga00v17_102060_c1 3300050491 Bacteria 1812
2826 nmdc:mga00v17_109774_c1 3300050491 Bacteria 1749
2827 nmdc:mga00v17_3803_c1 3300050491 Bacteria 7787
2828 nmdc:mga0yw44_130661_c1 3300050492 Bacteria 1625
2829 nmdc:mga0k408_105394_c1 3300050493 Bacteria 1665
2830 nmdc:mga0k408_1309_c2 3300050493 Bacteria 3346
2831 nmdc:mga0k408_142390_c1 3300050493 Bacteria 1427
2832 nmdc:mga0k408_156637_c1 3300050493 Bacteria 1356
2833 nmdc:mga0k408_18725_c2 3300050493 Bacteria 1634
2834 nmdc:mga0k408_2064_c1 3300050493 Bacteria 10745
2835 nmdc:mga0k408_31675_c1 3300050493 Bacteria 3020
2836 nmdc:mga0k408_60878_c1 3300050493 Bacteria 2194
2837 nmdc:mga0k408_7453_c1 3300050493 Bacteria 5843
2838 nmdc:mga0k408_76871_c1 3300050493 Bacteria 1952
2839 nmdc:mga0k408_83732_c1 3300050493 Bacteria 1870
2840 nmdc:mga06z11_11018_c1 3300050494 Bacteria 3880
2841 nmdc:mga06z11_54957_c1 3300050494 Bacteria 2054
2842 nmdc:mga04h51_71691_c1 3300050495 Bacteria 1211
2843 nmdc:mga07m45_11357_c1 3300050496 Bacteria 4677
2844 nmdc:mga07m45_1226_c1 3300050496 Bacteria 11616
2845 nmdc:mga07m45_15732_c1 3300050496 Bacteria 4042
2846 nmdc:mga07m45_18621_c1 3300050496 Bacteria 3753
2847 nmdc:mga07m45_3534_c1 3300050496 Bacteria 7549
2848 nmdc:mga07m45_639_c1 3300050496 Bacteria 13305
2849 nmdc:mga07m45_65588_c1 3300050496 Bacteria 2062
2850 nmdc:mga05p37_1155_c1 3300050507 Bacteria 30440
2851 nmdc:mga05p37_118816_c1 3300050507 Bacteria 3248
2852 nmdc:mga05p37_181_c1 3300050507 Bacteria 61821
2853 nmdc:mga05p37_196254_c1 3300050507 Bacteria 2447
2854 nmdc:mga05p37_21359_c1 3300050507 Bacteria 7840
2855 nmdc:mga09592_1175_c1 3300050508 Bacteria 20930
2856 nmdc:mga09592_1507_c1 3300050508 Bacteria 18749
2857 nmdc:mga09592_26046_c1 3300050508 Bacteria 4844
2858 nmdc:mga09592_71297_c1 3300050508 Bacteria 2949
2859 nmdc:mga0qj67_11865_c1 3300050509 Bacteria 6544
2860 nmdc:mga0qj67_50089_c1 3300050509 Bacteria 3302
2861 nmdc:mga0qj67_58959_c1 3300050509 Bacteria 3044
2862 nmdc:mga0qj67_81087_c1 3300050509 Bacteria 2601
2863 nmdc:mga06r32_115637_c1 3300050510 Bacteria 2642
2864 nmdc:mga06r32_23305_c1 3300050510 Bacteria 5726
2865 nmdc:mga06r32_441282_c1 3300050510 Bacteria 1282
2866 nmdc:mga06r32_58147_c1 3300050510 Bacteria 3716
2867 nmdc:mga06r32_73337_c1 3300050510 Bacteria 3316
2868 nmdc:mga06r32_91050_c1 3300050510 Bacteria 2980
2869 nmdc:mga08y16_104382_c1 3300050511 Bacteria 2950
2870 nmdc:mga08y16_14999_c1 3300050511 Bacteria 8151
2871 nmdc:mga08y16_18394_c1 3300050511 Bacteria 7366
2872 nmdc:mga08y16_224_c1 3300050511 Bacteria 50738
2873 nmdc:mga08y16_274570_c1 3300050511 Bacteria 1739
2874 nmdc:mga08y16_28872_c1 3300050511 Bacteria 5847
2875 nmdc:mga08y16_6391_c1 3300050511 Bacteria 12352
2876 nmdc:mga0n895_208220_c1 3300050512 Bacteria 1986
2877 nmdc:mga0n895_35549_c1 3300050512 Bacteria 4804
2878 nmdc:mga0n895_5199_c1 3300050512 Bacteria 10831
2879 nmdc:mga0n895_556763_c1 3300050512 Bacteria 1152
2880 nmdc:mga0n895_83565_c1 3300050512 Bacteria 3185
2881 nmdc:mga0n895_882707_c1 3300050512 Bacteria 880
2882 nmdc:mga0rr50_143591_c1 3300050513 Bacteria 1922
2883 nmdc:mga0rr50_2593_c1 3300050513 Bacteria 10242
2884 nmdc:mga0rr50_27167_c1 3300050513 Bacteria 4002
2885 nmdc:mga0rr50_297370_c1 3300050513 Bacteria 1350
2886 nmdc:mga08x19_108526_c1 3300050514 Bacteria 1849
2887 nmdc:mga08x19_1806_c1 3300050514 Bacteria 13151
2888 nmdc:mga08x19_18330_c1 3300050514 Bacteria 4290
2889 nmdc:mga08x19_219_c1 3300050514 Bacteria 43753
2890 nmdc:mga08x19_23923_c1 3300050514 Bacteria 3792
2891 nmdc:mga08x19_71036_c1 3300050514 Bacteria 2269
2892 nmdc:mga0a205_15430_c1 3300050515 Bacteria 7139
2893 nmdc:mga0a205_170038_c1 3300050515 Bacteria 2075
2894 nmdc:mga0a205_904_c1 3300050515 Bacteria 24422
2895 nmdc:mga0a205_97643_c1 3300050515 Bacteria 2836
2896 nmdc:mga0sz30_10668_c1 3300050516 Bacteria 3526
2897 nmdc:mga0sz30_98931_c1 3300050516 Bacteria 1273
2898 Ga0495601_0005820 3300053077 Bacteria 7188
2899 Ga0495601_0021607 3300053077 Bacteria 3942
2900 Ga0495601_0225105 3300053077 Bacteria 1225
2901 Ga0500610_0002566 3300053079 Bacteria 6744
2902 Ga0495595_0024845 3300053084 Bacteria 2649
2903 Ga0495595_0089481 3300053084 Bacteria 1476
2904 Ga0495619_0252910 3300053085 Bacteria 1221
2905 Ga0500646_0002088 3300053090 Bacteria 5207
2906 Ga0500583_0017328 3300053092 Bacteria 2899
2907 Ga0500651_0000137 3300053093 Bacteria 45846
2908 Ga0500651_0031359 3300053093 Bacteria 3347
2909 Ga0500562_025068 3300053108 Bacteria 1560
2910 Ga0500594_0005924 3300053118 Bacteria 2725
2911 Ga0500595_004168 3300053119 Bacteria 6554
2912 Ga0500607_033921 3300053121 Bacteria 2796
2913 Ga0500618_001749 3300053125 Bacteria 9209
2914 Ga0500618_003746 3300053125 Bacteria 5087
2915 Ga0500621_000009 3300053126 Bacteria 173209
2916 Ga0500658_0000507 3300053134 Bacteria 16624
2917 Ga0500658_0000854 3300053134 Bacteria 12508
2918 Ga0500559_0022366 3300053136 Bacteria 2680
2919 Ga0500568_0000554 3300053139 Bacteria 27551
2920 Ga0500573_0178958 3300053140 Bacteria 1141
2921 Ga0500577_0000465 3300053142 Bacteria 10483
2922 Ga0500586_040283 3300053145 Bacteria 1582
2923 Ga0500616_0011698 3300053153 Bacteria 5168
2924 Ga0500627_0031167 3300053158 Bacteria 2238
2925 Ga0500634_0041798 3300053161 Bacteria 2488
2926 Ga0500645_001181 3300053730 Bacteria 13913
2927 Ga0501084_0017661 3300054114 Bacteria 5935
2928 Ga0501084_0084750 3300054114 Bacteria 2660
2929 Ga0590071_001042 3300059421 Bacteria 7524
2930 Ga0590071_030382 3300059421 Bacteria 1287
2931 Ga0501082_0057859 3300060353 Bacteria 3339
2932 Ga0501082_0080327 3300060353 Bacteria 2814
2933 Ga0501082_0163713 3300060353 Bacteria 1933
2934 Ga0501082_0180649 3300060353 Bacteria 1835
2935 Ga0501082_0263756 3300060353 Bacteria 1498
2936 Ga0501082_0301150 3300060353 Bacteria 1396
2937 Ga0466962_0000504 3300061719 Bacteria 16980
2938 Ga0466962_0001146 3300061719 Bacteria 12229
2939 Ga0466962_0006815 3300061719 Bacteria 5483
2940 Ga0466962_0024459 3300061719 Bacteria 2901
2941 Ga0530510_0000409 3300061734 Bacteria 27905
2942 Ga0530510_0000684 3300061734 Bacteria 21892
2943 Ga0530510_0005871 3300061734 Bacteria 8508
2944 Ga0530510_0018333 3300061734 Bacteria 4963
2945 Ga0530510_0049300 3300061734 Bacteria 3043

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031901 Ga0307406_10034170 Ga0307406_100341703 227
2 3300026095 Ga0207676_10082576 Ga0207676_100825763 230
3 3300005354 Ga0070675_100557702 Ga0070675_1005577022 236
4 3300025926 Ga0207659_10355283 Ga0207659_103552832 236
5 3300038443 Ga0395901_0394551 Ga0395901_0394551_23_739 236
6 3300005456 Ga0070678_100097502 Ga0070678_1000975022 237
7 3300005459 Ga0068867_100047301 Ga0068867_1000473012 237
8 3300005841 Ga0068863_100271788 Ga0068863_1002717882 237
9 3300009176 Ga0105242_10161522 Ga0105242_101615222 237
10 3300017792 Ga0163161_10186378 Ga0163161_101863782 237
11 3300025934 Ga0207686_10104800 Ga0207686_101048002 237
12 3300025937 Ga0207669_10085400 Ga0207669_100854002 237
13 3300025940 Ga0207691_10014382 Ga0207691_100143827 237
14 3300026067 Ga0207678_10141914 Ga0207678_101419142 237
15 3300026089 Ga0207648_10025102 Ga0207648_100251024 237
16 3300026121 Ga0207683_10023146 Ga0207683_100231464 237
17 3300005336 Ga0070680_100178941 Ga0070680_1001789412 246
18 3300025304 Ga0209257_1020645 Ga0209257_10206452 250
19 3300046499 Ga0495594_0277180 Ga0495594_0277180_68_862 252
20 3300006846 Ga0075430_100063673 Ga0075430_1000636732 253
21 3300025908 Ga0207643_10053854 Ga0207643_100538542 255
22 3300041486 Ga0451807_1198663 Ga0451807_1198663_424_1194 255
23 3300005295 Ga0065707_10179063 Ga0065707_101790632 256
24 3300039437 Ga0436365_1784610 Ga0436365_1784610_59_853 256
25 3300006195 Ga0075366_10027555 Ga0075366_100275552 258
26 3300006353 Ga0075370_10030112 Ga0075370_100301122 258
27 3300009551 Ga0105238_10396181 Ga0105238_103961812 258
28 3300025924 Ga0207694_10290630 Ga0207694_102906302 258
29 3300031239 Ga0265328_10003818 Ga0265328_100038182 258
30 3300031250 Ga0265331_10042289 Ga0265331_100422893 258
31 3300031251 Ga0265327_10000012 Ga0265327_1000001262 258
32 3300050493 nmdc:mga0k408_7453_c1 nmdc:mga0k408_7453_c1_609_1460 258
33 3300050496 nmdc:mga07m45_18621_c1 nmdc:mga07m45_18621_c1_2178_3029 258
34 3300005339 Ga0070660_100183302 Ga0070660_1001833021 260
35 3300005455 Ga0070663_100302292 Ga0070663_1003022921 260
36 3300005535 Ga0070684_100191449 Ga0070684_1001914492 260
37 3300005563 Ga0068855_100316998 Ga0068855_1003169982 260
38 3300005577 Ga0068857_100141742 Ga0068857_1001417422 260
39 3300005614 Ga0068856_100079148 Ga0068856_1000791483 260
40 3300010375 Ga0105239_10068174 Ga0105239_100681743 260
41 3300013100 Ga0157373_10162898 Ga0157373_101628982 260
42 3300025919 Ga0207657_10196782 Ga0207657_101967822 260
43 3300025920 Ga0207649_10056168 Ga0207649_100561683 260
44 3300025960 Ga0207651_10618368 Ga0207651_106183681 260
45 3300026067 Ga0207678_10233767 Ga0207678_102337672 260
46 3300037312 Ga0395899_0041260 Ga0395899_0041260_678_1562 260
47 3300037312 Ga0395899_0089657 Ga0395899_0089657_111_995 260
48 3300037418 Ga0395900_0016821 Ga0395900_0016821_4868_5752 260
49 3300037418 Ga0395900_0035868 Ga0395900_0035868_1972_2856 260
50 3300037466 Ga0395898_0004630 Ga0395898_0004630_6219_7103 260
51 3300038443 Ga0395901_0029684 Ga0395901_0029684_2493_3377 260
52 3300028794 Ga0307515_10097070 Ga0307515_100970703 261
53 3300031456 Ga0307513_10008037 Ga0307513_100080374 261
54 3300009094 Ga0111539_10151211 Ga0111539_101512112 262
55 3300013308 Ga0157375_10396054 Ga0157375_103960541 262
56 3300027907 Ga0207428_10181219 Ga0207428_101812192 262
57 3300035120 Ga0373957_0041194 Ga0373957_0041194_806_1660 262
58 3300045051 Ga0451576_0759854 Ga0451576_0759854_17_865 262
59 3300050508 nmdc:mga09592_71297_c1 nmdc:mga09592_71297_c1_1682_2530 262
60 3300050511 nmdc:mga08y16_28872_c1 nmdc:mga08y16_28872_c1_3290_4138 262
61 3300005327 Ga0070658_10003070 Ga0070658_100030709 263
62 3300005336 Ga0070680_100011091 Ga0070680_1000110914 263
63 3300005530 Ga0070679_100006481 Ga0070679_1000064819 263
64 3300005563 Ga0068855_100003799 Ga0068855_1000037997 263
65 3300005937 Ga0081455_10003413 Ga0081455_100034134 263
66 3300009093 Ga0105240_10008203 Ga0105240_100082034 263
67 3300025909 Ga0207705_10010721 Ga0207705_100107213 263
68 3300025913 Ga0207695_10038695 Ga0207695_100386952 263
69 3300025917 Ga0207660_10035695 Ga0207660_100356953 263
70 3300025921 Ga0207652_10025590 Ga0207652_100255902 263
71 3300025949 Ga0207667_10044686 Ga0207667_100446864 263
72 3300026116 Ga0207674_10023166 Ga0207674_100231665 263
73 3300049823 Ga0501044_0489379 Ga0501044_0489379_222_1106 263
74 3300003856 Ga0058692_1002728 Ga0058692_10027282 264
75 3300005435 Ga0070714_100005684 Ga0070714_1000056842 264
76 3300005577 Ga0068857_100238205 Ga0068857_1002382052 264
77 3300006844 Ga0075428_100028500 Ga0075428_1000285002 264
78 3300009036 Ga0105244_10003993 Ga0105244_100039933 264
79 3300009036 Ga0105244_10027354 Ga0105244_100273543 264
80 3300009093 Ga0105240_10189237 Ga0105240_101892372 264
81 3300009147 Ga0114129_10514071 Ga0114129_105140712 264
82 3300013307 Ga0157372_10015939 Ga0157372_100159396 264
83 3300013307 Ga0157372_10595690 Ga0157372_105956901 264
84 3300025728 Ga0207655_1000024 Ga0207655_1000024386 264
85 3300025728 Ga0207655_1024118 Ga0207655_10241182 264
86 3300025929 Ga0207664_10083324 Ga0207664_100833242 264
87 3300027312 Ga0209371_1001086 Ga0209371_100108619 264
88 3300030500 Ga0268256_1003837 Ga0268256_10038375 264
89 3300035120 Ga0373957_0092605 Ga0373957_0092605_109_990 264
90 3300035692 Ga0373935_0089571 Ga0373935_0089571_21_902 264
91 3300035725 Ga0373947_0014019 Ga0373947_0014019_2364_3245 264
92 3300036401 Ga0373937_0032289 Ga0373937_0032289_815_1696 264
93 3300037068 Ga0373925_0015577 Ga0373925_0015577_1350_2231 264
94 3300046454 Ga0495592_0041716 Ga0495592_0041716_1161_2042 264
95 3300046462 Ga0495651_0079049 Ga0495651_0079049_703_1584 264
96 3300046536 Ga0495587_0047158 Ga0495587_0047158_499_1380 264
97 3300046543 Ga0495645_0000393 Ga0495645_0000393_27434_28315 264
98 3300046678 Ga0495599_0035702 Ga0495599_0035702_2122_3003 264
99 3300046680 Ga0495646_0064921 Ga0495646_0064921_410_1291 264
100 3300046809 Ga0495600_0079550 Ga0495600_0079550_968_1849 264
101 3300047317 Ga0495604_0018053 Ga0495604_0018053_540_1421 264
102 3300047319 Ga0495674_0024446 Ga0495674_0024446_1152_2033 264
103 3300047444 Ga0495675_0015655 Ga0495675_0015655_1904_2785 264
104 3300048088 Ga0495602_0003402 Ga0495602_0003402_10822_11703 264
105 3300048919 Ga0496116_0000734 Ga0496116_0000734_5764_6606 264
106 3300048922 Ga0496119_0005370 Ga0496119_0005370_7398_8240 264
107 3300048923 Ga0496120_0000178 Ga0496120_0000178_69201_70043 264
108 3300048927 Ga0496124_0001528 Ga0496124_0001528_12846_13688 264
109 3300050507 nmdc:mga05p37_196254_c1 nmdc:mga05p37_196254_c1_1033_1881 264
110 3300050510 nmdc:mga06r32_23305_c1 nmdc:mga06r32_23305_c1_3411_4259 264
111 3300053077 Ga0495601_0005820 Ga0495601_0005820_5594_6475 264
112 3300053077 Ga0495601_0021607 Ga0495601_0021607_2905_3786 264
113 3300053084 Ga0495595_0024845 Ga0495595_0024845_804_1685 264
114 3300005468 Ga0070707_100120098 Ga0070707_1001200983 265
115 3300006051 Ga0075364_10167547 Ga0075364_101675472 265
116 3300009011 Ga0105251_10005801 Ga0105251_100058013 265
117 3300009092 Ga0105250_10005110 Ga0105250_100051105 265
118 3300009148 Ga0105243_10256927 Ga0105243_102569272 265
119 3300009553 Ga0105249_10933152 Ga0105249_109331521 265
120 3300011119 Ga0105246_10654397 Ga0105246_106543971 265
121 3300013100 Ga0157373_10000081 Ga0157373_1000008168 265
122 3300013102 Ga0157371_10003054 Ga0157371_100030542 265
123 3300013102 Ga0157371_10004096 Ga0157371_100040967 265
124 3300013307 Ga0157372_10412157 Ga0157372_104121572 265
125 3300025711 Ga0207696_1000557 Ga0207696_100055716 265
126 3300025728 Ga0207655_1003550 Ga0207655_100355010 265
127 3300025735 Ga0207713_1008050 Ga0207713_10080502 265
128 3300025928 Ga0207700_10399980 Ga0207700_103999802 265
129 3300028794 Ga0307515_10000609 Ga0307515_100006093 265
130 3300028794 Ga0307515_10083759 Ga0307515_100837593 265
131 3300030522 Ga0307512_10039942 Ga0307512_100399425 265
132 3300031456 Ga0307513_10007295 Ga0307513_1000729510 265
133 3300031616 Ga0307508_10000404 Ga0307508_1000040415 265
134 3300031901 Ga0307406_10150457 Ga0307406_101504572 265
135 3300033179 Ga0307507_10070319 Ga0307507_100703191 265
136 3300035113 Ga0373936_0073256 Ga0373936_0073256_75_905 265
137 3300035170 Ga0373943_0151354 Ga0373943_0151354_313_1167 265
138 3300036401 Ga0373937_0019327 Ga0373937_0019327_117_947 265
139 3300037068 Ga0373925_0060878 Ga0373925_0060878_875_1705 265
140 3300041405 Ga0439438_000049 Ga0439438_000049_48699_49544 265
141 3300041407 Ga0439447_001003 Ga0439447_001003_1922_2767 265
142 3300042006 Ga0439432_001315 Ga0439432_001315_1206_2051 265
143 3300046452 Ga0495617_007839 Ga0495617_007839_91_936 265
144 3300046454 Ga0495592_0021799 Ga0495592_0021799_1050_1880 265
145 3300046458 Ga0495591_000010 Ga0495591_000010_56688_57533 265
146 3300046462 Ga0495651_0168450 Ga0495651_0168450_650_1480 265
147 3300046511 Ga0495608_0058846 Ga0495608_0058846_151_981 265
148 3300046517 Ga0495630_0099797 Ga0495630_0099797_331_1161 265
149 3300046529 Ga0495652_0066778 Ga0495652_0066778_1553_2383 265
150 3300046530 Ga0495654_0000151 Ga0495654_0000151_56720_57565 265
151 3300046533 Ga0495640_0221690 Ga0495640_0221690_330_1160 265
152 3300046559 Ga0495667_0090070 Ga0495667_0090070_149_979 265
153 3300046678 Ga0495599_0195839 Ga0495599_0195839_93_923 265
154 3300046809 Ga0495600_0209317 Ga0495600_0209317_334_1164 265
155 3300047470 Ga0495681_0046470 Ga0495681_0046470_354_1199 265
156 3300048904 Ga0496101_0000053 Ga0496101_0000053_86590_87435 265
157 3300048908 Ga0496105_0023635 Ga0496105_0023635_1848_2702 265
158 3300048917 Ga0496114_0065896 Ga0496114_0065896_1015_1869 265
159 3300048919 Ga0496116_0119215 Ga0496116_0119215_191_1036 265
160 3300048923 Ga0496120_0001587 Ga0496120_0001587_22766_23611 265
161 3300048925 Ga0496122_0033216 Ga0496122_0033216_2650_3495 265
162 3300048926 Ga0496123_0003349 Ga0496123_0003349_4885_5730 265
163 3300048927 Ga0496124_0064796 Ga0496124_0064796_1282_2127 265
164 3300009036 Ga0105244_10010701 Ga0105244_100107014 266
165 3300035171 Ga0373946_0053727 Ga0373946_0053727_620_1507 266
166 3300035725 Ga0373947_0259220 Ga0373947_0259220_134_1021 266
167 3300036401 Ga0373937_0002323 Ga0373937_0002323_4001_4888 266
168 3300037068 Ga0373925_0187326 Ga0373925_0187326_445_1296 266
169 3300039447 Ga0436361_0991849 Ga0436361_0991849_1519_2373 266
170 3300041459 Ga0451800_1562849 Ga0451800_1562849_10_816 266
171 3300044719 Ga0466971_0114372 Ga0466971_0114372_422_1222 266
172 3300046453 Ga0495627_059522 Ga0495627_059522_14_820 266
173 3300046459 Ga0495629_0240377 Ga0495629_0240377_130_1017 266
174 3300046516 Ga0495628_0125292 Ga0495628_0125292_103_954 266
175 3300046536 Ga0495587_0101495 Ga0495587_0101495_740_1627 266
176 3300046559 Ga0495667_0002589 Ga0495667_0002589_3658_4545 266
177 3300046678 Ga0495599_0308798 Ga0495599_0308798_21_908 266
178 3300047322 Ga0495680_0276205 Ga0495680_0276205_55_942 266
179 3300048920 Ga0496117_0015917 Ga0496117_0015917_3205_4011 266
180 3300050489 nmdc:mga03683_68951_c1 nmdc:mga03683_68951_c1_687_1493 266
181 3300053084 Ga0495595_0089481 Ga0495595_0089481_286_1137 266
182 3300053085 Ga0495619_0252910 Ga0495619_0252910_95_982 266
183 3300003856 Ga0058692_1000709 Ga0058692_100070912 267
184 3300005618 Ga0068864_100023957 Ga0068864_1000239572 267
185 3300005841 Ga0068863_100249671 Ga0068863_1002496712 267
186 3300006038 Ga0075365_10010701 Ga0075365_100107015 267
187 3300006237 Ga0097621_100026295 Ga0097621_1000262953 267
188 3300009177 Ga0105248_10002030 Ga0105248_100020306 267
189 3300013296 Ga0157374_10382557 Ga0157374_103825572 267
190 3300014325 Ga0163163_10006579 Ga0163163_100065794 267
191 3300025900 Ga0207710_10156814 Ga0207710_101568142 267
192 3300025931 Ga0207644_10000130 Ga0207644_1000013040 267
193 3300025941 Ga0207711_10105206 Ga0207711_101052062 267
194 3300026088 Ga0207641_10219723 Ga0207641_102197232 267
195 3300026095 Ga0207676_10033129 Ga0207676_100331293 267
196 3300027312 Ga0209371_1000061 Ga0209371_1000061127 267
197 3300027312 Ga0209371_1000230 Ga0209371_100023046 267
198 3300027312 Ga0209371_1002070 Ga0209371_10020709 267
199 3300030500 Ga0268256_1000059 Ga0268256_100005987 267
200 3300030500 Ga0268256_1004087 Ga0268256_10040873 267
201 3300046500 Ga0495596_0003690 Ga0495596_0003690_3671_4516 267
202 3300048915 Ga0496112_0092692 Ga0496112_0092692_353_1222 267
203 3300049593 Ga0501077_0080635 Ga0501077_0080635_377_1228 267
204 3300050494 nmdc:mga06z11_11018_c1 nmdc:mga06z11_11018_c1_828_1670 267
205 3300061734 Ga0530510_0049300 Ga0530510_0049300_1692_2543 267
206 3300005336 Ga0070680_100481560 Ga0070680_1004815601 268
207 3300009176 Ga0105242_10414568 Ga0105242_104145682 268
208 3300025917 Ga0207660_10330928 Ga0207660_103309282 268
209 3300031456 Ga0307513_10254795 Ga0307513_102547952 268
210 3300049589 Ga0501073_0058564 Ga0501073_0058564_231_1058 268
211 3300005335 Ga0070666_10027838 Ga0070666_100278383 269
212 3300005841 Ga0068863_100102350 Ga0068863_1001023503 269
213 3300006237 Ga0097621_100020606 Ga0097621_1000206063 269
214 3300006358 Ga0068871_100060549 Ga0068871_1000605493 269
215 3300009177 Ga0105248_10044986 Ga0105248_100449863 269
216 3300013308 Ga0157375_10264833 Ga0157375_102648332 269
217 3300014325 Ga0163163_10041142 Ga0163163_100411424 269
218 3300014968 Ga0157379_10178390 Ga0157379_101783902 269
219 3300014969 Ga0157376_10067680 Ga0157376_100676803 269
220 3300021361 Ga0213872_10000490 Ga0213872_1000049020 269
221 3300025903 Ga0207680_10084007 Ga0207680_100840072 269
222 3300025937 Ga0207669_10045607 Ga0207669_100456073 269
223 3300025941 Ga0207711_10139085 Ga0207711_101390852 269
224 3300025986 Ga0207658_10178618 Ga0207658_101786182 269
225 3300026121 Ga0207683_10040469 Ga0207683_100404692 269
226 3300031251 Ga0265327_10023089 Ga0265327_100230894 269
227 3300039447 Ga0436361_0289802 Ga0436361_0289802_14829_15683 269
228 3300042876 Ga0451577_0000276 Ga0451577_0000276_85465_86319 269
229 3300042876 Ga0451577_0001377 Ga0451577_0001377_4863_5714 269
230 3300044712 Ga0453684_0000891 Ga0453684_0000891_13180_14034 269
231 3300050512 nmdc:mga0n895_556763_c1 nmdc:mga0n895_556763_c1_218_1066 269
232 3300003856 Ga0058692_1000039 Ga0058692_100003946 270
233 3300027312 Ga0209371_1000119 Ga0209371_100011945 270
234 3300030500 Ga0268256_1000096 Ga0268256_100009684 270
235 3300007788 Ga0099795_10000559 Ga0099795_100005593 271
236 3300045051 Ga0451576_0527544 Ga0451576_0527544_383_1201 271
237 3300005336 Ga0070680_100144589 Ga0070680_1001445892 272
238 3300005339 Ga0070660_100184472 Ga0070660_1001844722 272
239 3300005458 Ga0070681_10041429 Ga0070681_100414294 272
240 3300013104 Ga0157370_10144853 Ga0157370_101448532 272
241 3300025919 Ga0207657_10104806 Ga0207657_101048063 272
242 3300025921 Ga0207652_10064863 Ga0207652_100648633 272
243 3300032004 Ga0307414_10039619 Ga0307414_100396193 272
244 3300046458 Ga0495591_001545 Ga0495591_001545_10628_11446 272
245 3300046471 Ga0495650_0000034 Ga0495650_0000034_97380_98198 272
246 3300046501 Ga0495607_0002446 Ga0495607_0002446_4570_5388 272
247 3300046507 Ga0495606_0000511 Ga0495606_0000511_56235_57053 272
248 3300046518 Ga0495631_0116050 Ga0495631_0116050_144_962 272
249 3300046520 Ga0495637_0015265 Ga0495637_0015265_931_1749 272
250 3300046523 Ga0495644_0005352 Ga0495644_0005352_2910_3728 272
251 3300046530 Ga0495654_0000549 Ga0495654_0000549_29364_30182 272
252 3300046692 Ga0495671_0000586 Ga0495671_0000586_18126_18944 272
253 3300046810 Ga0495660_0000020 Ga0495660_0000020_228948_229766 272
254 3300047320 Ga0495672_0000011 Ga0495672_0000011_120801_121619 272
255 3300047323 Ga0495683_0024993 Ga0495683_0024993_1702_2520 272
256 3300047469 Ga0495673_0000020 Ga0495673_0000020_107895_108713 272
257 3300049459 Ga0495678_002665 Ga0495678_002665_3462_4280 272
258 3300049460 Ga0495682_0000022 Ga0495682_0000022_109683_110501 272
259 3300053126 Ga0500621_000009 Ga0500621_000009_62767_63585 272
260 3300006051 Ga0075364_10058124 Ga0075364_100581242 273
261 3300006186 Ga0075369_10025320 Ga0075369_100253203 273
262 3300031548 Ga0307408_100001843 Ga0307408_1000018435 273
263 3300031731 Ga0307405_10027242 Ga0307405_100272422 273
264 3300031824 Ga0307413_10001940 Ga0307413_100019404 273
265 3300031852 Ga0307410_10002072 Ga0307410_100020722 273
266 3300031901 Ga0307406_10008312 Ga0307406_100083125 273
267 3300031911 Ga0307412_10087612 Ga0307412_100876122 273
268 3300032002 Ga0307416_100037351 Ga0307416_1000373512 273
269 3300032004 Ga0307414_10101861 Ga0307414_101018612 273
270 3300032005 Ga0307411_10002409 Ga0307411_100024094 273
271 3300032126 Ga0307415_100003806 Ga0307415_1000038064 273
272 3300048905 Ga0496102_0003600 Ga0496102_0003600_8220_9071 273
273 3300050493 nmdc:mga0k408_2064_c1 nmdc:mga0k408_2064_c1_2401_3249 273
274 iso_pu_bacteria 2902330777 2902331592 273
275 3300005289 Ga0065704_10079023 Ga0065704_100790233 274
276 3300005719 Ga0068861_100438212 Ga0068861_1004382122 274
277 3300006173 Ga0070716_100014589 Ga0070716_1000145893 274
278 3300009011 Ga0105251_10000791 Ga0105251_1000079111 274
279 3300009092 Ga0105250_10003376 Ga0105250_100033764 274
280 3300009147 Ga0114129_10958928 Ga0114129_109589282 274
281 3300009148 Ga0105243_10004191 Ga0105243_100041917 274
282 3300013102 Ga0157371_10153074 Ga0157371_101530742 274
283 3300021388 Ga0213875_10091158 Ga0213875_100911582 274
284 3300025298 Ga0209050_1001309 Ga0209050_10013093 274
285 3300025711 Ga0207696_1003192 Ga0207696_10031924 274
286 3300025735 Ga0207713_1004193 Ga0207713_10041937 274
287 3300025918 Ga0207662_10067838 Ga0207662_100678382 274
288 3300025935 Ga0207709_10000111 Ga0207709_10000111102 274
289 3300025936 Ga0207670_10163489 Ga0207670_101634892 274
290 3300025939 Ga0207665_10010512 Ga0207665_100105123 274
291 3300026118 Ga0207675_100162943 Ga0207675_1001629433 274
292 3300031911 Ga0307412_10001479 Ga0307412_100014793 274
293 3300039450 Ga0436363_1642553 Ga0436363_1642553_329_1156 274
294 3300042010 Ga0439452_000294 Ga0439452_000294_29344_30189 274
295 3300048919 Ga0496116_0081802 Ga0496116_0081802_384_1235 274
296 3300048921 Ga0496118_0019914 Ga0496118_0019914_1850_2701 274
297 3300048922 Ga0496119_0004476 Ga0496119_0004476_11160_12011 274
298 3300048923 Ga0496120_0050167 Ga0496120_0050167_698_1549 274
299 3300048924 Ga0496121_0000200 Ga0496121_0000200_80400_81251 274
300 3300048925 Ga0496122_0000021 Ga0496122_0000021_57798_58649 274
301 3300048926 Ga0496123_0000382 Ga0496123_0000382_3916_4767 274
302 3300048927 Ga0496124_0036375 Ga0496124_0036375_1952_2803 274
303 3300048927 Ga0496124_0058741 Ga0496124_0058741_1218_2069 274
304 3300048928 Ga0496125_0000005 Ga0496125_0000005_450887_451738 274
305 3300048928 Ga0496125_0004253 Ga0496125_0004253_14372_15223 274
306 3300048929 Ga0496126_0017155 Ga0496126_0017155_2455_3306 274
307 3300048929 Ga0496126_0370193 Ga0496126_0370193_219_1070 274
308 3300049575 Ga0501039_0044084 Ga0501039_0044084_1560_2408 274
309 3300049587 Ga0501071_0001663 Ga0501071_0001663_10140_10988 274
310 3300049588 Ga0501072_0113137 Ga0501072_0113137_341_1189 274
311 3300049591 Ga0501075_0070461 Ga0501075_0070461_1453_2301 274
312 3300049592 Ga0501076_0101087 Ga0501076_0101087_153_1001 274
313 iso_pu_bacteria 2952252522 2952255972 274
314 3300005366 Ga0070659_100138483 Ga0070659_1001384832 275
315 3300005548 Ga0070665_100028323 Ga0070665_1000283234 275
316 3300005937 Ga0081455_10000690 Ga0081455_1000069020 275
317 3300006880 Ga0075429_100469973 Ga0075429_1004699732 275
318 3300007076 Ga0075435_100065331 Ga0075435_1000653313 275
319 3300007265 Ga0099794_10087673 Ga0099794_100876732 275
320 3300013104 Ga0157370_10013205 Ga0157370_100132055 275
321 3300025302 Ga0207426_1023475 Ga0207426_10234752 275
322 3300027671 Ga0209588_1032020 Ga0209588_10320202 275
323 3300031548 Ga0307408_100000101 Ga0307408_1000001019 275
324 3300031901 Ga0307406_10006950 Ga0307406_100069505 275
325 3300037853 Ga0436364_1550787 Ga0436364_1550787_5934_6761 275
326 3300042005 Ga0439448_0054504 Ga0439448_0054504_342_1187 275
327 3300048919 Ga0496116_0000129 Ga0496116_0000129_32418_33263 275
328 3300048922 Ga0496119_0002224 Ga0496119_0002224_16480_17325 275
329 3300048923 Ga0496120_0000024 Ga0496120_0000024_171524_172369 275
330 3300049570 Ga0501033_0142277 Ga0501033_0142277_840_1691 275
331 3300049571 Ga0501034_0008920 Ga0501034_0008920_8016_8900 275
332 3300049571 Ga0501034_0034858 Ga0501034_0034858_3947_4831 275
333 3300049580 Ga0501046_0148493 Ga0501046_0148493_591_1442 275
334 3300049586 Ga0501070_0042582 Ga0501070_0042582_1967_2851 275
335 3300049586 Ga0501070_0327085 Ga0501070_0327085_248_1168 275
336 3300049588 Ga0501072_0136856 Ga0501072_0136856_869_1720 275
337 3300049590 Ga0501074_0113043 Ga0501074_0113043_1062_1913 275
338 3300049591 Ga0501075_0023210 Ga0501075_0023210_2488_3339 275
339 3300049593 Ga0501077_0016930 Ga0501077_0016930_586_1437 275
340 3300049742 Ga0501080_0458656 Ga0501080_0458656_173_1057 275
341 3300049743 Ga0501081_0035107 Ga0501081_0035107_2405_3256 275
342 3300049744 Ga0501083_0025901 Ga0501083_0025901_811_1698 275
343 3300049824 Ga0501045_0065609 Ga0501045_0065609_68_919 275
344 3300050512 nmdc:mga0n895_83565_c1 nmdc:mga0n895_83565_c1_1861_2712 275
345 3300050513 nmdc:mga0rr50_297370_c1 nmdc:mga0rr50_297370_c1_145_996 275
346 3300050514 nmdc:mga08x19_71036_c1 nmdc:mga08x19_71036_c1_104_955 275
347 3300050515 nmdc:mga0a205_97643_c1 nmdc:mga0a205_97643_c1_1400_2251 275
348 3300054114 Ga0501084_0017661 Ga0501084_0017661_4728_5579 275
349 3300060353 Ga0501082_0301150 Ga0501082_0301150_182_1069 275
350 3300061734 Ga0530510_0005871 Ga0530510_0005871_1377_2228 275
351 iso_pu_bacteria 2545555834 2545673907 275
352 iso_pu_bacteria 2739367655 2739612471 275
353 iso_pu_bacteria 2881927736 2881928645 275
354 iso_pu_bacteria 2887375801 2887378797 275
355 iso_pu_bacteria 641522639 641641898 275
356 iso_pu_bacteria 8002392321 8002394363 275
357 iso_pu_bacteria 8048746797 8048749396 275
358 3300005331 Ga0070670_100009835 Ga0070670_1000098352 276
359 3300005353 Ga0070669_100093894 Ga0070669_1000938942 276
360 3300005354 Ga0070675_100031854 Ga0070675_1000318544 276
361 3300005364 Ga0070673_100106446 Ga0070673_1001064462 276
362 3300005364 Ga0070673_100118956 Ga0070673_1001189561 276
363 3300005366 Ga0070659_100054288 Ga0070659_1000542883 276
364 3300005543 Ga0070672_100045833 Ga0070672_1000458333 276
365 3300005616 Ga0068852_100375982 Ga0068852_1003759822 276
366 3300005618 Ga0068864_100111774 Ga0068864_1001117743 276
367 3300005719 Ga0068861_100118506 Ga0068861_1001185062 276
368 3300006946 Ga0079104_1003203 Ga0079104_10032036 276
369 3300009177 Ga0105248_10019836 Ga0105248_100198362 276
370 3300013296 Ga0157374_10405071 Ga0157374_104050712 276
371 3300013297 Ga0157378_10141869 Ga0157378_101418692 276
372 3300013306 Ga0163162_10074406 Ga0163162_100744062 276
373 3300013306 Ga0163162_10089048 Ga0163162_100890482 276
374 3300013306 Ga0163162_10261285 Ga0163162_102612852 276
375 3300013308 Ga0157375_10004326 Ga0157375_100043264 276
376 3300015683 Ga0183362_10003 Ga0183362_10003572 276
377 3300021388 Ga0213875_10061257 Ga0213875_100612572 276
378 3300025903 Ga0207680_10196748 Ga0207680_101967482 276
379 3300025923 Ga0207681_10054437 Ga0207681_100544372 276
380 3300025925 Ga0207650_10072933 Ga0207650_100729332 276
381 3300025931 Ga0207644_10069089 Ga0207644_100690892 276
382 3300025931 Ga0207644_10214992 Ga0207644_102149921 276
383 3300025940 Ga0207691_10002783 Ga0207691_1000278314 276
384 3300025941 Ga0207711_10132106 Ga0207711_101321062 276
385 3300025960 Ga0207651_10155681 Ga0207651_101556812 276
386 3300025972 Ga0207668_10140854 Ga0207668_101408542 276
387 3300026088 Ga0207641_10001097 Ga0207641_100010976 276
388 3300026095 Ga0207676_10028771 Ga0207676_100287713 276
389 3300026118 Ga0207675_100025890 Ga0207675_1000258902 276
390 3300026118 Ga0207675_100271897 Ga0207675_1002718972 276
391 3300026142 Ga0207698_10365737 Ga0207698_103657372 276
392 3300027111 Ga0209281_1001347 Ga0209281_10013477 276
393 3300028379 Ga0268266_10272026 Ga0268266_102720262 276
394 3300028379 Ga0268266_10346755 Ga0268266_103467551 276
395 3300035695 Ga0373927_0001348 Ga0373927_0001348_14335_15183 276
396 3300036401 Ga0373937_0278954 Ga0373937_0278954_389_1222 276
397 3300037853 Ga0436364_0258905 Ga0436364_0258905_3084_3914 276
398 3300039437 Ga0436365_0058713 Ga0436365_0058713_2147_2977 276
399 3300047471 Ga0495684_0308527 Ga0495684_0308527_13_894 276
400 3300049573 Ga0501037_0141822 Ga0501037_0141822_807_1637 276
401 3300049574 Ga0501038_0286751 Ga0501038_0286751_91_921 276
402 3300049579 Ga0501043_0114047 Ga0501043_0114047_1117_1947 276
403 3300049581 Ga0501047_0119302 Ga0501047_0119302_502_1332 276
404 3300049822 Ga0501035_0265809 Ga0501035_0265809_392_1222 276
405 3300049823 Ga0501044_0258751 Ga0501044_0258751_776_1606 276
406 iso_pu_bacteria 2511231221 2512032470 276
407 iso_pu_bacteria 2643221628 2644161851 276
408 iso_pu_bacteria 2721755523 2722881997 276
409 iso_pu_bacteria 2738541307 2738880406 276
410 iso_pu_bacteria 2738543013 2739248286 276
411 iso_pu_bacteria 2839138175 2839143977 276
412 iso_pu_bacteria 2842677519 2842677538 276
413 iso_pu_bacteria 2885192300 2885196927 276
414 iso_pu_bacteria 2904541872 2904545119 276
415 iso_pu_bacteria 2919462493 2919467188 276
416 iso_pu_bacteria 2929160207 2929165297 276
417 iso_pu_bacteria 2929520902 2929523628 276
418 iso_pu_bacteria 2939602548 2939605624 276
419 iso_pu_bacteria 2954767861 2954768820 276
420 iso_pu_bacteria 8054002106 8054006016 276
421 3300006028 Ga0070717_10253298 Ga0070717_102532982 277
422 iso_pu_bacteria 2501025501 2501072953 277
423 iso_pu_bacteria 2501025502 2501083246 277
424 iso_pu_bacteria 2501025504 2501412457 277
425 iso_pu_bacteria 2508501125 2509130735 277
426 iso_pu_bacteria 2510065045 2510252476 277
427 iso_pu_bacteria 2510065053 2510285255 277
428 iso_pu_bacteria 2510065055 2510295839 277
429 iso_pu_bacteria 2510065058 2510313466 277
430 iso_pu_bacteria 2510917013 2511088081 277
431 iso_pu_bacteria 2510917014 2511101408 277
432 iso_pu_bacteria 2510917015 2511107989 277
433 iso_pu_bacteria 2511231002 2511244606 277
434 iso_pu_bacteria 2511231003 2511248771 277
435 iso_pu_bacteria 2511231025 2511379049 277
436 iso_pu_bacteria 2511231025 2511382600 277
437 iso_pu_bacteria 2511231026 2511387353 277
438 iso_pu_bacteria 2511231035 2511435978 277
439 iso_pu_bacteria 2512047030 2512348331 277
440 iso_pu_bacteria 2513020051 2513231036 277
441 iso_pu_bacteria 2513237082 2513552600 277
442 iso_pu_bacteria 2513237083 2513560659 277
443 iso_pu_bacteria 2513237151 2513962708 277
444 iso_pu_bacteria 2513237166 2514053174 277
445 iso_pu_bacteria 2515154122 2515684749 277
446 iso_pu_bacteria 2515154123 2515690916 277
447 iso_pu_bacteria 2515154189 2516021784 277
448 iso_pu_bacteria 2519103095 2519457545 277
449 iso_pu_bacteria 2521172590 2521559717 277
450 iso_pu_bacteria 2526164713 2527079918 277
451 iso_pu_bacteria 2537561728 2538428496 277
452 iso_pu_bacteria 2537561728 2538428710 277
453 iso_pu_bacteria 2547132181 2547698331 277
454 iso_pu_bacteria 2547132374 2548499016 277
455 iso_pu_bacteria 2547132416 2548651568 277
456 iso_pu_bacteria 2548876994 2550697411 277
457 iso_pu_bacteria 2551306416 2553006246 277
458 iso_pu_bacteria 2554235234 2555260899 277
459 iso_pu_bacteria 2561511199 2562464849 277
460 iso_pu_bacteria 2562617112 2563061639 277
461 iso_pu_bacteria 2582581311 2585294119 277
462 iso_pu_bacteria 2585427591 2585829058 277
463 iso_pu_bacteria 2585427592 2585833830 277
464 iso_pu_bacteria 2596583598 2597028668 277
465 iso_pu_bacteria 2597490356 2599103163 277
466 iso_pu_bacteria 2599185169 2599411799 277
467 iso_pu_bacteria 2599185178 2599445350 277
468 iso_pu_bacteria 2599185214 2599623386 277
469 iso_pu_bacteria 2599185226 2599675396 277
470 iso_pu_bacteria 2599185227 2599680991 277
471 iso_pu_bacteria 2599185229 2599693006 277
472 iso_pu_bacteria 2599185239 2599741073 277
473 iso_pu_bacteria 2599185240 2599748380 277
474 iso_pu_bacteria 2599185292 2599902297 277
475 iso_pu_bacteria 2599185299 2599929262 277
476 iso_pu_bacteria 2599185355 2600210292 277
477 iso_pu_bacteria 2600255254 2601524528 277
478 iso_pu_bacteria 2600255255 2601529682 277
479 iso_pu_bacteria 2600255256 2601534668 277
480 iso_pu_bacteria 2600255257 2601539253 277
481 iso_pu_bacteria 2600255280 2601616516 277
482 iso_pu_bacteria 2600255281 2601621238 277
483 iso_pu_bacteria 2600255287 2601646217 277
484 iso_pu_bacteria 2600255288 2601649635 277
485 iso_pu_bacteria 2600255289 2601654562 277
486 iso_pu_bacteria 2600255290 2601660164 277
487 iso_pu_bacteria 2600255291 2601664331 277
488 iso_pu_bacteria 2600255298 2601699095 277
489 iso_pu_bacteria 2600255299 2601702504 277
490 iso_pu_bacteria 2600255300 2601707306 277
491 iso_pu_bacteria 2600255301 2601712327 277
492 iso_pu_bacteria 2600255302 2601717823 277
493 iso_pu_bacteria 2600255303 2601723007 277
494 iso_pu_bacteria 2600255304 2601727751 277
495 iso_pu_bacteria 2600255305 2601732768 277
496 iso_pu_bacteria 2600255306 2601737463 277
497 iso_pu_bacteria 2600255307 2601741882 277
498 iso_pu_bacteria 2600255309 2601752780 277
499 iso_pu_bacteria 2600255310 2601757602 277
500 iso_pu_bacteria 2600255311 2601763961 277
501 iso_pu_bacteria 2600255392 2602021742 277
502 iso_pu_bacteria 2602042046 2603640309 277
503 iso_pu_bacteria 2602042047 2603646137 277
504 iso_pu_bacteria 2602042052 2603662495 277
505 iso_pu_bacteria 2602042053 2603667391 277
506 iso_pu_bacteria 2602042066 2603701790 277
507 iso_pu_bacteria 2602042067 2603706567 277
508 iso_pu_bacteria 2602042103 2603840177 277
509 iso_pu_bacteria 2602042104 2603845254 277
510 iso_pu_bacteria 2602042105 2603850327 277
511 iso_pu_bacteria 2602042106 2603855395 277
512 iso_pu_bacteria 2602042109 2603868339 277
513 iso_pu_bacteria 2602042110 2603873157 277
514 iso_pu_bacteria 2602042111 2603878202 277
515 iso_pu_bacteria 2603880178 2606050156 277
516 iso_pu_bacteria 2603880184 2606071820 277
517 iso_pu_bacteria 2603880202 2606147839 277
518 iso_pu_bacteria 2603880211 2606178226 277
519 iso_pu_bacteria 2608642108 2608671672 277
520 iso_pu_bacteria 2609459761 2609911219 277
521 iso_pu_bacteria 2636415599 2637222926 277
522 iso_pu_bacteria 2643221569 2643859676 277
523 iso_pu_bacteria 2643221570 2643867778 277
524 iso_pu_bacteria 2643221594 2643978975 277
525 iso_pu_bacteria 2643221596 2643991640 277
526 iso_pu_bacteria 2643221603 2644027974 277
527 iso_pu_bacteria 2643221621 2644121387 277
528 iso_pu_bacteria 2643221644 2644246836 277
529 iso_pu_bacteria 2643221652 2644293387 277
530 iso_pu_bacteria 2643221658 2644325552 277
531 iso_pu_bacteria 2643221672 2644399271 277
532 iso_pu_bacteria 2643221683 2644467044 277
533 iso_pu_bacteria 2643221717 2644648473 277
534 iso_pu_bacteria 2648501693 2650899848 277
535 iso_pu_bacteria 2654587920 2656275079 277
536 iso_pu_bacteria 2667528172 2671105294 277
537 iso_pu_bacteria 2667528173 2671110860 277
538 iso_pu_bacteria 2671180115 2671585019 277
539 iso_pu_bacteria 2675903046 2676408793 277
540 iso_pu_bacteria 2675903129 2676745783 277
541 iso_pu_bacteria 2681812866 2681994752 277
542 iso_pu_bacteria 2681812869 2682009670 277
543 iso_pu_bacteria 2684622997 2686356547 277
544 iso_pu_bacteria 2687453601 2689442632 277
545 iso_pu_bacteria 2711768156 2712472128 277
546 iso_pu_bacteria 2711768613 2713478494 277
547 iso_pu_bacteria 2718217991 2719641574 277
548 iso_pu_bacteria 2721755763 2723878935 277
549 iso_pu_bacteria 2738541277 2738718204 277
550 iso_pu_bacteria 2738541294 2738811018 277
551 iso_pu_bacteria 2738541296 2738824596 277
552 iso_pu_bacteria 2738541298 2738837063 277
553 iso_pu_bacteria 2738541306 2738878593 277
554 iso_pu_bacteria 2738541309 2738898378 277
555 iso_pu_bacteria 2738543002 2739190285 277
556 iso_pu_bacteria 2738543008 2739225186 277
557 iso_pu_bacteria 2738543019 2739281391 277
558 iso_pu_bacteria 2744054900 2746087336 277
559 iso_pu_bacteria 2744054901 2746093157 277
560 iso_pu_bacteria 2751185846 2753566061 277
561 iso_pu_bacteria 2751185917 2753854179 277
562 iso_pu_bacteria 2765235838 2765570975 277
563 iso_pu_bacteria 2765235842 2765591084 277
564 iso_pu_bacteria 2772190666 2772436779 277
565 iso_pu_bacteria 2773857672 2774132278 277
566 iso_pu_bacteria 2775506706 2775542921 277
567 iso_pu_bacteria 2775507074 2777021264 277
568 iso_pu_bacteria 2791354903 2791923772 277
569 iso_pu_bacteria 2791355010 2792311177 277
570 iso_pu_bacteria 2791355137 2792832822 277
571 iso_pu_bacteria 2791355275 2793403625 277
572 iso_pu_bacteria 2808606384 2808972889 277
573 iso_pu_bacteria 2808606386 2808984853 277
574 iso_pu_bacteria 2808606390 2809007946 277
575 iso_pu_bacteria 2808606391 2809015414 277
576 iso_pu_bacteria 2808606395 2809036264 277
577 iso_pu_bacteria 2808606414 2809126719 277
578 iso_pu_bacteria 2808606415 2809128259 277
579 iso_pu_bacteria 2808606419 2809147880 277
580 iso_pu_bacteria 2811995292 2813726553 277
581 iso_pu_bacteria 2814123068 2814693927 277
582 iso_pu_bacteria 2816332253 2817259736 277
583 iso_pu_bacteria 2816332256 2817277405 277
584 iso_pu_bacteria 2816332286 2817453571 277
585 iso_pu_bacteria 2818991436 2819542728 277
586 iso_pu_bacteria 2818991445 2819594807 277
587 iso_pu_bacteria 2818991446 2819600562 277
588 iso_pu_bacteria 2818991449 2819616058 277
589 iso_pu_bacteria 2818991450 2819624274 277
590 iso_pu_bacteria 2818991452 2819636826 277
591 iso_pu_bacteria 2821118458 2821122818 277
592 iso_pu_bacteria 2823373977 2823378152 277
593 iso_pu_bacteria 2831265667 2831267712 277
594 iso_pu_bacteria 2834641062 2834643048 277
595 iso_pu_bacteria 2838054893 2838061560 277
596 iso_pu_bacteria 2839094727 2839099333 277
597 iso_pu_bacteria 2842324504 2842332075 277
598 iso_pu_bacteria 2842348783 2842356473 277
599 iso_pu_bacteria 2842454564 2842461173 277
600 iso_pu_bacteria 2842718218 2842718735 277
601 iso_pu_bacteria 2842733646 2842736354 277
602 iso_pu_bacteria 2842747753 2842748862 277
603 iso_pu_bacteria 2844425489 2844429458 277
604 iso_pu_bacteria 2844528606 2844532301 277
605 iso_pu_bacteria 2846952575 2846953039 277
606 iso_pu_bacteria 2847085930 2847090104 277
607 iso_pu_bacteria 2847797336 2847797677 277
608 iso_pu_bacteria 2848858292 2848860844 277
609 iso_pu_bacteria 2852618963 2852620709 277
610 iso_pu_bacteria 2855730933 2855732100 277
611 iso_pu_bacteria 2855767633 2855768808 277
612 iso_pu_bacteria 2857537821 2857541946 277
613 iso_pu_bacteria 2857542790 2857546247 277
614 iso_pu_bacteria 2857576091 2857579863 277
615 iso_pu_bacteria 2858466076 2858470528 277
616 iso_pu_bacteria 2858950400 2858951655 277
617 iso_pu_bacteria 2863421361 2863426466 277
618 iso_pu_bacteria 2865014394 2865014896 277
619 iso_pu_bacteria 2870068957 2870069372 277
620 iso_pu_bacteria 2871272651 2871274066 277
621 iso_pu_bacteria 2871282230 2871283506 277
622 iso_pu_bacteria 2876601092 2876602559 277
623 iso_pu_bacteria 2881412998 2881415242 277
624 iso_pu_bacteria 2881609920 2881612500 277
625 iso_pu_bacteria 2883087390 2883090300 277
626 iso_pu_bacteria 2884086401 2884086794 277
627 iso_pu_bacteria 2884811622 2884811697 277
628 iso_pu_bacteria 2884836552 2884841317 277
629 iso_pu_bacteria 2884852848 2884856191 277
630 iso_pu_bacteria 2885198086 2885198818 277
631 iso_pu_bacteria 2885211737 2885211802 277
632 iso_pu_bacteria 2885266251 2885267001 277
633 iso_pu_bacteria 2885270888 2885272477 277
634 iso_pu_bacteria 2888366609 2888366824 277
635 iso_pu_bacteria 2888373701 2888375535 277
636 iso_pu_bacteria 2891670763 2891675180 277
637 iso_pu_bacteria 2894023352 2894024346 277
638 iso_pu_bacteria 2896154374 2896156883 277
639 iso_pu_bacteria 2899924645 2899928291 277
640 iso_pu_bacteria 2900051742 2900055034 277
641 iso_pu_bacteria 2900577576 2900580151 277
642 iso_pu_bacteria 2900634093 2900637183 277
643 iso_pu_bacteria 2902682994 2902686789 277
644 iso_pu_bacteria 2904434214 2904434353 277
645 iso_pu_bacteria 2904439833 2904443354 277
646 iso_pu_bacteria 2904449895 2904451828 277
647 iso_pu_bacteria 2904456579 2904462515 277
648 iso_pu_bacteria 2904474040 2904478720 277
649 iso_pu_bacteria 2904479285 2904481715 277
650 iso_pu_bacteria 2904483920 2904490229 277
651 iso_pu_bacteria 2904504865 2904509511 277
652 iso_pu_bacteria 2904513164 2904517924 277
653 iso_pu_bacteria 2904530477 2904533065 277
654 iso_pu_bacteria 2904564687 2904569370 277
655 iso_pu_bacteria 2904571731 2904576793 277
656 iso_pu_bacteria 2904584206 2904585618 277
657 iso_pu_bacteria 2904589729 2904593967 277
658 iso_pu_bacteria 2904601388 2904603880 277
659 iso_pu_bacteria 2904615490 2904623268 277
660 iso_pu_bacteria 2908669403 2908674511 277
661 iso_pu_bacteria 2917832318 2917834691 277
662 iso_pu_bacteria 2919046199 2919047587 277
663 iso_pu_bacteria 2919079590 2919081882 277
664 iso_pu_bacteria 2919108558 2919113154 277
665 iso_pu_bacteria 2919125081 2919128501 277
666 iso_pu_bacteria 2919150387 2919154828 277
667 iso_pu_bacteria 2919527303 2919533399 277
668 iso_pu_bacteria 2921643360 2921650389 277
669 iso_pu_bacteria 2923510766 2923513488 277
670 iso_pu_bacteria 2923634449 2923637562 277
671 iso_pu_bacteria 2927143783 2927148412 277
672 iso_pu_bacteria 2927833300 2927835984 277
673 iso_pu_bacteria 2928037797 2928041243 277
674 iso_pu_bacteria 2928044640 2928048085 277
675 iso_pu_bacteria 2928051484 2928055926 277
676 iso_pu_bacteria 2928058823 2928062680 277
677 iso_pu_bacteria 2928064002 2928066593 277
678 iso_pu_bacteria 2928070936 2928077253 277
679 iso_pu_bacteria 2928084124 2928087554 277
680 iso_pu_bacteria 2928108538 2928114100 277
681 iso_pu_bacteria 2928115317 2928120672 277
682 iso_pu_bacteria 2928130867 2928133974 277
683 iso_pu_bacteria 2928135762 2928141152 277
684 iso_pu_bacteria 2928157003 2928163079 277
685 iso_pu_bacteria 2928163908 2928170171 277
686 iso_pu_bacteria 2928170801 2928176307 277
687 iso_pu_bacteria 2928503688 2928509095 277
688 iso_pu_bacteria 2928536128 2928542047 277
689 iso_pu_bacteria 2932406140 2932409093 277
690 iso_pu_bacteria 2932422444 2932426425 277
691 iso_pu_bacteria 2935625433 2935628835 277
692 iso_pu_bacteria 2937539931 2937540467 277
693 iso_pu_bacteria 2937967321 2937971433 277
694 iso_pu_bacteria 2939568625 2939572198 277
695 iso_pu_bacteria 2939573065 2939576770 277
696 iso_pu_bacteria 2939577877 2939581603 277
697 iso_pu_bacteria 2939607340 2939611536 277
698 iso_pu_bacteria 2939617950 2939620729 277
699 iso_pu_bacteria 2939631187 2939635842 277
700 iso_pu_bacteria 2939642701 2939646513 277
701 iso_pu_bacteria 2941479691 2941483125 277
702 iso_pu_bacteria 2945874760 2945875595 277
703 iso_pu_bacteria 2945909444 2945910098 277
704 iso_pu_bacteria 2945934425 2945934453 277
705 iso_pu_bacteria 2945945610 2945946130 277
706 iso_pu_bacteria 2945951305 2945955245 277
707 iso_pu_bacteria 2945972063 2945975730 277
708 iso_pu_bacteria 2945984333 2945987886 277
709 iso_pu_bacteria 2969079654 2969079950 277
710 iso_pu_bacteria 2971820967 2971821311 277
711 iso_pu_bacteria 2974298342 2974298832 277
712 iso_pu_bacteria 2974310843 2974314683 277
713 iso_pu_bacteria 2974320154 2974320381 277
714 iso_pu_bacteria 2974435778 2974440516 277
715 iso_pu_bacteria 2978975091 2978977723 277
716 iso_pu_bacteria 2981990288 2981996074 277
717 iso_pu_bacteria 2984494565 2984499106 277
718 iso_pu_bacteria 2984499530 2984501126 277
719 iso_pu_bacteria 2984504281 2984505421 277
720 iso_pu_bacteria 2984559226 2984562404 277
721 iso_pu_bacteria 2984595703 2984600462 277
722 iso_pu_bacteria 2990261002 2990263811 277
723 iso_pu_bacteria 2990703756 2990704987 277
724 iso_pu_bacteria 2990710928 2990713912 277
725 iso_pu_bacteria 3000376612 3000377231 277
726 iso_pu_bacteria 641736151 642427093 277
727 iso_pu_bacteria 641736154 642417726 277
728 iso_pu_bacteria 642555112 642594506 277
729 iso_pu_bacteria 642555113 642623090 277
730 iso_pu_bacteria 8003400568 8003403087 277
731 iso_pu_bacteria 8003955200 8003958385 277
732 iso_pu_bacteria 8004592986 8004593561 277
733 iso_pu_bacteria 8015394850 8015398379 277
734 iso_pu_bacteria 8016733728 8016737614 277
735 iso_pu_bacteria 8018221730 8018222126 277
736 iso_pu_bacteria 8018405270 8018408900 277
737 iso_pu_bacteria 8018845410 8018847959 277
738 iso_pu_bacteria 8019499862 8019504222 277
739 iso_pu_bacteria 8019504834 8019507315 277
740 iso_pu_bacteria 8020807995 8020813947 277
741 iso_pu_bacteria 8020938398 8020939017 277
742 iso_pu_bacteria 8020945358 8020947732 277
743 iso_pu_bacteria 8020953355 8020953436 277
744 iso_pu_bacteria 8021120328 8021127543 277
745 iso_pu_bacteria 8039098773 8039099693 277
746 iso_pu_bacteria 8040167225 8040171524 277
747 iso_pu_bacteria 8040173305 8040174138 277
748 iso_pu_bacteria 8054844752 8054847573 277
749 iso_pu_bacteria 8054849141 8054852810 277
750 iso_pu_bacteria 8055087960 8055092355 277
751 iso_pu_bacteria 8055092621 8055093071 277
752 iso_pu_bacteria 8055097453 8055097718 277
753 iso_pu_bacteria 8055266321 8055269537 277
754 iso_pu_bacteria 8055301274 8055307301 277
755 iso_pu_bacteria 8055693939 8055698087 277
756 iso_pu_bacteria 8057304971 8057308013 277
757 3300005471 Ga0070698_100114841 Ga0070698_1001148412 278
758 3300035119 Ga0373956_0017802 Ga0373956_0017802_1806_2693 278
759 3300036712 Ga0316584_0299193 Ga0316584_0299193_254_1099 278
760 3300037588 Ga0316581_0011830 Ga0316581_0011830_366_1211 278
761 3300021361 Ga0213872_10013259 Ga0213872_100132593 279
762 3300031251 Ga0265327_10001288 Ga0265327_1000128823 279
763 3300037418 Ga0395900_0022464 Ga0395900_0022464_4970_5812 279
764 3300037466 Ga0395898_0152214 Ga0395898_0152214_1018_1860 279
765 3300038443 Ga0395901_0194518 Ga0395901_0194518_723_1565 279
766 3300039438 Ga0436360_0113868 Ga0436360_0113868_198_1097 279
767 3300039447 Ga0436361_0493504 Ga0436361_0493504_6258_7103 279
768 3300039447 Ga0436361_1098192 Ga0436361_1098192_2703_3548 279
769 3300049569 Ga0501032_0000615 Ga0501032_0000615_15629_16471 279
770 3300049571 Ga0501034_0005011 Ga0501034_0005011_10035_10877 279
771 3300049571 Ga0501034_0021600 Ga0501034_0021600_4256_5098 279
772 3300049572 Ga0501036_0005170 Ga0501036_0005170_4206_5048 279
773 3300049573 Ga0501037_0011457 Ga0501037_0011457_3139_3981 279
774 3300049573 Ga0501037_0039762 Ga0501037_0039762_1148_1990 279
775 3300049574 Ga0501038_0025897 Ga0501038_0025897_76_918 279
776 3300049579 Ga0501043_0006551 Ga0501043_0006551_1976_2818 279
777 3300049580 Ga0501046_0018570 Ga0501046_0018570_3919_4761 279
778 3300049581 Ga0501047_0012236 Ga0501047_0012236_4898_5740 279
779 3300049591 Ga0501075_0076563 Ga0501075_0076563_1612_2460 279
780 3300049743 Ga0501081_0264185 Ga0501081_0264185_51_899 279
781 3300049822 Ga0501035_0002665 Ga0501035_0002665_1072_1914 279
782 3300049823 Ga0501044_0001935 Ga0501044_0001935_18484_19326 279
783 3300049824 Ga0501045_0402197 Ga0501045_0402197_125_973 279
784 iso_pu_bacteria 2855195626 2855197729 279
785 iso_pu_bacteria 2899259804 2899260471 279
786 3300002987 JGI25159J45721_1011053 JGI25159J45721_10110532 280
787 3300003187 JGI25151J46595_10019135 JGI25151J46595_100191352 280
788 3300003773 Ga0055537_1000677 Ga0055537_100067715 280
789 3300003773 Ga0055537_1000717 Ga0055537_100071714 280
790 3300003784 Ga0055534_1000337 Ga0055534_100033715 280
791 3300003784 Ga0055534_1000467 Ga0055534_100046719 280
792 3300003790 Ga0055528_1001984 Ga0055528_100198411 280
793 3300005288 Ga0065714_10012771 Ga0065714_100127713 280
794 3300005288 Ga0065714_10112520 Ga0065714_101125202 280
795 3300005344 Ga0070661_100067884 Ga0070661_1000678843 280
796 3300005365 Ga0070688_100130439 Ga0070688_1001304392 280
797 3300005367 Ga0070667_100635658 Ga0070667_1006356581 280
798 3300005445 Ga0070708_100077599 Ga0070708_1000775993 280
799 3300005456 Ga0070678_100074180 Ga0070678_1000741802 280
800 3300005456 Ga0070678_100455021 Ga0070678_1004550212 280
801 3300005457 Ga0070662_100015748 Ga0070662_1000157482 280
802 3300005457 Ga0070662_100221517 Ga0070662_1002215172 280
803 3300005459 Ga0068867_100000081 Ga0068867_1000000815 280
804 3300005467 Ga0070706_100000463 Ga0070706_10000046341 280
805 3300005468 Ga0070707_100016835 Ga0070707_1000168353 280
806 3300005471 Ga0070698_100063925 Ga0070698_1000639252 280
807 3300005539 Ga0068853_100082163 Ga0068853_1000821632 280
808 3300005544 Ga0070686_100330231 Ga0070686_1003302311 280
809 3300005577 Ga0068857_100309183 Ga0068857_1003091832 280
810 3300005614 Ga0068856_100333356 Ga0068856_1003333562 280
811 3300005617 Ga0068859_100614459 Ga0068859_1006144592 280
812 3300006038 Ga0075365_10006309 Ga0075365_100063095 280
813 3300006038 Ga0075365_10154818 Ga0075365_101548182 280
814 3300006038 Ga0075365_10157954 Ga0075365_101579542 280
815 3300006042 Ga0075368_10004485 Ga0075368_100044853 280
816 3300006042 Ga0075368_10022247 Ga0075368_100222472 280
817 3300006048 Ga0075363_100146863 Ga0075363_1001468632 280
818 3300006058 Ga0075432_10016158 Ga0075432_100161583 280
819 3300006177 Ga0075362_10093971 Ga0075362_100939711 280
820 3300006178 Ga0075367_10013296 Ga0075367_100132964 280
821 3300006195 Ga0075366_10003522 Ga0075366_100035224 280
822 3300006195 Ga0075366_10026377 Ga0075366_100263773 280
823 3300006195 Ga0075366_10100175 Ga0075366_101001752 280
824 3300006195 Ga0075366_10126024 Ga0075366_101260242 280
825 3300006195 Ga0075366_10126212 Ga0075366_101262122 280
826 3300006353 Ga0075370_10058968 Ga0075370_100589682 280
827 3300006846 Ga0075430_100037043 Ga0075430_1000370434 280
828 3300006852 Ga0075433_10073217 Ga0075433_100732172 280
829 3300006914 Ga0075436_100011502 Ga0075436_1000115023 280
830 3300006931 Ga0097620_100614470 Ga0097620_1006144702 280
831 3300006948 Ga0099826_10001050 Ga0099826_1000105015 280
832 3300007265 Ga0099794_10000552 Ga0099794_100005526 280
833 3300009093 Ga0105240_10008046 Ga0105240_100080464 280
834 3300009147 Ga0114129_10005167 Ga0114129_1000516713 280
835 3300009148 Ga0105243_10010403 Ga0105243_100104034 280
836 3300009174 Ga0105241_10382629 Ga0105241_103826292 280
837 3300009545 Ga0105237_10003877 Ga0105237_100038774 280
838 3300009545 Ga0105237_10012592 Ga0105237_100125925 280
839 3300009551 Ga0105238_10009163 Ga0105238_100091634 280
840 3300009551 Ga0105238_10218652 Ga0105238_102186522 280
841 3300009551 Ga0105238_10306067 Ga0105238_103060672 280
842 3300009553 Ga0105249_10139191 Ga0105249_101391913 280
843 3300010375 Ga0105239_10000344 Ga0105239_1000034450 280
844 3300013100 Ga0157373_10153538 Ga0157373_101535382 280
845 3300013104 Ga0157370_10067954 Ga0157370_100679543 280
846 3300013105 Ga0157369_10001065 Ga0157369_100010654 280
847 3300013308 Ga0157375_10578185 Ga0157375_105781851 280
848 3300014497 Ga0182008_10058516 Ga0182008_100585161 280
849 3300014745 Ga0157377_10000048 Ga0157377_1000004862 280
850 3300014968 Ga0157379_10030571 Ga0157379_100305714 280
851 3300015261 Ga0182006_1008526 Ga0182006_10085263 280
852 3300021361 Ga0213872_10000093 Ga0213872_1000009364 280
853 3300021361 Ga0213872_10005470 Ga0213872_100054704 280
854 3300025263 Ga0209565_1000067 Ga0209565_1000067166 280
855 3300025273 Ga0209673_1000097 Ga0209673_100009778 280
856 3300025284 Ga0209130_1002024 Ga0209130_10020245 280
857 3300025291 Ga0209675_1000038 Ga0209675_100003878 280
858 3300025291 Ga0209675_1006032 Ga0209675_10060322 280
859 3300025291 Ga0209675_1012280 Ga0209675_10122803 280
860 3300025294 Ga0209025_1001066 Ga0209025_10010664 280
861 3300025294 Ga0209025_1010865 Ga0209025_10108655 280
862 3300025294 Ga0209025_1020674 Ga0209025_10206743 280
863 3300025298 Ga0209050_1012744 Ga0209050_10127442 280
864 3300025303 Ga0209051_1007797 Ga0209051_10077972 280
865 3300025910 Ga0207684_10002070 Ga0207684_100020705 280
866 3300025913 Ga0207695_10032526 Ga0207695_100325264 280
867 3300025914 Ga0207671_10004924 Ga0207671_100049249 280
868 3300025914 Ga0207671_10018021 Ga0207671_100180214 280
869 3300025933 Ga0207706_10010055 Ga0207706_100100557 280
870 3300025933 Ga0207706_10175026 Ga0207706_101750262 280
871 3300025935 Ga0207709_10001074 Ga0207709_1000107418 280
872 3300025936 Ga0207670_10325021 Ga0207670_103250211 280
873 3300025949 Ga0207667_10016009 Ga0207667_100160094 280
874 3300025961 Ga0207712_10121751 Ga0207712_101217512 280
875 3300026041 Ga0207639_10294103 Ga0207639_102941032 280
876 3300026067 Ga0207678_10125732 Ga0207678_101257322 280
877 3300026089 Ga0207648_10002319 Ga0207648_100023194 280
878 3300026116 Ga0207674_10159996 Ga0207674_101599962 280
879 3300026121 Ga0207683_10061405 Ga0207683_100614052 280
880 3300027665 Ga0209983_1032428 Ga0209983_10324282 280
881 3300027666 Ga0209282_1000250 Ga0209282_100025015 280
882 3300027671 Ga0209588_1004909 Ga0209588_10049092 280
883 3300027866 Ga0209813_10066271 Ga0209813_100662711 280
884 3300027876 Ga0209974_10017443 Ga0209974_100174433 280
885 3300028794 Ga0307515_10009632 Ga0307515_100096321 280
886 3300030521 Ga0307511_10000043 Ga0307511_1000004357 280
887 3300030744 Ga0316181_1016973 Ga0316181_10169736 280
888 3300031238 Ga0265332_10000125 Ga0265332_1000012522 280
889 3300031456 Ga0307513_10000117 Ga0307513_1000011788 280
890 3300031616 Ga0307508_10132035 Ga0307508_101320352 280
891 3300031616 Ga0307508_10146970 Ga0307508_101469702 280
892 3300031649 Ga0307514_10087532 Ga0307514_100875322 280
893 3300031730 Ga0307516_10000092 Ga0307516_100000923 280
894 3300031730 Ga0307516_10002741 Ga0307516_100027416 280
895 3300031730 Ga0307516_10020817 Ga0307516_100208172 280
896 3300031730 Ga0307516_10083491 Ga0307516_100834914 280
897 3300031731 Ga0307405_10130853 Ga0307405_101308532 280
898 3300031901 Ga0307406_10025663 Ga0307406_100256633 280
899 3300031901 Ga0307406_10409903 Ga0307406_104099032 280
900 3300032005 Ga0307411_10264290 Ga0307411_102642902 280
901 3300035691 Ga0373931_0111622 Ga0373931_0111622_209_1054 280
902 3300037471 Ga0395905_0007970 Ga0395905_0007970_4943_5797 280
903 3300037471 Ga0395905_0018407 Ga0395905_0018407_3270_4151 280
904 3300037471 Ga0395905_0022866 Ga0395905_0022866_2845_3693 280
905 3300039447 Ga0436361_0101461 Ga0436361_0101461_8474_9322 280
906 3300039447 Ga0436361_0523658 Ga0436361_0523658_10364_11218 280
907 3300039447 Ga0436361_1214496 Ga0436361_1214496_6912_7766 280
908 3300041404 Ga0439436_0034772 Ga0439436_0034772_257_1105 280
909 3300041404 Ga0439436_0036824 Ga0439436_0036824_251_1099 280
910 3300041406 Ga0439439_0010483 Ga0439439_0010483_1025_1873 280
911 3300041411 Ga0439466_0014294 Ga0439466_0014294_1752_2600 280
912 3300041411 Ga0439466_0031649 Ga0439466_0031649_683_1531 280
913 3300041458 Ga0451798_0955146 Ga0451798_0955146_121_975 280
914 3300041486 Ga0451807_0034638 Ga0451807_0034638_332_1186 280
915 3300042004 Ga0439445_0010606 Ga0439445_0010606_1257_2105 280
916 3300042006 Ga0439432_010402 Ga0439432_010402_1688_2536 280
917 3300042007 Ga0439449_0001584 Ga0439449_0001584_6338_7186 280
918 3300042007 Ga0439449_0069396 Ga0439449_0069396_327_1181 280
919 3300042010 Ga0439452_002955 Ga0439452_002955_754_1602 280
920 3300042122 Ga0450920_015091 Ga0450920_015091_400_1248 280
921 3300042123 Ga0450921_001212 Ga0450921_001212_531_1379 280
922 3300042125 Ga0450923_002065 Ga0450923_002065_1795_2643 280
923 3300042127 Ga0450890_006571 Ga0450890_006571_461_1309 280
924 3300042138 Ga0450903_016192 Ga0450903_016192_107_961 280
925 3300042147 Ga0450910_006503 Ga0450910_006503_432_1280 280
926 3300042156 Ga0439446_0064394 Ga0439446_0064394_82_930 280
927 3300042184 Ga0450908_016323 Ga0450908_016323_82_930 280
928 3300042435 Ga0439434_0037492 Ga0439434_0037492_382_1230 280
929 3300042439 Ga0439464_0005995 Ga0439464_0005995_185_1039 280
930 3300042531 Ga0450918_001444 Ga0450918_001444_2453_3301 280
931 3300044658 Ga0466972_0016715 Ga0466972_0016715_2514_3452 280
932 3300044658 Ga0466972_0080819 Ga0466972_0080819_599_1453 280
933 3300044673 Ga0453683_0018379 Ga0453683_0018379_2177_3025 280
934 3300044673 Ga0453683_0090096 Ga0453683_0090096_942_1796 280
935 3300044683 Ga0466965_0006837 Ga0466965_0006837_1184_2038 280
936 3300044712 Ga0453684_0018953 Ga0453684_0018953_8729_9580 280
937 3300044901 Ga0466960_0210232 Ga0466960_0210232_141_995 280
938 3300045051 Ga0451576_0025162 Ga0451576_0025162_5093_5947 280
939 3300045051 Ga0451576_0400474 Ga0451576_0400474_174_1028 280
940 3300046453 Ga0495627_014604 Ga0495627_014604_1620_2468 280
941 3300046674 Ga0495588_0035060 Ga0495588_0035060_1511_2359 280
942 3300047321 Ga0495676_0022957 Ga0495676_0022957_2979_3827 280
943 3300047443 Ga0495687_001485 Ga0495687_001485_16474_17349 280
944 3300047472 Ga0495686_0051319 Ga0495686_0051319_1044_1895 280
945 3300048911 Ga0496108_0337453 Ga0496108_0337453_238_1083 280
946 3300048919 Ga0496116_0006777 Ga0496116_0006777_4256_5104 280
947 3300048920 Ga0496117_0011620 Ga0496117_0011620_2233_3081 280
948 3300048921 Ga0496118_0155719 Ga0496118_0155719_406_1254 280
949 3300048924 Ga0496121_0038000 Ga0496121_0038000_1651_2499 280
950 3300048926 Ga0496123_0065430 Ga0496123_0065430_365_1213 280
951 3300048926 Ga0496123_0171276 Ga0496123_0171276_49_897 280
952 3300048928 Ga0496125_0000115 Ga0496125_0000115_127198_128040 280
953 3300049579 Ga0501043_0047121 Ga0501043_0047121_129_977 280
954 3300049585 Ga0501069_0204604 Ga0501069_0204604_14_862 280
955 3300049586 Ga0501070_0312004 Ga0501070_0312004_353_1198 280
956 3300049590 Ga0501074_0012555 Ga0501074_0012555_3554_4402 280
957 3300049590 Ga0501074_0024009 Ga0501074_0024009_973_1821 280
958 3300049662 Ga0501222_000664 Ga0501222_000664_378_1232 280
959 3300049673 Ga0501240_019339 Ga0501240_019339_111_959 280
960 3300049705 Ga0501225_0015601 Ga0501225_0015601_485_1333 280
961 3300049742 Ga0501080_0000400 Ga0501080_0000400_17459_18307 280
962 3300049759 Ga0501262_000577 Ga0501262_000577_2976_3824 280
963 3300049822 Ga0501035_0016665 Ga0501035_0016665_1845_2693 280
964 3300049823 Ga0501044_0006750 Ga0501044_0006750_188_1036 280
965 3300050489 nmdc:mga03683_115990_c1 nmdc:mga03683_115990_c1_169_1017 280
966 3300050491 nmdc:mga00v17_102060_c1 nmdc:mga00v17_102060_c1_141_989 280
967 3300050492 nmdc:mga0yw44_130661_c1 nmdc:mga0yw44_130661_c1_372_1214 280
968 3300050493 nmdc:mga0k408_105394_c1 nmdc:mga0k408_105394_c1_244_1146 280
969 3300050493 nmdc:mga0k408_142390_c1 nmdc:mga0k408_142390_c1_265_1107 280
970 3300050493 nmdc:mga0k408_60878_c1 nmdc:mga0k408_60878_c1_1233_2081 280
971 3300050493 nmdc:mga0k408_76871_c1 nmdc:mga0k408_76871_c1_586_1458 280
972 3300050494 nmdc:mga06z11_54957_c1 nmdc:mga06z11_54957_c1_74_946 280
973 3300050495 nmdc:mga04h51_71691_c1 nmdc:mga04h51_71691_c1_261_1115 280
974 3300050496 nmdc:mga07m45_1226_c1 nmdc:mga07m45_1226_c1_2761_3609 280
975 3300050496 nmdc:mga07m45_65588_c1 nmdc:mga07m45_65588_c1_33_905 280
976 3300050507 nmdc:mga05p37_181_c1 nmdc:mga05p37_181_c1_36283_37128 280
977 3300050514 nmdc:mga08x19_23923_c1 nmdc:mga08x19_23923_c1_255_1103 280
978 3300050515 nmdc:mga0a205_15430_c1 nmdc:mga0a205_15430_c1_3721_4566 280
979 3300050515 nmdc:mga0a205_170038_c1 nmdc:mga0a205_170038_c1_340_1185 280
980 3300050516 nmdc:mga0sz30_98931_c1 nmdc:mga0sz30_98931_c1_322_1164 280
981 3300053090 Ga0500646_0002088 Ga0500646_0002088_511_1353 280
982 3300053092 Ga0500583_0017328 Ga0500583_0017328_569_1411 280
983 3300053093 Ga0500651_0000137 Ga0500651_0000137_43331_44179 280
984 3300053134 Ga0500658_0000854 Ga0500658_0000854_5450_6298 280
985 3300059421 Ga0590071_001042 Ga0590071_001042_977_1831 280
986 2010549000 RicEn_C429 RicEn_07770 281
987 2162886007 SwRhRL2b_contig_2732836 SwRhRL2b_0087.00001920 281
988 2162886007 SwRhRL2b_contig_2885856 SwRhRL2b_0135.00006140 281
989 2162886007 SwRhRL2b_contig_3499265 SwRhRL2b_0823.00008060 281
990 2162886007 SwRhRL2b_contig_567942 SwRhRL2b_0742.00007270 281
991 3300001904 JGI24736J21556_1010718 JGI24736J21556_10107182 281
992 3300001915 JGI24741J21665_1000541 JGI24741J21665_10005415 281
993 3300001979 JGI24740J21852_10002256 JGI24740J21852_100022567 281
994 3300001979 JGI24740J21852_10002326 JGI24740J21852_100023267 281
995 3300001979 JGI24740J21852_10004219 JGI24740J21852_100042192 281
996 3300001979 JGI24740J21852_10010978 JGI24740J21852_100109783 281
997 3300001989 JGI24739J22299_10000107 JGI24739J22299_1000010713 281
998 3300001989 JGI24739J22299_10003223 JGI24739J22299_100032232 281
999 3300001989 JGI24739J22299_10003444 JGI24739J22299_100034444 281
1000 3300001989 JGI24739J22299_10010422 JGI24739J22299_100104223 281
1001 3300001989 JGI24739J22299_10014707 JGI24739J22299_100147072 281
1002 3300001989 JGI24739J22299_10015174 JGI24739J22299_100151743 281
1003 3300001989 JGI24739J22299_10021360 JGI24739J22299_100213602 281
1004 3300001990 JGI24737J22298_10012591 JGI24737J22298_100125913 281
1005 3300002067 JGI24735J21928_10000085 JGI24735J21928_1000008525 281
1006 3300002067 JGI24735J21928_10000389 JGI24735J21928_100003897 281
1007 3300002067 JGI24735J21928_10018754 JGI24735J21928_100187541 281
1008 3300002067 JGI24735J21928_10022708 JGI24735J21928_100227082 281
1009 3300002067 JGI24735J21928_10024721 JGI24735J21928_100247212 281
1010 3300002704 JGI25155J39150_1000022 JGI25155J39150_100002275 281
1011 3300002705 JGI25156J39149_1000005 JGI25156J39149_100000567 281
1012 3300002705 JGI25156J39149_1000985 JGI25156J39149_10009855 281
1013 3300002705 JGI25156J39149_1001813 JGI25156J39149_10018134 281
1014 3300002705 JGI25156J39149_1002127 JGI25156J39149_10021274 281
1015 3300002705 JGI25156J39149_1003520 JGI25156J39149_10035203 281
1016 3300002705 JGI25156J39149_1004341 JGI25156J39149_10043414 281
1017 3300002705 JGI25156J39149_1007169 JGI25156J39149_10071693 281
1018 3300002737 JGI25162J39368_1000001 JGI25162J39368_1000001241 281
1019 3300002737 JGI25162J39368_1002554 JGI25162J39368_10025546 281
1020 3300002737 JGI25162J39368_1006422 JGI25162J39368_10064222 281
1021 3300002738 JGI25154J39366_1000017 JGI25154J39366_100001759 281
1022 3300002741 JGI25157J39369_1000003 JGI25157J39369_100000375 281
1023 3300002741 JGI25157J39369_1000747 JGI25157J39369_100074711 281
1024 3300002771 JGI25163J39215_1000052 JGI25163J39215_100005240 281
1025 3300002772 JGI25164J39214_1000095 JGI25164J39214_100009539 281
1026 3300002773 JGI25152J39213_1000722 JGI25152J39213_10007225 281
1027 3300002774 JGI25150J39212_1001994 JGI25150J39212_10019944 281
1028 3300002987 JGI25159J45721_1001646 JGI25159J45721_10016465 281
1029 3300002987 JGI25159J45721_1001983 JGI25159J45721_10019833 281
1030 3300003187 JGI25151J46595_10002224 JGI25151J46595_1000222411 281
1031 3300003187 JGI25151J46595_10002783 JGI25151J46595_100027837 281
1032 3300003187 JGI25151J46595_10005185 JGI25151J46595_100051855 281
1033 3300003214 JGI25165J46597_1000001 JGI25165J46597_1000001235 281
1034 3300003214 JGI25165J46597_1002016 JGI25165J46597_10020163 281
1035 3300003323 rootH1_10025483 rootH1_100254832 281
1036 3300003354 JGI25160J50197_1000273 JGI25160J50197_10002734 281
1037 3300003354 JGI25160J50197_1000412 JGI25160J50197_10004122 281
1038 3300003374 JGI25161J50226_1000095 JGI25161J50226_100009514 281
1039 3300003751 Ga0055538_1000001 Ga0055538_1000001797 281
1040 3300003751 Ga0055538_1000077 Ga0055538_100007740 281
1041 3300003751 Ga0055538_1000141 Ga0055538_100014133 281
1042 3300003751 Ga0055538_1002889 Ga0055538_10028892 281
1043 3300003752 Ga0055539_1000001 Ga0055539_1000001797 281
1044 3300003752 Ga0055539_1000114 Ga0055539_100011443 281
1045 3300003752 Ga0055539_1000192 Ga0055539_100019233 281
1046 3300003756 Ga0055533_1000003 Ga0055533_1000003235 281
1047 3300003756 Ga0055533_1000122 Ga0055533_100012241 281
1048 3300003756 Ga0055533_1000192 Ga0055533_100019233 281
1049 3300003756 Ga0055533_1000272 Ga0055533_100027214 281
1050 3300003756 Ga0055533_1002282 Ga0055533_10022822 281
1051 3300003758 Ga0055532_1000002 Ga0055532_100000280 281
1052 3300003758 Ga0055532_1000029 Ga0055532_1000029127 281
1053 3300003758 Ga0055532_1000092 Ga0055532_100009284 281
1054 3300003758 Ga0055532_1000271 Ga0055532_100027123 281
1055 3300003758 Ga0055532_1004381 Ga0055532_10043813 281
1056 3300003759 Ga0055525_1000003 Ga0055525_1000003235 281
1057 3300003759 Ga0055525_1000155 Ga0055525_100015543 281
1058 3300003759 Ga0055525_1000260 Ga0055525_100026017 281
1059 3300003760 Ga0055527_1000035 Ga0055527_1000035122 281
1060 3300003760 Ga0055527_1000913 Ga0055527_10009135 281
1061 3300003760 Ga0055527_1000981 Ga0055527_10009815 281
1062 3300003760 Ga0055527_1001088 Ga0055527_10010883 281
1063 3300003761 Ga0055535_1000050 Ga0055535_1000050122 281
1064 3300003761 Ga0055535_1000380 Ga0055535_10003804 281
1065 3300003761 Ga0055535_1002482 Ga0055535_10024824 281
1066 3300003761 Ga0055535_1002486 Ga0055535_10024864 281
1067 3300003761 Ga0055535_1006572 Ga0055535_10065721 281
1068 3300003762 Ga0055542_1000062 Ga0055542_1000062164 281
1069 3300003762 Ga0055542_1000120 Ga0055542_100012084 281
1070 3300003762 Ga0055542_1002079 Ga0055542_10020796 281
1071 3300003762 Ga0055542_1003286 Ga0055542_10032863 281
1072 3300003763 Ga0055529_1000062 Ga0055529_100006296 281
1073 3300003763 Ga0055529_1000089 Ga0055529_1000089122 281
1074 3300003763 Ga0055529_1000604 Ga0055529_100060423 281
1075 3300003771 Ga0055526_1005266 Ga0055526_10052666 281
1076 3300003771 Ga0055526_1010582 Ga0055526_10105825 281
1077 3300003771 Ga0055526_1028546 Ga0055526_10285462 281
1078 3300003773 Ga0055537_1000483 Ga0055537_10004834 281
1079 3300003775 Ga0055524_1000073 Ga0055524_100007395 281
1080 3300003781 Ga0055536_1004647 Ga0055536_10046474 281
1081 3300003781 Ga0055536_1007734 Ga0055536_10077342 281
1082 3300003781 Ga0055536_1008270 Ga0055536_10082704 281
1083 3300003781 Ga0055536_1014872 Ga0055536_10148722 281
1084 3300003784 Ga0055534_1000548 Ga0055534_10005481 281
1085 3300003784 Ga0055534_1013385 Ga0055534_10133852 281
1086 3300003784 Ga0055534_1013418 Ga0055534_10134182 281
1087 3300003790 Ga0055528_1007433 Ga0055528_10074332 281
1088 3300003790 Ga0055528_1030303 Ga0055528_10303032 281
1089 3300003791 Ga0055530_10001136 Ga0055530_100011364 281
1090 3300003791 Ga0055530_10001548 Ga0055530_1000154818 281
1091 3300003791 Ga0055530_10027339 Ga0055530_100273392 281
1092 3300003792 Ga0055540_1000037 Ga0055540_1000037107 281
1093 3300003792 Ga0055540_1000202 Ga0055540_100020224 281
1094 3300003792 Ga0055540_1006735 Ga0055540_10067354 281
1095 3300003794 Ga0055531_10000112 Ga0055531_1000011260 281
1096 3300003794 Ga0055531_10001286 Ga0055531_100012865 281
1097 3300003794 Ga0055531_10002327 Ga0055531_100023272 281
1098 3300003841 Ga0055541_1000001 Ga0055541_1000001235 281
1099 3300003841 Ga0055541_1000078 Ga0055541_100007841 281
1100 3300003841 Ga0055541_1000127 Ga0055541_100012733 281
1101 3300003841 Ga0055541_1014898 Ga0055541_10148981 281
1102 3300003856 Ga0058692_1000291 Ga0058692_100029118 281
1103 3300003856 Ga0058692_1000442 Ga0058692_100044210 281
1104 3300003856 Ga0058692_1001289 Ga0058692_10012896 281
1105 3300003856 Ga0058692_1003453 Ga0058692_10034536 281
1106 3300003856 Ga0058692_1007004 Ga0058692_10070041 281
1107 3300003856 Ga0058692_1008157 Ga0058692_10081573 281
1108 3300003856 Ga0058692_1009172 Ga0058692_10091722 281
1109 3300003856 Ga0058692_1014082 Ga0058692_10140822 281
1110 3300004625 Ga0055543_1000218 Ga0055543_100021812 281
1111 3300004625 Ga0055543_1001979 Ga0055543_10019793 281
1112 3300005262 Ga0065165_1001344 Ga0065165_10013442 281
1113 3300005262 Ga0065165_1006946 Ga0065165_10069464 281
1114 3300005262 Ga0065165_1021206 Ga0065165_10212062 281
1115 3300005289 Ga0065704_10000716 Ga0065704_1000071612 281
1116 3300005289 Ga0065704_10001392 Ga0065704_100013929 281
1117 3300005289 Ga0065704_10004338 Ga0065704_100043382 281
1118 3300005289 Ga0065704_10072179 Ga0065704_100721796 281
1119 3300005289 Ga0065704_10074644 Ga0065704_100746441 281
1120 3300005289 Ga0065704_10152386 Ga0065704_101523862 281
1121 3300005289 Ga0065704_10173348 Ga0065704_101733482 281
1122 3300005290 Ga0065712_10142020 Ga0065712_101420201 281
1123 3300005293 Ga0065715_10128737 Ga0065715_101287372 281
1124 3300005293 Ga0065715_10163950 Ga0065715_101639502 281
1125 3300005295 Ga0065707_10010916 Ga0065707_100109161 281
1126 3300005295 Ga0065707_10131877 Ga0065707_101318772 281
1127 3300005295 Ga0065707_10174260 Ga0065707_101742602 281
1128 3300005327 Ga0070658_10003011 Ga0070658_100030119 281
1129 3300005327 Ga0070658_10009688 Ga0070658_100096882 281
1130 3300005327 Ga0070658_10078984 Ga0070658_100789842 281
1131 3300005327 Ga0070658_10083909 Ga0070658_100839091 281
1132 3300005327 Ga0070658_10302069 Ga0070658_103020692 281
1133 3300005328 Ga0070676_10008354 Ga0070676_100083542 281
1134 3300005328 Ga0070676_10142800 Ga0070676_101428002 281
1135 3300005328 Ga0070676_10201166 Ga0070676_102011661 281
1136 3300005328 Ga0070676_10238008 Ga0070676_102380081 281
1137 3300005329 Ga0070683_100048450 Ga0070683_1000484505 281
1138 3300005329 Ga0070683_100166675 Ga0070683_1001666752 281
1139 3300005329 Ga0070683_100251524 Ga0070683_1002515242 281
1140 3300005330 Ga0070690_100003946 Ga0070690_1000039462 281
1141 3300005330 Ga0070690_100026479 Ga0070690_1000264793 281
1142 3300005330 Ga0070690_100052025 Ga0070690_1000520252 281
1143 3300005331 Ga0070670_100003522 Ga0070670_1000035223 281
1144 3300005331 Ga0070670_100056008 Ga0070670_1000560083 281
1145 3300005331 Ga0070670_100077996 Ga0070670_1000779963 281
1146 3300005331 Ga0070670_100137669 Ga0070670_1001376692 281
1147 3300005333 Ga0070677_10053009 Ga0070677_100530092 281
1148 3300005334 Ga0068869_100001725 Ga0068869_1000017253 281
1149 3300005334 Ga0068869_100005071 Ga0068869_1000050713 281
1150 3300005334 Ga0068869_100028095 Ga0068869_1000280954 281
1151 3300005334 Ga0068869_100059897 Ga0068869_1000598972 281
1152 3300005334 Ga0068869_100237820 Ga0068869_1002378202 281
1153 3300005334 Ga0068869_100305374 Ga0068869_1003053742 281
1154 3300005335 Ga0070666_10004005 Ga0070666_100040057 281
1155 3300005335 Ga0070666_10005999 Ga0070666_100059995 281
1156 3300005335 Ga0070666_10055036 Ga0070666_100550361 281
1157 3300005335 Ga0070666_10109761 Ga0070666_101097613 281
1158 3300005335 Ga0070666_10122835 Ga0070666_101228352 281
1159 3300005335 Ga0070666_10257948 Ga0070666_102579481 281
1160 3300005336 Ga0070680_100000926 Ga0070680_1000009263 281
1161 3300005336 Ga0070680_100186700 Ga0070680_1001867002 281
1162 3300005336 Ga0070680_100252884 Ga0070680_1002528842 281
1163 3300005336 Ga0070680_100420803 Ga0070680_1004208032 281
1164 3300005337 Ga0070682_100067176 Ga0070682_1000671762 281
1165 3300005338 Ga0068868_100004295 Ga0068868_1000042952 281
1166 3300005338 Ga0068868_100015506 Ga0068868_1000155065 281
1167 3300005338 Ga0068868_100019381 Ga0068868_1000193812 281
1168 3300005338 Ga0068868_100110631 Ga0068868_1001106313 281
1169 3300005338 Ga0068868_100169376 Ga0068868_1001693762 281
1170 3300005339 Ga0070660_100000025 Ga0070660_10000002558 281
1171 3300005339 Ga0070660_100002704 Ga0070660_1000027045 281
1172 3300005339 Ga0070660_100003261 Ga0070660_1000032611 281
1173 3300005339 Ga0070660_100030267 Ga0070660_1000302672 281
1174 3300005339 Ga0070660_100172702 Ga0070660_1001727022 281
1175 3300005339 Ga0070660_100214965 Ga0070660_1002149652 281
1176 3300005339 Ga0070660_100232680 Ga0070660_1002326802 281
1177 3300005339 Ga0070660_100245769 Ga0070660_1002457692 281
1178 3300005340 Ga0070689_100012094 Ga0070689_1000120945 281
1179 3300005340 Ga0070689_100127769 Ga0070689_1001277691 281
1180 3300005340 Ga0070689_100224880 Ga0070689_1002248802 281
1181 3300005341 Ga0070691_10006998 Ga0070691_100069984 281
1182 3300005344 Ga0070661_100000077 Ga0070661_1000000779 281
1183 3300005344 Ga0070661_100001413 Ga0070661_1000014133 281
1184 3300005344 Ga0070661_100017823 Ga0070661_1000178234 281
1185 3300005344 Ga0070661_100083144 Ga0070661_1000831442 281
1186 3300005344 Ga0070661_100195483 Ga0070661_1001954832 281
1187 3300005344 Ga0070661_100197347 Ga0070661_1001973471 281
1188 3300005344 Ga0070661_100205370 Ga0070661_1002053702 281
1189 3300005344 Ga0070661_100333418 Ga0070661_1003334182 281
1190 3300005344 Ga0070661_100420036 Ga0070661_1004200361 281
1191 3300005345 Ga0070692_10000466 Ga0070692_100004662 281
1192 3300005345 Ga0070692_10028699 Ga0070692_100286992 281
1193 3300005345 Ga0070692_10085997 Ga0070692_100859972 281
1194 3300005345 Ga0070692_10095069 Ga0070692_100950691 281
1195 3300005347 Ga0070668_100010679 Ga0070668_1000106795 281
1196 3300005347 Ga0070668_100019151 Ga0070668_1000191515 281
1197 3300005347 Ga0070668_100036477 Ga0070668_1000364774 281
1198 3300005347 Ga0070668_100188905 Ga0070668_1001889053 281
1199 3300005353 Ga0070669_100073948 Ga0070669_1000739483 281
1200 3300005353 Ga0070669_100145895 Ga0070669_1001458952 281
1201 3300005354 Ga0070675_100025547 Ga0070675_1000255472 281
1202 3300005354 Ga0070675_100035472 Ga0070675_1000354722 281
1203 3300005354 Ga0070675_100037288 Ga0070675_1000372881 281
1204 3300005354 Ga0070675_100156515 Ga0070675_1001565153 281
1205 3300005354 Ga0070675_100209527 Ga0070675_1002095272 281
1206 3300005354 Ga0070675_100300364 Ga0070675_1003003641 281
1207 3300005354 Ga0070675_100394181 Ga0070675_1003941811 281
1208 3300005354 Ga0070675_100529622 Ga0070675_1005296222 281
1209 3300005354 Ga0070675_100560516 Ga0070675_1005605162 281
1210 3300005355 Ga0070671_100016334 Ga0070671_1000163342 281
1211 3300005355 Ga0070671_100026912 Ga0070671_1000269124 281
1212 3300005356 Ga0070674_100038940 Ga0070674_1000389403 281
1213 3300005356 Ga0070674_100042873 Ga0070674_1000428733 281
1214 3300005356 Ga0070674_100209603 Ga0070674_1002096032 281
1215 3300005356 Ga0070674_100278682 Ga0070674_1002786822 281
1216 3300005364 Ga0070673_100022597 Ga0070673_1000225973 281
1217 3300005364 Ga0070673_100064583 Ga0070673_1000645833 281
1218 3300005364 Ga0070673_100469855 Ga0070673_1004698551 281
1219 3300005365 Ga0070688_100023345 Ga0070688_1000233453 281
1220 3300005365 Ga0070688_100101736 Ga0070688_1001017362 281
1221 3300005365 Ga0070688_100207608 Ga0070688_1002076081 281
1222 3300005366 Ga0070659_100000642 Ga0070659_10000064214 281
1223 3300005366 Ga0070659_100018465 Ga0070659_1000184651 281
1224 3300005366 Ga0070659_100047862 Ga0070659_1000478623 281
1225 3300005366 Ga0070659_100052631 Ga0070659_1000526312 281
1226 3300005366 Ga0070659_100123635 Ga0070659_1001236352 281
1227 3300005366 Ga0070659_100130229 Ga0070659_1001302294 281
1228 3300005366 Ga0070659_100135197 Ga0070659_1001351971 281
1229 3300005366 Ga0070659_100154116 Ga0070659_1001541162 281
1230 3300005366 Ga0070659_100600432 Ga0070659_1006004321 281
1231 3300005367 Ga0070667_100004686 Ga0070667_1000046865 281
1232 3300005367 Ga0070667_100024560 Ga0070667_1000245603 281
1233 3300005367 Ga0070667_100046106 Ga0070667_1000461063 281
1234 3300005367 Ga0070667_100098947 Ga0070667_1000989472 281
1235 3300005367 Ga0070667_100145749 Ga0070667_1001457493 281
1236 3300005367 Ga0070667_100213821 Ga0070667_1002138212 281
1237 3300005406 Ga0070703_10044034 Ga0070703_100440342 281
1238 3300005434 Ga0070709_10023108 Ga0070709_100231083 281
1239 3300005434 Ga0070709_10144152 Ga0070709_101441522 281
1240 3300005435 Ga0070714_100009252 Ga0070714_1000092522 281
1241 3300005435 Ga0070714_100105328 Ga0070714_1001053281 281
1242 3300005435 Ga0070714_100149591 Ga0070714_1001495912 281
1243 3300005435 Ga0070714_100222057 Ga0070714_1002220572 281
1244 3300005435 Ga0070714_100296999 Ga0070714_1002969992 281
1245 3300005436 Ga0070713_100000045 Ga0070713_10000004551 281
1246 3300005436 Ga0070713_100028021 Ga0070713_1000280213 281
1247 3300005436 Ga0070713_100346055 Ga0070713_1003460552 281
1248 3300005437 Ga0070710_10066861 Ga0070710_100668612 281
1249 3300005437 Ga0070710_10099053 Ga0070710_100990532 281
1250 3300005438 Ga0070701_10046778 Ga0070701_100467783 281
1251 3300005438 Ga0070701_10057448 Ga0070701_100574482 281
1252 3300005438 Ga0070701_10108013 Ga0070701_101080132 281
1253 3300005438 Ga0070701_10118689 Ga0070701_101186892 281
1254 3300005440 Ga0070705_100009640 Ga0070705_1000096403 281
1255 3300005440 Ga0070705_100082987 Ga0070705_1000829872 281
1256 3300005440 Ga0070705_100129920 Ga0070705_1001299201 281
1257 3300005440 Ga0070705_100145374 Ga0070705_1001453742 281
1258 3300005441 Ga0070700_100000839 Ga0070700_1000008397 281
1259 3300005441 Ga0070700_100006753 Ga0070700_1000067532 281
1260 3300005441 Ga0070700_100039918 Ga0070700_1000399182 281
1261 3300005441 Ga0070700_100077894 Ga0070700_1000778941 281
1262 3300005441 Ga0070700_100114998 Ga0070700_1001149982 281
1263 3300005441 Ga0070700_100127895 Ga0070700_1001278952 281
1264 3300005444 Ga0070694_100000826 Ga0070694_1000008262 281
1265 3300005444 Ga0070694_100014909 Ga0070694_1000149094 281
1266 3300005444 Ga0070694_100027045 Ga0070694_1000270453 281
1267 3300005444 Ga0070694_100042777 Ga0070694_1000427773 281
1268 3300005445 Ga0070708_100000371 Ga0070708_1000003716 281
1269 3300005445 Ga0070708_100128321 Ga0070708_1001283212 281
1270 3300005445 Ga0070708_100351189 Ga0070708_1003511892 281
1271 3300005455 Ga0070663_100000011 Ga0070663_10000001127 281
1272 3300005455 Ga0070663_100010000 Ga0070663_1000100002 281
1273 3300005455 Ga0070663_100051160 Ga0070663_1000511602 281
1274 3300005455 Ga0070663_100075734 Ga0070663_1000757342 281
1275 3300005455 Ga0070663_100124093 Ga0070663_1001240931 281
1276 3300005455 Ga0070663_100136535 Ga0070663_1001365352 281
1277 3300005455 Ga0070663_100181372 Ga0070663_1001813721 281
1278 3300005455 Ga0070663_100267243 Ga0070663_1002672432 281
1279 3300005456 Ga0070678_100001525 Ga0070678_10000152512 281
1280 3300005456 Ga0070678_100002784 Ga0070678_1000027843 281
1281 3300005456 Ga0070678_100022766 Ga0070678_1000227664 281
1282 3300005456 Ga0070678_100092488 Ga0070678_1000924882 281
1283 3300005456 Ga0070678_100135102 Ga0070678_1001351023 281
1284 3300005457 Ga0070662_100020556 Ga0070662_1000205564 281
1285 3300005457 Ga0070662_100024044 Ga0070662_1000240443 281
1286 3300005457 Ga0070662_100048302 Ga0070662_1000483022 281
1287 3300005457 Ga0070662_100288375 Ga0070662_1002883752 281
1288 3300005457 Ga0070662_100291680 Ga0070662_1002916802 281
1289 3300005457 Ga0070662_100400403 Ga0070662_1004004032 281
1290 3300005457 Ga0070662_100437345 Ga0070662_1004373451 281
1291 3300005458 Ga0070681_10015201 Ga0070681_100152013 281
1292 3300005458 Ga0070681_10028617 Ga0070681_100286174 281
1293 3300005458 Ga0070681_10035599 Ga0070681_100355992 281
1294 3300005458 Ga0070681_10079093 Ga0070681_100790932 281
1295 3300005458 Ga0070681_10307947 Ga0070681_103079472 281
1296 3300005459 Ga0068867_100001697 Ga0068867_1000016978 281
1297 3300005459 Ga0068867_100002737 Ga0068867_1000027373 281
1298 3300005459 Ga0068867_100005994 Ga0068867_1000059942 281
1299 3300005459 Ga0068867_100014474 Ga0068867_1000144741 281
1300 3300005459 Ga0068867_100027466 Ga0068867_1000274663 281
1301 3300005459 Ga0068867_100071657 Ga0068867_1000716573 281
1302 3300005459 Ga0068867_100316556 Ga0068867_1003165562 281
1303 3300005459 Ga0068867_100493226 Ga0068867_1004932261 281
1304 3300005467 Ga0070706_100025322 Ga0070706_1000253221 281
1305 3300005467 Ga0070706_100160895 Ga0070706_1001608952 281
1306 3300005467 Ga0070706_100411718 Ga0070706_1004117181 281
1307 3300005468 Ga0070707_100014407 Ga0070707_1000144077 281
1308 3300005468 Ga0070707_100519028 Ga0070707_1005190282 281
1309 3300005471 Ga0070698_100368870 Ga0070698_1003688702 281
1310 3300005518 Ga0070699_100012659 Ga0070699_1000126591 281
1311 3300005518 Ga0070699_100019325 Ga0070699_1000193255 281
1312 3300005518 Ga0070699_100037364 Ga0070699_1000373642 281
1313 3300005518 Ga0070699_100043010 Ga0070699_1000430102 281
1314 3300005518 Ga0070699_100267640 Ga0070699_1002676401 281
1315 3300005518 Ga0070699_100280745 Ga0070699_1002807451 281
1316 3300005530 Ga0070679_100027239 Ga0070679_1000272392 281
1317 3300005530 Ga0070679_100068292 Ga0070679_1000682923 281
1318 3300005530 Ga0070679_100196836 Ga0070679_1001968362 281
1319 3300005530 Ga0070679_100225656 Ga0070679_1002256562 281
1320 3300005530 Ga0070679_100431033 Ga0070679_1004310331 281
1321 3300005530 Ga0070679_100437035 Ga0070679_1004370351 281
1322 3300005535 Ga0070684_100019385 Ga0070684_1000193851 281
1323 3300005535 Ga0070684_100130506 Ga0070684_1001305061 281
1324 3300005535 Ga0070684_100262902 Ga0070684_1002629022 281
1325 3300005536 Ga0070697_100033017 Ga0070697_1000330174 281
1326 3300005536 Ga0070697_100036372 Ga0070697_1000363723 281
1327 3300005536 Ga0070697_100038701 Ga0070697_1000387013 281
1328 3300005536 Ga0070697_100192702 Ga0070697_1001927022 281
1329 3300005539 Ga0068853_100001296 Ga0068853_10000129611 281
1330 3300005539 Ga0068853_100020012 Ga0068853_1000200122 281
1331 3300005539 Ga0068853_100020194 Ga0068853_1000201945 281
1332 3300005539 Ga0068853_100102306 Ga0068853_1001023063 281
1333 3300005539 Ga0068853_100127565 Ga0068853_1001275651 281
1334 3300005539 Ga0068853_100211249 Ga0068853_1002112492 281
1335 3300005539 Ga0068853_100264422 Ga0068853_1002644222 281
1336 3300005539 Ga0068853_100412992 Ga0068853_1004129922 281
1337 3300005543 Ga0070672_100005265 Ga0070672_1000052655 281
1338 3300005543 Ga0070672_100099627 Ga0070672_1000996272 281
1339 3300005543 Ga0070672_100155725 Ga0070672_1001557252 281
1340 3300005543 Ga0070672_100224506 Ga0070672_1002245062 281
1341 3300005544 Ga0070686_100035845 Ga0070686_1000358453 281
1342 3300005544 Ga0070686_100146440 Ga0070686_1001464402 281
1343 3300005545 Ga0070695_100000012 Ga0070695_10000001264 281
1344 3300005545 Ga0070695_100061703 Ga0070695_1000617032 281
1345 3300005545 Ga0070695_100086398 Ga0070695_1000863982 281
1346 3300005545 Ga0070695_100093576 Ga0070695_1000935762 281
1347 3300005545 Ga0070695_100128366 Ga0070695_1001283661 281
1348 3300005545 Ga0070695_100268192 Ga0070695_1002681922 281
1349 3300005546 Ga0070696_100002468 Ga0070696_10000246810 281
1350 3300005546 Ga0070696_100005059 Ga0070696_1000050592 281
1351 3300005546 Ga0070696_100011875 Ga0070696_1000118753 281
1352 3300005546 Ga0070696_100057905 Ga0070696_1000579052 281
1353 3300005546 Ga0070696_100064246 Ga0070696_1000642462 281
1354 3300005546 Ga0070696_100107167 Ga0070696_1001071672 281
1355 3300005546 Ga0070696_100168979 Ga0070696_1001689792 281
1356 3300005546 Ga0070696_100211850 Ga0070696_1002118502 281
1357 3300005547 Ga0070693_100000113 Ga0070693_10000011329 281
1358 3300005547 Ga0070693_100023547 Ga0070693_1000235473 281
1359 3300005548 Ga0070665_100000117 Ga0070665_100000117103 281
1360 3300005548 Ga0070665_100030015 Ga0070665_1000300155 281
1361 3300005548 Ga0070665_100037150 Ga0070665_1000371503 281
1362 3300005548 Ga0070665_100047026 Ga0070665_1000470262 281
1363 3300005548 Ga0070665_100054874 Ga0070665_1000548744 281
1364 3300005548 Ga0070665_100266465 Ga0070665_1002664652 281
1365 3300005548 Ga0070665_100274127 Ga0070665_1002741273 281
1366 3300005549 Ga0070704_100000059 Ga0070704_1000000593 281
1367 3300005549 Ga0070704_100010208 Ga0070704_1000102081 281
1368 3300005549 Ga0070704_100010359 Ga0070704_1000103593 281
1369 3300005549 Ga0070704_100066502 Ga0070704_1000665022 281
1370 3300005549 Ga0070704_100219893 Ga0070704_1002198932 281
1371 3300005549 Ga0070704_100461191 Ga0070704_1004611911 281
1372 3300005563 Ga0068855_100000651 Ga0068855_10000065126 281
1373 3300005563 Ga0068855_100002969 Ga0068855_10000296915 281
1374 3300005563 Ga0068855_100016883 Ga0068855_1000168836 281
1375 3300005563 Ga0068855_100020624 Ga0068855_1000206242 281
1376 3300005563 Ga0068855_100036519 Ga0068855_1000365194 281
1377 3300005563 Ga0068855_100067427 Ga0068855_1000674271 281
1378 3300005563 Ga0068855_100076357 Ga0068855_1000763573 281
1379 3300005563 Ga0068855_100080806 Ga0068855_1000808064 281
1380 3300005563 Ga0068855_100133389 Ga0068855_1001333892 281
1381 3300005563 Ga0068855_100177365 Ga0068855_1001773652 281
1382 3300005563 Ga0068855_100194088 Ga0068855_1001940882 281
1383 3300005563 Ga0068855_100479300 Ga0068855_1004793002 281
1384 3300005563 Ga0068855_100492947 Ga0068855_1004929472 281
1385 3300005564 Ga0070664_100000002 Ga0070664_10000000232 281
1386 3300005564 Ga0070664_100003038 Ga0070664_1000030384 281
1387 3300005564 Ga0070664_100023069 Ga0070664_1000230692 281
1388 3300005564 Ga0070664_100028363 Ga0070664_1000283633 281
1389 3300005564 Ga0070664_100065448 Ga0070664_1000654483 281
1390 3300005564 Ga0070664_100083711 Ga0070664_1000837113 281
1391 3300005564 Ga0070664_100199924 Ga0070664_1001999242 281
1392 3300005564 Ga0070664_100218858 Ga0070664_1002188582 281
1393 3300005577 Ga0068857_100000017 Ga0068857_10000001749 281
1394 3300005577 Ga0068857_100000810 Ga0068857_10000081011 281
1395 3300005577 Ga0068857_100002261 Ga0068857_10000226111 281
1396 3300005577 Ga0068857_100006146 Ga0068857_1000061467 281
1397 3300005577 Ga0068857_100077975 Ga0068857_1000779752 281
1398 3300005577 Ga0068857_100166089 Ga0068857_1001660892 281
1399 3300005577 Ga0068857_100198883 Ga0068857_1001988832 281
1400 3300005577 Ga0068857_100201006 Ga0068857_1002010062 281
1401 3300005577 Ga0068857_100361859 Ga0068857_1003618592 281
1402 3300005578 Ga0068854_100000043 Ga0068854_10000004354 281
1403 3300005578 Ga0068854_100000572 Ga0068854_10000057213 281
1404 3300005578 Ga0068854_100006155 Ga0068854_1000061557 281
1405 3300005578 Ga0068854_100016437 Ga0068854_1000164372 281
1406 3300005578 Ga0068854_100017824 Ga0068854_1000178244 281
1407 3300005578 Ga0068854_100026698 Ga0068854_1000266982 281
1408 3300005578 Ga0068854_100242754 Ga0068854_1002427542 281
1409 3300005578 Ga0068854_100354060 Ga0068854_1003540602 281
1410 3300005578 Ga0068854_100482182 Ga0068854_1004821822 281
1411 3300005614 Ga0068856_100000009 Ga0068856_1000000093 281
1412 3300005614 Ga0068856_100003497 Ga0068856_1000034975 281
1413 3300005614 Ga0068856_100014288 Ga0068856_1000142882 281
1414 3300005614 Ga0068856_100052020 Ga0068856_1000520204 281
1415 3300005614 Ga0068856_100086034 Ga0068856_1000860343 281
1416 3300005614 Ga0068856_100227250 Ga0068856_1002272502 281
1417 3300005614 Ga0068856_100283983 Ga0068856_1002839831 281
1418 3300005614 Ga0068856_100302699 Ga0068856_1003026992 281
1419 3300005614 Ga0068856_100455965 Ga0068856_1004559652 281
1420 3300005615 Ga0070702_100000275 Ga0070702_1000002752 281
1421 3300005616 Ga0068852_100001129 Ga0068852_1000011292 281
1422 3300005616 Ga0068852_100023990 Ga0068852_1000239905 281
1423 3300005616 Ga0068852_100042062 Ga0068852_1000420624 281
1424 3300005616 Ga0068852_100045092 Ga0068852_1000450923 281
1425 3300005616 Ga0068852_100056504 Ga0068852_1000565042 281
1426 3300005616 Ga0068852_100060146 Ga0068852_1000601463 281
1427 3300005616 Ga0068852_100153013 Ga0068852_1001530132 281
1428 3300005616 Ga0068852_100204780 Ga0068852_1002047802 281
1429 3300005616 Ga0068852_100617358 Ga0068852_1006173582 281
1430 3300005617 Ga0068859_100000466 Ga0068859_10000046612 281
1431 3300005617 Ga0068859_100003563 Ga0068859_10000356312 281
1432 3300005617 Ga0068859_100106044 Ga0068859_1001060442 281
1433 3300005617 Ga0068859_100113078 Ga0068859_1001130783 281
1434 3300005617 Ga0068859_100249859 Ga0068859_1002498592 281
1435 3300005618 Ga0068864_100001455 Ga0068864_10000145512 281
1436 3300005618 Ga0068864_100025485 Ga0068864_1000254854 281
1437 3300005618 Ga0068864_100062146 Ga0068864_1000621463 281
1438 3300005618 Ga0068864_100250307 Ga0068864_1002503072 281
1439 3300005718 Ga0068866_10000122 Ga0068866_100001222 281
1440 3300005718 Ga0068866_10017127 Ga0068866_100171273 281
1441 3300005718 Ga0068866_10024274 Ga0068866_100242743 281
1442 3300005719 Ga0068861_100027781 Ga0068861_1000277814 281
1443 3300005719 Ga0068861_100031998 Ga0068861_1000319984 281
1444 3300005719 Ga0068861_100072778 Ga0068861_1000727783 281
1445 3300005719 Ga0068861_100111133 Ga0068861_1001111332 281
1446 3300005719 Ga0068861_100280100 Ga0068861_1002801002 281
1447 3300005834 Ga0068851_10001481 Ga0068851_1000148111 281
1448 3300005834 Ga0068851_10001662 Ga0068851_100016622 281
1449 3300005834 Ga0068851_10041779 Ga0068851_100417791 281
1450 3300005834 Ga0068851_10077192 Ga0068851_100771922 281
1451 3300005834 Ga0068851_10126862 Ga0068851_101268622 281
1452 3300005840 Ga0068870_10171361 Ga0068870_101713612 281
1453 3300005841 Ga0068863_100080889 Ga0068863_1000808893 281
1454 3300005841 Ga0068863_100090892 Ga0068863_1000908923 281
1455 3300005841 Ga0068863_100168584 Ga0068863_1001685842 281
1456 3300005841 Ga0068863_100284228 Ga0068863_1002842282 281
1457 3300005841 Ga0068863_100496319 Ga0068863_1004963192 281
1458 3300005842 Ga0068858_100000624 Ga0068858_10000062412 281
1459 3300005842 Ga0068858_100005397 Ga0068858_1000053974 281
1460 3300005842 Ga0068858_100008387 Ga0068858_1000083872 281
1461 3300005842 Ga0068858_100025937 Ga0068858_1000259374 281
1462 3300005842 Ga0068858_100028584 Ga0068858_1000285846 281
1463 3300005842 Ga0068858_100095282 Ga0068858_1000952822 281
1464 3300005842 Ga0068858_100374558 Ga0068858_1003745582 281
1465 3300005842 Ga0068858_100381023 Ga0068858_1003810232 281
1466 3300005843 Ga0068860_100000782 Ga0068860_10000078212 281
1467 3300005843 Ga0068860_100004659 Ga0068860_10000465912 281
1468 3300005843 Ga0068860_100005775 Ga0068860_1000057758 281
1469 3300005843 Ga0068860_100156620 Ga0068860_1001566203 281
1470 3300005843 Ga0068860_100171100 Ga0068860_1001711002 281
1471 3300005843 Ga0068860_100304720 Ga0068860_1003047202 281
1472 3300005843 Ga0068860_100367618 Ga0068860_1003676182 281
1473 3300005844 Ga0068862_100004876 Ga0068862_1000048762 281
1474 3300005844 Ga0068862_100005868 Ga0068862_1000058687 281
1475 3300005844 Ga0068862_100007370 Ga0068862_1000073704 281
1476 3300005844 Ga0068862_100008013 Ga0068862_1000080133 281
1477 3300005844 Ga0068862_100020843 Ga0068862_1000208433 281
1478 3300005844 Ga0068862_100096088 Ga0068862_1000960882 281
1479 3300005844 Ga0068862_100197222 Ga0068862_1001972222 281
1480 3300005844 Ga0068862_100249904 Ga0068862_1002499043 281
1481 3300005937 Ga0081455_10114530 Ga0081455_101145302 281
1482 3300005981 Ga0081538_10005156 Ga0081538_100051565 281
1483 3300005985 Ga0081539_10000917 Ga0081539_1000091747 281
1484 3300005985 Ga0081539_10106945 Ga0081539_101069451 281
1485 3300006048 Ga0075363_100057248 Ga0075363_1000572482 281
1486 3300006048 Ga0075363_100248052 Ga0075363_1002480522 281
1487 3300006051 Ga0075364_10000908 Ga0075364_1000090814 281
1488 3300006051 Ga0075364_10022112 Ga0075364_100221124 281
1489 3300006051 Ga0075364_10048630 Ga0075364_100486302 281
1490 3300006051 Ga0075364_10090235 Ga0075364_100902352 281
1491 3300006051 Ga0075364_10161768 Ga0075364_101617682 281
1492 3300006163 Ga0070715_10038932 Ga0070715_100389322 281
1493 3300006177 Ga0075362_10005983 Ga0075362_100059834 281
1494 3300006177 Ga0075362_10010722 Ga0075362_100107222 281
1495 3300006178 Ga0075367_10118264 Ga0075367_101182642 281
1496 3300006186 Ga0075369_10018308 Ga0075369_100183082 281
1497 3300006195 Ga0075366_10007433 Ga0075366_100074332 281
1498 3300006195 Ga0075366_10008592 Ga0075366_100085923 281
1499 3300006195 Ga0075366_10012017 Ga0075366_100120174 281
1500 3300006195 Ga0075366_10033284 Ga0075366_100332842 281
1501 3300006195 Ga0075366_10054232 Ga0075366_100542323 281
1502 3300006195 Ga0075366_10136095 Ga0075366_101360951 281
1503 3300006195 Ga0075366_10188066 Ga0075366_101880661 281
1504 3300006195 Ga0075366_10212240 Ga0075366_102122402 281
1505 3300006237 Ga0097621_100000698 Ga0097621_1000006983 281
1506 3300006237 Ga0097621_100011805 Ga0097621_1000118052 281
1507 3300006237 Ga0097621_100030047 Ga0097621_1000300473 281
1508 3300006237 Ga0097621_100107835 Ga0097621_1001078352 281
1509 3300006237 Ga0097621_100108562 Ga0097621_1001085621 281
1510 3300006237 Ga0097621_100116629 Ga0097621_1001166293 281
1511 3300006237 Ga0097621_100122443 Ga0097621_1001224432 281
1512 3300006237 Ga0097621_100183562 Ga0097621_1001835622 281
1513 3300006237 Ga0097621_100270202 Ga0097621_1002702022 281
1514 3300006353 Ga0075370_10001008 Ga0075370_100010084 281
1515 3300006353 Ga0075370_10004338 Ga0075370_100043383 281
1516 3300006353 Ga0075370_10012932 Ga0075370_100129322 281
1517 3300006353 Ga0075370_10019534 Ga0075370_100195343 281
1518 3300006353 Ga0075370_10029150 Ga0075370_100291502 281
1519 3300006353 Ga0075370_10114693 Ga0075370_101146932 281
1520 3300006353 Ga0075370_10122546 Ga0075370_101225462 281
1521 3300006358 Ga0068871_100001353 Ga0068871_10000135312 281
1522 3300006358 Ga0068871_100002613 Ga0068871_10000261311 281
1523 3300006358 Ga0068871_100078976 Ga0068871_1000789762 281
1524 3300006358 Ga0068871_100357119 Ga0068871_1003571192 281
1525 3300006844 Ga0075428_100000799 Ga0075428_10000079911 281
1526 3300006844 Ga0075428_100038028 Ga0075428_1000380284 281
1527 3300006844 Ga0075428_100131858 Ga0075428_1001318582 281
1528 3300006844 Ga0075428_100205457 Ga0075428_1002054572 281
1529 3300006844 Ga0075428_100400369 Ga0075428_1004003692 281
1530 3300006846 Ga0075430_100003916 Ga0075430_1000039169 281
1531 3300006846 Ga0075430_100037035 Ga0075430_1000370353 281
1532 3300006846 Ga0075430_100085870 Ga0075430_1000858702 281
1533 3300006846 Ga0075430_100086294 Ga0075430_1000862943 281
1534 3300006846 Ga0075430_100089559 Ga0075430_1000895593 281
1535 3300006847 Ga0075431_100009882 Ga0075431_1000098827 281
1536 3300006847 Ga0075431_100040994 Ga0075431_1000409944 281
1537 3300006847 Ga0075431_100045869 Ga0075431_1000458693 281
1538 3300006847 Ga0075431_100051778 Ga0075431_1000517782 281
1539 3300006847 Ga0075431_100058672 Ga0075431_1000586724 281
1540 3300006847 Ga0075431_100274973 Ga0075431_1002749732 281
1541 3300006852 Ga0075433_10000171 Ga0075433_1000017130 281
1542 3300006852 Ga0075433_10124994 Ga0075433_101249943 281
1543 3300006871 Ga0075434_100016556 Ga0075434_1000165562 281
1544 3300006871 Ga0075434_100069148 Ga0075434_1000691483 281
1545 3300006871 Ga0075434_100080389 Ga0075434_1000803892 281
1546 3300006880 Ga0075429_100000463 Ga0075429_10000046329 281
1547 3300006880 Ga0075429_100000678 Ga0075429_1000006789 281
1548 3300006880 Ga0075429_100012319 Ga0075429_1000123194 281
1549 3300006880 Ga0075429_100060722 Ga0075429_1000607222 281
1550 3300006881 Ga0068865_100000404 Ga0068865_10000040413 281
1551 3300006881 Ga0068865_100002880 Ga0068865_1000028808 281
1552 3300006881 Ga0068865_100004236 Ga0068865_1000042362 281
1553 3300006914 Ga0075436_100000153 Ga0075436_1000001538 281
1554 3300006914 Ga0075436_100000602 Ga0075436_1000006029 281
1555 3300006914 Ga0075436_100021844 Ga0075436_1000218442 281
1556 3300006914 Ga0075436_100031066 Ga0075436_1000310662 281
1557 3300006914 Ga0075436_100072191 Ga0075436_1000721912 281
1558 3300006914 Ga0075436_100299174 Ga0075436_1002991742 281
1559 3300006931 Ga0097620_100000466 Ga0097620_10000046612 281
1560 3300006931 Ga0097620_100003563 Ga0097620_10000356312 281
1561 3300006931 Ga0097620_100106045 Ga0097620_1001060452 281
1562 3300006931 Ga0097620_100113077 Ga0097620_1001130773 281
1563 3300006931 Ga0097620_100249851 Ga0097620_1002498511 281
1564 3300006946 Ga0079104_1000078 Ga0079104_100007868 281
1565 3300006946 Ga0079104_1000227 Ga0079104_100022750 281
1566 3300006946 Ga0079104_1000328 Ga0079104_100032828 281
1567 3300006946 Ga0079104_1000892 Ga0079104_10008925 281
1568 3300006946 Ga0079104_1002540 Ga0079104_10025403 281
1569 3300006946 Ga0079104_1003482 Ga0079104_10034821 281
1570 3300006946 Ga0079104_1015841 Ga0079104_10158413 281
1571 3300006946 Ga0079104_1017421 Ga0079104_10174213 281
1572 3300006946 Ga0079104_1035302 Ga0079104_10353022 281
1573 3300007076 Ga0075435_100000824 Ga0075435_1000008242 281
1574 3300007076 Ga0075435_100145036 Ga0075435_1001450362 281
1575 3300007076 Ga0075435_100177740 Ga0075435_1001777402 281
1576 3300007265 Ga0099794_10012056 Ga0099794_100120562 281
1577 3300009011 Ga0105251_10000475 Ga0105251_1000047518 281
1578 3300009011 Ga0105251_10000708 Ga0105251_1000070824 281
1579 3300009011 Ga0105251_10001481 Ga0105251_100014817 281
1580 3300009011 Ga0105251_10001513 Ga0105251_1000151312 281
1581 3300009011 Ga0105251_10001883 Ga0105251_100018832 281
1582 3300009011 Ga0105251_10001897 Ga0105251_1000189713 281
1583 3300009011 Ga0105251_10003353 Ga0105251_100033539 281
1584 3300009011 Ga0105251_10003631 Ga0105251_1000363110 281
1585 3300009011 Ga0105251_10004377 Ga0105251_100043778 281
1586 3300009011 Ga0105251_10004411 Ga0105251_100044117 281
1587 3300009011 Ga0105251_10004602 Ga0105251_100046028 281
1588 3300009011 Ga0105251_10011195 Ga0105251_100111952 281
1589 3300009011 Ga0105251_10016903 Ga0105251_100169033 281
1590 3300009011 Ga0105251_10024976 Ga0105251_100249763 281
1591 3300009036 Ga0105244_10000017 Ga0105244_10000017156 281
1592 3300009036 Ga0105244_10000021 Ga0105244_10000021192 281
1593 3300009036 Ga0105244_10000119 Ga0105244_1000011934 281
1594 3300009036 Ga0105244_10000266 Ga0105244_1000026611 281
1595 3300009036 Ga0105244_10000314 Ga0105244_1000031431 281
1596 3300009036 Ga0105244_10000465 Ga0105244_1000046517 281
1597 3300009036 Ga0105244_10000525 Ga0105244_1000052530 281
1598 3300009036 Ga0105244_10002249 Ga0105244_1000224914 281
1599 3300009036 Ga0105244_10008215 Ga0105244_100082155 281
1600 3300009036 Ga0105244_10010529 Ga0105244_100105292 281
1601 3300009036 Ga0105244_10012089 Ga0105244_100120892 281
1602 3300009036 Ga0105244_10023134 Ga0105244_100231343 281
1603 3300009036 Ga0105244_10053714 Ga0105244_100537141 281
1604 3300009036 Ga0105244_10069621 Ga0105244_100696211 281
1605 3300009092 Ga0105250_10000012 Ga0105250_1000001243 281
1606 3300009092 Ga0105250_10000049 Ga0105250_1000004984 281
1607 3300009092 Ga0105250_10000259 Ga0105250_1000025931 281
1608 3300009092 Ga0105250_10000295 Ga0105250_100002957 281
1609 3300009092 Ga0105250_10003414 Ga0105250_100034143 281
1610 3300009092 Ga0105250_10003736 Ga0105250_100037363 281
1611 3300009092 Ga0105250_10004653 Ga0105250_100046535 281
1612 3300009092 Ga0105250_10018908 Ga0105250_100189082 281
1613 3300009092 Ga0105250_10022148 Ga0105250_100221482 281
1614 3300009092 Ga0105250_10036432 Ga0105250_100364322 281
1615 3300009093 Ga0105240_10001807 Ga0105240_1000180732 281
1616 3300009093 Ga0105240_10002360 Ga0105240_1000236028 281
1617 3300009093 Ga0105240_10003800 Ga0105240_1000380011 281
1618 3300009093 Ga0105240_10013166 Ga0105240_100131663 281
1619 3300009093 Ga0105240_10038236 Ga0105240_100382366 281
1620 3300009093 Ga0105240_10039064 Ga0105240_100390643 281
1621 3300009093 Ga0105240_10045802 Ga0105240_100458025 281
1622 3300009093 Ga0105240_10047378 Ga0105240_100473783 281
1623 3300009093 Ga0105240_10056620 Ga0105240_100566204 281
1624 3300009093 Ga0105240_10134703 Ga0105240_101347033 281
1625 3300009093 Ga0105240_10152994 Ga0105240_101529941 281
1626 3300009093 Ga0105240_10173201 Ga0105240_101732013 281
1627 3300009093 Ga0105240_10251144 Ga0105240_102511441 281
1628 3300009093 Ga0105240_10335236 Ga0105240_103352362 281
1629 3300009093 Ga0105240_10409120 Ga0105240_104091202 281
1630 3300009093 Ga0105240_10414370 Ga0105240_104143702 281
1631 3300009093 Ga0105240_10483546 Ga0105240_104835462 281
1632 3300009094 Ga0111539_10027007 Ga0111539_100270072 281
1633 3300009094 Ga0111539_10046081 Ga0111539_100460813 281
1634 3300009094 Ga0111539_10076603 Ga0111539_100766032 281
1635 3300009094 Ga0111539_10316104 Ga0111539_103161042 281
1636 3300009094 Ga0111539_10322138 Ga0111539_103221382 281
1637 3300009094 Ga0111539_10560101 Ga0111539_105601012 281
1638 3300009094 Ga0111539_10662938 Ga0111539_106629382 281
1639 3300009098 Ga0105245_10003268 Ga0105245_100032682 281
1640 3300009098 Ga0105245_10007918 Ga0105245_100079185 281
1641 3300009098 Ga0105245_10096930 Ga0105245_100969303 281
1642 3300009101 Ga0105247_10000171 Ga0105247_1000017132 281
1643 3300009101 Ga0105247_10080598 Ga0105247_100805982 281
1644 3300009147 Ga0114129_10001431 Ga0114129_1000143123 281
1645 3300009147 Ga0114129_10018075 Ga0114129_100180757 281
1646 3300009147 Ga0114129_10084982 Ga0114129_100849823 281
1647 3300009148 Ga0105243_10001640 Ga0105243_100016405 281
1648 3300009148 Ga0105243_10001806 Ga0105243_1000180611 281
1649 3300009148 Ga0105243_10002036 Ga0105243_100020363 281
1650 3300009148 Ga0105243_10002550 Ga0105243_100025503 281
1651 3300009148 Ga0105243_10014468 Ga0105243_100144685 281
1652 3300009148 Ga0105243_10043543 Ga0105243_100435432 281
1653 3300009148 Ga0105243_10087159 Ga0105243_100871592 281
1654 3300009148 Ga0105243_10217128 Ga0105243_102171282 281
1655 3300009174 Ga0105241_10000145 Ga0105241_1000014516 281
1656 3300009174 Ga0105241_10015247 Ga0105241_100152474 281
1657 3300009174 Ga0105241_10015429 Ga0105241_100154295 281
1658 3300009174 Ga0105241_10082820 Ga0105241_100828203 281
1659 3300009174 Ga0105241_10104785 Ga0105241_101047852 281
1660 3300009174 Ga0105241_10149694 Ga0105241_101496942 281
1661 3300009174 Ga0105241_10345220 Ga0105241_103452201 281
1662 3300009174 Ga0105241_10385097 Ga0105241_103850971 281
1663 3300009174 Ga0105241_10426728 Ga0105241_104267282 281
1664 3300009176 Ga0105242_10000721 Ga0105242_1000072113 281
1665 3300009176 Ga0105242_10001697 Ga0105242_1000169710 281
1666 3300009176 Ga0105242_10002028 Ga0105242_100020289 281
1667 3300009176 Ga0105242_10007843 Ga0105242_100078433 281
1668 3300009176 Ga0105242_10076499 Ga0105242_100764992 281
1669 3300009176 Ga0105242_10157790 Ga0105242_101577902 281
1670 3300009176 Ga0105242_10188246 Ga0105242_101882462 281
1671 3300009177 Ga0105248_10000736 Ga0105248_1000073612 281
1672 3300009177 Ga0105248_10018046 Ga0105248_100180463 281
1673 3300009177 Ga0105248_10024858 Ga0105248_100248585 281
1674 3300009177 Ga0105248_10048035 Ga0105248_100480352 281
1675 3300009177 Ga0105248_10059994 Ga0105248_100599942 281
1676 3300009177 Ga0105248_10066533 Ga0105248_100665332 281
1677 3300009177 Ga0105248_10097249 Ga0105248_100972492 281
1678 3300009177 Ga0105248_10210259 Ga0105248_102102592 281
1679 3300009545 Ga0105237_10004758 Ga0105237_100047587 281
1680 3300009545 Ga0105237_10008560 Ga0105237_1000856010 281
1681 3300009545 Ga0105237_10071548 Ga0105237_100715483 281
1682 3300009545 Ga0105237_10254757 Ga0105237_102547572 281
1683 3300009545 Ga0105237_10294643 Ga0105237_102946432 281
1684 3300009545 Ga0105237_10355761 Ga0105237_103557612 281
1685 3300009545 Ga0105237_10508152 Ga0105237_105081521 281
1686 3300009545 Ga0105237_10670381 Ga0105237_106703811 281
1687 3300009551 Ga0105238_10000006 Ga0105238_10000006253 281
1688 3300009551 Ga0105238_10001317 Ga0105238_1000131711 281
1689 3300009551 Ga0105238_10002609 Ga0105238_100026095 281
1690 3300009551 Ga0105238_10006104 Ga0105238_100061042 281
1691 3300009551 Ga0105238_10020927 Ga0105238_100209273 281
1692 3300009551 Ga0105238_10030214 Ga0105238_100302147 281
1693 3300009551 Ga0105238_10032839 Ga0105238_100328395 281
1694 3300009551 Ga0105238_10275235 Ga0105238_102752352 281
1695 3300009551 Ga0105238_10599725 Ga0105238_105997252 281
1696 3300009551 Ga0105238_10640464 Ga0105238_106404642 281
1697 3300009553 Ga0105249_10001475 Ga0105249_1000147510 281
1698 3300009553 Ga0105249_10014353 Ga0105249_100143533 281
1699 3300009553 Ga0105249_10046472 Ga0105249_100464722 281
1700 3300009553 Ga0105249_10067250 Ga0105249_100672503 281
1701 3300009553 Ga0105249_10440595 Ga0105249_104405952 281
1702 3300009553 Ga0105249_10669040 Ga0105249_106690402 281
1703 3300010159 Ga0099796_10009656 Ga0099796_100096562 281
1704 3300010375 Ga0105239_10003435 Ga0105239_1000343511 281
1705 3300010375 Ga0105239_10010870 Ga0105239_100108708 281
1706 3300010375 Ga0105239_10026603 Ga0105239_100266034 281
1707 3300010375 Ga0105239_10068280 Ga0105239_100682804 281
1708 3300010375 Ga0105239_10813706 Ga0105239_108137062 281
1709 3300011119 Ga0105246_10002163 Ga0105246_1000216311 281
1710 3300011119 Ga0105246_10064433 Ga0105246_100644333 281
1711 3300011119 Ga0105246_10124686 Ga0105246_101246861 281
1712 3300011119 Ga0105246_10164084 Ga0105246_101640842 281
1713 3300011119 Ga0105246_10199313 Ga0105246_101993131 281
1714 3300011119 Ga0105246_10205131 Ga0105246_102051312 281
1715 3300013100 Ga0157373_10000490 Ga0157373_1000049011 281
1716 3300013100 Ga0157373_10001424 Ga0157373_100014243 281
1717 3300013100 Ga0157373_10008814 Ga0157373_100088144 281
1718 3300013100 Ga0157373_10053985 Ga0157373_100539853 281
1719 3300013100 Ga0157373_10056319 Ga0157373_100563192 281
1720 3300013100 Ga0157373_10059145 Ga0157373_100591452 281
1721 3300013100 Ga0157373_10150348 Ga0157373_101503481 281
1722 3300013100 Ga0157373_10170199 Ga0157373_101701991 281
1723 3300013100 Ga0157373_10215459 Ga0157373_102154591 281
1724 3300013102 Ga0157371_10000068 Ga0157371_100000689 281
1725 3300013102 Ga0157371_10000102 Ga0157371_1000010293 281
1726 3300013102 Ga0157371_10001010 Ga0157371_1000101023 281
1727 3300013102 Ga0157371_10010537 Ga0157371_100105375 281
1728 3300013102 Ga0157371_10031184 Ga0157371_100311843 281
1729 3300013102 Ga0157371_10048834 Ga0157371_100488343 281
1730 3300013102 Ga0157371_10059427 Ga0157371_100594272 281
1731 3300013102 Ga0157371_10099905 Ga0157371_100999052 281
1732 3300013102 Ga0157371_10285380 Ga0157371_102853801 281
1733 3300013104 Ga0157370_10000560 Ga0157370_1000056010 281
1734 3300013104 Ga0157370_10000701 Ga0157370_1000070138 281
1735 3300013104 Ga0157370_10001168 Ga0157370_1000116822 281
1736 3300013104 Ga0157370_10001324 Ga0157370_1000132418 281
1737 3300013104 Ga0157370_10004462 Ga0157370_100044623 281
1738 3300013104 Ga0157370_10011489 Ga0157370_100114897 281
1739 3300013104 Ga0157370_10022659 Ga0157370_100226596 281
1740 3300013104 Ga0157370_10027854 Ga0157370_100278545 281
1741 3300013104 Ga0157370_10043338 Ga0157370_100433382 281
1742 3300013104 Ga0157370_10125915 Ga0157370_101259152 281
1743 3300013104 Ga0157370_10194698 Ga0157370_101946982 281
1744 3300013104 Ga0157370_10225281 Ga0157370_102252812 281
1745 3300013104 Ga0157370_10244071 Ga0157370_102440712 281
1746 3300013104 Ga0157370_10398261 Ga0157370_103982612 281
1747 3300013104 Ga0157370_10428258 Ga0157370_104282582 281
1748 3300013104 Ga0157370_10511344 Ga0157370_105113442 281
1749 3300013105 Ga0157369_10000147 Ga0157369_1000014728 281
1750 3300013105 Ga0157369_10001132 Ga0157369_1000113227 281
1751 3300013105 Ga0157369_10002069 Ga0157369_1000206917 281
1752 3300013105 Ga0157369_10002642 Ga0157369_100026429 281
1753 3300013105 Ga0157369_10007564 Ga0157369_100075647 281
1754 3300013105 Ga0157369_10011103 Ga0157369_100111037 281
1755 3300013105 Ga0157369_10015583 Ga0157369_100155833 281
1756 3300013105 Ga0157369_10026262 Ga0157369_100262625 281
1757 3300013105 Ga0157369_10028194 Ga0157369_100281943 281
1758 3300013105 Ga0157369_10045888 Ga0157369_100458884 281
1759 3300013105 Ga0157369_10149671 Ga0157369_101496713 281
1760 3300013105 Ga0157369_10165451 Ga0157369_101654511 281
1761 3300013105 Ga0157369_10306538 Ga0157369_103065382 281
1762 3300013105 Ga0157369_10359301 Ga0157369_103593011 281
1763 3300013105 Ga0157369_10375987 Ga0157369_103759872 281
1764 3300013105 Ga0157369_10428949 Ga0157369_104289492 281
1765 3300013296 Ga0157374_10000251 Ga0157374_1000025150 281
1766 3300013296 Ga0157374_10044634 Ga0157374_100446343 281
1767 3300013296 Ga0157374_10253522 Ga0157374_102535222 281
1768 3300013296 Ga0157374_10349615 Ga0157374_103496152 281
1769 3300013296 Ga0157374_10432812 Ga0157374_104328122 281
1770 3300013297 Ga0157378_10001998 Ga0157378_100019982 281
1771 3300013297 Ga0157378_10011642 Ga0157378_100116426 281
1772 3300013297 Ga0157378_10086000 Ga0157378_100860002 281
1773 3300013297 Ga0157378_10194133 Ga0157378_101941332 281
1774 3300013297 Ga0157378_10279997 Ga0157378_102799972 281
1775 3300013297 Ga0157378_10425305 Ga0157378_104253052 281
1776 3300013297 Ga0157378_10548138 Ga0157378_105481382 281
1777 3300013306 Ga0163162_10000314 Ga0163162_100003147 281
1778 3300013306 Ga0163162_10002127 Ga0163162_100021272 281
1779 3300013306 Ga0163162_10016393 Ga0163162_100163934 281
1780 3300013306 Ga0163162_10025748 Ga0163162_100257484 281
1781 3300013306 Ga0163162_10102853 Ga0163162_101028533 281
1782 3300013306 Ga0163162_10208711 Ga0163162_102087113 281
1783 3300013306 Ga0163162_10284251 Ga0163162_102842512 281
1784 3300013306 Ga0163162_10323844 Ga0163162_103238442 281
1785 3300013306 Ga0163162_10344959 Ga0163162_103449592 281
1786 3300013307 Ga0157372_10000177 Ga0157372_1000017724 281
1787 3300013307 Ga0157372_10001667 Ga0157372_1000166711 281
1788 3300013307 Ga0157372_10002048 Ga0157372_1000204810 281
1789 3300013307 Ga0157372_10005585 Ga0157372_100055859 281
1790 3300013307 Ga0157372_10012192 Ga0157372_100121929 281
1791 3300013307 Ga0157372_10014005 Ga0157372_100140057 281
1792 3300013307 Ga0157372_10040709 Ga0157372_100407093 281
1793 3300013307 Ga0157372_10052098 Ga0157372_100520982 281
1794 3300013307 Ga0157372_10052952 Ga0157372_100529525 281
1795 3300013307 Ga0157372_10117618 Ga0157372_101176183 281
1796 3300013307 Ga0157372_10138633 Ga0157372_101386333 281
1797 3300013307 Ga0157372_10143646 Ga0157372_101436463 281
1798 3300013307 Ga0157372_10169003 Ga0157372_101690032 281
1799 3300013307 Ga0157372_10202342 Ga0157372_102023422 281
1800 3300013307 Ga0157372_10211295 Ga0157372_102112951 281
1801 3300013307 Ga0157372_10223300 Ga0157372_102233002 281
1802 3300013307 Ga0157372_10243577 Ga0157372_102435772 281
1803 3300013307 Ga0157372_10378666 Ga0157372_103786662 281
1804 3300013307 Ga0157372_10450774 Ga0157372_104507742 281
1805 3300013307 Ga0157372_10466227 Ga0157372_104662272 281
1806 3300013307 Ga0157372_10608539 Ga0157372_106085391 281
1807 3300013307 Ga0157372_10620999 Ga0157372_106209992 281
1808 3300013307 Ga0157372_10795081 Ga0157372_107950811 281
1809 3300013308 Ga0157375_10070100 Ga0157375_100701004 281
1810 3300013308 Ga0157375_10070508 Ga0157375_100705083 281
1811 3300013308 Ga0157375_10121360 Ga0157375_101213601 281
1812 3300013308 Ga0157375_10516968 Ga0157375_105169681 281
1813 3300013308 Ga0157375_10677624 Ga0157375_106776241 281
1814 3300014325 Ga0163163_10357165 Ga0163163_103571651 281
1815 3300014326 Ga0157380_10022246 Ga0157380_100222464 281
1816 3300014326 Ga0157380_10082962 Ga0157380_100829623 281
1817 3300014326 Ga0157380_10099104 Ga0157380_100991042 281
1818 3300014326 Ga0157380_10239361 Ga0157380_102393612 281
1819 3300014497 Ga0182008_10002123 Ga0182008_100021233 281
1820 3300014497 Ga0182008_10004122 Ga0182008_100041225 281
1821 3300014497 Ga0182008_10007102 Ga0182008_100071025 281
1822 3300014497 Ga0182008_10010535 Ga0182008_100105354 281
1823 3300014497 Ga0182008_10025388 Ga0182008_100253882 281
1824 3300014497 Ga0182008_10135083 Ga0182008_101350831 281
1825 3300014497 Ga0182008_10151895 Ga0182008_101518952 281
1826 3300014968 Ga0157379_10000233 Ga0157379_1000023312 281
1827 3300014968 Ga0157379_10010467 Ga0157379_100104675 281
1828 3300014968 Ga0157379_10198973 Ga0157379_101989732 281
1829 3300014968 Ga0157379_10229856 Ga0157379_102298562 281
1830 3300014969 Ga0157376_10021873 Ga0157376_100218736 281
1831 3300014969 Ga0157376_10064678 Ga0157376_100646782 281
1832 3300014969 Ga0157376_10069377 Ga0157376_100693771 281
1833 3300014969 Ga0157376_10102194 Ga0157376_101021943 281
1834 3300015261 Ga0182006_1000009 Ga0182006_1000009107 281
1835 3300015261 Ga0182006_1002143 Ga0182006_10021438 281
1836 3300015261 Ga0182006_1029323 Ga0182006_10293232 281
1837 3300015261 Ga0182006_1030913 Ga0182006_10309131 281
1838 3300015261 Ga0182006_1057169 Ga0182006_10571692 281
1839 3300015262 Ga0182007_10000254 Ga0182007_1000025423 281
1840 3300015262 Ga0182007_10000642 Ga0182007_100006429 281
1841 3300015262 Ga0182007_10003593 Ga0182007_100035935 281
1842 3300015262 Ga0182007_10006892 Ga0182007_100068924 281
1843 3300015262 Ga0182007_10037664 Ga0182007_100376642 281
1844 3300015265 Ga0182005_1000317 Ga0182005_100031712 281
1845 3300015265 Ga0182005_1045813 Ga0182005_10458132 281
1846 3300015679 Ga0183366_1006 Ga0183366_100650 281
1847 3300015680 Ga0183370_1006 Ga0183370_100650 281
1848 3300015685 Ga0183369_1017 Ga0183369_101750 281
1849 3300015687 Ga0183368_1010 Ga0183368_101050 281
1850 3300016635 Ga0183361_10015 Ga0183361_10015155 281
1851 3300017792 Ga0163161_10000006 Ga0163161_1000000632 281
1852 3300017792 Ga0163161_10001265 Ga0163161_1000126518 281
1853 3300017792 Ga0163161_10025963 Ga0163161_100259634 281
1854 3300017792 Ga0163161_10027485 Ga0163161_100274854 281
1855 3300017792 Ga0163161_10043047 Ga0163161_100430473 281
1856 3300017792 Ga0163161_10078980 Ga0163161_100789803 281
1857 3300017792 Ga0163161_10151783 Ga0163161_101517832 281
1858 3300017792 Ga0163161_10300254 Ga0163161_103002542 281
1859 3300020610 Ga0154015_1105339 Ga0154015_11053392 281
1860 3300021361 Ga0213872_10003115 Ga0213872_100031155 281
1861 3300021361 Ga0213872_10015697 Ga0213872_100156973 281
1862 3300021361 Ga0213872_10040024 Ga0213872_100400243 281
1863 3300021384 Ga0213876_10000039 Ga0213876_1000003960 281
1864 3300021384 Ga0213876_10158566 Ga0213876_101585662 281
1865 3300022467 Ga0224712_10000002 Ga0224712_1000000249 281
1866 3300025206 Ga0209435_100002 Ga0209435_100002182 281
1867 3300025206 Ga0209435_100018 Ga0209435_10001892 281
1868 3300025207 Ga0209760_100066 Ga0209760_10006639 281
1869 3300025207 Ga0209760_100991 Ga0209760_1009912 281
1870 3300025208 Ga0209436_114206 Ga0209436_1142062 281
1871 3300025224 Ga0209784_100004 Ga0209784_100004235 281
1872 3300025224 Ga0209784_100009 Ga0209784_100009547 281
1873 3300025224 Ga0209784_100064 Ga0209784_10006440 281
1874 3300025225 Ga0209566_100004 Ga0209566_100004392 281
1875 3300025225 Ga0209566_100007 Ga0209566_100007547 281
1876 3300025225 Ga0209566_100079 Ga0209566_10007940 281
1877 3300025225 Ga0209566_100312 Ga0209566_1003128 281
1878 3300025226 Ga0209674_100006 Ga0209674_100006392 281
1879 3300025226 Ga0209674_100018 Ga0209674_100018547 281
1880 3300025226 Ga0209674_100159 Ga0209674_10015940 281
1881 3300025226 Ga0209674_100259 Ga0209674_10025925 281
1882 3300025226 Ga0209674_100260 Ga0209674_10026016 281
1883 3300025226 Ga0209674_103465 Ga0209674_1034652 281
1884 3300025228 Ga0209672_100052 Ga0209672_10005277 281
1885 3300025228 Ga0209672_100054 Ga0209672_100054194 281
1886 3300025228 Ga0209672_100072 Ga0209672_10007231 281
1887 3300025228 Ga0209672_100073 Ga0209672_10007325 281
1888 3300025228 Ga0209672_100214 Ga0209672_10021435 281
1889 3300025228 Ga0209672_101322 Ga0209672_1013223 281
1890 3300025228 Ga0209672_108144 Ga0209672_1081442 281
1891 3300025229 Ga0209147_100002 Ga0209147_1000021612 281
1892 3300025229 Ga0209147_100051 Ga0209147_10005192 281
1893 3300025229 Ga0209147_100093 Ga0209147_10009325 281
1894 3300025229 Ga0209147_100100 Ga0209147_10010023 281
1895 3300025229 Ga0209147_100328 Ga0209147_1003286 281
1896 3300025229 Ga0209147_100445 Ga0209147_1004456 281
1897 3300025230 Ga0209563_100009 Ga0209563_100009235 281
1898 3300025230 Ga0209563_100020 Ga0209563_100020547 281
1899 3300025230 Ga0209563_100135 Ga0209563_10013540 281
1900 3300025230 Ga0209563_100365 Ga0209563_10036510 281
1901 3300025231 Ga0207427_100136 Ga0207427_10013640 281
1902 3300025231 Ga0207427_100313 Ga0207427_10031311 281
1903 3300025231 Ga0207427_102368 Ga0207427_1023684 281
1904 3300025233 Ga0209437_100004 Ga0209437_100004235 281
1905 3300025233 Ga0209437_100136 Ga0209437_10013669 281
1906 3300025233 Ga0209437_100145 Ga0209437_10014512 281
1907 3300025233 Ga0209437_100149 Ga0209437_10014940 281
1908 3300025242 Ga0209258_100002 Ga0209258_1000021612 281
1909 3300025242 Ga0209258_100140 Ga0209258_10014025 281
1910 3300025242 Ga0209258_100154 Ga0209258_10015411 281
1911 3300025242 Ga0209258_100579 Ga0209258_10057924 281
1912 3300025242 Ga0209258_100581 Ga0209258_10058124 281
1913 3300025242 Ga0209258_100760 Ga0209258_10076011 281
1914 3300025245 Ga0207425_1001617 Ga0207425_10016175 281
1915 3300025245 Ga0207425_1002168 Ga0207425_10021683 281
1916 3300025245 Ga0207425_1002353 Ga0207425_10023531 281
1917 3300025246 Ga0209646_1000001 Ga0209646_10000012325 281
1918 3300025246 Ga0209646_1000081 Ga0209646_1000081180 281
1919 3300025246 Ga0209646_1000090 Ga0209646_100009011 281
1920 3300025250 Ga0209026_1000001 Ga0209026_1000001982 281
1921 3300025250 Ga0209026_1000042 Ga0209026_1000042154 281
1922 3300025253 Ga0209677_100005 Ga0209677_100005235 281
1923 3300025253 Ga0209677_100010 Ga0209677_100010547 281
1924 3300025253 Ga0209677_100110 Ga0209677_10011040 281
1925 3300025254 Ga0209148_1000119 Ga0209148_100011952 281
1926 3300025254 Ga0209148_1000140 Ga0209148_100014026 281
1927 3300025254 Ga0209148_1000145 Ga0209148_100014511 281
1928 3300025254 Ga0209148_1001374 Ga0209148_10013742 281
1929 3300025254 Ga0209148_1013067 Ga0209148_10130671 281
1930 3300025256 Ga0209759_1000001 Ga0209759_10000011956 281
1931 3300025256 Ga0209759_1000195 Ga0209759_100019535 281
1932 3300025256 Ga0209759_1000351 Ga0209759_100035128 281
1933 3300025256 Ga0209759_1000502 Ga0209759_100050225 281
1934 3300025256 Ga0209759_1005822 Ga0209759_10058224 281
1935 3300025256 Ga0209759_1015598 Ga0209759_10155982 281
1936 3300025258 Ga0209129_1000021 Ga0209129_1000021331 281
1937 3300025258 Ga0209129_1000054 Ga0209129_100005450 281
1938 3300025258 Ga0209129_1002334 Ga0209129_10023349 281
1939 3300025258 Ga0209129_1002683 Ga0209129_10026834 281
1940 3300025261 Ga0209233_1000005 Ga0209233_1000005392 281
1941 3300025261 Ga0209233_1000173 Ga0209233_100017325 281
1942 3300025261 Ga0209233_1000795 Ga0209233_10007958 281
1943 3300025261 Ga0209233_1020779 Ga0209233_10207791 281
1944 3300025263 Ga0209565_1000128 Ga0209565_1000128106 281
1945 3300025263 Ga0209565_1000648 Ga0209565_10006485 281
1946 3300025263 Ga0209565_1000708 Ga0209565_100070818 281
1947 3300025263 Ga0209565_1001327 Ga0209565_10013275 281
1948 3300025263 Ga0209565_1015194 Ga0209565_10151941 281
1949 3300025272 Ga0209455_1000021 Ga0209455_1000021199 281
1950 3300025272 Ga0209455_1000125 Ga0209455_100012526 281
1951 3300025272 Ga0209455_1000244 Ga0209455_100024452 281
1952 3300025272 Ga0209455_1001361 Ga0209455_10013617 281
1953 3300025272 Ga0209455_1003990 Ga0209455_10039901 281
1954 3300025273 Ga0209673_1000008 Ga0209673_1000008128 281
1955 3300025273 Ga0209673_1000098 Ga0209673_1000098150 281
1956 3300025273 Ga0209673_1000172 Ga0209673_100017256 281
1957 3300025273 Ga0209673_1001430 Ga0209673_100143018 281
1958 3300025284 Ga0209130_1000072 Ga0209130_100007289 281
1959 3300025284 Ga0209130_1000315 Ga0209130_100031547 281
1960 3300025284 Ga0209130_1000954 Ga0209130_10009545 281
1961 3300025284 Ga0209130_1001108 Ga0209130_10011083 281
1962 3300025284 Ga0209130_1008114 Ga0209130_10081142 281
1963 3300025291 Ga0209675_1000221 Ga0209675_100022118 281
1964 3300025291 Ga0209675_1000690 Ga0209675_10006905 281
1965 3300025291 Ga0209675_1003314 Ga0209675_10033144 281
1966 3300025291 Ga0209675_1007234 Ga0209675_10072345 281
1967 3300025291 Ga0209675_1009050 Ga0209675_10090505 281
1968 3300025291 Ga0209675_1017392 Ga0209675_10173922 281
1969 3300025292 Ga0209676_1000023 Ga0209676_1000023305 281
1970 3300025292 Ga0209676_1000048 Ga0209676_1000048382 281
1971 3300025292 Ga0209676_1000739 Ga0209676_100073942 281
1972 3300025292 Ga0209676_1001679 Ga0209676_100167911 281
1973 3300025292 Ga0209676_1015932 Ga0209676_10159322 281
1974 3300025294 Ga0209025_1000174 Ga0209025_1000174138 281
1975 3300025294 Ga0209025_1001733 Ga0209025_100173315 281
1976 3300025294 Ga0209025_1002139 Ga0209025_100213918 281
1977 3300025294 Ga0209025_1004985 Ga0209025_10049855 281
1978 3300025294 Ga0209025_1008849 Ga0209025_10088496 281
1979 3300025294 Ga0209025_1016447 Ga0209025_10164473 281
1980 3300025294 Ga0209025_1067115 Ga0209025_10671152 281
1981 3300025295 Ga0209564_1000241 Ga0209564_100024186 281
1982 3300025295 Ga0209564_1000435 Ga0209564_100043560 281
1983 3300025295 Ga0209564_1000998 Ga0209564_100099818 281
1984 3300025295 Ga0209564_1001515 Ga0209564_10015155 281
1985 3300025295 Ga0209564_1004319 Ga0209564_10043194 281
1986 3300025295 Ga0209564_1011596 Ga0209564_10115962 281
1987 3300025297 Ga0209758_1000034 Ga0209758_1000034388 281
1988 3300025297 Ga0209758_1002271 Ga0209758_100227115 281
1989 3300025297 Ga0209758_1004536 Ga0209758_10045365 281
1990 3300025298 Ga0209050_1000012 Ga0209050_1000012382 281
1991 3300025298 Ga0209050_1000022 Ga0209050_1000022287 281
1992 3300025298 Ga0209050_1000294 Ga0209050_100029490 281
1993 3300025298 Ga0209050_1001032 Ga0209050_100103252 281
1994 3300025298 Ga0209050_1002666 Ga0209050_100266613 281
1995 3300025298 Ga0209050_1002988 Ga0209050_10029884 281
1996 3300025298 Ga0209050_1019817 Ga0209050_10198173 281
1997 3300025299 Ga0209256_1000001 Ga0209256_10000011773 281
1998 3300025299 Ga0209256_1000103 Ga0209256_100010352 281
1999 3300025299 Ga0209256_1000120 Ga0209256_1000120115 281
2000 3300025299 Ga0209256_1000165 Ga0209256_1000165103 281
2001 3300025302 Ga0207426_1000058 Ga0207426_1000058180 281
2002 3300025302 Ga0207426_1000067 Ga0207426_1000067277 281
2003 3300025302 Ga0207426_1000199 Ga0207426_1000199129 281
2004 3300025302 Ga0207426_1000319 Ga0207426_100031983 281
2005 3300025302 Ga0207426_1002937 Ga0207426_10029375 281
2006 3300025302 Ga0207426_1004345 Ga0207426_10043453 281
2007 3300025303 Ga0209051_1000013 Ga0209051_1000013287 281
2008 3300025303 Ga0209051_1000018 Ga0209051_1000018497 281
2009 3300025303 Ga0209051_1000019 Ga0209051_1000019301 281
2010 3300025303 Ga0209051_1000235 Ga0209051_100023552 281
2011 3300025303 Ga0209051_1001398 Ga0209051_100139813 281
2012 3300025303 Ga0209051_1001560 Ga0209051_10015603 281
2013 3300025303 Ga0209051_1007671 Ga0209051_10076714 281
2014 3300025303 Ga0209051_1023326 Ga0209051_10233262 281
2015 3300025304 Ga0209257_1000024 Ga0209257_1000024328 281
2016 3300025304 Ga0209257_1000042 Ga0209257_1000042199 281
2017 3300025304 Ga0209257_1000057 Ga0209257_1000057240 281
2018 3300025304 Ga0209257_1000260 Ga0209257_100026048 281
2019 3300025315 Ga0207697_10000068 Ga0207697_1000006823 281
2020 3300025315 Ga0207697_10047106 Ga0207697_100471062 281
2021 3300025321 Ga0207656_10010098 Ga0207656_100100982 281
2022 3300025321 Ga0207656_10015328 Ga0207656_100153281 281
2023 3300025321 Ga0207656_10035950 Ga0207656_100359502 281
2024 3300025321 Ga0207656_10074587 Ga0207656_100745872 281
2025 3300025711 Ga0207696_1000040 Ga0207696_100004089 281
2026 3300025711 Ga0207696_1000046 Ga0207696_100004632 281
2027 3300025711 Ga0207696_1000146 Ga0207696_100014683 281
2028 3300025711 Ga0207696_1000332 Ga0207696_100033230 281
2029 3300025711 Ga0207696_1000337 Ga0207696_100033715 281
2030 3300025711 Ga0207696_1000421 Ga0207696_100042121 281
2031 3300025711 Ga0207696_1000770 Ga0207696_100077016 281
2032 3300025711 Ga0207696_1001424 Ga0207696_10014243 281
2033 3300025711 Ga0207696_1003996 Ga0207696_10039965 281
2034 3300025711 Ga0207696_1006611 Ga0207696_10066112 281
2035 3300025711 Ga0207696_1007301 Ga0207696_10073013 281
2036 3300025728 Ga0207655_1000043 Ga0207655_1000043267 281
2037 3300025728 Ga0207655_1000053 Ga0207655_100005398 281
2038 3300025728 Ga0207655_1000082 Ga0207655_100008297 281
2039 3300025728 Ga0207655_1000170 Ga0207655_100017034 281
2040 3300025728 Ga0207655_1000208 Ga0207655_100020831 281
2041 3300025728 Ga0207655_1000264 Ga0207655_100026428 281
2042 3300025728 Ga0207655_1000284 Ga0207655_100028435 281
2043 3300025728 Ga0207655_1000639 Ga0207655_100063936 281
2044 3300025728 Ga0207655_1000983 Ga0207655_100098313 281
2045 3300025728 Ga0207655_1002221 Ga0207655_10022212 281
2046 3300025728 Ga0207655_1003904 Ga0207655_10039046 281
2047 3300025728 Ga0207655_1006400 Ga0207655_10064008 281
2048 3300025728 Ga0207655_1007855 Ga0207655_10078556 281
2049 3300025728 Ga0207655_1011962 Ga0207655_10119622 281
2050 3300025728 Ga0207655_1015084 Ga0207655_10150845 281
2051 3300025728 Ga0207655_1028620 Ga0207655_10286202 281
2052 3300025728 Ga0207655_1039524 Ga0207655_10395242 281
2053 3300025728 Ga0207655_1061204 Ga0207655_10612041 281
2054 3300025735 Ga0207713_1000017 Ga0207713_100001787 281
2055 3300025735 Ga0207713_1000043 Ga0207713_1000043108 281
2056 3300025735 Ga0207713_1000053 Ga0207713_1000053151 281
2057 3300025735 Ga0207713_1000056 Ga0207713_100005632 281
2058 3300025735 Ga0207713_1000066 Ga0207713_100006681 281
2059 3300025735 Ga0207713_1000075 Ga0207713_1000075163 281
2060 3300025735 Ga0207713_1000186 Ga0207713_100018669 281
2061 3300025735 Ga0207713_1001564 Ga0207713_10015646 281
2062 3300025735 Ga0207713_1001691 Ga0207713_100169112 281
2063 3300025735 Ga0207713_1001781 Ga0207713_10017816 281
2064 3300025735 Ga0207713_1010744 Ga0207713_10107445 281
2065 3300025735 Ga0207713_1014242 Ga0207713_10142422 281
2066 3300025735 Ga0207713_1018073 Ga0207713_10180732 281
2067 3300025735 Ga0207713_1067091 Ga0207713_10670912 281
2068 3300025885 Ga0207653_10046050 Ga0207653_100460502 281
2069 3300025893 Ga0207682_10064973 Ga0207682_100649732 281
2070 3300025893 Ga0207682_10082931 Ga0207682_100829312 281
2071 3300025898 Ga0207692_10049694 Ga0207692_100496942 281
2072 3300025899 Ga0207642_10001712 Ga0207642_100017126 281
2073 3300025899 Ga0207642_10031527 Ga0207642_100315272 281
2074 3300025900 Ga0207710_10000024 Ga0207710_10000024261 281
2075 3300025901 Ga0207688_10073741 Ga0207688_100737412 281
2076 3300025901 Ga0207688_10147867 Ga0207688_101478672 281
2077 3300025903 Ga0207680_10016087 Ga0207680_100160873 281
2078 3300025903 Ga0207680_10021057 Ga0207680_100210572 281
2079 3300025903 Ga0207680_10095828 Ga0207680_100958281 281
2080 3300025903 Ga0207680_10181167 Ga0207680_101811672 281
2081 3300025904 Ga0207647_10000362 Ga0207647_100003627 281
2082 3300025904 Ga0207647_10003669 Ga0207647_100036696 281
2083 3300025904 Ga0207647_10005407 Ga0207647_100054079 281
2084 3300025904 Ga0207647_10037683 Ga0207647_100376832 281
2085 3300025904 Ga0207647_10039837 Ga0207647_100398374 281
2086 3300025904 Ga0207647_10053022 Ga0207647_100530222 281
2087 3300025905 Ga0207685_10050017 Ga0207685_100500172 281
2088 3300025906 Ga0207699_10198720 Ga0207699_101987202 281
2089 3300025907 Ga0207645_10004546 Ga0207645_100045466 281
2090 3300025907 Ga0207645_10008560 Ga0207645_100085602 281
2091 3300025907 Ga0207645_10038094 Ga0207645_100380943 281
2092 3300025907 Ga0207645_10151780 Ga0207645_101517802 281
2093 3300025908 Ga0207643_10010998 Ga0207643_100109983 281
2094 3300025908 Ga0207643_10047211 Ga0207643_100472112 281
2095 3300025908 Ga0207643_10055518 Ga0207643_100555182 281
2096 3300025908 Ga0207643_10171330 Ga0207643_101713301 281
2097 3300025908 Ga0207643_10187533 Ga0207643_101875332 281
2098 3300025909 Ga0207705_10002185 Ga0207705_100021857 281
2099 3300025909 Ga0207705_10101380 Ga0207705_101013801 281
2100 3300025910 Ga0207684_10009875 Ga0207684_100098755 281
2101 3300025910 Ga0207684_10150364 Ga0207684_101503641 281
2102 3300025911 Ga0207654_10000010 Ga0207654_10000010249 281
2103 3300025911 Ga0207654_10008657 Ga0207654_100086572 281
2104 3300025911 Ga0207654_10018548 Ga0207654_100185483 281
2105 3300025911 Ga0207654_10132411 Ga0207654_101324112 281
2106 3300025911 Ga0207654_10411268 Ga0207654_104112681 281
2107 3300025912 Ga0207707_10010626 Ga0207707_100106268 281
2108 3300025912 Ga0207707_10037447 Ga0207707_100374473 281
2109 3300025912 Ga0207707_10040244 Ga0207707_100402442 281
2110 3300025912 Ga0207707_10066443 Ga0207707_100664433 281
2111 3300025912 Ga0207707_10102072 Ga0207707_101020721 281
2112 3300025912 Ga0207707_10154925 Ga0207707_101549252 281
2113 3300025912 Ga0207707_10184091 Ga0207707_101840912 281
2114 3300025913 Ga0207695_10000829 Ga0207695_1000082938 281
2115 3300025913 Ga0207695_10003954 Ga0207695_1000395419 281
2116 3300025913 Ga0207695_10005351 Ga0207695_100053513 281
2117 3300025913 Ga0207695_10018245 Ga0207695_100182453 281
2118 3300025913 Ga0207695_10018937 Ga0207695_100189371 281
2119 3300025913 Ga0207695_10022639 Ga0207695_100226396 281
2120 3300025913 Ga0207695_10024387 Ga0207695_100243871 281
2121 3300025913 Ga0207695_10042207 Ga0207695_100422073 281
2122 3300025913 Ga0207695_10058197 Ga0207695_100581974 281
2123 3300025913 Ga0207695_10064800 Ga0207695_100648002 281
2124 3300025913 Ga0207695_10128872 Ga0207695_101288722 281
2125 3300025913 Ga0207695_10209693 Ga0207695_102096932 281
2126 3300025913 Ga0207695_10279688 Ga0207695_102796882 281
2127 3300025913 Ga0207695_10335441 Ga0207695_103354411 281
2128 3300025913 Ga0207695_10424282 Ga0207695_104242822 281
2129 3300025913 Ga0207695_10425441 Ga0207695_104254412 281
2130 3300025913 Ga0207695_10608726 Ga0207695_106087262 281
2131 3300025914 Ga0207671_10017988 Ga0207671_100179885 281
2132 3300025914 Ga0207671_10025053 Ga0207671_100250533 281
2133 3300025914 Ga0207671_10081245 Ga0207671_100812452 281
2134 3300025914 Ga0207671_10128642 Ga0207671_101286422 281
2135 3300025914 Ga0207671_10281137 Ga0207671_102811372 281
2136 3300025915 Ga0207693_10004206 Ga0207693_100042061 281
2137 3300025915 Ga0207693_10324698 Ga0207693_103246982 281
2138 3300025917 Ga0207660_10027612 Ga0207660_100276123 281
2139 3300025917 Ga0207660_10035168 Ga0207660_100351682 281
2140 3300025917 Ga0207660_10048380 Ga0207660_100483802 281
2141 3300025917 Ga0207660_10068787 Ga0207660_100687872 281
2142 3300025917 Ga0207660_10083058 Ga0207660_100830582 281
2143 3300025917 Ga0207660_10203557 Ga0207660_102035572 281
2144 3300025917 Ga0207660_10384032 Ga0207660_103840321 281
2145 3300025919 Ga0207657_10000065 Ga0207657_1000006562 281
2146 3300025919 Ga0207657_10000447 Ga0207657_100004472 281
2147 3300025919 Ga0207657_10002517 Ga0207657_1000251711 281
2148 3300025919 Ga0207657_10003605 Ga0207657_100036054 281
2149 3300025919 Ga0207657_10027949 Ga0207657_100279494 281
2150 3300025919 Ga0207657_10050415 Ga0207657_100504153 281
2151 3300025919 Ga0207657_10141031 Ga0207657_101410312 281
2152 3300025919 Ga0207657_10141240 Ga0207657_101412402 281
2153 3300025919 Ga0207657_10236962 Ga0207657_102369622 281
2154 3300025920 Ga0207649_10000533 Ga0207649_1000053315 281
2155 3300025920 Ga0207649_10046419 Ga0207649_100464192 281
2156 3300025920 Ga0207649_10071283 Ga0207649_100712832 281
2157 3300025920 Ga0207649_10303028 Ga0207649_103030281 281
2158 3300025920 Ga0207649_10321392 Ga0207649_103213921 281
2159 3300025920 Ga0207649_10365420 Ga0207649_103654201 281
2160 3300025921 Ga0207652_10051932 Ga0207652_100519323 281
2161 3300025921 Ga0207652_10101010 Ga0207652_101010103 281
2162 3300025921 Ga0207652_10173333 Ga0207652_101733332 281
2163 3300025921 Ga0207652_10268108 Ga0207652_102681082 281
2164 3300025922 Ga0207646_10002045 Ga0207646_1000204518 281
2165 3300025923 Ga0207681_10002690 Ga0207681_1000269010 281
2166 3300025923 Ga0207681_10063309 Ga0207681_100633092 281
2167 3300025923 Ga0207681_10080586 Ga0207681_100805863 281
2168 3300025923 Ga0207681_10115120 Ga0207681_101151203 281
2169 3300025923 Ga0207681_10251513 Ga0207681_102515132 281
2170 3300025924 Ga0207694_10000110 Ga0207694_1000011032 281
2171 3300025924 Ga0207694_10008526 Ga0207694_100085262 281
2172 3300025924 Ga0207694_10017482 Ga0207694_100174825 281
2173 3300025924 Ga0207694_10027009 Ga0207694_100270092 281
2174 3300025924 Ga0207694_10047487 Ga0207694_100474872 281
2175 3300025924 Ga0207694_10047702 Ga0207694_100477022 281
2176 3300025924 Ga0207694_10060523 Ga0207694_100605232 281
2177 3300025924 Ga0207694_10111212 Ga0207694_101112121 281
2178 3300025924 Ga0207694_10209521 Ga0207694_102095212 281
2179 3300025924 Ga0207694_10392635 Ga0207694_103926352 281
2180 3300025925 Ga0207650_10008850 Ga0207650_100088504 281
2181 3300025925 Ga0207650_10023136 Ga0207650_100231362 281
2182 3300025925 Ga0207650_10056121 Ga0207650_100561213 281
2183 3300025925 Ga0207650_10107878 Ga0207650_101078782 281
2184 3300025925 Ga0207650_10195879 Ga0207650_101958792 281
2185 3300025925 Ga0207650_10199039 Ga0207650_101990392 281
2186 3300025926 Ga0207659_10049410 Ga0207659_100494103 281
2187 3300025926 Ga0207659_10085813 Ga0207659_100858133 281
2188 3300025926 Ga0207659_10108459 Ga0207659_101084592 281
2189 3300025926 Ga0207659_10112608 Ga0207659_101126082 281
2190 3300025926 Ga0207659_10124566 Ga0207659_101245663 281
2191 3300025926 Ga0207659_10175191 Ga0207659_101751912 281
2192 3300025926 Ga0207659_10236473 Ga0207659_102364731 281
2193 3300025926 Ga0207659_10264301 Ga0207659_102643012 281
2194 3300025927 Ga0207687_10022655 Ga0207687_100226552 281
2195 3300025928 Ga0207700_10000051 Ga0207700_1000005150 281
2196 3300025928 Ga0207700_10091325 Ga0207700_100913253 281
2197 3300025928 Ga0207700_10552616 Ga0207700_105526162 281
2198 3300025929 Ga0207664_10011717 Ga0207664_100117174 281
2199 3300025929 Ga0207664_10068838 Ga0207664_100688383 281
2200 3300025929 Ga0207664_10107976 Ga0207664_101079761 281
2201 3300025929 Ga0207664_10471265 Ga0207664_104712651 281
2202 3300025931 Ga0207644_10002085 Ga0207644_100020855 281
2203 3300025931 Ga0207644_10322174 Ga0207644_103221742 281
2204 3300025932 Ga0207690_10000040 Ga0207690_1000004062 281
2205 3300025932 Ga0207690_10003996 Ga0207690_100039965 281
2206 3300025932 Ga0207690_10005258 Ga0207690_100052583 281
2207 3300025932 Ga0207690_10017612 Ga0207690_100176122 281
2208 3300025932 Ga0207690_10039425 Ga0207690_100394253 281
2209 3300025932 Ga0207690_10060359 Ga0207690_100603593 281
2210 3300025932 Ga0207690_10381365 Ga0207690_103813651 281
2211 3300025932 Ga0207690_10401573 Ga0207690_104015731 281
2212 3300025933 Ga0207706_10000156 Ga0207706_1000015643 281
2213 3300025933 Ga0207706_10025996 Ga0207706_100259964 281
2214 3300025933 Ga0207706_10071355 Ga0207706_100713553 281
2215 3300025933 Ga0207706_10134435 Ga0207706_101344353 281
2216 3300025933 Ga0207706_10320074 Ga0207706_103200742 281
2217 3300025934 Ga0207686_10003601 Ga0207686_100036013 281
2218 3300025934 Ga0207686_10010431 Ga0207686_100104314 281
2219 3300025934 Ga0207686_10022846 Ga0207686_100228463 281
2220 3300025934 Ga0207686_10145150 Ga0207686_101451502 281
2221 3300025934 Ga0207686_10177232 Ga0207686_101772322 281
2222 3300025934 Ga0207686_10184894 Ga0207686_101848942 281
2223 3300025935 Ga0207709_10000874 Ga0207709_1000087421 281
2224 3300025935 Ga0207709_10001012 Ga0207709_1000101213 281
2225 3300025935 Ga0207709_10001229 Ga0207709_100012298 281
2226 3300025935 Ga0207709_10010266 Ga0207709_100102664 281
2227 3300025935 Ga0207709_10088184 Ga0207709_100881841 281
2228 3300025935 Ga0207709_10215570 Ga0207709_102155702 281
2229 3300025936 Ga0207670_10002522 Ga0207670_100025226 281
2230 3300025936 Ga0207670_10076849 Ga0207670_100768492 281
2231 3300025936 Ga0207670_10109912 Ga0207670_101099122 281
2232 3300025936 Ga0207670_10121279 Ga0207670_101212792 281
2233 3300025937 Ga0207669_10018077 Ga0207669_100180773 281
2234 3300025937 Ga0207669_10042824 Ga0207669_100428241 281
2235 3300025937 Ga0207669_10051528 Ga0207669_100515282 281
2236 3300025937 Ga0207669_10070962 Ga0207669_100709622 281
2237 3300025937 Ga0207669_10187967 Ga0207669_101879672 281
2238 3300025937 Ga0207669_10226807 Ga0207669_102268072 281
2239 3300025938 Ga0207704_10003083 Ga0207704_100030834 281
2240 3300025938 Ga0207704_10005236 Ga0207704_100052363 281
2241 3300025938 Ga0207704_10178097 Ga0207704_101780972 281
2242 3300025938 Ga0207704_10197359 Ga0207704_101973592 281
2243 3300025938 Ga0207704_10215043 Ga0207704_102150432 281
2244 3300025939 Ga0207665_10002266 Ga0207665_100022667 281
2245 3300025939 Ga0207665_10205111 Ga0207665_102051112 281
2246 3300025939 Ga0207665_10241734 Ga0207665_102417341 281
2247 3300025939 Ga0207665_10247843 Ga0207665_102478432 281
2248 3300025940 Ga0207691_10000331 Ga0207691_1000033140 281
2249 3300025940 Ga0207691_10022541 Ga0207691_100225413 281
2250 3300025940 Ga0207691_10025670 Ga0207691_100256704 281
2251 3300025940 Ga0207691_10030697 Ga0207691_100306974 281
2252 3300025940 Ga0207691_10058915 Ga0207691_100589153 281
2253 3300025940 Ga0207691_10061770 Ga0207691_100617703 281
2254 3300025940 Ga0207691_10122125 Ga0207691_101221252 281
2255 3300025941 Ga0207711_10010140 Ga0207711_100101404 281
2256 3300025941 Ga0207711_10017638 Ga0207711_100176384 281
2257 3300025941 Ga0207711_10020362 Ga0207711_100203625 281
2258 3300025941 Ga0207711_10021326 Ga0207711_100213263 281
2259 3300025941 Ga0207711_10342235 Ga0207711_103422351 281
2260 3300025942 Ga0207689_10000234 Ga0207689_1000023413 281
2261 3300025942 Ga0207689_10000310 Ga0207689_1000031036 281
2262 3300025942 Ga0207689_10028706 Ga0207689_100287064 281
2263 3300025942 Ga0207689_10052850 Ga0207689_100528503 281
2264 3300025942 Ga0207689_10073052 Ga0207689_100730522 281
2265 3300025942 Ga0207689_10116488 Ga0207689_101164882 281
2266 3300025942 Ga0207689_10172399 Ga0207689_101723992 281
2267 3300025942 Ga0207689_10220202 Ga0207689_102202022 281
2268 3300025942 Ga0207689_10226968 Ga0207689_102269682 281
2269 3300025944 Ga0207661_10034359 Ga0207661_100343593 281
2270 3300025944 Ga0207661_10042276 Ga0207661_100422764 281
2271 3300025944 Ga0207661_10135481 Ga0207661_101354812 281
2272 3300025944 Ga0207661_10146730 Ga0207661_101467302 281
2273 3300025944 Ga0207661_10160532 Ga0207661_101605322 281
2274 3300025945 Ga0207679_10000001 Ga0207679_10000001205 281
2275 3300025945 Ga0207679_10005981 Ga0207679_100059812 281
2276 3300025945 Ga0207679_10013209 Ga0207679_100132094 281
2277 3300025945 Ga0207679_10015853 Ga0207679_100158534 281
2278 3300025945 Ga0207679_10078295 Ga0207679_100782952 281
2279 3300025945 Ga0207679_10152325 Ga0207679_101523252 281
2280 3300025945 Ga0207679_10163714 Ga0207679_101637142 281
2281 3300025949 Ga0207667_10000120 Ga0207667_1000012016 281
2282 3300025949 Ga0207667_10005056 Ga0207667_100050562 281
2283 3300025949 Ga0207667_10010777 Ga0207667_100107775 281
2284 3300025949 Ga0207667_10010866 Ga0207667_1001086610 281
2285 3300025949 Ga0207667_10019277 Ga0207667_100192774 281
2286 3300025949 Ga0207667_10023646 Ga0207667_100236466 281
2287 3300025949 Ga0207667_10033168 Ga0207667_100331682 281
2288 3300025949 Ga0207667_10055276 Ga0207667_100552763 281
2289 3300025949 Ga0207667_10061320 Ga0207667_100613201 281
2290 3300025949 Ga0207667_10145462 Ga0207667_101454622 281
2291 3300025949 Ga0207667_10169609 Ga0207667_101696092 281
2292 3300025949 Ga0207667_10253478 Ga0207667_102534784 281
2293 3300025949 Ga0207667_10289134 Ga0207667_102891342 281
2294 3300025949 Ga0207667_10386603 Ga0207667_103866032 281
2295 3300025949 Ga0207667_10396454 Ga0207667_103964542 281
2296 3300025949 Ga0207667_10739097 Ga0207667_107390971 281
2297 3300025960 Ga0207651_10001420 Ga0207651_100014207 281
2298 3300025960 Ga0207651_10062370 Ga0207651_100623703 281
2299 3300025960 Ga0207651_10247489 Ga0207651_102474892 281
2300 3300025961 Ga0207712_10005420 Ga0207712_100054203 281
2301 3300025961 Ga0207712_10094428 Ga0207712_100944282 281
2302 3300025961 Ga0207712_10123979 Ga0207712_101239792 281
2303 3300025972 Ga0207668_10024667 Ga0207668_100246673 281
2304 3300025972 Ga0207668_10054195 Ga0207668_100541952 281
2305 3300025972 Ga0207668_10110482 Ga0207668_101104821 281
2306 3300025972 Ga0207668_10383079 Ga0207668_103830792 281
2307 3300025972 Ga0207668_10385214 Ga0207668_103852141 281
2308 3300025981 Ga0207640_10000098 Ga0207640_1000009854 281
2309 3300025981 Ga0207640_10013700 Ga0207640_100137003 281
2310 3300025981 Ga0207640_10017314 Ga0207640_100173144 281
2311 3300025981 Ga0207640_10022720 Ga0207640_100227202 281
2312 3300025981 Ga0207640_10057789 Ga0207640_100577892 281
2313 3300025981 Ga0207640_10455698 Ga0207640_104556981 281
2314 3300025986 Ga0207658_10000650 Ga0207658_100006504 281
2315 3300025986 Ga0207658_10159130 Ga0207658_101591302 281
2316 3300025986 Ga0207658_10442428 Ga0207658_104424282 281
2317 3300025986 Ga0207658_10477674 Ga0207658_104776741 281
2318 3300026023 Ga0207677_10007151 Ga0207677_100071514 281
2319 3300026023 Ga0207677_10008746 Ga0207677_100087464 281
2320 3300026023 Ga0207677_10018191 Ga0207677_100181912 281
2321 3300026023 Ga0207677_10023319 Ga0207677_100233194 281
2322 3300026023 Ga0207677_10076044 Ga0207677_100760443 281
2323 3300026023 Ga0207677_10092656 Ga0207677_100926562 281
2324 3300026035 Ga0207703_10000443 Ga0207703_1000044324 281
2325 3300026035 Ga0207703_10003876 Ga0207703_1000387611 281
2326 3300026035 Ga0207703_10009968 Ga0207703_100099684 281
2327 3300026035 Ga0207703_10016647 Ga0207703_100166474 281
2328 3300026035 Ga0207703_10050674 Ga0207703_100506741 281
2329 3300026035 Ga0207703_10096551 Ga0207703_100965513 281
2330 3300026035 Ga0207703_10154787 Ga0207703_101547872 281
2331 3300026035 Ga0207703_10166087 Ga0207703_101660872 281
2332 3300026041 Ga0207639_10015329 Ga0207639_100153294 281
2333 3300026041 Ga0207639_10109932 Ga0207639_101099322 281
2334 3300026041 Ga0207639_10128044 Ga0207639_101280442 281
2335 3300026041 Ga0207639_10260286 Ga0207639_102602862 281
2336 3300026067 Ga0207678_10000001 Ga0207678_10000001228 281
2337 3300026067 Ga0207678_10001984 Ga0207678_1000198411 281
2338 3300026067 Ga0207678_10002621 Ga0207678_100026214 281
2339 3300026067 Ga0207678_10009704 Ga0207678_100097043 281
2340 3300026067 Ga0207678_10045821 Ga0207678_100458214 281
2341 3300026067 Ga0207678_10104759 Ga0207678_101047592 281
2342 3300026067 Ga0207678_10109691 Ga0207678_101096911 281
2343 3300026067 Ga0207678_10322585 Ga0207678_103225852 281
2344 3300026067 Ga0207678_10348267 Ga0207678_103482672 281
2345 3300026075 Ga0207708_10001026 Ga0207708_100010269 281
2346 3300026075 Ga0207708_10006748 Ga0207708_100067484 281
2347 3300026075 Ga0207708_10018391 Ga0207708_100183913 281
2348 3300026075 Ga0207708_10021822 Ga0207708_100218223 281
2349 3300026075 Ga0207708_10058663 Ga0207708_100586633 281
2350 3300026075 Ga0207708_10065650 Ga0207708_100656503 281
2351 3300026078 Ga0207702_10000301 Ga0207702_1000030151 281
2352 3300026078 Ga0207702_10002083 Ga0207702_100020835 281
2353 3300026078 Ga0207702_10003982 Ga0207702_1000398211 281
2354 3300026078 Ga0207702_10081372 Ga0207702_100813722 281
2355 3300026078 Ga0207702_10098153 Ga0207702_100981532 281
2356 3300026078 Ga0207702_10134222 Ga0207702_101342222 281
2357 3300026078 Ga0207702_10331351 Ga0207702_103313511 281
2358 3300026078 Ga0207702_10406738 Ga0207702_104067381 281
2359 3300026078 Ga0207702_10545170 Ga0207702_105451702 281
2360 3300026088 Ga0207641_10004409 Ga0207641_100044095 281
2361 3300026088 Ga0207641_10011393 Ga0207641_100113932 281
2362 3300026088 Ga0207641_10081148 Ga0207641_100811482 281
2363 3300026088 Ga0207641_10117072 Ga0207641_101170722 281
2364 3300026089 Ga0207648_10000055 Ga0207648_1000005512 281
2365 3300026089 Ga0207648_10000179 Ga0207648_1000017928 281
2366 3300026089 Ga0207648_10000512 Ga0207648_100005121 281
2367 3300026089 Ga0207648_10001876 Ga0207648_1000187611 281
2368 3300026089 Ga0207648_10003029 Ga0207648_100030294 281
2369 3300026089 Ga0207648_10012861 Ga0207648_100128612 281
2370 3300026089 Ga0207648_10099833 Ga0207648_100998332 281
2371 3300026089 Ga0207648_10168332 Ga0207648_101683322 281
2372 3300026089 Ga0207648_10169096 Ga0207648_101690962 281
2373 3300026089 Ga0207648_10478617 Ga0207648_104786172 281
2374 3300026095 Ga0207676_10000995 Ga0207676_1000099512 281
2375 3300026095 Ga0207676_10039700 Ga0207676_100397002 281
2376 3300026095 Ga0207676_10155340 Ga0207676_101553402 281
2377 3300026095 Ga0207676_10292263 Ga0207676_102922632 281
2378 3300026116 Ga0207674_10000179 Ga0207674_1000017948 281
2379 3300026116 Ga0207674_10000418 Ga0207674_1000041833 281
2380 3300026116 Ga0207674_10003078 Ga0207674_1000307817 281
2381 3300026116 Ga0207674_10006035 Ga0207674_100060357 281
2382 3300026116 Ga0207674_10013444 Ga0207674_100134443 281
2383 3300026116 Ga0207674_10016416 Ga0207674_100164164 281
2384 3300026116 Ga0207674_10017229 Ga0207674_100172298 281
2385 3300026116 Ga0207674_10092849 Ga0207674_100928492 281
2386 3300026116 Ga0207674_10106537 Ga0207674_101065373 281
2387 3300026116 Ga0207674_10159374 Ga0207674_101593742 281
2388 3300026116 Ga0207674_10184871 Ga0207674_101848712 281
2389 3300026116 Ga0207674_10238057 Ga0207674_102380572 281
2390 3300026116 Ga0207674_10313173 Ga0207674_103131732 281
2391 3300026116 Ga0207674_10438382 Ga0207674_104383822 281
2392 3300026118 Ga0207675_100000704 Ga0207675_1000007042 281
2393 3300026118 Ga0207675_100000726 Ga0207675_1000007263 281
2394 3300026118 Ga0207675_100001602 Ga0207675_1000016029 281
2395 3300026118 Ga0207675_100001605 Ga0207675_1000016059 281
2396 3300026118 Ga0207675_100001640 Ga0207675_10000164016 281
2397 3300026118 Ga0207675_100025019 Ga0207675_1000250193 281
2398 3300026118 Ga0207675_100055456 Ga0207675_1000554562 281
2399 3300026118 Ga0207675_100067169 Ga0207675_1000671693 281
2400 3300026118 Ga0207675_100139402 Ga0207675_1001394023 281
2401 3300026121 Ga0207683_10000276 Ga0207683_100002763 281
2402 3300026121 Ga0207683_10012074 Ga0207683_100120744 281
2403 3300026121 Ga0207683_10183878 Ga0207683_101838782 281
2404 3300026121 Ga0207683_10185522 Ga0207683_101855222 281
2405 3300026121 Ga0207683_10186640 Ga0207683_101866402 281
2406 3300026121 Ga0207683_10314328 Ga0207683_103143282 281
2407 3300026121 Ga0207683_10489314 Ga0207683_104893142 281
2408 3300026121 Ga0207683_10494707 Ga0207683_104947071 281
2409 3300026142 Ga0207698_10001892 Ga0207698_100018924 281
2410 3300026142 Ga0207698_10012303 Ga0207698_100123033 281
2411 3300026142 Ga0207698_10056147 Ga0207698_100561471 281
2412 3300026142 Ga0207698_10069857 Ga0207698_100698572 281
2413 3300026142 Ga0207698_10070407 Ga0207698_100704072 281
2414 3300026142 Ga0207698_10085968 Ga0207698_100859682 281
2415 3300026142 Ga0207698_10098407 Ga0207698_100984072 281
2416 3300026142 Ga0207698_10314781 Ga0207698_103147812 281
2417 3300027111 Ga0209281_1000031 Ga0209281_1000031314 281
2418 3300027111 Ga0209281_1000065 Ga0209281_1000065157 281
2419 3300027111 Ga0209281_1000112 Ga0209281_100011297 281
2420 3300027111 Ga0209281_1000139 Ga0209281_1000139135 281
2421 3300027111 Ga0209281_1000162 Ga0209281_100016252 281
2422 3300027111 Ga0209281_1000455 Ga0209281_100045527 281
2423 3300027111 Ga0209281_1000606 Ga0209281_10006064 281
2424 3300027111 Ga0209281_1000649 Ga0209281_10006493 281
2425 3300027111 Ga0209281_1001020 Ga0209281_10010203 281
2426 3300027111 Ga0209281_1001477 Ga0209281_10014772 281
2427 3300027111 Ga0209281_1002258 Ga0209281_10022583 281
2428 3300027252 Ga0209973_1003493 Ga0209973_10034932 281
2429 3300027312 Ga0209371_1000027 Ga0209371_100002785 281
2430 3300027312 Ga0209371_1000029 Ga0209371_1000029307 281
2431 3300027312 Ga0209371_1000082 Ga0209371_1000082116 281
2432 3300027312 Ga0209371_1000115 Ga0209371_100011551 281
2433 3300027312 Ga0209371_1000344 Ga0209371_100034433 281
2434 3300027312 Ga0209371_1000478 Ga0209371_100047823 281
2435 3300027312 Ga0209371_1000575 Ga0209371_100057515 281
2436 3300027312 Ga0209371_1001324 Ga0209371_10013248 281
2437 3300027312 Ga0209371_1001508 Ga0209371_100150812 281
2438 3300027312 Ga0209371_1001755 Ga0209371_100175516 281
2439 3300027312 Ga0209371_1003264 Ga0209371_10032643 281
2440 3300027312 Ga0209371_1008347 Ga0209371_10083474 281
2441 3300027312 Ga0209371_1016349 Ga0209371_10163492 281
2442 3300027312 Ga0209371_1016682 Ga0209371_10166822 281
2443 3300027360 Ga0209969_1007422 Ga0209969_10074222 281
2444 3300027364 Ga0209967_1003182 Ga0209967_10031822 281
2445 3300027364 Ga0209967_1003772 Ga0209967_10037722 281
2446 3300027395 Ga0209996_1012693 Ga0209996_10126932 281
2447 3300027395 Ga0209996_1013325 Ga0209996_10133251 281
2448 3300027462 Ga0210000_1008850 Ga0210000_10088502 281
2449 3300027471 Ga0209995_1003224 Ga0209995_10032242 281
2450 3300027512 Ga0209179_1002596 Ga0209179_10025962 281
2451 3300027543 Ga0209999_1004984 Ga0209999_10049843 281
2452 3300027665 Ga0209983_1012662 Ga0209983_10126622 281
2453 3300027665 Ga0209983_1018754 Ga0209983_10187542 281
2454 3300027671 Ga0209588_1004210 Ga0209588_10042102 281
2455 3300027682 Ga0209971_1001384 Ga0209971_10013845 281
2456 3300027682 Ga0209971_1002480 Ga0209971_10024804 281
2457 3300027876 Ga0209974_10006071 Ga0209974_100060713 281
2458 3300027876 Ga0209974_10006556 Ga0209974_100065564 281
2459 3300027876 Ga0209974_10006964 Ga0209974_100069642 281
2460 3300027876 Ga0209974_10026686 Ga0209974_100266862 281
2461 3300027907 Ga0207428_10000627 Ga0207428_1000062711 281
2462 3300027907 Ga0207428_10003201 Ga0207428_100032013 281
2463 3300027907 Ga0207428_10017027 Ga0207428_100170273 281
2464 3300027907 Ga0207428_10047412 Ga0207428_100474123 281
2465 3300027907 Ga0207428_10326630 Ga0207428_103266302 281
2466 3300028379 Ga0268266_10000079 Ga0268266_10000079101 281
2467 3300028379 Ga0268266_10013058 Ga0268266_100130585 281
2468 3300028379 Ga0268266_10043388 Ga0268266_100433884 281
2469 3300028379 Ga0268266_10111635 Ga0268266_101116352 281
2470 3300028379 Ga0268266_10142334 Ga0268266_101423343 281
2471 3300028379 Ga0268266_10204733 Ga0268266_102047332 281
2472 3300028379 Ga0268266_10549949 Ga0268266_105499491 281
2473 3300028380 Ga0268265_10003038 Ga0268265_1000303811 281
2474 3300028380 Ga0268265_10006476 Ga0268265_100064764 281
2475 3300028380 Ga0268265_10008107 Ga0268265_100081076 281
2476 3300028380 Ga0268265_10057229 Ga0268265_100572293 281
2477 3300028380 Ga0268265_10087637 Ga0268265_100876372 281
2478 3300028380 Ga0268265_10186521 Ga0268265_101865212 281
2479 3300028380 Ga0268265_10261074 Ga0268265_102610742 281
2480 3300028380 Ga0268265_10602044 Ga0268265_106020442 281
2481 3300028381 Ga0268264_10000566 Ga0268264_1000056612 281
2482 3300028381 Ga0268264_10000613 Ga0268264_1000061341 281
2483 3300028381 Ga0268264_10007788 Ga0268264_100077884 281
2484 3300028381 Ga0268264_10029433 Ga0268264_100294335 281
2485 3300028381 Ga0268264_10050172 Ga0268264_100501723 281
2486 3300028381 Ga0268264_10129331 Ga0268264_101293312 281
2487 3300028381 Ga0268264_10168262 Ga0268264_101682622 281
2488 3300028381 Ga0268264_10219861 Ga0268264_102198611 281
2489 3300028381 Ga0268264_10251994 Ga0268264_102519942 281
2490 3300028381 Ga0268264_10296413 Ga0268264_102964132 281
2491 3300028794 Ga0307515_10000011 Ga0307515_10000011403 281
2492 3300028794 Ga0307515_10000472 Ga0307515_1000047283 281
2493 3300028794 Ga0307515_10048317 Ga0307515_100483174 281
2494 3300028800 Ga0265338_10000092 Ga0265338_10000092129 281
2495 3300030500 Ga0268256_1000032 Ga0268256_100003287 281
2496 3300030500 Ga0268256_1000045 Ga0268256_1000045204 281
2497 3300030500 Ga0268256_1000072 Ga0268256_1000072115 281
2498 3300030500 Ga0268256_1000097 Ga0268256_100009782 281
2499 3300030500 Ga0268256_1000292 Ga0268256_100029214 281
2500 3300030500 Ga0268256_1000406 Ga0268256_100040615 281
2501 3300030500 Ga0268256_1000875 Ga0268256_100087515 281
2502 3300030500 Ga0268256_1001132 Ga0268256_10011328 281
2503 3300030500 Ga0268256_1001295 Ga0268256_100129512 281
2504 3300030500 Ga0268256_1004211 Ga0268256_10042112 281
2505 3300030500 Ga0268256_1004783 Ga0268256_10047833 281
2506 3300030500 Ga0268256_1008681 Ga0268256_10086814 281
2507 3300030500 Ga0268256_1012315 Ga0268256_10123153 281
2508 3300030500 Ga0268256_1018522 Ga0268256_10185222 281
2509 3300030744 Ga0316181_1217554 Ga0316181_12175542 281
2510 3300031235 Ga0265330_10000046 Ga0265330_1000004615 281
2511 3300031235 Ga0265330_10001529 Ga0265330_1000152912 281
2512 3300031238 Ga0265332_10000028 Ga0265332_1000002897 281
2513 3300031238 Ga0265332_10000951 Ga0265332_100009516 281
2514 3300031242 Ga0265329_10020290 Ga0265329_100202902 281
2515 3300031242 Ga0265329_10030607 Ga0265329_100306072 281
2516 3300031247 Ga0265340_10036331 Ga0265340_100363313 281
2517 3300031250 Ga0265331_10046704 Ga0265331_100467042 281
2518 3300031344 Ga0265316_10010060 Ga0265316_100100608 281
2519 3300031456 Ga0307513_10002745 Ga0307513_100027458 281
2520 3300031456 Ga0307513_10100176 Ga0307513_101001762 281
2521 3300031456 Ga0307513_10207822 Ga0307513_102078222 281
2522 3300031548 Ga0307408_100004804 Ga0307408_1000048044 281
2523 3300031548 Ga0307408_100006023 Ga0307408_1000060234 281
2524 3300031548 Ga0307408_100108106 Ga0307408_1001081062 281
2525 3300031548 Ga0307408_100148467 Ga0307408_1001484672 281
2526 3300031649 Ga0307514_10015811 Ga0307514_100158113 281
2527 3300031665 Ga0316575_10051327 Ga0316575_100513272 281
2528 3300031711 Ga0265314_10000054 Ga0265314_1000005497 281
2529 3300031711 Ga0265314_10001039 Ga0265314_1000103919 281
2530 3300031711 Ga0265314_10020564 Ga0265314_100205642 281
2531 3300031712 Ga0265342_10203033 Ga0265342_102030332 281
2532 3300031731 Ga0307405_10039827 Ga0307405_100398272 281
2533 3300031824 Ga0307413_10049019 Ga0307413_100490192 281
2534 3300031824 Ga0307413_10222001 Ga0307413_102220012 281
2535 3300031852 Ga0307410_10009283 Ga0307410_100092834 281
2536 3300031852 Ga0307410_10022186 Ga0307410_100221861 281
2537 3300031852 Ga0307410_10188189 Ga0307410_101881892 281
2538 3300031852 Ga0307410_10407504 Ga0307410_104075042 281
2539 3300031901 Ga0307406_10006712 Ga0307406_100067124 281
2540 3300031901 Ga0307406_10017190 Ga0307406_100171904 281
2541 3300031911 Ga0307412_10000056 Ga0307412_10000056135 281
2542 3300031911 Ga0307412_10026189 Ga0307412_100261892 281
2543 3300031911 Ga0307412_10122622 Ga0307412_101226222 281
2544 3300031911 Ga0307412_10238366 Ga0307412_102383661 281
2545 3300031995 Ga0307409_100001038 Ga0307409_1000010382 281
2546 3300031995 Ga0307409_100079835 Ga0307409_1000798351 281
2547 3300031995 Ga0307409_100160415 Ga0307409_1001604152 281
2548 3300031995 Ga0307409_100286465 Ga0307409_1002864652 281
2549 3300031995 Ga0307409_100430906 Ga0307409_1004309062 281
2550 3300032002 Ga0307416_100003645 Ga0307416_1000036453 281
2551 3300032002 Ga0307416_100005875 Ga0307416_1000058752 281
2552 3300032002 Ga0307416_100006880 Ga0307416_1000068806 281
2553 3300032002 Ga0307416_100050028 Ga0307416_1000500281 281
2554 3300032002 Ga0307416_100128284 Ga0307416_1001282842 281
2555 3300032002 Ga0307416_100144491 Ga0307416_1001444913 281
2556 3300032002 Ga0307416_100469600 Ga0307416_1004696001 281
2557 3300032004 Ga0307414_10331868 Ga0307414_103318682 281
2558 3300032005 Ga0307411_10047989 Ga0307411_100479892 281
2559 3300032005 Ga0307411_10223608 Ga0307411_102236082 281
2560 3300032126 Ga0307415_100057530 Ga0307415_1000575302 281
2561 3300032126 Ga0307415_100161535 Ga0307415_1001615352 281
2562 3300032133 Ga0316583_10039012 Ga0316583_100390122 281
2563 3300034819 Ga0373958_0010242 Ga0373958_0010242_171_1019 281
2564 3300034957 Ga0373938_0009740 Ga0373938_0009740_248_1096 281
2565 3300035084 Ga0373928_0012221 Ga0373928_0012221_432_1280 281
2566 3300035085 Ga0373929_0014997 Ga0373929_0014997_391_1239 281
2567 3300035111 Ga0373923_0031909 Ga0373923_0031909_703_1551 281
2568 3300035114 Ga0373939_0000800 Ga0373939_0000800_4733_5581 281
2569 3300035115 Ga0373941_0042703 Ga0373941_0042703_299_1147 281
2570 3300035116 Ga0373945_0016065 Ga0373945_0016065_447_1295 281
2571 3300035116 Ga0373945_0032025 Ga0373945_0032025_683_1531 281
2572 3300035117 Ga0373953_0156998 Ga0373953_0156998_100_948 281
2573 3300035170 Ga0373943_0026856 Ga0373943_0026856_1362_2300 281
2574 3300035207 Ga0373942_0024173 Ga0373942_0024173_428_1276 281
2575 3300035242 Ga0373962_0009455 Ga0373962_0009455_1125_1973 281
2576 3300035398 Ga0316574_0004300 Ga0316574_0004300_5499_6347 281
2577 3300035691 Ga0373931_0021727 Ga0373931_0021727_1209_2180 281
2578 3300035691 Ga0373931_0022572 Ga0373931_0022572_1273_2121 281
2579 3300035691 Ga0373931_0066565 Ga0373931_0066565_130_978 281
2580 3300035691 Ga0373931_0201137 Ga0373931_0201137_22_978 281
2581 3300035692 Ga0373935_0010225 Ga0373935_0010225_693_1541 281
2582 3300035692 Ga0373935_0031753 Ga0373935_0031753_791_1639 281
2583 3300035695 Ga0373927_0022204 Ga0373927_0022204_554_1402 281
2584 3300035724 Ga0373933_0091156 Ga0373933_0091156_448_1293 281
2585 3300035724 Ga0373933_0163385 Ga0373933_0163385_517_1365 281
2586 3300035725 Ga0373947_0014664 Ga0373947_0014664_3349_4197 281
2587 3300035725 Ga0373947_0092270 Ga0373947_0092270_41_994 281
2588 3300036401 Ga0373937_0328655 Ga0373937_0328655_513_1370 281
2589 3300036647 Ga0316582_0019083 Ga0316582_0019083_337_1185 281
2590 3300037068 Ga0373925_0049488 Ga0373925_0049488_757_1605 281
2591 3300037068 Ga0373925_0051267 Ga0373925_0051267_1650_2498 281
2592 3300037068 Ga0373925_0131688 Ga0373925_0131688_652_1500 281
2593 3300037312 Ga0395899_0000080 Ga0395899_0000080_105264_106109 281
2594 3300037312 Ga0395899_0000678 Ga0395899_0000678_23654_24505 281
2595 3300037312 Ga0395899_0001980 Ga0395899_0001980_13936_14781 281
2596 3300037312 Ga0395899_0003854 Ga0395899_0003854_7995_8846 281
2597 3300037312 Ga0395899_0111990 Ga0395899_0111990_908_1753 281
2598 3300037312 Ga0395899_0117455 Ga0395899_0117455_498_1346 281
2599 3300037312 Ga0395899_0124060 Ga0395899_0124060_628_1473 281
2600 3300037418 Ga0395900_0000087 Ga0395900_0000087_65460_66305 281
2601 3300037418 Ga0395900_0001157 Ga0395900_0001157_28433_29278 281
2602 3300037418 Ga0395900_0008285 Ga0395900_0008285_690_1538 281
2603 3300037418 Ga0395900_0024154 Ga0395900_0024154_2197_3042 281
2604 3300037418 Ga0395900_0036525 Ga0395900_0036525_3804_4652 281
2605 3300037418 Ga0395900_0059008 Ga0395900_0059008_1362_2213 281
2606 3300037418 Ga0395900_0081813 Ga0395900_0081813_252_1100 281
2607 3300037418 Ga0395900_0123093 Ga0395900_0123093_967_1812 281
2608 3300037418 Ga0395900_0138557 Ga0395900_0138557_496_1347 281
2609 3300037418 Ga0395900_0197250 Ga0395900_0197250_723_1568 281
2610 3300037418 Ga0395900_0219098 Ga0395900_0219098_573_1418 281
2611 3300037418 Ga0395900_0356799 Ga0395900_0356799_387_1232 281
2612 3300037466 Ga0395898_0000448 Ga0395898_0000448_40222_41067 281
2613 3300037466 Ga0395898_0000800 Ga0395898_0000800_24604_25449 281
2614 3300037466 Ga0395898_0012884 Ga0395898_0012884_1031_1879 281
2615 3300037466 Ga0395898_0034645 Ga0395898_0034645_3228_4073 281
2616 3300037466 Ga0395898_0066943 Ga0395898_0066943_493_1344 281
2617 3300037466 Ga0395898_0129963 Ga0395898_0129963_92_937 281
2618 3300037466 Ga0395898_0133393 Ga0395898_0133393_1102_1950 281
2619 3300037471 Ga0395905_0000166 Ga0395905_0000166_26785_27630 281
2620 3300037471 Ga0395905_0037768 Ga0395905_0037768_2919_3767 281
2621 3300037471 Ga0395905_0065898 Ga0395905_0065898_840_1688 281
2622 3300037471 Ga0395905_0077937 Ga0395905_0077937_1356_2201 281
2623 3300037471 Ga0395905_0159612 Ga0395905_0159612_1156_2007 281
2624 3300037471 Ga0395905_0162677 Ga0395905_0162677_988_1839 281
2625 3300037471 Ga0395905_0255552 Ga0395905_0255552_99_947 281
2626 3300037471 Ga0395905_0453065 Ga0395905_0453065_66_914 281
2627 3300038443 Ga0395901_0000053 Ga0395901_0000053_134451_135296 281
2628 3300038443 Ga0395901_0000931 Ga0395901_0000931_3626_4471 281
2629 3300038443 Ga0395901_0001081 Ga0395901_0001081_11861_12706 281
2630 3300038443 Ga0395901_0002028 Ga0395901_0002028_18942_19793 281
2631 3300038443 Ga0395901_0007255 Ga0395901_0007255_6557_7402 281
2632 3300038443 Ga0395901_0071783 Ga0395901_0071783_605_1453 281
2633 3300038443 Ga0395901_0161166 Ga0395901_0161166_193_1041 281
2634 3300038443 Ga0395901_0332562 Ga0395901_0332562_308_1156 281
2635 3300039437 Ga0436365_0171687 Ga0436365_0171687_114263_115108 281
2636 3300039437 Ga0436365_0517772 Ga0436365_0517772_1393_2241 281
2637 3300039437 Ga0436365_0536600 Ga0436365_0536600_783_1631 281
2638 3300039447 Ga0436361_0054021 Ga0436361_0054021_2188_3039 281
2639 3300039447 Ga0436361_0069490 Ga0436361_0069490_2883_3728 281
2640 3300039447 Ga0436361_0487065 Ga0436361_0487065_50959_51810 281
2641 3300039453 Ga0436362_0053187 Ga0436362_0053187_77_925 281
2642 3300041405 Ga0439438_002822 Ga0439438_002822_3189_4037 281
2643 3300041405 Ga0439438_010171 Ga0439438_010171_1086_1931 281
2644 3300041407 Ga0439447_003380 Ga0439447_003380_1384_2232 281
2645 3300041411 Ga0439466_0000011 Ga0439466_0000011_86129_86974 281
2646 3300041411 Ga0439466_0011895 Ga0439466_0011895_2014_2859 281
2647 3300041453 Ga0451797_0060702 Ga0451797_0060702_440_1285 281
2648 3300042005 Ga0439448_0000066 Ga0439448_0000066_1690_2535 281
2649 3300042005 Ga0439448_0045810 Ga0439448_0045810_246_1094 281
2650 3300042006 Ga0439432_003882 Ga0439432_003882_1516_2361 281
2651 3300042006 Ga0439432_018519 Ga0439432_018519_1352_2197 281
2652 3300042006 Ga0439432_021892 Ga0439432_021892_63_911 281
2653 3300042006 Ga0439432_048349 Ga0439432_048349_437_1282 281
2654 3300042006 Ga0439432_090413 Ga0439432_090413_51_896 281
2655 3300042010 Ga0439452_000010 Ga0439452_000010_155163_156008 281
2656 3300042010 Ga0439452_000012 Ga0439452_000012_322590_323435 281
2657 3300042010 Ga0439452_000026 Ga0439452_000026_132124_132969 281
2658 3300042010 Ga0439452_000039 Ga0439452_000039_108994_109839 281
2659 3300042010 Ga0439452_011200 Ga0439452_011200_992_1837 281
2660 3300042012 Ga0439455_0035204 Ga0439455_0035204_359_1216 281
2661 3300042146 Ga0450907_000007 Ga0450907_000007_29114_29959 281
2662 3300042156 Ga0439446_0002089 Ga0439446_0002089_1241_2089 281
2663 3300042156 Ga0439446_0043871 Ga0439446_0043871_372_1220 281
2664 3300042436 Ga0439435_0000773 Ga0439435_0000773_515_1363 281
2665 3300042439 Ga0439464_0000536 Ga0439464_0000536_51_896 281
2666 3300042876 Ga0451577_0037671 Ga0451577_0037671_3219_4067 281
2667 3300042876 Ga0451577_0101262 Ga0451577_0101262_1691_2548 281
2668 3300042876 Ga0451577_0301448 Ga0451577_0301448_61_1056 281
2669 3300042876 Ga0451577_0367528 Ga0451577_0367528_292_1140 281
2670 3300042876 Ga0451577_0506065 Ga0451577_0506065_76_924 281
2671 3300044656 Ga0466969_0000821 Ga0466969_0000821_12138_12983 281
2672 3300044656 Ga0466969_0004750 Ga0466969_0004750_1764_2609 281
2673 3300044656 Ga0466969_0056818 Ga0466969_0056818_593_1438 281
2674 3300044659 Ga0466973_0054379 Ga0466973_0054379_1494_2339 281
2675 3300044666 Ga0466977_0000206 Ga0466977_0000206_11099_11944 281
2676 3300044669 Ga0466981_0000025 Ga0466981_0000025_52897_53742 281
2677 3300044683 Ga0466965_0001659 Ga0466965_0001659_2208_3053 281
2678 3300044683 Ga0466965_0008393 Ga0466965_0008393_2043_2891 281
2679 3300044683 Ga0466965_0037201 Ga0466965_0037201_1406_2251 281
2680 3300044684 Ga0466966_0000070 Ga0466966_0000070_41574_42419 281
2681 3300044684 Ga0466966_0000493 Ga0466966_0000493_5119_5964 281
2682 3300044684 Ga0466966_0035532 Ga0466966_0035532_126_977 281
2683 3300044684 Ga0466966_0045140 Ga0466966_0045140_171_1016 281
2684 3300044684 Ga0466966_0103678 Ga0466966_0103678_286_1131 281
2685 3300044693 Ga0466961_0000274 Ga0466961_0000274_27900_28745 281
2686 3300044693 Ga0466961_0005142 Ga0466961_0005142_4873_5718 281
2687 3300044693 Ga0466961_0007183 Ga0466961_0007183_4281_5126 281
2688 3300044693 Ga0466961_0015762 Ga0466961_0015762_1891_2736 281
2689 3300044693 Ga0466961_0017419 Ga0466961_0017419_498_1346 281
2690 3300044693 Ga0466961_0056221 Ga0466961_0056221_448_1293 281
2691 3300044693 Ga0466961_0136729 Ga0466961_0136729_370_1218 281
2692 3300044693 Ga0466961_0176679 Ga0466961_0176679_122_967 281
2693 3300044694 Ga0466963_0003089 Ga0466963_0003089_3037_3882 281
2694 3300044694 Ga0466963_0006832 Ga0466963_0006832_990_1835 281
2695 3300044694 Ga0466963_0078219 Ga0466963_0078219_969_1814 281
2696 3300044706 Ga0466964_0008845 Ga0466964_0008845_2864_3712 281
2697 3300044706 Ga0466964_0162295 Ga0466964_0162295_41_886 281
2698 3300044712 Ga0453684_0001215 Ga0453684_0001215_9768_10616 281
2699 3300044712 Ga0453684_0065564 Ga0453684_0065564_268_1116 281
2700 3300044712 Ga0453684_0382783 Ga0453684_0382783_599_1456 281
2701 3300044712 Ga0453684_0472557 Ga0453684_0472557_135_986 281
2702 3300044712 Ga0453684_0688794 Ga0453684_0688794_250_1098 281
2703 3300044719 Ga0466971_0000785 Ga0466971_0000785_6096_6941 281
2704 3300044719 Ga0466971_0027092 Ga0466971_0027092_530_1381 281
2705 3300044735 Ga0466968_0006425 Ga0466968_0006425_1951_2796 281
2706 3300044765 Ga0466970_0004728 Ga0466970_0004728_2940_3791 281
2707 3300044765 Ga0466970_0022241 Ga0466970_0022241_385_1230 281
2708 3300044765 Ga0466970_0140087 Ga0466970_0140087_415_1260 281
2709 3300044842 Ga0466957_0002683 Ga0466957_0002683_1385_2230 281
2710 3300044842 Ga0466957_0005803 Ga0466957_0005803_1402_2247 281
2711 3300044842 Ga0466957_0006517 Ga0466957_0006517_1170_2015 281
2712 3300044842 Ga0466957_0106773 Ga0466957_0106773_850_1698 281
2713 3300044901 Ga0466960_0036786 Ga0466960_0036786_1081_1929 281
2714 3300045049 Ga0466959_0008264 Ga0466959_0008264_4832_5677 281
2715 3300045049 Ga0466959_0019888 Ga0466959_0019888_2769_3614 281
2716 3300045049 Ga0466959_0025325 Ga0466959_0025325_530_1375 281
2717 3300045049 Ga0466959_0121689 Ga0466959_0121689_704_1555 281
2718 3300045051 Ga0451576_0004449 Ga0451576_0004449_5384_6232 281
2719 3300045051 Ga0451576_0220372 Ga0451576_0220372_623_1471 281
2720 3300045051 Ga0451576_0354329 Ga0451576_0354329_169_1017 281
2721 3300045051 Ga0451576_0496713 Ga0451576_0496713_46_891 281
2722 3300045836 Ga0466958_0006572 Ga0466958_0006572_4815_5660 281
2723 3300045836 Ga0466958_0010337 Ga0466958_0010337_4128_4973 281
2724 3300045836 Ga0466958_0011937 Ga0466958_0011937_3907_4752 281
2725 3300045836 Ga0466958_0026601 Ga0466958_0026601_999_1844 281
2726 3300045836 Ga0466958_0179978 Ga0466958_0179978_76_924 281
2727 3300045976 Ga0466967_0061012 Ga0466967_0061012_1503_2351 281
2728 3300046453 Ga0495627_000200 Ga0495627_000200_32455_33300 281
2729 3300046454 Ga0495592_0005154 Ga0495592_0005154_5099_5950 281
2730 3300046454 Ga0495592_0014242 Ga0495592_0014242_1192_2037 281
2731 3300046454 Ga0495592_0016551 Ga0495592_0016551_1122_1970 281
2732 3300046454 Ga0495592_0032716 Ga0495592_0032716_167_1012 281
2733 3300046454 Ga0495592_0049228 Ga0495592_0049228_775_1620 281
2734 3300046455 Ga0495603_0001778 Ga0495603_0001778_1886_2734 281
2735 3300046455 Ga0495603_0006995 Ga0495603_0006995_1392_2237 281
2736 3300046455 Ga0495603_0009555 Ga0495603_0009555_1412_2257 281
2737 3300046455 Ga0495603_0058865 Ga0495603_0058865_223_1068 281
2738 3300046457 Ga0495590_0001272 Ga0495590_0001272_5856_6701 281
2739 3300046457 Ga0495590_0017958 Ga0495590_0017958_938_1783 281
2740 3300046457 Ga0495590_0029651 Ga0495590_0029651_375_1220 281
2741 3300046458 Ga0495591_000029 Ga0495591_000029_109689_110534 281
2742 3300046458 Ga0495591_010810 Ga0495591_010810_1460_2305 281
2743 3300046458 Ga0495591_012665 Ga0495591_012665_1037_1882 281
2744 3300046459 Ga0495629_0000309 Ga0495629_0000309_14288_15133 281
2745 3300046459 Ga0495629_0000465 Ga0495629_0000465_27587_28432 281
2746 3300046459 Ga0495629_0002392 Ga0495629_0002392_1487_2332 281
2747 3300046459 Ga0495629_0013337 Ga0495629_0013337_2311_3156 281
2748 3300046459 Ga0495629_0025673 Ga0495629_0025673_1447_2292 281
2749 3300046460 Ga0495638_0033635 Ga0495638_0033635_1114_1965 281
2750 3300046460 Ga0495638_0041512 Ga0495638_0041512_489_1334 281
2751 3300046461 Ga0495641_0141496 Ga0495641_0141496_24_872 281
2752 3300046462 Ga0495651_0061251 Ga0495651_0061251_1193_2044 281
2753 3300046462 Ga0495651_0067489 Ga0495651_0067489_1692_2537 281
2754 3300046462 Ga0495651_0090387 Ga0495651_0090387_699_1544 281
2755 3300046462 Ga0495651_0137387 Ga0495651_0137387_846_1697 281
2756 3300046463 Ga0495653_0008935 Ga0495653_0008935_6347_7198 281
2757 3300046463 Ga0495653_0017910 Ga0495653_0017910_3607_4452 281
2758 3300046463 Ga0495653_0021702 Ga0495653_0021702_2535_3380 281
2759 3300046463 Ga0495653_0026447 Ga0495653_0026447_1086_1931 281
2760 3300046463 Ga0495653_0056301 Ga0495653_0056301_122_967 281
2761 3300046463 Ga0495653_0115761 Ga0495653_0115761_460_1305 281
2762 3300046463 Ga0495653_0124186 Ga0495653_0124186_889_1740 281
2763 3300046463 Ga0495653_0159853 Ga0495653_0159853_36_881 281
2764 3300046471 Ga0495650_0000103 Ga0495650_0000103_106308_107153 281
2765 3300046471 Ga0495650_0000199 Ga0495650_0000199_87988_88833 281
2766 3300046471 Ga0495650_0011421 Ga0495650_0011421_628_1473 281
2767 3300046471 Ga0495650_0011940 Ga0495650_0011940_2115_2960 281
2768 3300046471 Ga0495650_0017540 Ga0495650_0017540_1904_2749 281
2769 3300046472 Ga0495580_0001163 Ga0495580_0001163_10302_11150 281
2770 3300046472 Ga0495580_0002599 Ga0495580_0002599_1537_2382 281
2771 3300046472 Ga0495580_0011405 Ga0495580_0011405_4181_5026 281
2772 3300046472 Ga0495580_0021613 Ga0495580_0021613_1838_2683 281
2773 3300046472 Ga0495580_0026493 Ga0495580_0026493_1346_2191 281
2774 3300046472 Ga0495580_0038400 Ga0495580_0038400_1777_2622 281
2775 3300046472 Ga0495580_0039121 Ga0495580_0039121_1577_2422 281
2776 3300046472 Ga0495580_0046211 Ga0495580_0046211_1392_2237 281
2777 3300046472 Ga0495580_0064553 Ga0495580_0064553_135_980 281
2778 3300046472 Ga0495580_0094503 Ga0495580_0094503_232_1170 281
2779 3300046472 Ga0495580_0106803 Ga0495580_0106803_171_1016 281
2780 3300046473 Ga0495582_0012734 Ga0495582_0012734_1546_2391 281
2781 3300046473 Ga0495582_0133886 Ga0495582_0133886_454_1299 281
2782 3300046474 Ga0495605_0006950 Ga0495605_0006950_388_1233 281
2783 3300046474 Ga0495605_0008418 Ga0495605_0008418_3336_4181 281
2784 3300046474 Ga0495605_0016498 Ga0495605_0016498_242_1087 281
2785 3300046475 Ga0495639_0031953 Ga0495639_0031953_1429_2277 281
2786 3300046477 Ga0495664_0024732 Ga0495664_0024732_1480_2325 281
2787 3300046500 Ga0495596_0035504 Ga0495596_0035504_95_940 281
2788 3300046500 Ga0495596_0043681 Ga0495596_0043681_792_1637 281
2789 3300046506 Ga0495583_0001367 Ga0495583_0001367_15293_16138 281
2790 3300046507 Ga0495606_0004590 Ga0495606_0004590_5411_6256 281
2791 3300046507 Ga0495606_0006813 Ga0495606_0006813_7739_8584 281
2792 3300046507 Ga0495606_0010602 Ga0495606_0010602_5609_6454 281
2793 3300046507 Ga0495606_0016546 Ga0495606_0016546_1141_1986 281
2794 3300046507 Ga0495606_0060173 Ga0495606_0060173_1426_2271 281
2795 3300046511 Ga0495608_0011755 Ga0495608_0011755_2744_3589 281
2796 3300046511 Ga0495608_0013275 Ga0495608_0013275_2238_3089 281
2797 3300046511 Ga0495608_0020368 Ga0495608_0020368_206_1057 281
2798 3300046512 Ga0495610_0001399 Ga0495610_0001399_14914_15759 281
2799 3300046512 Ga0495610_0008257 Ga0495610_0008257_3445_4296 281
2800 3300046512 Ga0495610_0011733 Ga0495610_0011733_1770_2615 281
2801 3300046513 Ga0495616_0003177 Ga0495616_0003177_2635_3486 281
2802 3300046514 Ga0495618_0003505 Ga0495618_0003505_149_1000 281
2803 3300046514 Ga0495618_0015530 Ga0495618_0015530_3755_4600 281
2804 3300046514 Ga0495618_0045726 Ga0495618_0045726_1841_2686 281
2805 3300046514 Ga0495618_0246691 Ga0495618_0246691_259_1104 281
2806 3300046514 Ga0495618_0283893 Ga0495618_0283893_22_873 281
2807 3300046515 Ga0495620_0005020 Ga0495620_0005020_5029_5874 281
2808 3300046515 Ga0495620_0010395 Ga0495620_0010395_316_1167 281
2809 3300046515 Ga0495620_0011504 Ga0495620_0011504_3466_4311 281
2810 3300046515 Ga0495620_0020260 Ga0495620_0020260_992_1837 281
2811 3300046516 Ga0495628_0000707 Ga0495628_0000707_8357_9208 281
2812 3300046516 Ga0495628_0003737 Ga0495628_0003737_111_956 281
2813 3300046516 Ga0495628_0013265 Ga0495628_0013265_4175_5020 281
2814 3300046516 Ga0495628_0026331 Ga0495628_0026331_2067_2918 281
2815 3300046516 Ga0495628_0033891 Ga0495628_0033891_1259_2104 281
2816 3300046516 Ga0495628_0087172 Ga0495628_0087172_1383_2228 281
2817 3300046516 Ga0495628_0094648 Ga0495628_0094648_715_1563 281
2818 3300046516 Ga0495628_0116933 Ga0495628_0116933_24_869 281
2819 3300046517 Ga0495630_0005486 Ga0495630_0005486_1537_2382 281
2820 3300046517 Ga0495630_0022086 Ga0495630_0022086_410_1255 281
2821 3300046518 Ga0495631_0003505 Ga0495631_0003505_7427_8278 281
2822 3300046518 Ga0495631_0048223 Ga0495631_0048223_420_1265 281
2823 3300046520 Ga0495637_0038702 Ga0495637_0038702_888_1739 281
2824 3300046520 Ga0495637_0065779 Ga0495637_0065779_378_1229 281
2825 3300046522 Ga0495643_0013531 Ga0495643_0013531_3847_4701 281
2826 3300046522 Ga0495643_0036223 Ga0495643_0036223_1657_2502 281
2827 3300046522 Ga0495643_0065213 Ga0495643_0065213_795_1640 281
2828 3300046523 Ga0495644_0029303 Ga0495644_0029303_187_1032 281
2829 3300046524 Ga0495648_0021096 Ga0495648_0021096_2731_3576 281
2830 3300046524 Ga0495648_0030108 Ga0495648_0030108_595_1443 281
2831 3300046524 Ga0495648_0048223 Ga0495648_0048223_83_928 281
2832 3300046524 Ga0495648_0056071 Ga0495648_0056071_444_1289 281
2833 3300046526 Ga0495666_0002075 Ga0495666_0002075_2323_3168 281
2834 3300046526 Ga0495666_0009566 Ga0495666_0009566_1547_2392 281
2835 3300046526 Ga0495666_0011675 Ga0495666_0011675_2220_3065 281
2836 3300046528 Ga0495642_0004800 Ga0495642_0004800_1304_2149 281
2837 3300046528 Ga0495642_0040514 Ga0495642_0040514_961_1815 281
2838 3300046528 Ga0495642_0051349 Ga0495642_0051349_221_1066 281
2839 3300046528 Ga0495642_0104393 Ga0495642_0104393_186_1031 281
2840 3300046529 Ga0495652_0009439 Ga0495652_0009439_543_1394 281
2841 3300046529 Ga0495652_0024360 Ga0495652_0024360_2500_3345 281
2842 3300046529 Ga0495652_0027427 Ga0495652_0027427_3878_4729 281
2843 3300046529 Ga0495652_0067129 Ga0495652_0067129_221_1072 281
2844 3300046529 Ga0495652_0188171 Ga0495652_0188171_591_1436 281
2845 3300046529 Ga0495652_0298077 Ga0495652_0298077_173_1018 281
2846 3300046530 Ga0495654_0011899 Ga0495654_0011899_275_1120 281
2847 3300046530 Ga0495654_0065786 Ga0495654_0065786_663_1508 281
2848 3300046531 Ga0495665_0007232 Ga0495665_0007232_2312_3157 281
2849 3300046531 Ga0495665_0014053 Ga0495665_0014053_1412_2257 281
2850 3300046531 Ga0495665_0096158 Ga0495665_0096158_405_1250 281
2851 3300046533 Ga0495640_0033174 Ga0495640_0033174_1326_2171 281
2852 3300046535 Ga0495586_0007786 Ga0495586_0007786_111_956 281
2853 3300046536 Ga0495587_0043895 Ga0495587_0043895_307_1152 281
2854 3300046539 Ga0495621_0007024 Ga0495621_0007024_2109_2957 281
2855 3300046539 Ga0495621_0013316 Ga0495621_0013316_1504_2355 281
2856 3300046539 Ga0495621_0060758 Ga0495621_0060758_57_908 281
2857 3300046542 Ga0495597_0001315 Ga0495597_0001315_4169_5017 281
2858 3300046542 Ga0495597_0003381 Ga0495597_0003381_1938_2783 281
2859 3300046542 Ga0495597_0003748 Ga0495597_0003748_6533_7387 281
2860 3300046542 Ga0495597_0004771 Ga0495597_0004771_1116_1961 281
2861 3300046542 Ga0495597_0067209 Ga0495597_0067209_37_882 281
2862 3300046542 Ga0495597_0085167 Ga0495597_0085167_77_922 281
2863 3300046543 Ga0495645_0001757 Ga0495645_0001757_2402_3247 281
2864 3300046543 Ga0495645_0007581 Ga0495645_0007581_1365_2210 281
2865 3300046543 Ga0495645_0008090 Ga0495645_0008090_224_1075 281
2866 3300046543 Ga0495645_0055442 Ga0495645_0055442_539_1390 281
2867 3300046543 Ga0495645_0059253 Ga0495645_0059253_1474_2322 281
2868 3300046557 Ga0495622_0000968 Ga0495622_0000968_12300_13145 281
2869 3300046559 Ga0495667_0109994 Ga0495667_0109994_63_908 281
2870 3300046615 Ga0495656_0000090 Ga0495656_0000090_35290_36141 281
2871 3300046642 Ga0495634_0208830 Ga0495634_0208830_220_1065 281
2872 3300046642 Ga0495634_0230205 Ga0495634_0230205_92_937 281
2873 3300046648 Ga0495611_0022841 Ga0495611_0022841_50_895 281
2874 3300046648 Ga0495611_0036477 Ga0495611_0036477_1199_2044 281
2875 3300046660 Ga0495625_0001055 Ga0495625_0001055_22226_23077 281
2876 3300046660 Ga0495625_0002257 Ga0495625_0002257_18849_19700 281
2877 3300046660 Ga0495625_0025375 Ga0495625_0025375_3165_4016 281
2878 3300046660 Ga0495625_0050158 Ga0495625_0050158_1413_2258 281
2879 3300046663 Ga0495635_0004221 Ga0495635_0004221_4058_4903 281
2880 3300046663 Ga0495635_0162929 Ga0495635_0162929_104_949 281
2881 3300046663 Ga0495635_0333152 Ga0495635_0333152_77_922 281
2882 3300046665 Ga0495661_0022257 Ga0495661_0022257_1458_2303 281
2883 3300046665 Ga0495661_0025624 Ga0495661_0025624_1382_2227 281
2884 3300046674 Ga0495588_0052721 Ga0495588_0052721_904_1752 281
2885 3300046675 Ga0495657_0073063 Ga0495657_0073063_85_930 281
2886 3300046675 Ga0495657_0236501 Ga0495657_0236501_195_1046 281
2887 3300046678 Ga0495599_0021474 Ga0495599_0021474_2939_3784 281
2888 3300046678 Ga0495599_0051035 Ga0495599_0051035_1458_2303 281
2889 3300046678 Ga0495599_0160208 Ga0495599_0160208_510_1355 281
2890 3300046678 Ga0495599_0162714 Ga0495599_0162714_62_907 281
2891 3300046679 Ga0495623_0040566 Ga0495623_0040566_483_1328 281
2892 3300046679 Ga0495623_0128835 Ga0495623_0128835_21_866 281
2893 3300046680 Ga0495646_0001463 Ga0495646_0001463_6340_7191 281
2894 3300046680 Ga0495646_0003553 Ga0495646_0003553_2205_3050 281
2895 3300046680 Ga0495646_0005006 Ga0495646_0005006_1868_2713 281
2896 3300046680 Ga0495646_0027204 Ga0495646_0027204_1887_2732 281
2897 3300046680 Ga0495646_0038698 Ga0495646_0038698_1918_2763 281
2898 3300046680 Ga0495646_0156927 Ga0495646_0156927_44_895 281
2899 3300046684 Ga0495669_0006300 Ga0495669_0006300_227_1075 281
2900 3300046684 Ga0495669_0046182 Ga0495669_0046182_70_915 281
2901 3300046689 Ga0495613_0026407 Ga0495613_0026407_1490_2335 281
2902 3300046689 Ga0495613_0058917 Ga0495613_0058917_463_1308 281
2903 3300046689 Ga0495613_0093315 Ga0495613_0093315_493_1338 281
2904 3300046690 Ga0495624_0002116 Ga0495624_0002116_194_1039 281
2905 3300046690 Ga0495624_0008626 Ga0495624_0008626_4400_5245 281
2906 3300046690 Ga0495624_0021936 Ga0495624_0021936_1895_2740 281
2907 3300046690 Ga0495624_0023036 Ga0495624_0023036_2654_3499 281
2908 3300046691 Ga0495670_0076189 Ga0495670_0076189_684_1535 281
2909 3300046692 Ga0495671_0015488 Ga0495671_0015488_1609_2454 281
2910 3300046692 Ga0495671_0078200 Ga0495671_0078200_678_1523 281
2911 3300046692 Ga0495671_0092160 Ga0495671_0092160_182_1033 281
2912 3300046694 Ga0495649_0002815 Ga0495649_0002815_4200_5045 281
2913 3300046694 Ga0495649_0005731 Ga0495649_0005731_1329_2174 281
2914 3300046694 Ga0495649_0007303 Ga0495649_0007303_5654_6499 281
2915 3300046694 Ga0495649_0055187 Ga0495649_0055187_136_981 281
2916 3300046794 Ga0495589_0031804 Ga0495589_0031804_394_1239 281
2917 3300046794 Ga0495589_0061234 Ga0495589_0061234_319_1164 281
2918 3300046794 Ga0495589_0072648 Ga0495589_0072648_647_1492 281
2919 3300046809 Ga0495600_0000383 Ga0495600_0000383_9275_10126 281
2920 3300046809 Ga0495600_0009727 Ga0495600_0009727_439_1284 281
2921 3300046809 Ga0495600_0105756 Ga0495600_0105756_91_936 281
2922 3300046809 Ga0495600_0245684 Ga0495600_0245684_212_1057 281
2923 3300046810 Ga0495660_0000045 Ga0495660_0000045_107880_108725 281
2924 3300046810 Ga0495660_0009345 Ga0495660_0009345_2728_3573 281
2925 3300046810 Ga0495660_0033500 Ga0495660_0033500_948_1793 281
2926 3300046810 Ga0495660_0035318 Ga0495660_0035318_888_1733 281
2927 3300046810 Ga0495660_0118594 Ga0495660_0118594_250_1095 281
2928 3300047315 Ga0495581_0002341 Ga0495581_0002341_7492_8337 281
2929 3300047315 Ga0495581_0010561 Ga0495581_0010561_3093_3938 281
2930 3300047315 Ga0495581_0040061 Ga0495581_0040061_200_1045 281
2931 3300047317 Ga0495604_0013517 Ga0495604_0013517_1932_2777 281
2932 3300047317 Ga0495604_0042053 Ga0495604_0042053_665_1516 281
2933 3300047317 Ga0495604_0057076 Ga0495604_0057076_851_1696 281
2934 3300047317 Ga0495604_0058437 Ga0495604_0058437_217_1062 281
2935 3300047317 Ga0495604_0074253 Ga0495604_0074253_179_1024 281
2936 3300047318 Ga0495636_0002751 Ga0495636_0002751_140_988 281
2937 3300047319 Ga0495674_0043297 Ga0495674_0043297_2312_3157 281
2938 3300047319 Ga0495674_0047294 Ga0495674_0047294_1715_2560 281
2939 3300047319 Ga0495674_0058660 Ga0495674_0058660_1198_2043 281
2940 3300047319 Ga0495674_0067855 Ga0495674_0067855_2062_2907 281
2941 3300047319 Ga0495674_0159844 Ga0495674_0159844_370_1215 281
2942 3300047319 Ga0495674_0191202 Ga0495674_0191202_562_1407 281
2943 3300047319 Ga0495674_0338264 Ga0495674_0338264_114_959 281
2944 3300047320 Ga0495672_0000039 Ga0495672_0000039_44441_45286 281
2945 3300047320 Ga0495672_0000040 Ga0495672_0000040_133841_134686 281
2946 3300047320 Ga0495672_0011163 Ga0495672_0011163_3654_4499 281
2947 3300047320 Ga0495672_0033435 Ga0495672_0033435_1355_2200 281
2948 3300047320 Ga0495672_0060079 Ga0495672_0060079_1007_1852 281
2949 3300047320 Ga0495672_0065091 Ga0495672_0065091_187_1035 281
2950 3300047320 Ga0495672_0093874 Ga0495672_0093874_707_1552 281
2951 3300047321 Ga0495676_0045661 Ga0495676_0045661_1185_2030 281
2952 3300047321 Ga0495676_0048156 Ga0495676_0048156_2445_3290 281
2953 3300047321 Ga0495676_0084422 Ga0495676_0084422_1357_2205 281
2954 3300047322 Ga0495680_0019793 Ga0495680_0019793_1732_2577 281
2955 3300047322 Ga0495680_0034679 Ga0495680_0034679_2515_3360 281
2956 3300047322 Ga0495680_0069262 Ga0495680_0069262_198_1043 281
2957 3300047322 Ga0495680_0072348 Ga0495680_0072348_267_1112 281
2958 3300047323 Ga0495683_0000890 Ga0495683_0000890_15109_15954 281
2959 3300047323 Ga0495683_0003192 Ga0495683_0003192_746_1591 281
2960 3300047323 Ga0495683_0008819 Ga0495683_0008819_3327_4172 281
2961 3300047323 Ga0495683_0018431 Ga0495683_0018431_1238_2083 281
2962 3300047323 Ga0495683_0035182 Ga0495683_0035182_573_1418 281
2963 3300047443 Ga0495687_000216 Ga0495687_000216_39655_40500 281
2964 3300047443 Ga0495687_025438 Ga0495687_025438_1279_2124 281
2965 3300047443 Ga0495687_031137 Ga0495687_031137_681_1526 281
2966 3300047443 Ga0495687_110568 Ga0495687_110568_10_855 281
2967 3300047444 Ga0495675_0028080 Ga0495675_0028080_1876_2721 281
2968 3300047444 Ga0495675_0085614 Ga0495675_0085614_30_875 281
2969 3300047446 Ga0495679_000016 Ga0495679_000016_128052_128897 281
2970 3300047446 Ga0495679_000271 Ga0495679_000271_16546_17391 281
2971 3300047446 Ga0495679_002610 Ga0495679_002610_3988_4833 281
2972 3300047446 Ga0495679_002720 Ga0495679_002720_6149_6994 281
2973 3300047446 Ga0495679_003006 Ga0495679_003006_4166_5011 281
2974 3300047446 Ga0495679_058619 Ga0495679_058619_280_1125 281
2975 3300047447 Ga0495685_036106 Ga0495685_036106_237_1082 281
2976 3300047469 Ga0495673_0000079 Ga0495673_0000079_97952_98797 281
2977 3300047469 Ga0495673_0028333 Ga0495673_0028333_1074_1919 281
2978 3300047469 Ga0495673_0045376 Ga0495673_0045376_870_1715 281
2979 3300047469 Ga0495673_0067324 Ga0495673_0067324_550_1395 281
2980 3300047470 Ga0495681_0053360 Ga0495681_0053360_598_1443 281
2981 3300047470 Ga0495681_0149702 Ga0495681_0149702_92_943 281
2982 3300047471 Ga0495684_0212584 Ga0495684_0212584_521_1366 281
2983 3300047471 Ga0495684_0265155 Ga0495684_0265155_40_885 281
2984 3300047472 Ga0495686_0000214 Ga0495686_0000214_59306_60151 281
2985 3300047673 Ga0495593_0011529 Ga0495593_0011529_2481_3326 281
2986 3300047673 Ga0495593_0018332 Ga0495593_0018332_1553_2398 281
2987 3300047673 Ga0495593_0021264 Ga0495593_0021264_1913_2758 281
2988 3300047673 Ga0495593_0074797 Ga0495593_0074797_363_1208 281
2989 3300048088 Ga0495602_0004708 Ga0495602_0004708_938_1783 281
2990 3300048088 Ga0495602_0023613 Ga0495602_0023613_1540_2385 281
2991 3300048088 Ga0495602_0037133 Ga0495602_0037133_1311_2156 281
2992 3300048088 Ga0495602_0064279 Ga0495602_0064279_611_1456 281
2993 3300048088 Ga0495602_0109557 Ga0495602_0109557_825_1676 281
2994 3300048088 Ga0495602_0279474 Ga0495602_0279474_99_944 281
2995 3300048089 Ga0495614_0000511 Ga0495614_0000511_63_908 281
2996 3300048089 Ga0495614_0008517 Ga0495614_0008517_2143_2988 281
2997 3300048091 Ga0495626_0003417 Ga0495626_0003417_248_1093 281
2998 3300048091 Ga0495626_0011295 Ga0495626_0011295_1990_2835 281
2999 3300048091 Ga0495626_0020060 Ga0495626_0020060_596_1441 281
3000 3300048091 Ga0495626_0114437 Ga0495626_0114437_189_1034 281
3001 3300048903 Ga0496100_0010366 Ga0496100_0010366_850_1695 281
3002 3300048903 Ga0496100_0148669 Ga0496100_0148669_397_1242 281
3003 3300048903 Ga0496100_0234698 Ga0496100_0234698_84_929 281
3004 3300048903 Ga0496100_0327934 Ga0496100_0327934_140_985 281
3005 3300048904 Ga0496101_0015082 Ga0496101_0015082_4177_5022 281
3006 3300048904 Ga0496101_0015457 Ga0496101_0015457_2261_3106 281
3007 3300048904 Ga0496101_0065571 Ga0496101_0065571_1564_2415 281
3008 3300048905 Ga0496102_0002846 Ga0496102_0002846_1333_2178 281
3009 3300048905 Ga0496102_0003638 Ga0496102_0003638_4580_5425 281
3010 3300048905 Ga0496102_0012962 Ga0496102_0012962_1513_2358 281
3011 3300048905 Ga0496102_0040375 Ga0496102_0040375_1990_2835 281
3012 3300048905 Ga0496102_0042034 Ga0496102_0042034_1255_2100 281
3013 3300048905 Ga0496102_0055185 Ga0496102_0055185_439_1392 281
3014 3300048905 Ga0496102_0072284 Ga0496102_0072284_947_1918 281
3015 3300048905 Ga0496102_0257448 Ga0496102_0257448_476_1327 281
3016 3300048906 Ga0496103_0002469 Ga0496103_0002469_10565_11410 281
3017 3300048906 Ga0496103_0046670 Ga0496103_0046670_1236_2081 281
3018 3300048906 Ga0496103_0182904 Ga0496103_0182904_200_1045 281
3019 3300048906 Ga0496103_0215280 Ga0496103_0215280_33_1004 281
3020 3300048907 Ga0496104_0000113 Ga0496104_0000113_22419_23264 281
3021 3300048907 Ga0496104_0003827 Ga0496104_0003827_8765_9610 281
3022 3300048907 Ga0496104_0023772 Ga0496104_0023772_2771_3622 281
3023 3300048907 Ga0496104_0059497 Ga0496104_0059497_1513_2361 281
3024 3300048907 Ga0496104_0151067 Ga0496104_0151067_1262_2107 281
3025 3300048907 Ga0496104_0290241 Ga0496104_0290241_78_923 281
3026 3300048907 Ga0496104_0300844 Ga0496104_0300844_118_963 281
3027 3300048908 Ga0496105_0003958 Ga0496105_0003958_6753_7604 281
3028 3300048908 Ga0496105_0065843 Ga0496105_0065843_1936_2781 281
3029 3300048908 Ga0496105_0113210 Ga0496105_0113210_1343_2188 281
3030 3300048908 Ga0496105_0170263 Ga0496105_0170263_535_1380 281
3031 3300048909 Ga0496106_0007800 Ga0496106_0007800_5268_6113 281
3032 3300048909 Ga0496106_0031478 Ga0496106_0031478_957_1928 281
3033 3300048909 Ga0496106_0195462 Ga0496106_0195462_375_1223 281
3034 3300048910 Ga0496107_0017463 Ga0496107_0017463_2387_3232 281
3035 3300048910 Ga0496107_0058852 Ga0496107_0058852_900_1871 281
3036 3300048910 Ga0496107_0076795 Ga0496107_0076795_577_1422 281
3037 3300048910 Ga0496107_0307508 Ga0496107_0307508_18_866 281
3038 3300048911 Ga0496108_0284370 Ga0496108_0284370_253_1206 281
3039 3300048912 Ga0496109_0089547 Ga0496109_0089547_1409_2260 281
3040 3300048912 Ga0496109_0174255 Ga0496109_0174255_767_1612 281
3041 3300048912 Ga0496109_0387868 Ga0496109_0387868_313_1161 281
3042 3300048913 Ga0496110_0000450 Ga0496110_0000450_2371_3216 281
3043 3300048913 Ga0496110_0256639 Ga0496110_0256639_497_1345 281
3044 3300048913 Ga0496110_0376408 Ga0496110_0376408_405_1250 281
3045 3300048913 Ga0496110_0464063 Ga0496110_0464063_16_978 281
3046 3300048914 Ga0496111_0374380 Ga0496111_0374380_49_894 281
3047 3300048915 Ga0496112_0002790 Ga0496112_0002790_12711_13673 281
3048 3300048915 Ga0496112_0009588 Ga0496112_0009588_2705_3550 281
3049 3300048916 Ga0496113_0037101 Ga0496113_0037101_1008_1853 281
3050 3300048916 Ga0496113_0063448 Ga0496113_0063448_1546_2508 281
3051 3300048917 Ga0496114_0008353 Ga0496114_0008353_1968_2813 281
3052 3300048917 Ga0496114_0243481 Ga0496114_0243481_464_1312 281
3053 3300048917 Ga0496114_0248489 Ga0496114_0248489_703_1548 281
3054 3300048917 Ga0496114_0365117 Ga0496114_0365117_203_1156 281
3055 3300048918 Ga0496115_0184312 Ga0496115_0184312_112_957 281
3056 3300048919 Ga0496116_0000058 Ga0496116_0000058_246624_247469 281
3057 3300048919 Ga0496116_0000278 Ga0496116_0000278_66664_67509 281
3058 3300048919 Ga0496116_0000498 Ga0496116_0000498_11536_12381 281
3059 3300048919 Ga0496116_0002010 Ga0496116_0002010_19516_20361 281
3060 3300048919 Ga0496116_0018067 Ga0496116_0018067_1920_2765 281
3061 3300048919 Ga0496116_0084099 Ga0496116_0084099_804_1649 281
3062 3300048920 Ga0496117_0000092 Ga0496117_0000092_135760_136605 281
3063 3300048920 Ga0496117_0000224 Ga0496117_0000224_23406_24251 281
3064 3300048920 Ga0496117_0000400 Ga0496117_0000400_6671_7516 281
3065 3300048920 Ga0496117_0003328 Ga0496117_0003328_10081_10926 281
3066 3300048920 Ga0496117_0004125 Ga0496117_0004125_8178_9023 281
3067 3300048920 Ga0496117_0008005 Ga0496117_0008005_8590_9435 281
3068 3300048920 Ga0496117_0011864 Ga0496117_0011864_5351_6196 281
3069 3300048920 Ga0496117_0012307 Ga0496117_0012307_6304_7149 281
3070 3300048920 Ga0496117_0012900 Ga0496117_0012900_6134_6979 281
3071 3300048920 Ga0496117_0028442 Ga0496117_0028442_2849_3700 281
3072 3300048920 Ga0496117_0060747 Ga0496117_0060747_1348_2193 281
3073 3300048920 Ga0496117_0062113 Ga0496117_0062113_1182_2027 281
3074 3300048920 Ga0496117_0077832 Ga0496117_0077832_693_1538 281
3075 3300048920 Ga0496117_0087413 Ga0496117_0087413_148_993 281
3076 3300048920 Ga0496117_0161141 Ga0496117_0161141_159_1004 281
3077 3300048921 Ga0496118_0000053 Ga0496118_0000053_99206_100051 281
3078 3300048921 Ga0496118_0000540 Ga0496118_0000540_59871_60716 281
3079 3300048921 Ga0496118_0000718 Ga0496118_0000718_49061_49906 281
3080 3300048921 Ga0496118_0001531 Ga0496118_0001531_932_1777 281
3081 3300048921 Ga0496118_0003145 Ga0496118_0003145_19524_20369 281
3082 3300048921 Ga0496118_0003209 Ga0496118_0003209_5092_5937 281
3083 3300048921 Ga0496118_0003978 Ga0496118_0003978_2756_3601 281
3084 3300048921 Ga0496118_0003984 Ga0496118_0003984_10081_10926 281
3085 3300048921 Ga0496118_0005606 Ga0496118_0005606_4082_4927 281
3086 3300048921 Ga0496118_0006660 Ga0496118_0006660_4485_5336 281
3087 3300048921 Ga0496118_0020193 Ga0496118_0020193_485_1330 281
3088 3300048921 Ga0496118_0029281 Ga0496118_0029281_1296_2141 281
3089 3300048921 Ga0496118_0038828 Ga0496118_0038828_1265_2110 281
3090 3300048921 Ga0496118_0058417 Ga0496118_0058417_1153_1998 281
3091 3300048921 Ga0496118_0062755 Ga0496118_0062755_1812_2657 281
3092 3300048921 Ga0496118_0074874 Ga0496118_0074874_1200_2045 281
3093 3300048921 Ga0496118_0114347 Ga0496118_0114347_681_1526 281
3094 3300048921 Ga0496118_0208757 Ga0496118_0208757_261_1106 281
3095 3300048922 Ga0496119_0000023 Ga0496119_0000023_88437_89282 281
3096 3300048922 Ga0496119_0000075 Ga0496119_0000075_67227_68072 281
3097 3300048922 Ga0496119_0000285 Ga0496119_0000285_9147_9992 281
3098 3300048922 Ga0496119_0000555 Ga0496119_0000555_46171_47016 281
3099 3300048922 Ga0496119_0001950 Ga0496119_0001950_22440_23285 281
3100 3300048922 Ga0496119_0003164 Ga0496119_0003164_11572_12417 281
3101 3300048922 Ga0496119_0017948 Ga0496119_0017948_2832_3677 281
3102 3300048923 Ga0496120_0000008 Ga0496120_0000008_92223_93068 281
3103 3300048923 Ga0496120_0000388 Ga0496120_0000388_60938_61783 281
3104 3300048923 Ga0496120_0000548 Ga0496120_0000548_4957_5802 281
3105 3300048923 Ga0496120_0000758 Ga0496120_0000758_13337_14182 281
3106 3300048923 Ga0496120_0002687 Ga0496120_0002687_1744_2589 281
3107 3300048923 Ga0496120_0008474 Ga0496120_0008474_2139_2984 281
3108 3300048923 Ga0496120_0008652 Ga0496120_0008652_5043_5888 281
3109 3300048923 Ga0496120_0024221 Ga0496120_0024221_636_1481 281
3110 3300048923 Ga0496120_0093490 Ga0496120_0093490_689_1534 281
3111 3300048923 Ga0496120_0140248 Ga0496120_0140248_198_1043 281
3112 3300048924 Ga0496121_0000304 Ga0496121_0000304_4275_5120 281
3113 3300048924 Ga0496121_0003964 Ga0496121_0003964_7998_8843 281
3114 3300048924 Ga0496121_0007406 Ga0496121_0007406_1798_2643 281
3115 3300048924 Ga0496121_0009287 Ga0496121_0009287_8041_8886 281
3116 3300048924 Ga0496121_0013099 Ga0496121_0013099_7889_8734 281
3117 3300048924 Ga0496121_0027348 Ga0496121_0027348_3787_4638 281
3118 3300048924 Ga0496121_0033160 Ga0496121_0033160_3660_4508 281
3119 3300048924 Ga0496121_0041075 Ga0496121_0041075_2857_3702 281
3120 3300048924 Ga0496121_0115659 Ga0496121_0115659_906_1757 281
3121 3300048924 Ga0496121_0332563 Ga0496121_0332563_28_873 281
3122 3300048925 Ga0496122_0000108 Ga0496122_0000108_79550_80395 281
3123 3300048925 Ga0496122_0000904 Ga0496122_0000904_11532_12377 281
3124 3300048925 Ga0496122_0001295 Ga0496122_0001295_31684_32529 281
3125 3300048925 Ga0496122_0001307 Ga0496122_0001307_29169_30014 281
3126 3300048925 Ga0496122_0001889 Ga0496122_0001889_8345_9196 281
3127 3300048925 Ga0496122_0003683 Ga0496122_0003683_1272_2123 281
3128 3300048925 Ga0496122_0009582 Ga0496122_0009582_4150_4995 281
3129 3300048925 Ga0496122_0039601 Ga0496122_0039601_1129_1974 281
3130 3300048925 Ga0496122_0061817 Ga0496122_0061817_1154_1999 281
3131 3300048925 Ga0496122_0072275 Ga0496122_0072275_41_886 281
3132 3300048926 Ga0496123_0000065 Ga0496123_0000065_110635_111480 281
3133 3300048926 Ga0496123_0000424 Ga0496123_0000424_70376_71221 281
3134 3300048926 Ga0496123_0000504 Ga0496123_0000504_56032_56877 281
3135 3300048926 Ga0496123_0000703 Ga0496123_0000703_42352_43197 281
3136 3300048926 Ga0496123_0001035 Ga0496123_0001035_18928_19779 281
3137 3300048926 Ga0496123_0002189 Ga0496123_0002189_4004_4849 281
3138 3300048926 Ga0496123_0005290 Ga0496123_0005290_877_1722 281
3139 3300048926 Ga0496123_0017969 Ga0496123_0017969_1848_2699 281
3140 3300048926 Ga0496123_0023531 Ga0496123_0023531_2120_2965 281
3141 3300048926 Ga0496123_0032154 Ga0496123_0032154_940_1785 281
3142 3300048926 Ga0496123_0222477 Ga0496123_0222477_11_862 281
3143 3300048927 Ga0496124_0000004 Ga0496124_0000004_742847_743698 281
3144 3300048927 Ga0496124_0000109 Ga0496124_0000109_149851_150696 281
3145 3300048927 Ga0496124_0000147 Ga0496124_0000147_43160_44005 281
3146 3300048927 Ga0496124_0000251 Ga0496124_0000251_65254_66099 281
3147 3300048927 Ga0496124_0000304 Ga0496124_0000304_32717_33562 281
3148 3300048927 Ga0496124_0000379 Ga0496124_0000379_38664_39509 281
3149 3300048927 Ga0496124_0001721 Ga0496124_0001721_33_878 281
3150 3300048927 Ga0496124_0004538 Ga0496124_0004538_9925_10770 281
3151 3300048927 Ga0496124_0009521 Ga0496124_0009521_586_1431 281
3152 3300048927 Ga0496124_0013849 Ga0496124_0013849_48_893 281
3153 3300048927 Ga0496124_0056880 Ga0496124_0056880_1148_1993 281
3154 3300048927 Ga0496124_0080515 Ga0496124_0080515_1007_1852 281
3155 3300048927 Ga0496124_0109018 Ga0496124_0109018_742_1587 281
3156 3300048927 Ga0496124_0120787 Ga0496124_0120787_703_1554 281
3157 3300048927 Ga0496124_0121804 Ga0496124_0121804_124_975 281
3158 3300048928 Ga0496125_0000104 Ga0496125_0000104_101461_102306 281
3159 3300048928 Ga0496125_0000740 Ga0496125_0000740_41579_42424 281
3160 3300048928 Ga0496125_0001627 Ga0496125_0001627_22420_23271 281
3161 3300048928 Ga0496125_0003971 Ga0496125_0003971_10988_11833 281
3162 3300048928 Ga0496125_0005839 Ga0496125_0005839_4759_5604 281
3163 3300048928 Ga0496125_0007136 Ga0496125_0007136_6905_7750 281
3164 3300048928 Ga0496125_0028048 Ga0496125_0028048_810_1655 281
3165 3300048928 Ga0496125_0052873 Ga0496125_0052873_1320_2171 281
3166 3300048929 Ga0496126_0000538 Ga0496126_0000538_18134_18979 281
3167 3300048929 Ga0496126_0001394 Ga0496126_0001394_29054_29899 281
3168 3300048929 Ga0496126_0001579 Ga0496126_0001579_7695_8540 281
3169 3300048929 Ga0496126_0003828 Ga0496126_0003828_3460_4305 281
3170 3300048929 Ga0496126_0006622 Ga0496126_0006622_4399_5244 281
3171 3300048929 Ga0496126_0028738 Ga0496126_0028738_1954_2799 281
3172 3300048929 Ga0496126_0043488 Ga0496126_0043488_1336_2181 281
3173 3300048929 Ga0496126_0100423 Ga0496126_0100423_1374_2219 281
3174 3300048929 Ga0496126_0183072 Ga0496126_0183072_386_1231 281
3175 3300048929 Ga0496126_0200504 Ga0496126_0200504_480_1325 281
3176 3300048929 Ga0496126_0457979 Ga0496126_0457979_94_939 281
3177 3300049459 Ga0495678_017979 Ga0495678_017979_791_1636 281
3178 3300049459 Ga0495678_113021 Ga0495678_113021_10_855 281
3179 3300049460 Ga0495682_0012554 Ga0495682_0012554_1537_2382 281
3180 3300049460 Ga0495682_0061008 Ga0495682_0061008_470_1315 281
3181 3300049570 Ga0501033_0052069 Ga0501033_0052069_2064_2915 281
3182 3300049571 Ga0501034_0074100 Ga0501034_0074100_728_1576 281
3183 3300049572 Ga0501036_0033415 Ga0501036_0033415_3344_4192 281
3184 3300049572 Ga0501036_0207534 Ga0501036_0207534_363_1214 281
3185 3300049572 Ga0501036_0360482 Ga0501036_0360482_118_990 281
3186 3300049577 Ga0501041_0011028 Ga0501041_0011028_3990_4841 281
3187 3300049578 Ga0501042_0091557 Ga0501042_0091557_151_999 281
3188 3300049578 Ga0501042_0122072 Ga0501042_0122072_209_1057 281
3189 3300049580 Ga0501046_0035965 Ga0501046_0035965_119_967 281
3190 3300049580 Ga0501046_0158582 Ga0501046_0158582_461_1312 281
3191 3300049581 Ga0501047_0021033 Ga0501047_0021033_5349_6197 281
3192 3300049581 Ga0501047_0117323 Ga0501047_0117323_1004_1876 281
3193 3300049582 Ga0501048_0042191 Ga0501048_0042191_2298_3146 281
3194 3300049583 Ga0501067_0027998 Ga0501067_0027998_397_1245 281
3195 3300049584 Ga0501068_0028444 Ga0501068_0028444_1177_2049 281
3196 3300049584 Ga0501068_0191912 Ga0501068_0191912_211_1059 281
3197 3300049585 Ga0501069_0002412 Ga0501069_0002412_7985_8857 281
3198 3300049586 Ga0501070_0002316 Ga0501070_0002316_9446_10318 281
3199 3300049586 Ga0501070_0058803 Ga0501070_0058803_1876_2724 281
3200 3300049586 Ga0501070_0075435 Ga0501070_0075435_970_1842 281
3201 3300049586 Ga0501070_0109144 Ga0501070_0109144_569_1441 281
3202 3300049587 Ga0501071_0029183 Ga0501071_0029183_2505_3353 281
3203 3300049587 Ga0501071_0055975 Ga0501071_0055975_1400_2251 281
3204 3300049588 Ga0501072_0017370 Ga0501072_0017370_2780_3628 281
3205 3300049588 Ga0501072_0116808 Ga0501072_0116808_759_1610 281
3206 3300049589 Ga0501073_0011901 Ga0501073_0011901_3614_4486 281
3207 3300049589 Ga0501073_0052071 Ga0501073_0052071_1700_2548 281
3208 3300049590 Ga0501074_0002551 Ga0501074_0002551_3747_4619 281
3209 3300049591 Ga0501075_0001151 Ga0501075_0001151_6860_7708 281
3210 3300049591 Ga0501075_0201145 Ga0501075_0201145_438_1289 281
3211 3300049592 Ga0501076_0000794 Ga0501076_0000794_8601_9449 281
3212 3300049592 Ga0501076_0056838 Ga0501076_0056838_526_1374 281
3213 3300049592 Ga0501076_0192905 Ga0501076_0192905_309_1160 281
3214 3300049741 Ga0501079_0011571 Ga0501079_0011571_5772_6644 281
3215 3300049741 Ga0501079_0013876 Ga0501079_0013876_496_1344 281
3216 3300049741 Ga0501079_0050332 Ga0501079_0050332_1452_2303 281
3217 3300049741 Ga0501079_0050973 Ga0501079_0050973_166_1017 281
3218 3300049742 Ga0501080_0004208 Ga0501080_0004208_9265_10137 281
3219 3300049742 Ga0501080_0007125 Ga0501080_0007125_2038_2886 281
3220 3300049742 Ga0501080_0017097 Ga0501080_0017097_2979_3830 281
3221 3300049743 Ga0501081_0001465 Ga0501081_0001465_13268_14116 281
3222 3300049744 Ga0501083_0001718 Ga0501083_0001718_4786_5658 281
3223 3300049744 Ga0501083_0034952 Ga0501083_0034952_352_1200 281
3224 3300049822 Ga0501035_0018956 Ga0501035_0018956_4913_5785 281
3225 3300049822 Ga0501035_0120268 Ga0501035_0120268_526_1398 281
3226 3300049824 Ga0501045_0034291 Ga0501045_0034291_2493_3341 281
3227 3300050489 nmdc:mga03683_4308_c1 nmdc:mga03683_4308_c1_1714_2565 281
3228 3300050490 nmdc:mga03n38_145766_c1 nmdc:mga03n38_145766_c1_128_979 281
3229 3300050491 nmdc:mga00v17_109774_c1 nmdc:mga00v17_109774_c1_553_1404 281
3230 3300050491 nmdc:mga00v17_3803_c1 nmdc:mga00v17_3803_c1_5299_6150 281
3231 3300050493 nmdc:mga0k408_1309_c2 nmdc:mga0k408_1309_c2_1285_2142 281
3232 3300050493 nmdc:mga0k408_156637_c1 nmdc:mga0k408_156637_c1_32_880 281
3233 3300050493 nmdc:mga0k408_18725_c2 nmdc:mga0k408_18725_c2_318_1169 281
3234 3300050493 nmdc:mga0k408_31675_c1 nmdc:mga0k408_31675_c1_1787_2638 281
3235 3300050493 nmdc:mga0k408_83732_c1 nmdc:mga0k408_83732_c1_696_1547 281
3236 3300050496 nmdc:mga07m45_11357_c1 nmdc:mga07m45_11357_c1_634_1485 281
3237 3300050496 nmdc:mga07m45_15732_c1 nmdc:mga07m45_15732_c1_1226_2077 281
3238 3300050496 nmdc:mga07m45_3534_c1 nmdc:mga07m45_3534_c1_4327_5178 281
3239 3300050496 nmdc:mga07m45_639_c1 nmdc:mga07m45_639_c1_9432_10283 281
3240 3300050507 nmdc:mga05p37_1155_c1 nmdc:mga05p37_1155_c1_13549_14397 281
3241 3300050507 nmdc:mga05p37_118816_c1 nmdc:mga05p37_118816_c1_2362_3213 281
3242 3300050507 nmdc:mga05p37_21359_c1 nmdc:mga05p37_21359_c1_3855_4703 281
3243 3300050508 nmdc:mga09592_1175_c1 nmdc:mga09592_1175_c1_11513_12361 281
3244 3300050508 nmdc:mga09592_1507_c1 nmdc:mga09592_1507_c1_14660_15508 281
3245 3300050508 nmdc:mga09592_26046_c1 nmdc:mga09592_26046_c1_2919_3767 281
3246 3300050509 nmdc:mga0qj67_11865_c1 nmdc:mga0qj67_11865_c1_1094_1942 281
3247 3300050509 nmdc:mga0qj67_50089_c1 nmdc:mga0qj67_50089_c1_1167_2015 281
3248 3300050509 nmdc:mga0qj67_58959_c1 nmdc:mga0qj67_58959_c1_1466_2314 281
3249 3300050509 nmdc:mga0qj67_81087_c1 nmdc:mga0qj67_81087_c1_1424_2272 281
3250 3300050510 nmdc:mga06r32_115637_c1 nmdc:mga06r32_115637_c1_1782_2630 281
3251 3300050510 nmdc:mga06r32_441282_c1 nmdc:mga06r32_441282_c1_191_1039 281
3252 3300050510 nmdc:mga06r32_58147_c1 nmdc:mga06r32_58147_c1_793_1641 281
3253 3300050510 nmdc:mga06r32_73337_c1 nmdc:mga06r32_73337_c1_2092_2943 281
3254 3300050510 nmdc:mga06r32_91050_c1 nmdc:mga06r32_91050_c1_1809_2657 281
3255 3300050511 nmdc:mga08y16_104382_c1 nmdc:mga08y16_104382_c1_19_867 281
3256 3300050511 nmdc:mga08y16_14999_c1 nmdc:mga08y16_14999_c1_6518_7366 281
3257 3300050511 nmdc:mga08y16_18394_c1 nmdc:mga08y16_18394_c1_484_1335 281
3258 3300050511 nmdc:mga08y16_224_c1 nmdc:mga08y16_224_c1_44668_45516 281
3259 3300050511 nmdc:mga08y16_274570_c1 nmdc:mga08y16_274570_c1_498_1349 281
3260 3300050511 nmdc:mga08y16_6391_c1 nmdc:mga08y16_6391_c1_4668_5516 281
3261 3300050512 nmdc:mga0n895_208220_c1 nmdc:mga0n895_208220_c1_18_869 281
3262 3300050512 nmdc:mga0n895_35549_c1 nmdc:mga0n895_35549_c1_635_1486 281
3263 3300050512 nmdc:mga0n895_5199_c1 nmdc:mga0n895_5199_c1_1067_1915 281
3264 3300050512 nmdc:mga0n895_882707_c1 nmdc:mga0n895_882707_c1_16_867 281
3265 3300050513 nmdc:mga0rr50_143591_c1 nmdc:mga0rr50_143591_c1_796_1644 281
3266 3300050513 nmdc:mga0rr50_2593_c1 nmdc:mga0rr50_2593_c1_478_1326 281
3267 3300050513 nmdc:mga0rr50_27167_c1 nmdc:mga0rr50_27167_c1_2465_3316 281
3268 3300050514 nmdc:mga08x19_108526_c1 nmdc:mga08x19_108526_c1_735_1583 281
3269 3300050514 nmdc:mga08x19_1806_c1 nmdc:mga08x19_1806_c1_11944_12792 281
3270 3300050514 nmdc:mga08x19_18330_c1 nmdc:mga08x19_18330_c1_982_1830 281
3271 3300050514 nmdc:mga08x19_219_c1 nmdc:mga08x19_219_c1_9977_10825 281
3272 3300050515 nmdc:mga0a205_904_c1 nmdc:mga0a205_904_c1_4261_5109 281
3273 3300050516 nmdc:mga0sz30_10668_c1 nmdc:mga0sz30_10668_c1_13_864 281
3274 3300053077 Ga0495601_0225105 Ga0495601_0225105_317_1168 281
3275 3300053079 Ga0500610_0002566 Ga0500610_0002566_1698_2549 281
3276 3300053093 Ga0500651_0031359 Ga0500651_0031359_2108_2959 281
3277 3300053108 Ga0500562_025068 Ga0500562_025068_484_1335 281
3278 3300053118 Ga0500594_0005924 Ga0500594_0005924_1593_2444 281
3279 3300053119 Ga0500595_004168 Ga0500595_004168_382_1233 281
3280 3300053121 Ga0500607_033921 Ga0500607_033921_1793_2644 281
3281 3300053125 Ga0500618_001749 Ga0500618_001749_1243_2094 281
3282 3300053125 Ga0500618_003746 Ga0500618_003746_1755_2606 281
3283 3300053134 Ga0500658_0000507 Ga0500658_0000507_9647_10498 281
3284 3300053136 Ga0500559_0022366 Ga0500559_0022366_601_1452 281
3285 3300053139 Ga0500568_0000554 Ga0500568_0000554_6163_7014 281
3286 3300053140 Ga0500573_0178958 Ga0500573_0178958_128_979 281
3287 3300053142 Ga0500577_0000465 Ga0500577_0000465_8283_9131 281
3288 3300053145 Ga0500586_040283 Ga0500586_040283_135_986 281
3289 3300053153 Ga0500616_0011698 Ga0500616_0011698_1309_2160 281
3290 3300053158 Ga0500627_0031167 Ga0500627_0031167_613_1464 281
3291 3300053161 Ga0500634_0041798 Ga0500634_0041798_244_1095 281
3292 3300053730 Ga0500645_001181 Ga0500645_001181_5288_6139 281
3293 3300054114 Ga0501084_0084750 Ga0501084_0084750_1667_2518 281
3294 3300059421 Ga0590071_030382 Ga0590071_030382_399_1247 281
3295 3300060353 Ga0501082_0057859 Ga0501082_0057859_702_1553 281
3296 3300060353 Ga0501082_0080327 Ga0501082_0080327_1442_2290 281
3297 3300060353 Ga0501082_0163713 Ga0501082_0163713_62_913 281
3298 3300060353 Ga0501082_0180649 Ga0501082_0180649_59_931 281
3299 3300060353 Ga0501082_0263756 Ga0501082_0263756_354_1202 281
3300 3300061719 Ga0466962_0000504 Ga0466962_0000504_884_1729 281
3301 3300061719 Ga0466962_0001146 Ga0466962_0001146_5057_5902 281
3302 3300061719 Ga0466962_0006815 Ga0466962_0006815_3095_3943 281
3303 3300061719 Ga0466962_0024459 Ga0466962_0024459_45_896 281
3304 3300061734 Ga0530510_0000409 Ga0530510_0000409_21787_22635 281
3305 3300061734 Ga0530510_0000684 Ga0530510_0000684_18386_19237 281
3306 3300061734 Ga0530510_0018333 Ga0530510_0018333_3324_4175 281
3307 iso_pu_bacteria 2854601825 2854604204 281
3308 iso_pu_bacteria 2894772417 2894773310 281

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

141

328

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4tqu-assembly1.cif.gz_N crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate 0.8478 3 273
4tqu-assembly1.cif.gz_N crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate 0.8174 3 273
4jbw-assembly2.cif.gz_I crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.8069 1 271
3fh6-assembly2.cif.gz_I crystal structure of the resting state maltose transporter from e. coli 0.8034 1 270
4jbw-assembly1.cif.gz_F crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.8012 55 271
ID Description Score Start End Superfamily
af_P10906_2_274_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9515 2 274 1.10.3720.10
af_P10906_2_274_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9481 2 274 1.10.3720.10
af_L7N652_1_266_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9046 1 273 1.10.3720.10
af_L7N652_1_266_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8982 1 273 1.10.3720.10
af_I6Y1U3_2_266_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8796 4 273 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A4Q9EW21-F1-model_v4 deleted 0.9577 1 281
AF-A0A1N6NSW4-F1-model_v4 sn-glycerol-3-phosphate transport system permease protein UgpE 0.9556 1 281 GO:0005886
GO:0055085
AF-A0A147GYH8-F1-model_v4 deleted 0.9549 1 281
AF-A0A8B4XK96-F1-model_v4 deleted 0.9542 1 281
AF-A0A501S574-F1-model_v4 deleted 0.9537 1 281

Feature Viewer

pLDDT pTM Quality
85.31 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map