F497301

General Info

Members Datasets Scaffolds Average Seq Length
3389 1109 6778 241

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100033046|Ga0070714_1000330463
Length 269
Sequence MPTSRKMSASRKLIWGRGMPDLKMADAAATRPVTAAGTPVLAVQDLQAWYGESHILHGINFNVNAGEVVTLLGRNGAGKTTTLKSVMGIIGKRTGSVLFNGRDIIRASSDKIARMGVAFCPEERGIFASLDVRENLLLPPIVRSGGLSLDQIFELFPNLKERLDSQGTKLSGGEQQMLAIARILRTGARFLMLDEPTEGLAPVIIQQIGHTIARLKKEGFTILLVEQNFRFAATVADRYYIVEHGKVIDGFANADLQANMDKLHTYLGV

Samples

Sample ID Description Type Environment
1 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
4 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
5 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
6 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
7 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
10 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
11 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
12 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
13 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
14 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
15 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
16 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
17 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
18 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
19 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
20 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
21 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
22 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
23 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
24 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
25 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
26 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
27 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
29 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
30 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
31 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
32 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
33 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
34 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
35 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
36 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
37 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
38 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
39 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
40 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
41 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
42 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
43 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
44 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
45 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
46 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
47 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
48 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
49 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
50 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
51 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
52 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
53 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
54 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
55 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
56 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
57 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
58 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
59 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
60 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
61 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
62 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
63 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
64 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
65 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
66 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
67 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
68 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
69 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
70 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
71 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
72 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
73 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
74 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
75 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
76 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
77 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
78 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
79 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
80 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
81 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
82 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
83 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
84 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
85 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
86 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
87 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
88 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
89 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
90 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
91 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
92 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
93 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
94 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
95 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
96 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
97 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
98 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
99 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
100 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
101 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
102 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
103 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
104 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
105 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
106 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
107 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
108 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
109 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
110 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
111 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
112 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
113 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
114 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
115 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
116 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
117 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
118 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
119 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
120 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
121 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
122 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
123 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
124 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
125 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
126 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
127 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
128 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
129 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
130 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
131 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
132 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
133 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
134 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
135 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
136 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
137 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
138 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
139 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
140 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
141 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
142 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
143 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
144 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
145 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
146 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
147 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
148 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
149 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
150 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
151 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
152 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
153 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
154 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
155 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
156 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
157 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
158 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
159 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
160 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
161 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
162 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
163 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
164 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
165 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
166 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
167 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
168 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
169 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
170 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
171 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
172 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
173 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
174 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
175 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
176 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
177 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
178 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
179 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
180 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
181 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
182 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
183 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
184 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
185 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
186 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
187 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
188 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
189 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
190 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
191 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
192 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
193 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
194 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
195 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
196 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
197 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
198 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
199 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
200 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
201 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
203 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
204 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
205 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
206 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
207 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
208 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
209 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
210 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
211 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
212 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
273 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
274 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
275 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
276 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
277 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
279 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
280 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
281 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
282 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
283 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
284 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
285 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
286 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
287 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
288 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
289 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
290 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
291 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
292 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
293 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
294 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
295 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
296 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
298 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
299 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
300 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
301 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
302 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
303 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
304 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
305 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
306 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
307 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
308 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
309 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
310 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
311 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
312 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
313 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
314 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
315 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
316 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
317 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
318 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
319 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
320 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
321 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
322 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
323 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
324 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
325 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
326 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
327 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
328 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
329 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
330 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
331 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
332 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
333 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
334 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
335 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
336 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
337 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
338 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
339 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
340 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
341 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
342 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
343 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
344 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
345 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
346 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
347 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
348 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
349 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
350 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
351 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
352 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
353 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
354 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
355 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
356 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
357 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
358 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
359 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
360 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
361 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
362 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
363 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
364 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
365 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
366 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
367 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
368 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
369 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
370 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
371 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
372 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
373 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
374 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
375 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
376 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
377 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
378 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
379 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
380 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
381 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
382 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
383 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
384 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
385 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
386 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
387 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
388 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
389 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
390 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
391 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
392 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
393 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
394 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
395 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
396 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
397 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
398 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
399 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
400 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
401 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
402 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
403 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
404 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
405 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
406 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
407 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
408 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
409 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
410 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
411 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
412 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
413 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
414 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
415 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
416 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
417 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
418 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
419 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
420 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
421 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
422 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
423 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
424 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
425 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
426 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
427 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
428 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
429 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
430 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
431 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
432 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
433 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
434 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
435 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
436 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
437 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
438 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
439 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
440 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
441 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
442 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
443 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
444 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
445 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
446 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
447 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
448 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
449 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
450 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
451 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
452 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
453 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
454 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
455 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
456 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
457 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
458 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
459 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
460 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
461 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
462 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
463 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
464 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
465 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
466 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
467 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
468 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
469 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
470 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
471 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
472 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
473 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
474 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
475 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
476 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
477 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
478 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
479 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
480 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
481 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
482 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
483 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
484 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
485 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
486 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
487 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
488 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
489 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
490 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
491 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
492 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
493 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
494 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
495 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
496 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
497 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
498 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
499 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
500 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
501 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
502 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
503 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
504 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
505 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
506 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
507 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
508 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
509 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
510 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
511 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
512 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
513 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
514 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
515 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
516 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
517 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
518 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
519 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
520 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
521 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
522 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
523 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
524 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
525 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
526 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
527 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
528 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
529 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
530 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
531 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
532 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
533 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
534 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
535 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
536 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
537 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
538 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
539 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
540 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
541 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
542 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
543 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
544 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
545 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
546 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
547 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
548 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
549 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
550 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
551 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
552 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
553 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
554 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
555 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
556 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
557 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
558 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
559 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
560 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
561 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
562 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
563 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
564 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
565 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
566 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
567 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
568 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
569 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
570 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
571 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
572 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
573 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
574 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
575 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
576 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
577 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
578 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
579 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
580 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
581 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
582 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
583 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
584 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
585 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
586 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
587 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
588 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
589 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
590 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
591 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
592 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
593 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
594 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
595 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
596 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
597 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
598 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
599 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
600 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
601 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
602 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
603 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
604 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
605 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
606 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
607 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
608 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
609 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
610 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
611 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
612 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
613 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
614 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
615 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
616 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
617 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
618 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
619 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
620 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
621 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
622 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
623 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
624 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
625 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
626 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
627 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
628 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
629 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
630 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
631 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
632 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
633 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
634 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
635 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
636 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
637 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
638 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
639 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
640 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
641 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
642 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
643 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
644 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
645 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
646 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
647 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
648 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
649 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
650 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
651 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
652 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
653 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
654 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
655 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
656 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
657 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
658 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
659 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
660 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
661 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
662 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
663 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
664 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
665 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
666 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
667 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
668 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
669 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
670 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
671 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
672 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
673 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
674 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
675 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
676 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
677 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
678 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
679 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
680 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
681 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
682 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
683 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
684 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
685 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
686 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
687 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
688 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
689 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
690 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
691 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
692 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
693 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
694 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
695 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
696 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
697 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
698 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
699 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
700 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
701 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
702 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
703 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
704 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
705 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
706 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
707 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
708 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
709 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
710 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
711 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
712 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
713 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
714 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
715 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
716 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
717 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
718 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
719 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
720 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
721 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
722 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
723 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
724 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
725 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
726 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
727 2643221582 Rhizobium sp. Root651 Isolate Unclassified
728 2643221651 Afipia sp. Root123D2 Isolate Unclassified
729 2643221693 Rhizobium sp. Root491 Isolate Unclassified
730 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
731 2718217882 Rhizobium sp. N741 Isolate Nodule
732 2718217927 Rhizobium sp. N324 Isolate Nodule
733 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
734 2718218009 Rhizobium sp. N561 Isolate Nodule
735 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
736 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
737 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
738 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
739 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
740 2718218363 Rhizobium sp. N113 Isolate Nodule
741 2718218365 Rhizobium sp. N731 Isolate Nodule
742 2718218366 Rhizobium sp. N621 Isolate Nodule
743 2718218423 Rhizobium sp. N941 Isolate Nodule
744 2721755514 Rhizobium sp. N6212 Isolate Nodule
745 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
746 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
747 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
748 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
749 2721755809 Rhizobium sp. N541 Isolate Nodule
750 2721755810 Rhizobium sp. N871 Isolate Nodule
751 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
752 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
753 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
754 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
755 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
756 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
757 2728369365 Rhizobium sp. N1341 Isolate Nodule
758 2728369397 Rhizobium sp. N1314 Isolate Nodule
759 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
760 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
761 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
762 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
763 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
764 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
765 2791355199
766 2791355256 Rhizobium sp. M10 Isolate Nodule
767 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
768 2791355261 Rhizobium sp. J15 Isolate Nodule
769 2791355262 Rhizobium sp. M1 Isolate Nodule
770 2791355263 Rhizobium chutanense C5 Isolate Nodule
771 2791355264 Rhizobium sp. S9 Isolate Nodule
772 2791355265 Rhizobium sp. H4 Isolate Nodule
773 2791355266 Rhizobium sp. L43 Isolate Nodule
774 2791355267 Rhizobium sp. L18 Isolate Nodule
775 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
776 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
777 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
778 2802429633 Rhizobium anhuiense J3 Isolate Nodule
779 2802429634 Rhizobium anhuiense S10 Isolate Nodule
780 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
781 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
782 2802429637 Rhizobium anhuiense C15 Isolate Nodule
783 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
784 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
785 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
786 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
787 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
788 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
789 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
790 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
791 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
792 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
793 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
794 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
795 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
796 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
797 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
798 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
799 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
800 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
801 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
802 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
803 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
804 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
805 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
806 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
807 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
808 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
809 2838048938 Rhizobium pisi 27/80 Isolate Nodule
810 2838061910 Rhizobium phaseoli L15 Isolate Nodule
811 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
812 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
813 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
814 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
815 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
816 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
817 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
818 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
819 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
820 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
821 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
822 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
823 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
824 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
825 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
826 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
827 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
828 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
829 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
830 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
831 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
832 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
833 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
834 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
835 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
836 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
837 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
838 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
839 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
840 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
841 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
842 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
843 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
844 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
845 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
846 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
847 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
848 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
849 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
850 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
851 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
852 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
853 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
854 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
855 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
856 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
857 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
858 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
859 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
860 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
861 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
862 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
863 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
864 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
865 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
866 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
867 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
868 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
869 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
870 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
871 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
872 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
873 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
874 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
875 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
876 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
877 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
878 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
879 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
880 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
881 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
882 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
883 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
884 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
885 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
886 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
887 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
888 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
889 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
890 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
891 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
892 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
893 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
894 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
895 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
896 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
897 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
898 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
899 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
900 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
901 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
902 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
903 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
904 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
905 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
906 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
907 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
908 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
909 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
910 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
911 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
912 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
913 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
914 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
915 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
916 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
917 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
918 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
919 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
920 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
921 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
922 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
923 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
924 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
925 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
926 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
927 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
928 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
929 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
930 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
931 2904699407
932 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
933 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
934 2906610324
935 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
936 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
937 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
938 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
939 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
940 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
941 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
942 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
943 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
944 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
945 2922368715
946 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
947 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
948 2922425934
949 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
950 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
951 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
952 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
953 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
954 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
955 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
956 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
957 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
958 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
959 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
960 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
961 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
962 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
963 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
964 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
965 2933599457 Rhizobium phaseoli M3 Isolate Nodule
966 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
967 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
968 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
969 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
970 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
971 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
972 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
973 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
974 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
975 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
976 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
977 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
978 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
979 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
980 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
981 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
982 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
983 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
984 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
985 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
986 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
987 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
988 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
989 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
990 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
991 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
992 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
993 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
994 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
995 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
996 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
997 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
998 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
999 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
1000 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
1001 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
1002 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
1003 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
1004 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
1005 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
1006 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
1007 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
1008 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
1009 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
1010 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
1011 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
1012 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
1013 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
1014 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
1015 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
1016 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
1017 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
1018 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
1019 2936381700 Rhizobium chutanense C16 Isolate Unclassified
1020 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
1021 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
1022 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
1023 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
1024 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
1025 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
1026 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
1027 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
1028 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
1029 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
1030 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
1031 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
1032 2996893221 Rhizobium sp. R635 Isolate Nodule
1033 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
1034 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
1035 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
1036 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
1037 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
1038 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
1039 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
1040 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
1041 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
1042 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
1043 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
1044 8005275841 Rhizobium sp. N4311 Isolate Nodule
1045 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
1046 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
1047 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
1048 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
1049 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
1050 8005382845 Rhizobium sp. R634 Isolate Nodule
1051 8005395548 Rhizobium sp. R339 Isolate Nodule
1052 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
1053 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
1054 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
1055 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
1056 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
1057 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
1058 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
1059 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
1060 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
1061 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
1062 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
1063 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
1064 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
1065 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
1066 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
1067 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
1068 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
1069 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
1070 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
1071 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
1072 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
1073 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
1074 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
1075 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
1076 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
1077 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
1078 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
1079 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
1080 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
1081 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
1082 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
1083 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
1084 8018176218 Rhizobium sp. N122 Isolate Nodule
1085 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
1086 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
1087 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
1088 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
1089 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
1090 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
1091 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
1092 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
1093 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
1094 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
1095 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
1096 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
1097 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
1098 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
1099 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
1100 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
1101 8024501048 Rhizobium sp. H4 Isolate Nodule
1102 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
1103 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
1104 8056382006 Rhizobium croatiense 13T Isolate Nodule
1105 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
1106 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
1107 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
1108 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule
1109 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.09
Metatranscriptomes 0.06
Isolates 12.85

Biome Distribution

Category Percentage (%)
Aerial Root 0.09
Bulb 0
Endosphere 9.12
Nodule 10.56
Rhizoplane 6.08
Rhizosphere 67.28
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070714_100033046 3300005435 Bacteria 4323
2 2214800749 2209111006 Bacteria 11408
3 ARcpr5oldR_c000100 3300000041 Bacteria 15578
4 ARSoilYngRDRAFT_c00075 3300000042 Bacteria 16753
5 ARSoilOldRDRAFT_c000149 3300000044 Bacteria 11868
6 ARCol0yngRDRAFT_1000031 3300000652 Bacteria 25026
7 JGI24739J22299_10000841 3300001989 Bacteria 11280
8 JGI24739J22299_10002406 3300001989 Bacteria 7218
9 JGI24737J22298_10000354 3300001990 Bacteria 15482
10 JGI24737J22298_10002958 3300001990 Bacteria 6023
11 JGI24737J22298_10019467 3300001990 Bacteria 2171
12 JGI24750J21931_1000181 3300002070 Bacteria 10568
13 JGI24748J21848_1003912 3300002074 Bacteria 1706
14 JGI24744J21845_10006346 3300002077 Bacteria 2455
15 JGI24742J22300_10000268 3300002244 Bacteria 7787
16 JGI25151J46595_10000632 3300003187 Bacteria 30374
17 JGI25151J46595_10004763 3300003187 Bacteria 7118
18 JGI25406J46586_10000047 3300003203 Bacteria 54770
19 JGI25406J46586_10005366 3300003203 Bacteria 5949
20 JGI25406J46586_10009471 3300003203 Bacteria 4359
21 JGI25406J46586_10017560 3300003203 Bacteria 2956
22 JGI25165J46597_1003997 3300003214 Bacteria 3356
23 JGI25165J46597_1017345 3300003214 Bacteria 959
24 JGI25153J46596_10000767 3300003215 Bacteria 19660
25 JGI25153J46596_10011019 3300003215 Bacteria 4032
26 JGI25153J46596_10020476 3300003215 Bacteria 2500
27 rootH2_10047947 3300003320 Bacteria 1499
28 rootL2_10033369 3300003322 Bacteria 1542
29 JGI25160J50197_1000983 3300003354 Bacteria 14834
30 JGI25160J50197_1017322 3300003354 Bacteria 2286
31 JGI25160J50197_1050312 3300003354 Bacteria 889
32 JGI25407J50210_10020206 3300003373 Bacteria 1733
33 JGI25161J50226_1012815 3300003374 Bacteria 991
34 Ga0006562J51391_1007623 3300003578 Bacteria 4340
35 JGI25404J52841_10003960 3300003659 Bacteria 2971
36 JGI25404J52841_10035142 3300003659 Bacteria 1067
37 Ga0055526_1031765 3300003771 Bacteria 1505
38 Ga0055526_1047142 3300003771 Bacteria 1015
39 Ga0055524_1025219 3300003775 Bacteria 1867
40 Ga0058692_1005513 3300003856 Bacteria 3601
41 JGI25405J52794_10000287 3300003911 Bacteria 6886
42 Ga0055543_1006579 3300004625 Bacteria 2788
43 Ga0055543_1007303 3300004625 Bacteria 2571
44 Ga0065165_1000348 3300005262 Bacteria 75762
45 Ga0065165_1011649 3300005262 Bacteria 3640
46 Ga0065165_1029983 3300005262 Bacteria 1735
47 Ga0065717_1002491 3300005276 Bacteria 1897
48 Ga0065716_1002308 3300005277 Bacteria 1954
49 Ga0065704_10079458 3300005289 Bacteria 4156
50 Ga0065712_10000390 3300005290 Bacteria 11890
51 Ga0065712_10070724 3300005290 Bacteria 5761
52 Ga0065712_10076036 3300005290 Bacteria 3745
53 Ga0065712_10088603 3300005290 Bacteria 2511
54 Ga0065715_10089022 3300005293 Bacteria 16633
55 Ga0065715_10089268 3300005293 Bacteria 11746
56 Ga0065715_10101385 3300005293 Bacteria 3211
57 Ga0070658_10015383 3300005327 Bacteria 6123
58 Ga0070658_10122301 3300005327 Bacteria 2163
59 Ga0070658_10180480 3300005327 Bacteria 1776
60 Ga0070658_10205749 3300005327 Bacteria 1662
61 Ga0070658_10216291 3300005327 Bacteria 1620
62 Ga0070658_10261583 3300005327 Bacteria 1470
63 Ga0070676_10060308 3300005328 Bacteria 2252
64 Ga0070676_10062786 3300005328 Bacteria 2211
65 Ga0070676_10093190 3300005328 Bacteria 1849
66 Ga0070676_10227607 3300005328 Bacteria 1234
67 Ga0070683_100001166 3300005329 Bacteria 19905
68 Ga0070683_100005419 3300005329 Bacteria 10655
69 Ga0070683_100073442 3300005329 Bacteria 3194
70 Ga0070683_100089470 3300005329 Bacteria 2889
71 Ga0070690_100000577 3300005330 Bacteria 18482
72 Ga0070690_100004183 3300005330 Bacteria 7989
73 Ga0070690_100025741 3300005330 Bacteria 3624
74 Ga0070690_100209535 3300005330 Bacteria 1360
75 Ga0070690_100351638 3300005330 Bacteria 1070
76 Ga0070690_100493760 3300005330 Bacteria 915
77 Ga0070670_100023361 3300005331 Bacteria 5322
78 Ga0070670_100023984 3300005331 Bacteria 5248
79 Ga0070670_100027483 3300005331 Bacteria 4893
80 Ga0070670_100091837 3300005331 Bacteria 2610
81 Ga0070677_10000126 3300005333 Bacteria 25482
82 Ga0068869_100017818 3300005334 Bacteria 4824
83 Ga0068869_100096406 3300005334 Bacteria 2232
84 Ga0070666_10012294 3300005335 Bacteria 5395
85 Ga0070666_10323131 3300005335 Bacteria 1101
86 Ga0070666_10453982 3300005335 Bacteria 926
87 Ga0070680_100001711 3300005336 Bacteria 16114
88 Ga0070680_100005116 3300005336 Bacteria 9901
89 Ga0070680_100006307 3300005336 Bacteria 9007
90 Ga0070680_100041160 3300005336 Bacteria 3745
91 Ga0070680_100255919 3300005336 Bacteria 1481
92 Ga0070680_100262175 3300005336 Bacteria 1462
93 Ga0070680_100358338 3300005336 Bacteria 1241
94 Ga0070680_100378511 3300005336 Bacteria 1205
95 Ga0070680_100481602 3300005336 Bacteria 1061
96 Ga0070682_100015622 3300005337 Bacteria 4402
97 Ga0070682_100037612 3300005337 Bacteria 2964
98 Ga0070682_100044167 3300005337 Bacteria 2759
99 Ga0070682_100057924 3300005337 Bacteria 2442
100 Ga0070682_100086854 3300005337 Bacteria 2038
101 Ga0070682_100148252 3300005337 Bacteria 1607
102 Ga0068868_100021618 3300005338 Bacteria 4846
103 Ga0068868_100083316 3300005338 Bacteria 2567
104 Ga0068868_100250395 3300005338 Bacteria 1491
105 Ga0070660_100002257 3300005339 Bacteria 13236
106 Ga0070660_100004146 3300005339 Bacteria 10010
107 Ga0070660_100057471 3300005339 Bacteria 3013
108 Ga0070660_100079812 3300005339 Bacteria 2567
109 Ga0070660_100142205 3300005339 Bacteria 1925
110 Ga0070689_100000578 3300005340 Bacteria 22062
111 Ga0070689_100003384 3300005340 Bacteria 10600
112 Ga0070689_100010800 3300005340 Bacteria 6525
113 Ga0070689_100242805 3300005340 Bacteria 1484
114 Ga0070691_10000994 3300005341 Bacteria 11602
115 Ga0070691_10015972 3300005341 Bacteria 3450
116 Ga0070687_100010103 3300005343 Bacteria 4065
117 Ga0070687_100417930 3300005343 Bacteria 884
118 Ga0070661_100000804 3300005344 Bacteria 22558
119 Ga0070661_100034764 3300005344 Bacteria 3656
120 Ga0070661_100051071 3300005344 Bacteria 3026
121 Ga0070661_100057600 3300005344 Bacteria 2847
122 Ga0070661_100065791 3300005344 Bacteria 2663
123 Ga0070661_100224900 3300005344 Bacteria 1440
124 Ga0070692_10000837 3300005345 Bacteria 10325
125 Ga0070692_10003900 3300005345 Bacteria 6147
126 Ga0070692_10148925 3300005345 Bacteria 1331
127 Ga0070668_100001248 3300005347 Bacteria 18134
128 Ga0070668_100007317 3300005347 Bacteria 8189
129 Ga0070668_100283558 3300005347 Bacteria 1384
130 Ga0070669_100129595 3300005353 Bacteria 1933
131 Ga0070669_100163550 3300005353 Bacteria 1731
132 Ga0070669_100238919 3300005353 Bacteria 1442
133 Ga0070669_100421591 3300005353 Bacteria 1095
134 Ga0070675_100028323 3300005354 Bacteria 4509
135 Ga0070675_100060172 3300005354 Bacteria 3135
136 Ga0070675_100161424 3300005354 Bacteria 1927
137 Ga0070675_100179745 3300005354 Bacteria 1829
138 Ga0070675_100206691 3300005354 Bacteria 1705
139 Ga0070675_100222261 3300005354 Bacteria 1645
140 Ga0070675_100497197 3300005354 Bacteria 1098
141 Ga0070671_100004422 3300005355 Bacteria 11117
142 Ga0070671_100008994 3300005355 Bacteria 8015
143 Ga0070671_100034544 3300005355 Bacteria 4185
144 Ga0070671_100074315 3300005355 Bacteria 2840
145 Ga0070671_100160294 3300005355 Bacteria 1902
146 Ga0070674_100039368 3300005356 Bacteria 3191
147 Ga0070674_100064762 3300005356 Bacteria 2563
148 Ga0070674_100081680 3300005356 Bacteria 2310
149 Ga0070674_100126935 3300005356 Bacteria 1896
150 Ga0070674_100167496 3300005356 Bacteria 1672
151 Ga0070673_100000152 3300005364 Bacteria 33183
152 Ga0070673_100014377 3300005364 Bacteria 5510
153 Ga0070673_100270638 3300005364 Bacteria 1487
154 Ga0070688_100000558 3300005365 Bacteria 18862
155 Ga0070688_100007486 3300005365 Bacteria 5889
156 Ga0070688_100010117 3300005365 Bacteria 5187
157 Ga0070688_100048956 3300005365 Bacteria 2628
158 Ga0070688_100059436 3300005365 Bacteria 2410
159 Ga0070688_100086759 3300005365 Bacteria 2037
160 Ga0070688_100667858 3300005365 Bacteria 802
161 Ga0070659_100003307 3300005366 Bacteria 11482
162 Ga0070659_100009498 3300005366 Bacteria 7146
163 Ga0070659_100055803 3300005366 Bacteria 3114
164 Ga0070659_100079952 3300005366 Bacteria 2610
165 Ga0070659_100080795 3300005366 Bacteria 2596
166 Ga0070659_100187662 3300005366 Bacteria 1698
167 Ga0070659_100297639 3300005366 Bacteria 1345
168 Ga0070667_100005640 3300005367 Bacteria 10453
169 Ga0070667_100018732 3300005367 Bacteria 5742
170 Ga0070667_100047274 3300005367 Bacteria 3620
171 Ga0070667_100074024 3300005367 Bacteria 2905
172 Ga0070667_100183725 3300005367 Bacteria 1850
173 Ga0070667_100262914 3300005367 Bacteria 1545
174 Ga0070703_10003642 3300005406 Bacteria 4372
175 Ga0070709_10000782 3300005434 Bacteria 17817
176 Ga0070709_10005372 3300005434 Bacteria 6936
177 Ga0070709_10010922 3300005434 Bacteria 5043
178 Ga0070709_10016344 3300005434 Bacteria 4233
179 Ga0070709_10027248 3300005434 Bacteria 3396
180 Ga0070709_10135202 3300005434 Bacteria 1688
181 Ga0070709_10137539 3300005434 Bacteria 1675
182 Ga0070709_10144826 3300005434 Bacteria 1636
183 Ga0070709_10231696 3300005434 Bacteria 1322
184 Ga0070709_10266370 3300005434 Bacteria 1240
185 Ga0070714_100018005 3300005435 Bacteria 5729
186 Ga0070714_100050850 3300005435 Bacteria 3532
187 Ga0070714_100119265 3300005435 Bacteria 2345
188 Ga0070714_100121603 3300005435 Bacteria 2323
189 Ga0070714_100211017 3300005435 Bacteria 1780
190 Ga0070714_100281333 3300005435 Bacteria 1546
191 Ga0070714_100316487 3300005435 Bacteria 1458
192 Ga0070714_100320387 3300005435 Bacteria 1450
193 Ga0070714_100394202 3300005435 Bacteria 1307
194 Ga0070714_100440951 3300005435 Bacteria 1236
195 Ga0070714_100594327 3300005435 Bacteria 1062
196 Ga0070713_100002911 3300005436 Bacteria 11206
197 Ga0070713_100008027 3300005436 Bacteria 7459
198 Ga0070713_100015728 3300005436 Bacteria 5668
199 Ga0070713_100027065 3300005436 Bacteria 4511
200 Ga0070713_100033179 3300005436 Bacteria 4133
201 Ga0070713_100095040 3300005436 Bacteria 2570
202 Ga0070713_100119577 3300005436 Bacteria 2308
203 Ga0070713_100179251 3300005436 Bacteria 1903
204 Ga0070713_100243742 3300005436 Bacteria 1637
205 Ga0070713_100320745 3300005436 Bacteria 1431
206 Ga0070710_10000207 3300005437 Bacteria 27705
207 Ga0070710_10013899 3300005437 Bacteria 4041
208 Ga0070710_10023389 3300005437 Bacteria 3247
209 Ga0070710_10055347 3300005437 Bacteria 2242
210 Ga0070710_10090957 3300005437 Bacteria 1800
211 Ga0070710_10147473 3300005437 Bacteria 1448
212 Ga0070710_10286330 3300005437 Bacteria 1071
213 Ga0070701_10006958 3300005438 Bacteria 4797
214 Ga0070701_10059353 3300005438 Bacteria 2011
215 Ga0070701_10247617 3300005438 Bacteria 1075
216 Ga0070711_100010118 3300005439 Bacteria 5828
217 Ga0070711_100039542 3300005439 Bacteria 3178
218 Ga0070711_100066166 3300005439 Bacteria 2531
219 Ga0070711_100095419 3300005439 Bacteria 2152
220 Ga0070711_100206065 3300005439 Bacteria 1520
221 Ga0070711_100228999 3300005439 Bacteria 1448
222 Ga0070711_100562228 3300005439 Bacteria 947
223 Ga0070705_100091513 3300005440 Bacteria 1896
224 Ga0070705_100122453 3300005440 Bacteria 1682
225 Ga0070705_100138887 3300005440 Bacteria 1597
226 Ga0070705_100186094 3300005440 Bacteria 1411
227 Ga0070700_100134066 3300005441 Bacteria 1675
228 Ga0070700_100349627 3300005441 Bacteria 1095
229 Ga0070694_100015746 3300005444 Bacteria 4755
230 Ga0070694_100021938 3300005444 Bacteria 4087
231 Ga0070694_100063956 3300005444 Bacteria 2517
232 Ga0070694_100100065 3300005444 Bacteria 2050
233 Ga0070708_100000402 3300005445 Bacteria 32565
234 Ga0070708_100030242 3300005445 Bacteria 4681
235 Ga0070708_100043098 3300005445 Bacteria 3964
236 Ga0070708_100329551 3300005445 Bacteria 1438
237 Ga0070663_100005434 3300005455 Bacteria 7566
238 Ga0070663_100038315 3300005455 Bacteria 3344
239 Ga0070663_100048294 3300005455 Bacteria 3017
240 Ga0070663_100083288 3300005455 Bacteria 2355
241 Ga0070663_100124245 3300005455 Bacteria 1953
242 Ga0070663_100158417 3300005455 Bacteria 1741
243 Ga0070663_100179180 3300005455 Bacteria 1643
244 Ga0070663_100204069 3300005455 Bacteria 1544
245 Ga0070663_100308231 3300005455 Bacteria 1269
246 Ga0070663_100332821 3300005455 Bacteria 1224
247 Ga0070678_100004112 3300005456 Bacteria 8196
248 Ga0070678_100007751 3300005456 Bacteria 6386
249 Ga0070678_100086598 3300005456 Bacteria 2390
250 Ga0070678_100102705 3300005456 Bacteria 2219
251 Ga0070678_100139865 3300005456 Bacteria 1936
252 Ga0070678_100143223 3300005456 Bacteria 1915
253 Ga0070678_100260780 3300005456 Bacteria 1457
254 Ga0070678_100274721 3300005456 Bacteria 1422
255 Ga0070662_100085733 3300005457 Bacteria 2354
256 Ga0070662_100086134 3300005457 Bacteria 2349
257 Ga0070662_100120408 3300005457 Bacteria 2011
258 Ga0070662_100446903 3300005457 Bacteria 1072
259 Ga0070662_100561194 3300005457 Bacteria 957
260 Ga0070681_10014894 3300005458 Bacteria 7732
261 Ga0070681_10025614 3300005458 Bacteria 5934
262 Ga0070681_10030082 3300005458 Bacteria 5449
263 Ga0070681_10035776 3300005458 Bacteria 4988
264 Ga0070681_10037334 3300005458 Bacteria 4876
265 Ga0070681_10042460 3300005458 Bacteria 4556
266 Ga0070681_10044070 3300005458 Bacteria 4465
267 Ga0070681_10055680 3300005458 Bacteria 3937
268 Ga0070681_10099342 3300005458 Bacteria 2856
269 Ga0070681_10190201 3300005458 Bacteria 1972
270 Ga0070681_10225691 3300005458 Bacteria 1788
271 Ga0070681_10263401 3300005458 Bacteria 1636
272 Ga0070681_10270276 3300005458 Bacteria 1611
273 Ga0068867_100017670 3300005459 Bacteria 5063
274 Ga0068867_100030103 3300005459 Bacteria 3915
275 Ga0068867_100102330 3300005459 Bacteria 2189
276 Ga0070685_10013859 3300005466 Bacteria 4263
277 Ga0070685_10015988 3300005466 Bacteria 3991
278 Ga0070685_10104305 3300005466 Bacteria 1736
279 Ga0070685_10143121 3300005466 Bacteria 1508
280 Ga0070685_10156070 3300005466 Bacteria 1451
281 Ga0070685_10265134 3300005466 Bacteria 1144
282 Ga0070685_10318249 3300005466 Bacteria 1054
283 Ga0070706_100008099 3300005467 Bacteria 9801
284 Ga0070706_100074414 3300005467 Bacteria 3144
285 Ga0070706_100157241 3300005467 Bacteria 2122
286 Ga0070706_100167976 3300005467 Bacteria 2048
287 Ga0070706_100336666 3300005467 Bacteria 1407
288 Ga0070707_100001543 3300005468 Bacteria 22396
289 Ga0070707_100005986 3300005468 Bacteria 11345
290 Ga0070698_100004215 3300005471 Bacteria 15801
291 Ga0070698_100008716 3300005471 Bacteria 10926
292 Ga0070698_100166257 3300005471 Bacteria 2149
293 Ga0070698_100266593 3300005471 Bacteria 1645
294 Ga0070698_100513301 3300005471 Bacteria 1137
295 Ga0070699_100000945 3300005518 Bacteria 27089
296 Ga0070699_100025311 3300005518 Bacteria 5118
297 Ga0070699_100174405 3300005518 Bacteria 1906
298 Ga0070679_100005711 3300005530 Bacteria 11536
299 Ga0070679_100020690 3300005530 Bacteria 6418
300 Ga0070679_100021650 3300005530 Bacteria 6277
301 Ga0070679_100029325 3300005530 Bacteria 5429
302 Ga0070679_100044073 3300005530 Bacteria 4444
303 Ga0070679_100073578 3300005530 Bacteria 3408
304 Ga0070679_100100484 3300005530 Bacteria 2879
305 Ga0070679_100103859 3300005530 Bacteria 2828
306 Ga0070679_100153818 3300005530 Bacteria 2276
307 Ga0070679_100212778 3300005530 Bacteria 1896
308 Ga0070679_100308150 3300005530 Bacteria 1533
309 Ga0070679_100378956 3300005530 Bacteria 1361
310 Ga0070679_100546857 3300005530 Bacteria 1102
311 Ga0070679_100760959 3300005530 Bacteria 911
312 Ga0070684_100009657 3300005535 Bacteria 7608
313 Ga0070684_100035950 3300005535 Bacteria 4242
314 Ga0070684_100040713 3300005535 Bacteria 4002
315 Ga0070684_100137077 3300005535 Bacteria 2211
316 Ga0070684_100309103 3300005535 Bacteria 1451
317 Ga0070684_100537840 3300005535 Bacteria 1084
318 Ga0070697_100000582 3300005536 Bacteria 27575
319 Ga0070697_100340285 3300005536 Bacteria 1294
320 Ga0068853_100005841 3300005539 Bacteria 9693
321 Ga0068853_100016544 3300005539 Bacteria 6073
322 Ga0068853_100038445 3300005539 Bacteria 4076
323 Ga0068853_100159443 3300005539 Bacteria 2035
324 Ga0068853_100164770 3300005539 Bacteria 2002
325 Ga0068853_100296674 3300005539 Bacteria 1493
326 Ga0068853_100309640 3300005539 Bacteria 1462
327 Ga0068853_100338018 3300005539 Bacteria 1399
328 Ga0070672_100016204 3300005543 Bacteria 5330
329 Ga0070672_100070477 3300005543 Bacteria 2778
330 Ga0070672_100120831 3300005543 Bacteria 2144
331 Ga0070672_100317905 3300005543 Bacteria 1323
332 Ga0070686_100001565 3300005544 Bacteria 12859
333 Ga0070686_100001691 3300005544 Bacteria 12333
334 Ga0070686_100013506 3300005544 Bacteria 4680
335 Ga0070686_100272813 3300005544 Bacteria 1244
336 Ga0070695_100009605 3300005545 Bacteria 5761
337 Ga0070695_100021403 3300005545 Bacteria 3956
338 Ga0070695_100053539 3300005545 Bacteria 2595
339 Ga0070695_100075998 3300005545 Bacteria 2211
340 Ga0070695_100157036 3300005545 Bacteria 1593
341 Ga0070695_100212054 3300005545 Bacteria 1391
342 Ga0070696_100030304 3300005546 Bacteria 3703
343 Ga0070696_100039589 3300005546 Bacteria 3254
344 Ga0070696_100054727 3300005546 Bacteria 2781
345 Ga0070696_100350032 3300005546 Bacteria 1144
346 Ga0070696_100383842 3300005546 Bacteria 1095
347 Ga0070693_100007514 3300005547 Bacteria 5330
348 Ga0070693_100053519 3300005547 Bacteria 2318
349 Ga0070665_100023837 3300005548 Bacteria 6167
350 Ga0070665_100026731 3300005548 Bacteria 5812
351 Ga0070665_100138461 3300005548 Bacteria 2437
352 Ga0070665_100219757 3300005548 Bacteria 1900
353 Ga0070665_100257120 3300005548 Bacteria 1747
354 Ga0070665_100409363 3300005548 Bacteria 1364
355 Ga0070704_100000428 3300005549 Bacteria 19609
356 Ga0070704_100003017 3300005549 Bacteria 9573
357 Ga0070704_100006216 3300005549 Bacteria 7021
358 Ga0070704_100040512 3300005549 Bacteria 3207
359 Ga0068855_100007720 3300005563 Bacteria 12990
360 Ga0068855_100020644 3300005563 Bacteria 7900
361 Ga0068855_100025903 3300005563 Bacteria 7015
362 Ga0068855_100027404 3300005563 Bacteria 6815
363 Ga0068855_100051955 3300005563 Bacteria 4827
364 Ga0068855_100066294 3300005563 Bacteria 4209
365 Ga0068855_100069332 3300005563 Bacteria 4104
366 Ga0068855_100189794 3300005563 Bacteria 2318
367 Ga0068855_100283572 3300005563 Bacteria 1838
368 Ga0068855_100305283 3300005563 Bacteria 1762
369 Ga0068855_100388409 3300005563 Bacteria 1531
370 Ga0068855_100595429 3300005563 Bacteria 1193
371 Ga0068855_100617164 3300005563 Bacteria 1168
372 Ga0068855_100830046 3300005563 Bacteria 981
373 Ga0068855_101204016 3300005563 Bacteria 787
374 Ga0070664_100130014 3300005564 Bacteria 2211
375 Ga0068857_100003968 3300005577 Bacteria 12457
376 Ga0068857_100004864 3300005577 Bacteria 11393
377 Ga0068857_100031478 3300005577 Bacteria 4688
378 Ga0068857_100045958 3300005577 Bacteria 3874
379 Ga0068857_100048809 3300005577 Bacteria 3756
380 Ga0068857_100102510 3300005577 Bacteria 2569
381 Ga0068857_100254177 3300005577 Bacteria 1611
382 Ga0068857_100330990 3300005577 Bacteria 1408
383 Ga0068857_100375815 3300005577 Bacteria 1319
384 Ga0068854_100020081 3300005578 Bacteria 4512
385 Ga0068854_100097086 3300005578 Bacteria 2202
386 Ga0068854_100147894 3300005578 Bacteria 1809
387 Ga0068854_100437325 3300005578 Bacteria 1090
388 Ga0068854_100486477 3300005578 Bacteria 1037
389 Ga0068856_100001367 3300005614 Bacteria 25662
390 Ga0068856_100006599 3300005614 Bacteria 11374
391 Ga0068856_100020287 3300005614 Bacteria 6455
392 Ga0068856_100061243 3300005614 Bacteria 3717
393 Ga0068856_100062138 3300005614 Bacteria 3689
394 Ga0068856_100098271 3300005614 Bacteria 2917
395 Ga0068856_100149912 3300005614 Bacteria 2341
396 Ga0068856_100208326 3300005614 Bacteria 1970
397 Ga0068856_100751895 3300005614 Bacteria 995
398 Ga0070702_100002620 3300005615 Bacteria 7835
399 Ga0070702_100007155 3300005615 Bacteria 5330
400 Ga0070702_100278065 3300005615 Bacteria 1148
401 Ga0070702_100287218 3300005615 Bacteria 1132
402 Ga0068852_100009344 3300005616 Bacteria 7278
403 Ga0068852_100015291 3300005616 Bacteria 5943
404 Ga0068852_100032482 3300005616 Bacteria 4322
405 Ga0068852_100089333 3300005616 Bacteria 2754
406 Ga0068852_100295216 3300005616 Bacteria 1567
407 Ga0068852_100321595 3300005616 Bacteria 1503
408 Ga0068852_100562400 3300005616 Bacteria 1142
409 Ga0068859_100006242 3300005617 Bacteria 12100
410 Ga0068859_100160203 3300005617 Bacteria 2329
411 Ga0068859_100239615 3300005617 Bacteria 1903
412 Ga0068859_100278339 3300005617 Bacteria 1766
413 Ga0068864_100019207 3300005618 Bacteria 5712
414 Ga0068864_100218327 3300005618 Bacteria 1758
415 Ga0068864_100294705 3300005618 Bacteria 1517
416 Ga0068866_10000301 3300005718 Bacteria 23583
417 Ga0068861_100038262 3300005719 Bacteria 3571
418 Ga0068861_100152700 3300005719 Bacteria 1896
419 Ga0068861_100446622 3300005719 Bacteria 1158
420 Ga0068851_10003991 3300005834 Bacteria 6619
421 Ga0068870_10121826 3300005840 Bacteria 1503
422 Ga0068870_10178263 3300005840 Bacteria 1273
423 Ga0068870_10251628 3300005840 Bacteria 1095
424 Ga0068863_100000340 3300005841 Bacteria 47641
425 Ga0068863_100055280 3300005841 Bacteria 3759
426 Ga0068863_100177223 3300005841 Bacteria 2046
427 Ga0068863_100245582 3300005841 Bacteria 1728
428 Ga0068863_100601333 3300005841 Bacteria 1088
429 Ga0068858_100009915 3300005842 Bacteria 9049
430 Ga0068858_100050734 3300005842 Bacteria 3840
431 Ga0068858_100122486 3300005842 Bacteria 2433
432 Ga0068858_100282461 3300005842 Bacteria 1581
433 Ga0068858_100311040 3300005842 Bacteria 1504
434 Ga0068858_100323371 3300005842 Bacteria 1474
435 Ga0068860_100007133 3300005843 Bacteria 11182
436 Ga0068860_100009824 3300005843 Bacteria 9493
437 Ga0068860_100079139 3300005843 Bacteria 3125
438 Ga0068860_100103522 3300005843 Bacteria 2717
439 Ga0068860_100112463 3300005843 Bacteria 2604
440 Ga0068860_100295567 3300005843 Bacteria 1586
441 Ga0068860_100504565 3300005843 Bacteria 1208
442 Ga0068860_100847774 3300005843 Bacteria 928
443 Ga0068862_100008991 3300005844 Bacteria 8269
444 Ga0068862_100180084 3300005844 Bacteria 1896
445 Ga0081455_10000007 3300005937 Bacteria 269394
446 Ga0081455_10000982 3300005937 Bacteria 36310
447 Ga0081455_10001236 3300005937 Bacteria 31947
448 Ga0081455_10001479 3300005937 Bacteria 29079
449 Ga0081455_10005102 3300005937 Bacteria 14486
450 Ga0081455_10007694 3300005937 Bacteria 11311
451 Ga0081455_10029199 3300005937 Bacteria 5030
452 Ga0081455_10091911 3300005937 Bacteria 2457
453 Ga0081455_10120112 3300005937 Bacteria 2072
454 Ga0081455_10193333 3300005937 Bacteria 1530
455 Ga0081455_10223522 3300005937 Bacteria 1393
456 Ga0081455_10258846 3300005937 Bacteria 1268
457 Ga0081538_10004143 3300005981 Bacteria 13457
458 Ga0081538_10021648 3300005981 Bacteria 4682
459 Ga0081538_10058124 3300005981 Bacteria 2246
460 Ga0081538_10121026 3300005981 Bacteria 1257
461 Ga0081540_1000430 3300005983 Bacteria 41337
462 Ga0081540_1000979 3300005983 Bacteria 25757
463 Ga0081540_1002120 3300005983 Bacteria 16520
464 Ga0081540_1004971 3300005983 Bacteria 9998
465 Ga0081540_1020017 3300005983 Bacteria 4042
466 Ga0081540_1035864 3300005983 Bacteria 2654
467 Ga0081540_1036383 3300005983 Bacteria 2626
468 Ga0081540_1040361 3300005983 Bacteria 2434
469 Ga0081540_1082360 3300005983 Bacteria 1444
470 Ga0081539_10000009 3300005985 Bacteria 509286
471 Ga0081539_10000140 3300005985 Bacteria 166746
472 Ga0081539_10000423 3300005985 Bacteria 89970
473 Ga0081539_10000496 3300005985 Bacteria 82338
474 Ga0081539_10001457 3300005985 Bacteria 40268
475 Ga0081539_10016652 3300005985 Bacteria 5228
476 Ga0081539_10131852 3300005985 Bacteria 1226
477 Ga0070717_10001010 3300006028 Bacteria 18846
478 Ga0070717_10004040 3300006028 Bacteria 10570
479 Ga0070717_10008664 3300006028 Bacteria 7607
480 Ga0070717_10024021 3300006028 Bacteria 4837
481 Ga0070717_10047440 3300006028 Bacteria 3519
482 Ga0070717_10050455 3300006028 Bacteria 3420
483 Ga0070717_10054610 3300006028 Bacteria 3294
484 Ga0070717_10202606 3300006028 Bacteria 1739
485 Ga0070717_10245678 3300006028 Bacteria 1580
486 Ga0070717_10537816 3300006028 Bacteria 1058
487 Ga0070717_10594255 3300006028 Bacteria 1004
488 Ga0075365_10008429 3300006038 Bacteria 5852
489 Ga0075365_10014902 3300006038 Bacteria 4687
490 Ga0075365_10014941 3300006038 Bacteria 4683
491 Ga0075365_10033601 3300006038 Bacteria 3307
492 Ga0075365_10058374 3300006038 Bacteria 2569
493 Ga0075365_10066431 3300006038 Bacteria 2419
494 Ga0075365_10067098 3300006038 Bacteria 2408
495 Ga0075365_10169761 3300006038 Bacteria 1522
496 Ga0075365_10219174 3300006038 Bacteria 1335
497 Ga0075365_10316764 3300006038 Bacteria 1098
498 Ga0075365_10348760 3300006038 Bacteria 1043
499 Ga0075368_10001344 3300006042 Bacteria 7817
500 Ga0075368_10015526 3300006042 Bacteria 2827
501 Ga0075368_10081226 3300006042 Bacteria 1319
502 Ga0075368_10100391 3300006042 Bacteria 1188
503 Ga0075368_10110550 3300006042 Bacteria 1133
504 Ga0075363_100032084 3300006048 Bacteria 2726
505 Ga0075363_100034423 3300006048 Bacteria 2644
506 Ga0075363_100096491 3300006048 Bacteria 1632
507 Ga0075363_100134114 3300006048 Bacteria 1391
508 Ga0075363_100184498 3300006048 Bacteria 1188
509 Ga0075364_10010235 3300006051 Bacteria 5657
510 Ga0075364_10111207 3300006051 Bacteria 1828
511 Ga0075364_10131363 3300006051 Bacteria 1681
512 Ga0075364_10147114 3300006051 Bacteria 1587
513 Ga0075364_10251608 3300006051 Bacteria 1201
514 Ga0075432_10003516 3300006058 Bacteria 5310
515 Ga0070715_10000384 3300006163 Bacteria 11062
516 Ga0070715_10007897 3300006163 Bacteria 3682
517 Ga0070715_10038700 3300006163 Bacteria 1982
518 Ga0070715_10105027 3300006163 Bacteria 1324
519 Ga0070715_10138648 3300006163 Bacteria 1179
520 Ga0070716_100002683 3300006173 Bacteria 8234
521 Ga0070716_100031449 3300006173 Bacteria 2886
522 Ga0070716_100136624 3300006173 Bacteria 1558
523 Ga0070716_100223375 3300006173 Bacteria 1267
524 Ga0070716_100256142 3300006173 Bacteria 1195
525 Ga0070712_100029585 3300006175 Bacteria 3673
526 Ga0070712_100039975 3300006175 Bacteria 3212
527 Ga0070712_100073082 3300006175 Bacteria 2458
528 Ga0070712_100140252 3300006175 Bacteria 1844
529 Ga0070712_100144436 3300006175 Bacteria 1819
530 Ga0070712_100154674 3300006175 Bacteria 1764
531 Ga0070712_100161624 3300006175 Bacteria 1730
532 Ga0070712_100166907 3300006175 Bacteria 1705
533 Ga0070712_100187099 3300006175 Bacteria 1617
534 Ga0070712_100269324 3300006175 Bacteria 1368
535 Ga0075362_10003234 3300006177 Bacteria 5651
536 Ga0075362_10004260 3300006177 Bacteria 5111
537 Ga0075362_10031905 3300006177 Bacteria 2283
538 Ga0075362_10073459 3300006177 Bacteria 1565
539 Ga0075362_10276865 3300006177 Bacteria 829
540 Ga0075367_10001631 3300006178 Bacteria 9753
541 Ga0075367_10005140 3300006178 Bacteria 6460
542 Ga0075367_10025671 3300006178 Bacteria 3334
543 Ga0075367_10030507 3300006178 Bacteria 3091
544 Ga0075367_10100305 3300006178 Bacteria 1769
545 Ga0075367_10334591 3300006178 Bacteria 955
546 Ga0075369_10000309 3300006186 Bacteria 14533
547 Ga0075369_10004732 3300006186 Bacteria 5050
548 Ga0075369_10043763 3300006186 Bacteria 1922
549 Ga0075369_10090032 3300006186 Bacteria 1368
550 Ga0075369_10169305 3300006186 Bacteria 1003
551 Ga0075427_10000215 3300006194 Bacteria 5937
552 Ga0075366_10002759 3300006195 Bacteria 9084
553 Ga0075366_10023686 3300006195 Bacteria 3577
554 Ga0075366_10029384 3300006195 Bacteria 3229
555 Ga0075366_10038610 3300006195 Bacteria 2820
556 Ga0075366_10195852 3300006195 Bacteria 1228
557 Ga0075366_10351209 3300006195 Bacteria 905
558 Ga0097621_100000880 3300006237 Bacteria 21059
559 Ga0097621_100010144 3300006237 Bacteria 6876
560 Ga0097621_100019547 3300006237 Bacteria 5201
561 Ga0097621_100718780 3300006237 Bacteria 921
562 Ga0075370_10003972 3300006353 Bacteria 7107
563 Ga0075370_10006733 3300006353 Bacteria 5799
564 Ga0075370_10010136 3300006353 Bacteria 4913
565 Ga0075370_10031999 3300006353 Bacteria 2938
566 Ga0075370_10061765 3300006353 Bacteria 2134
567 Ga0075370_10194498 3300006353 Bacteria 1196
568 Ga0068871_100000301 3300006358 Bacteria 34368
569 Ga0068871_100058078 3300006358 Bacteria 3149
570 Ga0068871_100071098 3300006358 Bacteria 2861
571 Ga0068871_100296754 3300006358 Bacteria 1417
572 Ga0068871_100465748 3300006358 Bacteria 1135
573 Ga0075428_100003180 3300006844 Bacteria 17952
574 Ga0075428_100010432 3300006844 Bacteria 10318
575 Ga0075428_100014642 3300006844 Bacteria 8709
576 Ga0075428_100015421 3300006844 Bacteria 8470
577 Ga0075428_100028697 3300006844 Bacteria 6156
578 Ga0075428_100056741 3300006844 Bacteria 4288
579 Ga0075428_100108279 3300006844 Bacteria 3029
580 Ga0075428_100149018 3300006844 Bacteria 2542
581 Ga0075428_100363717 3300006844 Bacteria 1552
582 Ga0075430_100000201 3300006846 Bacteria 40551
583 Ga0075430_100010309 3300006846 Bacteria 7913
584 Ga0075430_100034856 3300006846 Bacteria 4273
585 Ga0075430_100083716 3300006846 Bacteria 2672
586 Ga0075430_100135967 3300006846 Bacteria 2048
587 Ga0075430_100369797 3300006846 Bacteria 1184
588 Ga0075431_100000260 3300006847 Bacteria 40551
589 Ga0075431_100000689 3300006847 Bacteria 29038
590 Ga0075431_100002486 3300006847 Bacteria 17768
591 Ga0075431_100006419 3300006847 Bacteria 11673
592 Ga0075431_100012575 3300006847 Bacteria 8542
593 Ga0075431_100029122 3300006847 Bacteria 5681
594 Ga0075431_100053455 3300006847 Bacteria 4164
595 Ga0075431_100348250 3300006847 Bacteria 1490
596 Ga0075433_10000007 3300006852 Bacteria 75995
597 Ga0075433_10005682 3300006852 Bacteria 9802
598 Ga0075433_10006405 3300006852 Bacteria 9308
599 Ga0075433_10090718 3300006852 Bacteria 2701
600 Ga0075433_10124855 3300006852 Bacteria 2286
601 Ga0075433_10144262 3300006852 Bacteria 2117
602 Ga0075433_10300544 3300006852 Bacteria 1421
603 Ga0075434_100000091 3300006871 Bacteria 49489
604 Ga0075434_100007954 3300006871 Bacteria 9826
605 Ga0075434_100008472 3300006871 Bacteria 9565
606 Ga0075434_100078187 3300006871 Bacteria 3303
607 Ga0075434_100097944 3300006871 Bacteria 2937
608 Ga0075434_100100400 3300006871 Bacteria 2900
609 Ga0075434_100147653 3300006871 Bacteria 2371
610 Ga0075434_100184464 3300006871 Bacteria 2107
611 Ga0075434_100210667 3300006871 Bacteria 1964
612 Ga0075434_100232819 3300006871 Bacteria 1862
613 Ga0075434_100378720 3300006871 Bacteria 1436
614 Ga0075434_100437183 3300006871 Bacteria 1329
615 Ga0075434_100614417 3300006871 Bacteria 1106
616 Ga0075429_100001824 3300006880 Bacteria 17627
617 Ga0075429_100025360 3300006880 Bacteria 5146
618 Ga0075429_100033460 3300006880 Bacteria 4467
619 Ga0075429_100074414 3300006880 Bacteria 2959
620 Ga0075429_100546581 3300006880 Bacteria 1015
621 Ga0068865_100003545 3300006881 Bacteria 9367
622 Ga0068865_100091169 3300006881 Bacteria 2211
623 Ga0068865_100244320 3300006881 Bacteria 1414
624 Ga0075436_100000911 3300006914 Bacteria 19696
625 Ga0075436_100004744 3300006914 Bacteria 9328
626 Ga0075436_100013383 3300006914 Bacteria 5620
627 Ga0075436_100015016 3300006914 Bacteria 5309
628 Ga0097620_100006242 3300006931 Bacteria 12100
629 Ga0097620_100160199 3300006931 Bacteria 2329
630 Ga0097620_100239613 3300006931 Bacteria 1903
631 Ga0097620_100278309 3300006931 Bacteria 1766
632 Ga0099825_1037418 3300006941 Bacteria 1606
633 Ga0099825_1047582 3300006941 Bacteria 1009
634 Ga0099824_1006204 3300006942 Bacteria 16518
635 Ga0099824_1027442 3300006942 Bacteria 2749
636 Ga0099822_1022012 3300006943 Bacteria 6078
637 Ga0099823_1052075 3300006944 Bacteria 2455
638 Ga0099826_10001282 3300006948 Bacteria 14779
639 Ga0099826_10013390 3300006948 Bacteria 6198
640 Ga0075435_100010439 3300007076 Bacteria 6794
641 Ga0075435_100013156 3300007076 Bacteria 6148
642 Ga0075435_100177767 3300007076 Bacteria 1798
643 Ga0075435_100262117 3300007076 Bacteria 1473
644 Ga0099794_10004713 3300007265 Bacteria 5401
645 Ga0099794_10016781 3300007265 Bacteria 3252
646 Ga0099794_10031309 3300007265 Bacteria 2490
647 Ga0099795_10008607 3300007788 Bacteria 2919
648 Ga0099795_10013140 3300007788 Bacteria 2533
649 Ga0099795_10021859 3300007788 Bacteria 2104
650 Ga0099795_10034530 3300007788 Bacteria 1762
651 Ga0099795_10050216 3300007788 Bacteria 1516
652 Ga0099795_10052355 3300007788 Bacteria 1491
653 Ga0099795_10073784 3300007788 Bacteria 1292
654 Ga0099795_10097297 3300007788 Bacteria 1149
655 Ga0099795_10124368 3300007788 Bacteria 1035
656 Ga0105251_10142346 3300009011 Bacteria 1085
657 Ga0105244_10031022 3300009036 Bacteria 2839
658 Ga0105250_10010344 3300009092 Bacteria 3887
659 Ga0105250_10072694 3300009092 Bacteria 1390
660 Ga0105240_10002078 3300009093 Bacteria 32819
661 Ga0105240_10008497 3300009093 Bacteria 14684
662 Ga0105240_10010726 3300009093 Bacteria 12859
663 Ga0105240_10018492 3300009093 Bacteria 9354
664 Ga0105240_10049019 3300009093 Bacteria 5335
665 Ga0105240_10072340 3300009093 Bacteria 4261
666 Ga0105240_10073858 3300009093 Bacteria 4211
667 Ga0105240_10359146 3300009093 Bacteria 1651
668 Ga0111539_10001672 3300009094 Bacteria 29559
669 Ga0111539_10005053 3300009094 Bacteria 17137
670 Ga0111539_10013178 3300009094 Bacteria 10337
671 Ga0111539_10013469 3300009094 Bacteria 10221
672 Ga0111539_10080073 3300009094 Bacteria 3842
673 Ga0111539_10096925 3300009094 Bacteria 3464
674 Ga0111539_10117210 3300009094 Bacteria 3122
675 Ga0111539_10135906 3300009094 Bacteria 2879
676 Ga0111539_10150026 3300009094 Bacteria 2729
677 Ga0111539_10207765 3300009094 Bacteria 2282
678 Ga0111539_10465857 3300009094 Bacteria 1471
679 Ga0111539_10513109 3300009094 Bacteria 1396
680 Ga0111539_10792160 3300009094 Bacteria 1103
681 Ga0105245_10010701 3300009098 Bacteria 7981
682 Ga0105245_10060879 3300009098 Bacteria 3401
683 Ga0105245_10209089 3300009098 Bacteria 1877
684 Ga0105245_10340683 3300009098 Bacteria 1483
685 Ga0105245_10438750 3300009098 Bacteria 1312
686 Ga0105245_10663566 3300009098 Bacteria 1074
687 Ga0105245_10963198 3300009098 Bacteria 897
688 Ga0105247_10002113 3300009101 Bacteria 13737
689 Ga0105247_10017859 3300009101 Bacteria 4255
690 Ga0105247_10048912 3300009101 Bacteria 2598
691 Ga0105247_10071195 3300009101 Bacteria 2174
692 Ga0105247_10126326 3300009101 Bacteria 1663
693 Ga0114129_10002772 3300009147 Bacteria 24406
694 Ga0114129_10002794 3300009147 Bacteria 24351
695 Ga0114129_10007261 3300009147 Bacteria 15774
696 Ga0114129_10007546 3300009147 Bacteria 15485
697 Ga0114129_10008566 3300009147 Bacteria 14580
698 Ga0114129_10013314 3300009147 Bacteria 11724
699 Ga0114129_10040031 3300009147 Bacteria 6610
700 Ga0114129_10063809 3300009147 Bacteria 5141
701 Ga0114129_10177583 3300009147 Bacteria 2900
702 Ga0114129_10410765 3300009147 Bacteria 1782
703 Ga0114129_10560926 3300009147 Bacteria 1484
704 Ga0105243_10004021 3300009148 Bacteria 11712
705 Ga0105243_10004388 3300009148 Bacteria 11162
706 Ga0105243_10484939 3300009148 Bacteria 1168
707 Ga0105243_10599478 3300009148 Bacteria 1060
708 Ga0105241_10001943 3300009174 Bacteria 15638
709 Ga0105241_10071648 3300009174 Bacteria 2691
710 Ga0105241_10090226 3300009174 Bacteria 2416
711 Ga0105241_10119444 3300009174 Bacteria 2121
712 Ga0105241_10139492 3300009174 Bacteria 1972
713 Ga0105241_10193359 3300009174 Bacteria 1695
714 Ga0105241_10221398 3300009174 Bacteria 1591
715 Ga0105242_10007706 3300009176 Bacteria 8285
716 Ga0105242_10066498 3300009176 Bacteria 2977
717 Ga0105242_10075610 3300009176 Bacteria 2805
718 Ga0105248_10003102 3300009177 Bacteria 18407
719 Ga0105248_10016902 3300009177 Bacteria 8033
720 Ga0105248_10028593 3300009177 Bacteria 6212
721 Ga0105248_10091386 3300009177 Bacteria 3428
722 Ga0105248_10132194 3300009177 Bacteria 2816
723 Ga0105248_10485094 3300009177 Bacteria 1393
724 Ga0105248_11237321 3300009177 Bacteria 844
725 Ga0105237_10008804 3300009545 Bacteria 10884
726 Ga0105237_10017102 3300009545 Bacteria 7523
727 Ga0105237_10023507 3300009545 Bacteria 6314
728 Ga0105237_10026985 3300009545 Bacteria 5866
729 Ga0105237_10037680 3300009545 Bacteria 4886
730 Ga0105237_10042457 3300009545 Bacteria 4586
731 Ga0105237_10047336 3300009545 Bacteria 4323
732 Ga0105237_10063264 3300009545 Bacteria 3698
733 Ga0105237_10070520 3300009545 Bacteria 3491
734 Ga0105237_10128445 3300009545 Bacteria 2529
735 Ga0105237_10156862 3300009545 Bacteria 2273
736 Ga0105237_10241685 3300009545 Bacteria 1807
737 Ga0105237_10509819 3300009545 Bacteria 1209
738 Ga0105237_10632019 3300009545 Bacteria 1077
739 Ga0105237_10781819 3300009545 Bacteria 961
740 Ga0105238_10029110 3300009551 Bacteria 5627
741 Ga0105238_10031635 3300009551 Bacteria 5387
742 Ga0105238_10040037 3300009551 Bacteria 4750
743 Ga0105238_10048490 3300009551 Bacteria 4280
744 Ga0105238_10075579 3300009551 Bacteria 3360
745 Ga0105238_10141315 3300009551 Bacteria 2384
746 Ga0105238_10188485 3300009551 Bacteria 2039
747 Ga0105238_10420653 3300009551 Bacteria 1331
748 Ga0105249_10001599 3300009553 Bacteria 19830
749 Ga0105249_10107423 3300009553 Bacteria 2634
750 Ga0105249_10192532 3300009553 Bacteria 1991
751 Ga0105249_10215942 3300009553 Bacteria 1885
752 Ga0105249_10352903 3300009553 Bacteria 1490
753 Ga0105249_10370927 3300009553 Bacteria 1455
754 Ga0105249_10633846 3300009553 Bacteria 1126
755 Ga0123341_1000115 3300009765 Bacteria 35967
756 Ga0123342_1042230 3300009766 Bacteria 1616
757 Ga0099796_10005583 3300010159 Bacteria 3147
758 Ga0099796_10054629 3300010159 Bacteria 1397
759 Ga0099796_10104958 3300010159 Bacteria 1068
760 Ga0099796_10111679 3300010159 Bacteria 1041
761 Ga0105239_10005426 3300010375 Bacteria 14965
762 Ga0105239_10009271 3300010375 Bacteria 11127
763 Ga0105239_10009752 3300010375 Bacteria 10796
764 Ga0105239_10010937 3300010375 Bacteria 10137
765 Ga0105239_10027788 3300010375 Bacteria 6225
766 Ga0105239_10049782 3300010375 Bacteria 4595
767 Ga0105239_10071911 3300010375 Bacteria 3801
768 Ga0105239_10117803 3300010375 Bacteria 2947
769 Ga0105239_10202041 3300010375 Bacteria 2226
770 Ga0105239_10438958 3300010375 Bacteria 1480
771 Ga0105239_10461300 3300010375 Bacteria 1442
772 Ga0105239_10531558 3300010375 Bacteria 1338
773 Ga0105239_11112449 3300010375 Bacteria 909
774 Ga0105246_10003677 3300011119 Bacteria 9284
775 Ga0105246_10103040 3300011119 Bacteria 2082
776 Ga0105246_10213527 3300011119 Bacteria 1508
777 Ga0105246_10493502 3300011119 Bacteria 1038
778 Ga0105246_10678471 3300011119 Bacteria 900
779 Ga0157344_1001670 3300012476 Bacteria 1089
780 Ga0157336_1003074 3300012477 Bacteria 983
781 Ga0157335_1001681 3300012492 Bacteria 1247
782 Ga0157347_1003344 3300012502 Bacteria 1434
783 Ga0157327_1001684 3300012512 Bacteria 1428
784 Ga0157373_10000761 3300013100 Bacteria 24994
785 Ga0157373_10012576 3300013100 Bacteria 6222
786 Ga0157373_10203328 3300013100 Bacteria 1396
787 Ga0157373_10215732 3300013100 Bacteria 1353
788 Ga0157373_10525250 3300013100 Bacteria 857
789 Ga0157371_10067213 3300013102 Bacteria 2537
790 Ga0157371_10169010 3300013102 Bacteria 1562
791 Ga0157370_10002006 3300013104 Bacteria 25031
792 Ga0157370_10009940 3300013104 Bacteria 10072
793 Ga0157370_10018929 3300013104 Bacteria 6923
794 Ga0157370_10028738 3300013104 Bacteria 5467
795 Ga0157370_10295611 3300013104 Bacteria 1496
796 Ga0157370_10330629 3300013104 Bacteria 1405
797 Ga0157369_10003343 3300013105 Bacteria 19049
798 Ga0157369_10016056 3300013105 Bacteria 8423
799 Ga0157369_10050781 3300013105 Bacteria 4489
800 Ga0157369_10191299 3300013105 Bacteria 2150
801 Ga0157369_10248706 3300013105 Bacteria 1856
802 Ga0157369_10256929 3300013105 Bacteria 1822
803 Ga0157374_10001695 3300013296 Bacteria 18451
804 Ga0157374_10102495 3300013296 Bacteria 2745
805 Ga0157374_10123076 3300013296 Bacteria 2505
806 Ga0157374_10308095 3300013296 Bacteria 1567
807 Ga0157378_10003374 3300013297 Bacteria 14202
808 Ga0157378_10010352 3300013297 Bacteria 8141
809 Ga0157378_10054648 3300013297 Bacteria 3555
810 Ga0157378_10444909 3300013297 Bacteria 1285
811 Ga0157378_11205270 3300013297 Bacteria 796
812 Ga0163162_10010828 3300013306 Bacteria 8874
813 Ga0163162_10021289 3300013306 Bacteria 6384
814 Ga0163162_10036548 3300013306 Bacteria 4896
815 Ga0163162_10083180 3300013306 Bacteria 3274
816 Ga0163162_10103908 3300013306 Bacteria 2935
817 Ga0163162_10497537 3300013306 Bacteria 1350
818 Ga0163162_10994381 3300013306 Bacteria 948
819 Ga0163162_11444112 3300013306 Bacteria 783
820 Ga0157372_10004321 3300013307 Bacteria 15190
821 Ga0157372_10144832 3300013307 Bacteria 2740
822 Ga0157372_10373898 3300013307 Bacteria 1661
823 Ga0157372_10401645 3300013307 Bacteria 1597
824 Ga0157372_10450612 3300013307 Bacteria 1500
825 Ga0157375_10043638 3300013308 Bacteria 4350
826 Ga0157375_10102841 3300013308 Bacteria 2943
827 Ga0157375_10117294 3300013308 Bacteria 2767
828 Ga0157375_10144011 3300013308 Bacteria 2512
829 Ga0157375_10437473 3300013308 Bacteria 1474
830 Ga0157375_11437515 3300013308 Bacteria 813
831 Ga0163163_10013922 3300014325 Bacteria 7379
832 Ga0163163_10130170 3300014325 Bacteria 2556
833 Ga0163163_10134865 3300014325 Bacteria 2509
834 Ga0163163_10137066 3300014325 Bacteria 2489
835 Ga0163163_10259466 3300014325 Bacteria 1789
836 Ga0163163_10530928 3300014325 Bacteria 1239
837 Ga0157380_10000891 3300014326 Bacteria 18753
838 Ga0157380_10083169 3300014326 Bacteria 2621
839 Ga0157380_10131678 3300014326 Bacteria 2135
840 Ga0182008_10003568 3300014497 Bacteria 9329
841 Ga0157377_10000517 3300014745 Bacteria 16366
842 Ga0157377_10007948 3300014745 Bacteria 5149
843 Ga0157377_10100674 3300014745 Bacteria 1721
844 Ga0157377_10189732 3300014745 Bacteria 1298
845 Ga0157379_10006391 3300014968 Bacteria 10151
846 Ga0157379_10041791 3300014968 Bacteria 4092
847 Ga0157379_10110359 3300014968 Bacteria 2470
848 Ga0157376_10082196 3300014969 Bacteria 2767
849 Ga0157376_10100398 3300014969 Bacteria 2527
850 Ga0157376_10570416 3300014969 Bacteria 1122
851 Ga0182006_1061042 3300015261 Bacteria 1423
852 Ga0182007_10004862 3300015262 Bacteria 6003
853 Ga0182007_10037820 3300015262 Bacteria 1620
854 Ga0163161_10009345 3300017792 Bacteria 6784
855 Ga0163161_10015874 3300017792 Bacteria 5254
856 Ga0163161_10052525 3300017792 Bacteria 2954
857 Ga0163161_10177779 3300017792 Bacteria 1630
858 Ga0163161_10212177 3300017792 Bacteria 1496
859 Ga0214544_1000002 3300021320 Bacteria 753857
860 Ga0214542_1000001 3300021321 Bacteria 1018696
861 Ga0214545_1000001 3300021324 Bacteria 1092817
862 Ga0214543_1000001 3300021327 Bacteria 776921
863 Ga0213876_10078532 3300021384 Bacteria 1744
864 Ga0213876_10097493 3300021384 Bacteria 1558
865 Ga0213876_10136121 3300021384 Bacteria 1307
866 Ga0213876_10172015 3300021384 Bacteria 1152
867 Ga0213875_10000091 3300021388 Bacteria 104903
868 Ga0213875_10033782 3300021388 Bacteria 2417
869 Ga0213875_10152345 3300021388 Bacteria 1084
870 Ga0209563_100864 3300025230 Bacteria 9008
871 Ga0207425_1003944 3300025245 Bacteria 4580
872 Ga0207425_1006454 3300025245 Bacteria 3205
873 Ga0209677_100423 3300025253 Bacteria 25097
874 Ga0209677_104828 3300025253 Bacteria 3725
875 Ga0209148_1000841 3300025254 Bacteria 21793
876 Ga0209233_1004815 3300025261 Bacteria 4544
877 Ga0209233_1006073 3300025261 Bacteria 3931
878 Ga0209233_1014046 3300025261 Bacteria 2268
879 Ga0207666_1000059 3300025271 Bacteria 19909
880 Ga0209455_1004004 3300025272 Bacteria 4988
881 Ga0209455_1014846 3300025272 Bacteria 1741
882 Ga0209673_1001741 3300025273 Bacteria 18243
883 Ga0209673_1064092 3300025273 Bacteria 903
884 Ga0207673_1000333 3300025290 Bacteria 4735
885 Ga0209025_1000072 3300025294 Bacteria 283452
886 Ga0209025_1000277 3300025294 Bacteria 117930
887 Ga0209025_1060560 3300025294 Bacteria 1420
888 Ga0209564_1002118 3300025295 Bacteria 16837
889 Ga0209564_1003264 3300025295 Bacteria 11319
890 Ga0209758_1000053 3300025297 Bacteria 337751
891 Ga0209758_1000140 3300025297 Bacteria 174267
892 Ga0209758_1000164 3300025297 Bacteria 151759
893 Ga0209758_1000628 3300025297 Bacteria 54130
894 Ga0209758_1001346 3300025297 Bacteria 29651
895 Ga0209758_1002251 3300025297 Bacteria 20027
896 Ga0209758_1002853 3300025297 Bacteria 16777
897 Ga0209758_1003241 3300025297 Bacteria 15100
898 Ga0209758_1019965 3300025297 Bacteria 3198
899 Ga0209256_1006146 3300025299 Bacteria 6496
900 Ga0209256_1048974 3300025299 Bacteria 1032
901 Ga0207426_1000035 3300025302 Bacteria 448327
902 Ga0207426_1000822 3300025302 Bacteria 33249
903 Ga0207426_1002280 3300025302 Bacteria 12650
904 Ga0207426_1002722 3300025302 Bacteria 10753
905 Ga0207426_1011102 3300025302 Bacteria 3454
906 Ga0209051_1000062 3300025303 Bacteria 251081
907 Ga0209051_1007606 3300025303 Bacteria 5897
908 Ga0209257_1002192 3300025304 Bacteria 20207
909 Ga0209257_1002227 3300025304 Bacteria 19938
910 Ga0207697_10016374 3300025315 Bacteria 3054
911 Ga0207697_10030409 3300025315 Bacteria 2210
912 Ga0207697_10045084 3300025315 Bacteria 1815
913 Ga0207656_10094325 3300025321 Bacteria 1363
914 Ga0207653_10002470 3300025885 Bacteria 5874
915 Ga0207692_10000214 3300025898 Bacteria 19493
916 Ga0207692_10000549 3300025898 Bacteria 13336
917 Ga0207692_10001653 3300025898 Bacteria 8431
918 Ga0207692_10041664 3300025898 Bacteria 2275
919 Ga0207692_10300358 3300025898 Bacteria 977
920 Ga0207692_10341178 3300025898 Bacteria 921
921 Ga0207642_10002010 3300025899 Bacteria 6271
922 Ga0207710_10003499 3300025900 Bacteria 6989
923 Ga0207710_10040784 3300025900 Bacteria 2058
924 Ga0207710_10251011 3300025900 Bacteria 884
925 Ga0207688_10000167 3300025901 Bacteria 28809
926 Ga0207688_10012456 3300025901 Bacteria 4627
927 Ga0207688_10037781 3300025901 Bacteria 2679
928 Ga0207688_10062780 3300025901 Bacteria 2095
929 Ga0207688_10100357 3300025901 Bacteria 1671
930 Ga0207688_10165814 3300025901 Bacteria 1311
931 Ga0207680_10042699 3300025903 Bacteria 2654
932 Ga0207680_10539338 3300025903 Bacteria 832
933 Ga0207647_10000712 3300025904 Bacteria 26107
934 Ga0207647_10021442 3300025904 Bacteria 4313
935 Ga0207647_10025278 3300025904 Bacteria 3905
936 Ga0207647_10063221 3300025904 Bacteria 2251
937 Ga0207647_10135897 3300025904 Bacteria 1443
938 Ga0207685_10056378 3300025905 Bacteria 1537
939 Ga0207685_10085059 3300025905 Bacteria 1318
940 Ga0207699_10000379 3300025906 Bacteria 23393
941 Ga0207699_10001444 3300025906 Bacteria 11277
942 Ga0207699_10018629 3300025906 Bacteria 3683
943 Ga0207699_10027860 3300025906 Bacteria 3133
944 Ga0207699_10037725 3300025906 Bacteria 2764
945 Ga0207699_10118069 3300025906 Bacteria 1711
946 Ga0207699_10191024 3300025906 Bacteria 1382
947 Ga0207699_10227305 3300025906 Bacteria 1277
948 Ga0207645_10041500 3300025907 Bacteria 2945
949 Ga0207645_10093821 3300025907 Bacteria 1931
950 Ga0207645_10398653 3300025907 Bacteria 925
951 Ga0207643_10000007 3300025908 Bacteria 171706
952 Ga0207643_10055849 3300025908 Bacteria 2246
953 Ga0207705_10010007 3300025909 Bacteria 6903
954 Ga0207705_10035725 3300025909 Bacteria 3555
955 Ga0207705_10044960 3300025909 Bacteria 3174
956 Ga0207705_10161176 3300025909 Bacteria 1685
957 Ga0207705_10285018 3300025909 Bacteria 1265
958 Ga0207705_10329457 3300025909 Bacteria 1174
959 Ga0207705_10353393 3300025909 Bacteria 1132
960 Ga0207684_10000370 3300025910 Bacteria 60789
961 Ga0207684_10002538 3300025910 Bacteria 18333
962 Ga0207684_10094372 3300025910 Bacteria 2552
963 Ga0207684_10240125 3300025910 Bacteria 1563
964 Ga0207654_10002421 3300025911 Bacteria 9531
965 Ga0207654_10012820 3300025911 Bacteria 4302
966 Ga0207654_10049594 3300025911 Bacteria 2409
967 Ga0207654_10112452 3300025911 Bacteria 1697
968 Ga0207654_10179424 3300025911 Bacteria 1381
969 Ga0207654_10189913 3300025911 Bacteria 1346
970 Ga0207654_10191643 3300025911 Bacteria 1340
971 Ga0207654_10199582 3300025911 Bacteria 1316
972 Ga0207707_10002327 3300025912 Bacteria 17115
973 Ga0207707_10008501 3300025912 Bacteria 8896
974 Ga0207707_10013561 3300025912 Bacteria 7103
975 Ga0207707_10019379 3300025912 Bacteria 5938
976 Ga0207707_10023051 3300025912 Bacteria 5446
977 Ga0207707_10033610 3300025912 Bacteria 4488
978 Ga0207707_10041272 3300025912 Bacteria 4030
979 Ga0207707_10077717 3300025912 Bacteria 2897
980 Ga0207707_10127177 3300025912 Bacteria 2228
981 Ga0207707_10127768 3300025912 Bacteria 2223
982 Ga0207707_10206500 3300025912 Bacteria 1712
983 Ga0207695_10000910 3300025913 Bacteria 53286
984 Ga0207695_10001998 3300025913 Bacteria 31500
985 Ga0207695_10069051 3300025913 Bacteria 3618
986 Ga0207695_10094888 3300025913 Bacteria 2989
987 Ga0207695_10157943 3300025913 Bacteria 2201
988 Ga0207695_10252228 3300025913 Bacteria 1664
989 Ga0207695_10560391 3300025913 Bacteria 1024
990 Ga0207671_10006943 3300025914 Bacteria 9965
991 Ga0207671_10016287 3300025914 Bacteria 5783
992 Ga0207671_10020564 3300025914 Bacteria 5022
993 Ga0207671_10025479 3300025914 Bacteria 4443
994 Ga0207671_10052004 3300025914 Bacteria 3035
995 Ga0207671_10063661 3300025914 Bacteria 2741
996 Ga0207671_10066849 3300025914 Bacteria 2676
997 Ga0207671_10106600 3300025914 Bacteria 2127
998 Ga0207671_10158090 3300025914 Bacteria 1754
999 Ga0207671_10279121 3300025914 Bacteria 1317
1000 Ga0207671_10330476 3300025914 Bacteria 1207
1001 Ga0207671_10398178 3300025914 Bacteria 1095
1002 Ga0207693_10002705 3300025915 Bacteria 15367
1003 Ga0207693_10005995 3300025915 Bacteria 10077
1004 Ga0207693_10008772 3300025915 Bacteria 8263
1005 Ga0207693_10009172 3300025915 Bacteria 8078
1006 Ga0207693_10024965 3300025915 Bacteria 4740
1007 Ga0207693_10026683 3300025915 Bacteria 4570
1008 Ga0207693_10047611 3300025915 Bacteria 3368
1009 Ga0207693_10069177 3300025915 Bacteria 2763
1010 Ga0207693_10077879 3300025915 Bacteria 2596
1011 Ga0207693_10086904 3300025915 Bacteria 2450
1012 Ga0207693_10095753 3300025915 Bacteria 2327
1013 Ga0207693_10130348 3300025915 Bacteria 1977
1014 Ga0207693_10141278 3300025915 Bacteria 1893
1015 Ga0207693_10219164 3300025915 Bacteria 1495
1016 Ga0207693_10257103 3300025915 Bacteria 1370
1017 Ga0207663_10039729 3300025916 Bacteria 2853
1018 Ga0207663_10160610 3300025916 Bacteria 1586
1019 Ga0207663_10206225 3300025916 Bacteria 1421
1020 Ga0207663_10494534 3300025916 Bacteria 949
1021 Ga0207660_10002332 3300025917 Bacteria 12496
1022 Ga0207660_10010845 3300025917 Bacteria 5924
1023 Ga0207660_10082827 3300025917 Bacteria 2361
1024 Ga0207660_10161945 3300025917 Bacteria 1727
1025 Ga0207660_10203637 3300025917 Bacteria 1547
1026 Ga0207660_10230487 3300025917 Bacteria 1456
1027 Ga0207660_10245363 3300025917 Bacteria 1412
1028 Ga0207660_10261735 3300025917 Bacteria 1368
1029 Ga0207660_10502736 3300025917 Bacteria 983
1030 Ga0207662_10000195 3300025918 Bacteria 28315
1031 Ga0207662_10028750 3300025918 Bacteria 3216
1032 Ga0207657_10002386 3300025919 Bacteria 20326
1033 Ga0207657_10008747 3300025919 Bacteria 10247
1034 Ga0207657_10011584 3300025919 Bacteria 8748
1035 Ga0207657_10016670 3300025919 Bacteria 7079
1036 Ga0207657_10058476 3300025919 Bacteria 3317
1037 Ga0207657_10083360 3300025919 Bacteria 2682
1038 Ga0207657_10155807 3300025919 Bacteria 1857
1039 Ga0207657_10186323 3300025919 Bacteria 1676
1040 Ga0207657_10279449 3300025919 Bacteria 1326
1041 Ga0207649_10000944 3300025920 Bacteria 18174
1042 Ga0207649_10044696 3300025920 Bacteria 2713
1043 Ga0207649_10127013 3300025920 Bacteria 1727
1044 Ga0207649_10207708 3300025920 Bacteria 1387
1045 Ga0207652_10004942 3300025921 Bacteria 10792
1046 Ga0207652_10010833 3300025921 Bacteria 7347
1047 Ga0207652_10024031 3300025921 Bacteria 5055
1048 Ga0207652_10033023 3300025921 Bacteria 4356
1049 Ga0207652_10053721 3300025921 Bacteria 3461
1050 Ga0207652_10077551 3300025921 Bacteria 2900
1051 Ga0207652_10111765 3300025921 Bacteria 2423
1052 Ga0207652_10176395 3300025921 Bacteria 1919
1053 Ga0207652_10179839 3300025921 Bacteria 1900
1054 Ga0207652_10452151 3300025921 Bacteria 1158
1055 Ga0207646_10000466 3300025922 Bacteria 54002
1056 Ga0207646_10007223 3300025922 Bacteria 11333
1057 Ga0207646_10101595 3300025922 Bacteria 2578
1058 Ga0207681_10007509 3300025923 Bacteria 6677
1059 Ga0207681_10105247 3300025923 Bacteria 2042
1060 Ga0207681_10167967 3300025923 Bacteria 1660
1061 Ga0207681_10297065 3300025923 Bacteria 1277
1062 Ga0207694_10000157 3300025924 Bacteria 70076
1063 Ga0207694_10015529 3300025924 Bacteria 5742
1064 Ga0207694_10055037 3300025924 Bacteria 3088
1065 Ga0207694_10055889 3300025924 Bacteria 3065
1066 Ga0207694_10138329 3300025924 Bacteria 1957
1067 Ga0207694_10200051 3300025924 Bacteria 1625
1068 Ga0207694_10373063 3300025924 Bacteria 1183
1069 Ga0207650_10001317 3300025925 Bacteria 17984
1070 Ga0207650_10015847 3300025925 Bacteria 5258
1071 Ga0207650_10609690 3300025925 Bacteria 918
1072 Ga0207659_10027512 3300025926 Bacteria 3851
1073 Ga0207659_10058686 3300025926 Bacteria 2763
1074 Ga0207659_10380271 3300025926 Bacteria 1177
1075 Ga0207687_10000072 3300025927 Bacteria 76222
1076 Ga0207687_10065041 3300025927 Bacteria 2589
1077 Ga0207687_10152426 3300025927 Bacteria 1765
1078 Ga0207687_10446443 3300025927 Bacteria 1072
1079 Ga0207700_10003964 3300025928 Bacteria 8661
1080 Ga0207700_10033119 3300025928 Bacteria 3695
1081 Ga0207700_10036417 3300025928 Bacteria 3554
1082 Ga0207700_10043564 3300025928 Bacteria 3297
1083 Ga0207700_10092959 3300025928 Bacteria 2386
1084 Ga0207700_10226812 3300025928 Bacteria 1586
1085 Ga0207700_10270055 3300025928 Bacteria 1459
1086 Ga0207700_10394985 3300025928 Bacteria 1211
1087 Ga0207700_10487580 3300025928 Bacteria 1090
1088 Ga0207664_10009594 3300025929 Bacteria 6800
1089 Ga0207664_10025036 3300025929 Bacteria 4488
1090 Ga0207664_10027649 3300025929 Bacteria 4303
1091 Ga0207664_10042081 3300025929 Bacteria 3564
1092 Ga0207664_10047718 3300025929 Bacteria 3365
1093 Ga0207664_10077102 3300025929 Bacteria 2700
1094 Ga0207664_10171444 3300025929 Bacteria 1857
1095 Ga0207664_10284032 3300025929 Bacteria 1453
1096 Ga0207664_10291382 3300025929 Bacteria 1434
1097 Ga0207644_10002402 3300025931 Bacteria 12066
1098 Ga0207644_10040831 3300025931 Bacteria 3280
1099 Ga0207644_10077073 3300025931 Bacteria 2454
1100 Ga0207644_10371212 3300025931 Bacteria 1165
1101 Ga0207690_10023472 3300025932 Bacteria 3849
1102 Ga0207690_10283892 3300025932 Bacteria 1290
1103 Ga0207690_10347958 3300025932 Bacteria 1171
1104 Ga0207690_10348024 3300025932 Bacteria 1171
1105 Ga0207690_10458217 3300025932 Bacteria 1026
1106 Ga0207706_10022595 3300025933 Bacteria 5645
1107 Ga0207706_10079345 3300025933 Bacteria 2887
1108 Ga0207686_10001034 3300025934 Bacteria 16473
1109 Ga0207686_10176727 3300025934 Bacteria 1511
1110 Ga0207686_10177780 3300025934 Bacteria 1507
1111 Ga0207686_10223801 3300025934 Bacteria 1360
1112 Ga0207709_10021477 3300025935 Bacteria 3655
1113 Ga0207670_10000792 3300025936 Bacteria 16529
1114 Ga0207670_10012298 3300025936 Bacteria 5002
1115 Ga0207670_10062250 3300025936 Bacteria 2550
1116 Ga0207670_10257139 3300025936 Bacteria 1352
1117 Ga0207669_10000176 3300025937 Bacteria 29979
1118 Ga0207669_10028450 3300025937 Bacteria 3075
1119 Ga0207704_10053582 3300025938 Bacteria 2453
1120 Ga0207704_10057976 3300025938 Bacteria 2382
1121 Ga0207704_10102449 3300025938 Bacteria 1912
1122 Ga0207704_10700379 3300025938 Bacteria 838
1123 Ga0207665_10000872 3300025939 Bacteria 20402
1124 Ga0207665_10003514 3300025939 Bacteria 10466
1125 Ga0207665_10026788 3300025939 Bacteria 3807
1126 Ga0207665_10028369 3300025939 Bacteria 3697
1127 Ga0207665_10028429 3300025939 Bacteria 3692
1128 Ga0207665_10093042 3300025939 Bacteria 2093
1129 Ga0207665_10143833 3300025939 Bacteria 1703
1130 Ga0207691_10036748 3300025940 Bacteria 4538
1131 Ga0207691_10179741 3300025940 Bacteria 1849
1132 Ga0207691_10236997 3300025940 Bacteria 1578
1133 Ga0207691_10253609 3300025940 Bacteria 1518
1134 Ga0207711_10001106 3300025941 Bacteria 25759
1135 Ga0207711_10025866 3300025941 Bacteria 4922
1136 Ga0207711_10126085 3300025941 Bacteria 2290
1137 Ga0207711_10131951 3300025941 Bacteria 2241
1138 Ga0207711_10361668 3300025941 Bacteria 1344
1139 Ga0207689_10000366 3300025942 Bacteria 42711
1140 Ga0207689_10209795 3300025942 Bacteria 1609
1141 Ga0207661_10006099 3300025944 Bacteria 8514
1142 Ga0207661_10037631 3300025944 Bacteria 3786
1143 Ga0207661_10045590 3300025944 Bacteria 3471
1144 Ga0207661_10055205 3300025944 Bacteria 3185
1145 Ga0207661_10144897 3300025944 Bacteria 2048
1146 Ga0207661_10171199 3300025944 Bacteria 1890
1147 Ga0207679_10000029 3300025945 Bacteria 183002
1148 Ga0207679_10071063 3300025945 Bacteria 2624
1149 Ga0207679_10107476 3300025945 Bacteria 2195
1150 Ga0207679_10254089 3300025945 Bacteria 1496
1151 Ga0207679_10300147 3300025945 Bacteria 1384
1152 Ga0207667_10011520 3300025949 Bacteria 10275
1153 Ga0207667_10016633 3300025949 Bacteria 8304
1154 Ga0207667_10027880 3300025949 Bacteria 6140
1155 Ga0207667_10029315 3300025949 Bacteria 5969
1156 Ga0207667_10032031 3300025949 Bacteria 5668
1157 Ga0207667_10037424 3300025949 Bacteria 5186
1158 Ga0207667_10099559 3300025949 Bacteria 2999
1159 Ga0207667_10172584 3300025949 Bacteria 2222
1160 Ga0207667_10207765 3300025949 Bacteria 2007
1161 Ga0207667_10336320 3300025949 Bacteria 1541
1162 Ga0207667_10566526 3300025949 Bacteria 1148
1163 Ga0207651_10011383 3300025960 Bacteria 4980
1164 Ga0207651_10095426 3300025960 Bacteria 2190
1165 Ga0207712_10384215 3300025961 Bacteria 1176
1166 Ga0207668_10016219 3300025972 Bacteria 4644
1167 Ga0207668_10026431 3300025972 Bacteria 3768
1168 Ga0207668_10030484 3300025972 Bacteria 3544
1169 Ga0207668_10116433 3300025972 Bacteria 2015
1170 Ga0207640_10001667 3300025981 Bacteria 11922
1171 Ga0207640_10077475 3300025981 Bacteria 2260
1172 Ga0207640_10078611 3300025981 Bacteria 2246
1173 Ga0207640_10334952 3300025981 Bacteria 1210
1174 Ga0207658_10019541 3300025986 Bacteria 4686
1175 Ga0207658_10074005 3300025986 Bacteria 2587
1176 Ga0207658_10088668 3300025986 Bacteria 2393
1177 Ga0207658_10099238 3300025986 Bacteria 2277
1178 Ga0207677_10005872 3300026023 Bacteria 6679
1179 Ga0207677_10033442 3300026023 Bacteria 3318
1180 Ga0207677_10044918 3300026023 Bacteria 2947
1181 Ga0207677_10207323 3300026023 Bacteria 1562
1182 Ga0207677_10256022 3300026023 Bacteria 1424
1183 Ga0207677_10283556 3300026023 Bacteria 1361
1184 Ga0207703_10009816 3300026035 Bacteria 7509
1185 Ga0207703_10067369 3300026035 Bacteria 2946
1186 Ga0207703_10218947 3300026035 Bacteria 1701
1187 Ga0207703_10247021 3300026035 Bacteria 1607
1188 Ga0207703_10340568 3300026035 Bacteria 1378
1189 Ga0207703_10357947 3300026035 Bacteria 1345
1190 Ga0207703_10375033 3300026035 Bacteria 1315
1191 Ga0207703_10508721 3300026035 Bacteria 1131
1192 Ga0207639_10014940 3300026041 Bacteria 5470
1193 Ga0207639_10055535 3300026041 Bacteria 3032
1194 Ga0207639_10055995 3300026041 Bacteria 3020
1195 Ga0207639_10073737 3300026041 Bacteria 2677
1196 Ga0207639_10085694 3300026041 Bacteria 2506
1197 Ga0207639_10120582 3300026041 Bacteria 2154
1198 Ga0207639_10164905 3300026041 Bacteria 1871
1199 Ga0207639_10171439 3300026041 Bacteria 1838
1200 Ga0207639_10284515 3300026041 Bacteria 1455
1201 Ga0207678_10003198 3300026067 Bacteria 14815
1202 Ga0207678_10007352 3300026067 Bacteria 9752
1203 Ga0207678_10016139 3300026067 Bacteria 6558
1204 Ga0207678_10025988 3300026067 Bacteria 5108
1205 Ga0207678_10132969 3300026067 Bacteria 2122
1206 Ga0207678_10146684 3300026067 Bacteria 2014
1207 Ga0207678_10160446 3300026067 Bacteria 1920
1208 Ga0207678_10265400 3300026067 Bacteria 1472
1209 Ga0207678_10276120 3300026067 Bacteria 1442
1210 Ga0207678_10302514 3300026067 Bacteria 1374
1211 Ga0207678_10326914 3300026067 Bacteria 1320
1212 Ga0207678_10429780 3300026067 Bacteria 1146
1213 Ga0207678_10489001 3300026067 Bacteria 1072
1214 Ga0207708_10031621 3300026075 Bacteria 4018
1215 Ga0207708_10078856 3300026075 Bacteria 2529
1216 Ga0207702_10000002 3300026078 Bacteria 491507
1217 Ga0207702_10000761 3300026078 Bacteria 34283
1218 Ga0207702_10039386 3300026078 Bacteria 3959
1219 Ga0207702_10044507 3300026078 Bacteria 3731
1220 Ga0207702_10112569 3300026078 Bacteria 2422
1221 Ga0207702_10168087 3300026078 Bacteria 2008
1222 Ga0207702_10185719 3300026078 Bacteria 1917
1223 Ga0207702_10305397 3300026078 Bacteria 1511
1224 Ga0207702_10399516 3300026078 Bacteria 1325
1225 Ga0207702_10427072 3300026078 Bacteria 1282
1226 Ga0207702_10530684 3300026078 Bacteria 1150
1227 Ga0207641_10049558 3300026088 Bacteria 3549
1228 Ga0207641_10093441 3300026088 Bacteria 2636
1229 Ga0207641_10202804 3300026088 Bacteria 1830
1230 Ga0207641_10249600 3300026088 Bacteria 1657
1231 Ga0207641_10985035 3300026088 Bacteria 839
1232 Ga0207648_10049096 3300026089 Bacteria 3694
1233 Ga0207648_10199900 3300026089 Bacteria 1772
1234 Ga0207676_10011025 3300026095 Bacteria 6452
1235 Ga0207676_10087095 3300026095 Bacteria 2553
1236 Ga0207676_10131033 3300026095 Bacteria 2132
1237 Ga0207676_10179758 3300026095 Bacteria 1851
1238 Ga0207674_10007304 3300026116 Bacteria 12874
1239 Ga0207674_10009531 3300026116 Bacteria 11081
1240 Ga0207674_10032607 3300026116 Bacteria 5462
1241 Ga0207674_10035480 3300026116 Bacteria 5204
1242 Ga0207674_10036525 3300026116 Bacteria 5117
1243 Ga0207674_10070209 3300026116 Bacteria 3522
1244 Ga0207674_10141097 3300026116 Bacteria 2369
1245 Ga0207674_10197551 3300026116 Bacteria 1961
1246 Ga0207675_100005465 3300026118 Bacteria 12176
1247 Ga0207675_100057399 3300026118 Bacteria 3632
1248 Ga0207675_100543894 3300026118 Bacteria 1160
1249 Ga0207683_10005003 3300026121 Bacteria 11387
1250 Ga0207683_10019699 3300026121 Bacteria 5765
1251 Ga0207683_10034410 3300026121 Bacteria 4403
1252 Ga0207683_10170010 3300026121 Bacteria 1974
1253 Ga0207683_10245545 3300026121 Bacteria 1633
1254 Ga0207683_10270199 3300026121 Bacteria 1553
1255 Ga0207683_10354920 3300026121 Bacteria 1346
1256 Ga0207698_10015437 3300026142 Bacteria 5113
1257 Ga0207698_10063007 3300026142 Bacteria 2899
1258 Ga0207698_10091051 3300026142 Bacteria 2496
1259 Ga0207698_10137597 3300026142 Bacteria 2098
1260 Ga0207698_10398835 3300026142 Bacteria 1314
1261 Ga0207698_10426141 3300026142 Bacteria 1274
1262 Ga0207698_10907852 3300026142 Bacteria 888
1263 Ga0209389_1000061 3300027296 Bacteria 105698
1264 Ga0209389_1000201 3300027296 Bacteria 42938
1265 Ga0209371_1000035 3300027312 Bacteria 368979
1266 Ga0209371_1002757 3300027312 Bacteria 9420
1267 Ga0209589_1000001 3300027357 Bacteria 794224
1268 Ga0209589_1000465 3300027357 Bacteria 56891
1269 Ga0209489_100001 3300027361 Bacteria 794224
1270 Ga0209489_100006 3300027361 Bacteria 475698
1271 Ga0209489_100035 3300027361 Bacteria 168255
1272 Ga0209700_100001 3300027363 Bacteria 794224
1273 Ga0209700_100005 3300027363 Bacteria 573969
1274 Ga0209996_1010248 3300027395 Bacteria 1242
1275 Ga0209995_1008058 3300027471 Bacteria 1698
1276 Ga0209970_1005707 3300027614 Bacteria 2050
1277 Ga0210002_1000397 3300027617 Bacteria 5946
1278 Ga0210002_1004078 3300027617 Bacteria 2167
1279 Ga0209282_1000173 3300027666 Bacteria 36304
1280 Ga0209282_1033066 3300027666 Bacteria 3155
1281 Ga0209588_1004305 3300027671 Bacteria 4006
1282 Ga0209588_1006241 3300027671 Bacteria 3455
1283 Ga0209971_1025258 3300027682 Bacteria 1419
1284 Ga0209966_1000488 3300027695 Bacteria 10592
1285 Ga0209966_1007934 3300027695 Bacteria 1871
1286 Ga0209998_10001963 3300027717 Bacteria 4824
1287 Ga0209998_10004329 3300027717 Bacteria 3022
1288 Ga0209813_10006996 3300027866 Bacteria 2800
1289 Ga0209813_10027816 3300027866 Bacteria 1645
1290 Ga0209813_10032548 3300027866 Bacteria 1546
1291 Ga0209974_10000736 3300027876 Bacteria 11197
1292 Ga0209974_10011388 3300027876 Bacteria 2986
1293 Ga0209974_10015099 3300027876 Bacteria 2565
1294 Ga0207428_10000115 3300027907 Bacteria 109072
1295 Ga0207428_10000119 3300027907 Bacteria 106261
1296 Ga0207428_10000228 3300027907 Bacteria 77812
1297 Ga0207428_10001793 3300027907 Bacteria 21978
1298 Ga0207428_10064578 3300027907 Bacteria 2890
1299 Ga0207428_10166459 3300027907 Bacteria 1671
1300 Ga0207428_10204458 3300027907 Bacteria 1485
1301 Ga0207428_10501278 3300027907 Bacteria 882
1302 Ga0207428_10537328 3300027907 Bacteria 846
1303 Ga0268266_10003390 3300028379 Bacteria 15951
1304 Ga0268266_10016724 3300028379 Bacteria 6271
1305 Ga0268266_10019122 3300028379 Bacteria 5833
1306 Ga0268266_10047487 3300028379 Bacteria 3679
1307 Ga0268266_10053036 3300028379 Bacteria 3483
1308 Ga0268266_10125805 3300028379 Bacteria 2287
1309 Ga0268266_10174703 3300028379 Bacteria 1952
1310 Ga0268266_10225690 3300028379 Bacteria 1723
1311 Ga0268266_10518942 3300028379 Bacteria 1139
1312 Ga0268265_10036239 3300028380 Bacteria 3612
1313 Ga0268265_10081296 3300028380 Bacteria 2558
1314 Ga0268265_10197226 3300028380 Bacteria 1743
1315 Ga0268265_10242957 3300028380 Bacteria 1590
1316 Ga0268265_10655818 3300028380 Bacteria 1009
1317 Ga0268264_10000149 3300028381 Bacteria 163972
1318 Ga0268264_10086370 3300028381 Bacteria 2695
1319 Ga0268264_10186362 3300028381 Bacteria 1888
1320 Ga0268264_10198056 3300028381 Bacteria 1836
1321 Ga0268264_10382454 3300028381 Bacteria 1348
1322 Ga0265337_1011528 3300028556 Bacteria 3042
1323 Ga0265326_10002417 3300028558 Bacteria 6290
1324 Ga0265319_1003112 3300028563 Bacteria 8766
1325 Ga0265334_10004574 3300028573 Bacteria 6128
1326 Ga0265318_10002252 3300028577 Bacteria 10404
1327 Ga0265323_10000280 3300028653 Bacteria 29540
1328 Ga0265322_10014531 3300028654 Bacteria 2275
1329 Ga0265336_10000434 3300028666 Bacteria 25752
1330 Ga0307517_10011552 3300028786 Bacteria 12229
1331 Ga0307517_10149715 3300028786 Bacteria 1606
1332 Ga0307515_10000006 3300028794 Bacteria 725810
1333 Ga0307515_10000176 3300028794 Bacteria 157429
1334 Ga0307515_10053707 3300028794 Bacteria 5935
1335 Ga0307515_10076623 3300028794 Bacteria 4432
1336 Ga0307515_10110548 3300028794 Bacteria 3215
1337 Ga0265338_10000776 3300028800 Bacteria 54431
1338 Ga0265338_10013590 3300028800 Bacteria 9173
1339 Ga0265338_10163725 3300028800 Bacteria 1715
1340 Ga0265324_10004764 3300029957 Bacteria 6007
1341 Ga0268256_1000037 3300030500 Bacteria 367024
1342 Ga0268256_1005826 3300030500 Bacteria 4736
1343 Ga0316181_1167445 3300030744 Bacteria 1445
1344 Ga0265760_10032847 3300031090 Bacteria 1533
1345 Ga0265330_10004928 3300031235 Bacteria 6724
1346 Ga0265330_10027061 3300031235 Bacteria 2591
1347 Ga0265330_10050224 3300031235 Bacteria 1829
1348 Ga0265332_10009521 3300031238 Bacteria 4335
1349 Ga0265332_10039774 3300031238 Bacteria 2037
1350 Ga0265325_10000533 3300031241 Bacteria 27589
1351 Ga0265325_10001355 3300031241 Bacteria 17353
1352 Ga0265325_10009757 3300031241 Bacteria 5593
1353 Ga0265325_10019350 3300031241 Bacteria 3765
1354 Ga0265325_10020316 3300031241 Bacteria 3662
1355 Ga0265340_10000710 3300031247 Bacteria 18813
1356 Ga0265339_10011400 3300031249 Bacteria 5472
1357 Ga0265339_10043156 3300031249 Bacteria 2494
1358 Ga0265339_10096182 3300031249 Bacteria 1546
1359 Ga0265339_10116265 3300031249 Bacteria 1379
1360 Ga0265331_10070418 3300031250 Bacteria 1637
1361 Ga0265331_10071852 3300031250 Bacteria 1617
1362 Ga0265331_10113589 3300031250 Bacteria 1241
1363 Ga0265327_10000409 3300031251 Bacteria 79035
1364 Ga0265316_10332060 3300031344 Bacteria 1103
1365 Ga0307509_10093588 3300031507 Bacteria 3066
1366 Ga0307408_100410083 3300031548 Bacteria 1166
1367 Ga0307408_100415758 3300031548 Bacteria 1158
1368 Ga0265313_10000251 3300031595 Bacteria 58545
1369 Ga0265313_10016098 3300031595 Bacteria 4319
1370 Ga0265313_10080588 3300031595 Bacteria 1479
1371 Ga0265313_10113235 3300031595 Bacteria 1191
1372 Ga0307508_10000009 3300031616 Bacteria 256966
1373 Ga0307508_10009580 3300031616 Bacteria 8900
1374 Ga0307508_10044235 3300031616 Bacteria 3985
1375 Ga0307508_10111959 3300031616 Bacteria 2330
1376 Ga0316575_10024525 3300031665 Bacteria 2336
1377 Ga0265314_10006179 3300031711 Bacteria 10637
1378 Ga0265314_10025825 3300031711 Bacteria 4423
1379 Ga0265314_10030417 3300031711 Bacteria 3997
1380 Ga0265314_10051642 3300031711 Bacteria 2863
1381 Ga0265314_10164678 3300031711 Bacteria 1345
1382 Ga0265342_10005706 3300031712 Bacteria 9411
1383 Ga0265342_10023698 3300031712 Bacteria 3881
1384 Ga0265342_10050434 3300031712 Bacteria 2486
1385 Ga0265342_10051164 3300031712 Bacteria 2466
1386 Ga0265342_10113152 3300031712 Bacteria 1534
1387 Ga0265342_10148148 3300031712 Bacteria 1305
1388 Ga0316576_10031265 3300031727 Bacteria 3776
1389 Ga0316578_10003963 3300031728 Bacteria 6901
1390 Ga0316578_10016422 3300031728 Bacteria 4007
1391 Ga0307516_10002828 3300031730 Bacteria 22862
1392 Ga0307516_10008211 3300031730 Bacteria 11855
1393 Ga0307516_10044284 3300031730 Bacteria 4404
1394 Ga0307516_10052133 3300031730 Bacteria 4007
1395 Ga0307516_10100062 3300031730 Bacteria 2715
1396 Ga0307410_10234493 3300031852 Bacteria 1419
1397 Ga0307412_10035375 3300031911 Bacteria 3191
1398 Ga0307412_10068659 3300031911 Bacteria 2411
1399 Ga0307412_10264995 3300031911 Bacteria 1342
1400 Ga0307409_100254278 3300031995 Bacteria 1608
1401 Ga0307409_100414580 3300031995 Bacteria 1290
1402 Ga0307409_100581707 3300031995 Bacteria 1104
1403 Ga0307416_100095977 3300032002 Bacteria 2562
1404 Ga0307416_100113109 3300032002 Bacteria 2398
1405 Ga0307416_100367627 3300032002 Bacteria 1463
1406 Ga0307414_10436817 3300032004 Bacteria 1145
1407 Ga0307411_10107028 3300032005 Bacteria 1992
1408 Ga0307411_10126807 3300032005 Bacteria 1858
1409 Ga0307415_100170678 3300032126 Bacteria 1696
1410 Ga0307507_10099505 3300033179 Bacteria 2442
1411 Ga0307510_10005184 3300033180 Bacteria 15491
1412 Ga0307510_10052336 3300033180 Bacteria 4306
1413 Ga0307510_10063180 3300033180 Bacteria 3774
1414 Ga0307510_10064293 3300033180 Bacteria 3727
1415 Ga0315911_1000006 3300033442 Bacteria 414563
1416 Ga0316215_1000454 3300033544 Bacteria 4706
1417 Ga0373930_0000193 3300034816 Bacteria 7392
1418 Ga0373930_0007999 3300034816 Bacteria 1838
1419 Ga0373930_0019964 3300034816 Bacteria 1302
1420 Ga0373950_0014938 3300034818 Bacteria 1312
1421 Ga0373958_0000120 3300034819 Bacteria 8568
1422 Ga0373958_0000654 3300034819 Bacteria 4356
1423 Ga0373959_0002191 3300034820 Bacteria 3113
1424 Ga0373938_0000272 3300034957 Bacteria 8203
1425 Ga0373938_0002483 3300034957 Bacteria 2978
1426 Ga0373938_0012749 3300034957 Bacteria 1583
1427 Ga0373938_0042745 3300034957 Bacteria 1012
1428 Ga0373926_0002200 3300035083 Bacteria 6148
1429 Ga0373926_0015814 3300035083 Bacteria 2575
1430 Ga0373926_0064125 3300035083 Bacteria 1342
1431 Ga0373928_0000209 3300035084 Bacteria 11317
1432 Ga0373928_0007184 3300035084 Bacteria 2147
1433 Ga0373929_0000164 3300035085 Bacteria 11604
1434 Ga0373929_0008483 3300035085 Bacteria 1894
1435 Ga0373929_0012164 3300035085 Bacteria 1633
1436 Ga0373929_0018963 3300035085 Bacteria 1373
1437 Ga0373934_0011816 3300035086 Bacteria 3289
1438 Ga0373934_0015364 3300035086 Bacteria 2904
1439 Ga0373934_0020467 3300035086 Bacteria 2542
1440 Ga0373940_0024995 3300035088 Bacteria 1552
1441 Ga0373944_0041265 3300035089 Bacteria 1427
1442 Ga0373949_0000798 3300035090 Bacteria 10057
1443 Ga0373949_0004138 3300035090 Bacteria 3355
1444 Ga0373949_0041832 3300035090 Bacteria 1129
1445 Ga0373951_0000288 3300035091 Bacteria 16139
1446 Ga0373951_0004006 3300035091 Bacteria 3533
1447 Ga0373952_0000289 3300035092 Bacteria 8323
1448 Ga0373952_0003744 3300035092 Bacteria 2748
1449 Ga0373952_0024274 3300035092 Bacteria 1301
1450 Ga0373923_0001901 3300035111 Bacteria 6231
1451 Ga0373923_0003839 3300035111 Bacteria 4891
1452 Ga0373923_0023040 3300035111 Bacteria 2446
1453 Ga0373923_0058755 3300035111 Bacteria 1629
1454 Ga0373923_0076644 3300035111 Bacteria 1444
1455 Ga0373932_0000818 3300035112 Bacteria 9217
1456 Ga0373932_0002835 3300035112 Bacteria 4291
1457 Ga0373932_0096930 3300035112 Bacteria 954
1458 Ga0373936_0000311 3300035113 Bacteria 16394
1459 Ga0373936_0012550 3300035113 Bacteria 3225
1460 Ga0373936_0095975 3300035113 Bacteria 1247
1461 Ga0373936_0113187 3300035113 Bacteria 1154
1462 Ga0373936_0133874 3300035113 Bacteria 1067
1463 Ga0373936_0160493 3300035113 Bacteria 979
1464 Ga0373939_0001805 3300035114 Bacteria 5152
1465 Ga0373939_0002107 3300035114 Bacteria 4739
1466 Ga0373939_0037814 3300035114 Bacteria 1436
1467 Ga0373941_0000513 3300035115 Bacteria 7759
1468 Ga0373941_0006287 3300035115 Bacteria 2852
1469 Ga0373945_0007021 3300035116 Bacteria 3643
1470 Ga0373945_0008578 3300035116 Bacteria 3332
1471 Ga0373953_0018550 3300035117 Bacteria 2576
1472 Ga0373953_0020421 3300035117 Bacteria 2475
1473 Ga0373953_0031174 3300035117 Bacteria 2072
1474 Ga0373954_0001502 3300035118 Bacteria 9487
1475 Ga0373954_0011301 3300035118 Bacteria 3954
1476 Ga0373954_0015057 3300035118 Bacteria 3454
1477 Ga0373954_0015610 3300035118 Bacteria 3396
1478 Ga0373954_0017814 3300035118 Bacteria 3193
1479 Ga0373954_0035383 3300035118 Bacteria 2316
1480 Ga0373954_0060395 3300035118 Bacteria 1788
1481 Ga0373954_0066420 3300035118 Bacteria 1708
1482 Ga0373954_0170363 3300035118 Bacteria 1066
1483 Ga0373956_0006863 3300035119 Bacteria 4571
1484 Ga0373956_0009778 3300035119 Bacteria 3906
1485 Ga0373956_0046454 3300035119 Bacteria 1940
1486 Ga0373956_0085482 3300035119 Bacteria 1451
1487 Ga0373957_0010573 3300035120 Bacteria 3055
1488 Ga0373957_0016267 3300035120 Bacteria 2573
1489 Ga0373957_0037905 3300035120 Bacteria 1802
1490 Ga0373957_0039897 3300035120 Bacteria 1763
1491 Ga0373960_0108659 3300035121 Bacteria 907
1492 Ga0373943_0001913 3300035170 Bacteria 9421
1493 Ga0373943_0002342 3300035170 Bacteria 8607
1494 Ga0373943_0015577 3300035170 Bacteria 3456
1495 Ga0373943_0028239 3300035170 Bacteria 2643
1496 Ga0373943_0046733 3300035170 Bacteria 2113
1497 Ga0373943_0048727 3300035170 Bacteria 2077
1498 Ga0373946_0003909 3300035171 Bacteria 5300
1499 Ga0373946_0005256 3300035171 Bacteria 4668
1500 Ga0373946_0005318 3300035171 Bacteria 4640
1501 Ga0373946_0009447 3300035171 Bacteria 3593
1502 Ga0373946_0023791 3300035171 Bacteria 2396
1503 Ga0373946_0026456 3300035171 Bacteria 2289
1504 Ga0373946_0154702 3300035171 Bacteria 1072
1505 Ga0373946_0175518 3300035171 Bacteria 1014
1506 Ga0373946_0182050 3300035171 Bacteria 998
1507 Ga0373946_0209885 3300035171 Bacteria 936
1508 Ga0373955_0000367 3300035172 Bacteria 19049
1509 Ga0373955_0000424 3300035172 Bacteria 17800
1510 Ga0373955_0000593 3300035172 Bacteria 15421
1511 Ga0373955_0001743 3300035172 Bacteria 9330
1512 Ga0373955_0005474 3300035172 Bacteria 5709
1513 Ga0373955_0046006 3300035172 Bacteria 2357
1514 Ga0373955_0232349 3300035172 Bacteria 1103
1515 Ga0373942_0099018 3300035207 Bacteria 888
1516 Ga0373961_0000196 3300035241 Bacteria 28662
1517 Ga0373961_0010213 3300035241 Bacteria 2310
1518 Ga0373961_0018104 3300035241 Bacteria 1836
1519 Ga0373961_0019220 3300035241 Bacteria 1792
1520 Ga0373961_0027175 3300035241 Bacteria 1569
1521 Ga0373961_0030025 3300035241 Bacteria 1509
1522 Ga0373962_0000667 3300035242 Bacteria 7822
1523 Ga0373962_0000793 3300035242 Bacteria 7207
1524 Ga0373962_0011451 3300035242 Bacteria 2224
1525 Ga0316574_0002397 3300035398 Bacteria 9382
1526 Ga0316574_0022360 3300035398 Bacteria 3763
1527 Ga0373924_0000989 3300035410 Bacteria 9006
1528 Ga0373924_0005031 3300035410 Bacteria 4653
1529 Ga0373924_0010401 3300035410 Bacteria 3428
1530 Ga0373924_0012620 3300035410 Bacteria 3159
1531 Ga0373924_0018693 3300035410 Bacteria 2675
1532 Ga0373924_0114024 3300035410 Bacteria 1170
1533 Ga0373931_0001664 3300035691 Bacteria 9623
1534 Ga0373931_0003298 3300035691 Bacteria 7226
1535 Ga0373931_0010248 3300035691 Bacteria 4502
1536 Ga0373931_0018423 3300035691 Bacteria 3473
1537 Ga0373931_0028120 3300035691 Bacteria 2875
1538 Ga0373931_0090060 3300035691 Bacteria 1708
1539 Ga0373931_0287849 3300035691 Bacteria 1011
1540 Ga0373935_0000602 3300035692 Bacteria 18790
1541 Ga0373935_0000644 3300035692 Bacteria 18381
1542 Ga0373935_0008200 3300035692 Bacteria 6261
1543 Ga0373935_0020975 3300035692 Bacteria 3996
1544 Ga0373935_0051822 3300035692 Bacteria 2607
1545 Ga0373927_0000069 3300035695 Bacteria 74096
1546 Ga0373927_0009820 3300035695 Bacteria 6415
1547 Ga0373927_0032735 3300035695 Bacteria 3386
1548 Ga0373927_0045167 3300035695 Bacteria 2850
1549 Ga0373927_0051893 3300035695 Bacteria 2652
1550 Ga0373927_0057647 3300035695 Bacteria 2511
1551 Ga0373927_0058470 3300035695 Bacteria 2493
1552 Ga0373927_0105981 3300035695 Bacteria 1830
1553 Ga0373927_0124048 3300035695 Bacteria 1686
1554 Ga0373927_0161597 3300035695 Bacteria 1467
1555 Ga0373933_0000445 3300035724 Bacteria 25820
1556 Ga0373933_0000588 3300035724 Bacteria 22728
1557 Ga0373933_0002509 3300035724 Bacteria 10318
1558 Ga0373933_0005388 3300035724 Bacteria 6964
1559 Ga0373933_0006376 3300035724 Bacteria 6421
1560 Ga0373933_0009054 3300035724 Bacteria 5433
1561 Ga0373933_0040462 3300035724 Bacteria 2747
1562 Ga0373933_0091342 3300035724 Bacteria 1879
1563 Ga0373947_0000288 3300035725 Bacteria 28482
1564 Ga0373947_0000385 3300035725 Bacteria 24888
1565 Ga0373947_0001014 3300035725 Bacteria 17141
1566 Ga0373947_0001401 3300035725 Bacteria 14834
1567 Ga0373947_0024081 3300035725 Bacteria 3545
1568 Ga0373947_0025175 3300035725 Bacteria 3470
1569 Ga0373947_0042886 3300035725 Bacteria 2701
1570 Ga0373947_0111249 3300035725 Bacteria 1731
1571 Ga0373947_0128475 3300035725 Bacteria 1616
1572 Ga0373947_0143861 3300035725 Bacteria 1531
1573 Ga0373947_0345954 3300035725 Bacteria 997
1574 Ga0373937_0000073 3300036401 Bacteria 91771
1575 Ga0373937_0000996 3300036401 Bacteria 24045
1576 Ga0373937_0001508 3300036401 Bacteria 19561
1577 Ga0373937_0001798 3300036401 Bacteria 18015
1578 Ga0373937_0038193 3300036401 Bacteria 4376
1579 Ga0373937_0040386 3300036401 Bacteria 4253
1580 Ga0373937_0069584 3300036401 Bacteria 3245
1581 Ga0373937_0165478 3300036401 Bacteria 2074
1582 Ga0373937_0205404 3300036401 Bacteria 1852
1583 Ga0373937_0340176 3300036401 Bacteria 1421
1584 Ga0316582_0173380 3300036647 Bacteria 1465
1585 Ga0316584_0020146 3300036712 Bacteria 4831
1586 Ga0316584_0063209 3300036712 Bacteria 2771
1587 Ga0373925_0000055 3300037068 Bacteria 123638
1588 Ga0373925_0001787 3300037068 Bacteria 17936
1589 Ga0373925_0002967 3300037068 Bacteria 13392
1590 Ga0373925_0023950 3300037068 Bacteria 4454
1591 Ga0373925_0031253 3300037068 Bacteria 3912
1592 Ga0373925_0047380 3300037068 Bacteria 3199
1593 Ga0373925_0054013 3300037068 Bacteria 3004
1594 Ga0373925_0093009 3300037068 Bacteria 2307
1595 Ga0373925_0106834 3300037068 Bacteria 2158
1596 Ga0373925_0414618 3300037068 Bacteria 1100
1597 Ga0373925_0661327 3300037068 Bacteria 861
1598 Ga0395899_0072113 3300037312 Bacteria 2527
1599 Ga0395899_0091057 3300037312 Bacteria 2210
1600 Ga0395899_0093488 3300037312 Bacteria 2176
1601 Ga0395899_0116923 3300037312 Bacteria 1913
1602 Ga0395899_0387096 3300037312 Bacteria 928
1603 Ga0395900_0003151 3300037418 Bacteria 17891
1604 Ga0395900_0007859 3300037418 Bacteria 10990
1605 Ga0395900_0019170 3300037418 Bacteria 6975
1606 Ga0395900_0022268 3300037418 Bacteria 6483
1607 Ga0395900_0057396 3300037418 Bacteria 4008
1608 Ga0395900_0396471 3300037418 Bacteria 1345
1609 Ga0395900_0608930 3300037418 Bacteria 1032
1610 Ga0395900_0679561 3300037418 Bacteria 964
1611 Ga0395898_0002243 3300037466 Bacteria 23493
1612 Ga0395898_0002749 3300037466 Bacteria 20281
1613 Ga0395898_0009024 3300037466 Bacteria 10497
1614 Ga0395898_0030570 3300037466 Bacteria 5389
1615 Ga0395898_0073653 3300037466 Bacteria 3299
1616 Ga0395898_0159575 3300037466 Bacteria 2157
1617 Ga0395898_0186442 3300037466 Bacteria 1983
1618 Ga0395898_0188310 3300037466 Bacteria 1972
1619 Ga0395898_0248528 3300037466 Bacteria 1696
1620 Ga0395898_0506490 3300037466 Bacteria 1148
1621 Ga0395898_0614965 3300037466 Bacteria 1029
1622 Ga0395898_0624824 3300037466 Bacteria 1020
1623 Ga0395905_0038754 3300037471 Bacteria 4470
1624 Ga0395905_0560285 3300037471 Bacteria 1044
1625 Ga0395905_0598851 3300037471 Bacteria 1004
1626 Ga0436364_0154921 3300037853 Bacteria 3496
1627 Ga0436364_0914936 3300037853 Bacteria 3878
1628 Ga0436364_1198940 3300037853 Bacteria 1632
1629 Ga0436364_1490833 3300037853 Bacteria 1641
1630 Ga0436364_1553220 3300037853 Bacteria 76403
1631 Ga0395901_0005463 3300038443 Bacteria 12866
1632 Ga0395901_0015298 3300038443 Bacteria 7807
1633 Ga0395901_0028377 3300038443 Bacteria 5754
1634 Ga0395901_0066722 3300038443 Bacteria 3748
1635 Ga0395901_0112837 3300038443 Bacteria 2854
1636 Ga0395901_0369533 3300038443 Bacteria 1477
1637 Ga0395901_0378724 3300038443 Bacteria 1457
1638 Ga0395901_0955708 3300038443 Bacteria 835
1639 Ga0436365_0011601 3300039437 Bacteria 1395
1640 Ga0436365_0088563 3300039437 Bacteria 10412
1641 Ga0436365_0100417 3300039437 Bacteria 960
1642 Ga0436365_0606602 3300039437 Bacteria 1315
1643 Ga0436365_0613407 3300039437 Bacteria 2810
1644 Ga0436365_0638285 3300039437 Bacteria 2326
1645 Ga0436365_0952142 3300039437 Bacteria 3441
1646 Ga0436365_0991224 3300039437 Bacteria 1879
1647 Ga0436365_1156283 3300039437 Bacteria 1445
1648 Ga0436365_1678428 3300039437 Bacteria 1191
1649 Ga0436365_1704080 3300039437 Bacteria 7107
1650 Ga0436360_0827604 3300039438 Bacteria 879
1651 Ga0436360_1055266 3300039438 Bacteria 2090
1652 Ga0436360_1105678 3300039438 Bacteria 2638
1653 Ga0436361_0031089 3300039447 Bacteria 2421
1654 Ga0436361_0090327 3300039447 Bacteria 4097
1655 Ga0436361_0211396 3300039447 Bacteria 1899
1656 Ga0436361_0713381 3300039447 Bacteria 1943
1657 Ga0436361_1027368 3300039447 Bacteria 8549
1658 Ga0436363_0631544 3300039450 Bacteria 3728
1659 Ga0436363_1327161 3300039450 Bacteria 939
1660 Ga0436362_0054978 3300039453 Bacteria 1041
1661 Ga0436362_0227087 3300039453 Bacteria 1014
1662 Ga0436362_1231365 3300039453 Bacteria 1069
1663 Ga0439453_0009873 3300041408 Bacteria 1563
1664 Ga0439465_0053487 3300041413 Bacteria 1327
1665 Ga0451797_1242110 3300041453 Bacteria 1419
1666 Ga0451833_0043958 3300041491 Bacteria 1455
1667 Ga0451833_1331165 3300041491 Bacteria 2097
1668 Ga0451835_0654905 3300041492 Bacteria 1559
1669 Ga0451839_0188649 3300041496 Bacteria 1102
1670 Ga0451839_0648225 3300041496 Bacteria 1333
1671 Ga0451841_1200378 3300041498 Bacteria 978
1672 Ga0451845_0542334 3300041501 Bacteria 1871
1673 Ga0451847_0191157 3300041503 Bacteria 2063
1674 Ga0451843_0434796 3300041509 Bacteria 1192
1675 Ga0451853_0212274 3300041512 Bacteria 992
1676 Ga0439441_000256 3300042001 Bacteria 5211
1677 Ga0439448_0024228 3300042005 Bacteria 1897
1678 Ga0439450_001710 3300042008 Bacteria 3275
1679 Ga0439455_0032483 3300042012 Bacteria 1305
1680 Ga0439456_008814 3300042013 Bacteria 2085
1681 Ga0450911_007104 3300042115 Bacteria 1637
1682 Ga0450923_018482 3300042125 Bacteria 1334
1683 Ga0439444_0000843 3300042437 Bacteria 3709
1684 Ga0439460_0010710 3300042461 Bacteria 2354
1685 Ga0439460_0013080 3300042461 Bacteria 2165
1686 Ga0451577_0001635 3300042876 Bacteria 29060
1687 Ga0451577_0142797 3300042876 Bacteria 2152
1688 Ga0466969_0012275 3300044656 Bacteria 4523
1689 Ga0466969_0155954 3300044656 Bacteria 1050
1690 Ga0466972_0000189 3300044658 Bacteria 47501
1691 Ga0466972_0019592 3300044658 Bacteria 3382
1692 Ga0453683_0005758 3300044673 Bacteria 8595
1693 Ga0453683_0006980 3300044673 Bacteria 7698
1694 Ga0466965_0137646 3300044683 Bacteria 1269
1695 Ga0466966_0000196 3300044684 Bacteria 40708
1696 Ga0466966_0016313 3300044684 Bacteria 4912
1697 Ga0466966_0064302 3300044684 Bacteria 2310
1698 Ga0466961_0000239 3300044693 Bacteria 36887
1699 Ga0466963_0035708 3300044694 Bacteria 3239
1700 Ga0466963_0077082 3300044694 Bacteria 2252
1701 Ga0466963_0081881 3300044694 Bacteria 2187
1702 Ga0466963_0188018 3300044694 Bacteria 1443
1703 Ga0466964_0249136 3300044706 Bacteria 875
1704 Ga0453684_0026520 3300044712 Bacteria 8362
1705 Ga0466971_0083555 3300044719 Bacteria 1458
1706 Ga0466968_0003867 3300044735 Bacteria 5560
1707 Ga0466970_0093988 3300044765 Bacteria 1629
1708 Ga0466957_0054521 3300044842 Bacteria 2441
1709 Ga0466957_0361451 3300044842 Bacteria 987
1710 Ga0466960_0068898 3300044901 Bacteria 1756
1711 Ga0466959_0012195 3300045049 Bacteria 6203
1712 Ga0466959_0021923 3300045049 Bacteria 4718
1713 Ga0466959_0242055 3300045049 Bacteria 1246
1714 Ga0451576_0138866 3300045051 Bacteria 2535
1715 Ga0451576_0158822 3300045051 Bacteria 2359
1716 Ga0466967_0153889 3300045976 Bacteria 2152
1717 Ga0466967_0175380 3300045976 Bacteria 2019
1718 Ga0466967_0217970 3300045976 Bacteria 1812
1719 Ga0466967_0303736 3300045976 Bacteria 1536
1720 Ga0495592_0000408 3300046454 Bacteria 32792
1721 Ga0495592_0001873 3300046454 Bacteria 14799
1722 Ga0495592_0005376 3300046454 Bacteria 9453
1723 Ga0495592_0006702 3300046454 Bacteria 8590
1724 Ga0495592_0047310 3300046454 Bacteria 3203
1725 Ga0495592_0057851 3300046454 Bacteria 2861
1726 Ga0495592_0104215 3300046454 Bacteria 2017
1727 Ga0495592_0105939 3300046454 Bacteria 1997
1728 Ga0495592_0174373 3300046454 Bacteria 1470
1729 Ga0495592_0178499 3300046454 Bacteria 1448
1730 Ga0495603_0000429 3300046455 Bacteria 23279
1731 Ga0495603_0000847 3300046455 Bacteria 17534
1732 Ga0495603_0004251 3300046455 Bacteria 8529
1733 Ga0495603_0006331 3300046455 Bacteria 7084
1734 Ga0495603_0008544 3300046455 Bacteria 6188
1735 Ga0495603_0017980 3300046455 Bacteria 4278
1736 Ga0495603_0086940 3300046455 Bacteria 1829
1737 Ga0495603_0099034 3300046455 Bacteria 1702
1738 Ga0495629_0000083 3300046459 Bacteria 83715
1739 Ga0495629_0000183 3300046459 Bacteria 56534
1740 Ga0495629_0002130 3300046459 Bacteria 15353
1741 Ga0495629_0009616 3300046459 Bacteria 7061
1742 Ga0495629_0014325 3300046459 Bacteria 5706
1743 Ga0495629_0023416 3300046459 Bacteria 4400
1744 Ga0495629_0205058 3300046459 Bacteria 1362
1745 Ga0495629_0236505 3300046459 Bacteria 1258
1746 Ga0495629_0292959 3300046459 Bacteria 1115
1747 Ga0495638_0000399 3300046460 Bacteria 53351
1748 Ga0495638_0019634 3300046460 Bacteria 4470
1749 Ga0495638_0086100 3300046460 Bacteria 1900
1750 Ga0495638_0089498 3300046460 Bacteria 1857
1751 Ga0495641_0007011 3300046461 Bacteria 7155
1752 Ga0495641_0024188 3300046461 Bacteria 3002
1753 Ga0495641_0091479 3300046461 Bacteria 1359
1754 Ga0495641_0127686 3300046461 Bacteria 1135
1755 Ga0495651_0001256 3300046462 Bacteria 19642
1756 Ga0495651_0004686 3300046462 Bacteria 10466
1757 Ga0495651_0009898 3300046462 Bacteria 7329
1758 Ga0495651_0013879 3300046462 Bacteria 6233
1759 Ga0495651_0040157 3300046462 Bacteria 3640
1760 Ga0495651_0051027 3300046462 Bacteria 3191
1761 Ga0495651_0058133 3300046462 Bacteria 2967
1762 Ga0495651_0064718 3300046462 Bacteria 2794
1763 Ga0495651_0072710 3300046462 Bacteria 2611
1764 Ga0495653_0000003 3300046463 Bacteria 377892
1765 Ga0495653_0001017 3300046463 Bacteria 21626
1766 Ga0495653_0027582 3300046463 Bacteria 4544
1767 Ga0495653_0074698 3300046463 Bacteria 2525
1768 Ga0495653_0091118 3300046463 Bacteria 2229
1769 Ga0495653_0109805 3300046463 Bacteria 1984
1770 Ga0495653_0131991 3300046463 Bacteria 1767
1771 Ga0495653_0249709 3300046463 Bacteria 1178
1772 Ga0495580_0000716 3300046472 Bacteria 28310
1773 Ga0495580_0004389 3300046472 Bacteria 11850
1774 Ga0495580_0017791 3300046472 Bacteria 5302
1775 Ga0495580_0024614 3300046472 Bacteria 4404
1776 Ga0495580_0198453 3300046472 Bacteria 1383
1777 Ga0495582_0000094 3300046473 Bacteria 45642
1778 Ga0495582_0006958 3300046473 Bacteria 6290
1779 Ga0495582_0034865 3300046473 Bacteria 2766
1780 Ga0495582_0056861 3300046473 Bacteria 2156
1781 Ga0495582_0107487 3300046473 Bacteria 1566
1782 Ga0495605_0123978 3300046474 Bacteria 1170
1783 Ga0495605_0134445 3300046474 Bacteria 1113
1784 Ga0495639_0000150 3300046475 Bacteria 36003
1785 Ga0495639_0000831 3300046475 Bacteria 14072
1786 Ga0495639_0002285 3300046475 Bacteria 8403
1787 Ga0495639_0061139 3300046475 Bacteria 1727
1788 Ga0495639_0077182 3300046475 Bacteria 1546
1789 Ga0495639_0093781 3300046475 Bacteria 1411
1790 Ga0495662_0000080 3300046476 Bacteria 34571
1791 Ga0495662_0007312 3300046476 Bacteria 5464
1792 Ga0495662_0032263 3300046476 Bacteria 2530
1793 Ga0495662_0071163 3300046476 Bacteria 1685
1794 Ga0495664_0000001 3300046477 Bacteria 757730
1795 Ga0495664_0004418 3300046477 Bacteria 7698
1796 Ga0495664_0006189 3300046477 Bacteria 6607
1797 Ga0495664_0009459 3300046477 Bacteria 5454
1798 Ga0495664_0029728 3300046477 Bacteria 3197
1799 Ga0495664_0030301 3300046477 Bacteria 3168
1800 Ga0495664_0076148 3300046477 Bacteria 2008
1801 Ga0495664_0251473 3300046477 Bacteria 1069
1802 Ga0495664_0374405 3300046477 Bacteria 856
1803 Ga0495584_0042407 3300046491 Bacteria 2297
1804 Ga0495594_0001325 3300046499 Bacteria 12887
1805 Ga0495594_0001874 3300046499 Bacteria 10943
1806 Ga0495594_0005553 3300046499 Bacteria 6478
1807 Ga0495594_0097085 3300046499 Bacteria 1656
1808 Ga0495594_0239238 3300046499 Bacteria 1035
1809 Ga0495607_0032661 3300046501 Bacteria 3174
1810 Ga0495583_0003795 3300046506 Bacteria 11224
1811 Ga0495583_0087782 3300046506 Bacteria 1343
1812 Ga0495606_0001591 3300046507 Bacteria 29647
1813 Ga0495606_0002520 3300046507 Bacteria 21082
1814 Ga0495606_0328432 3300046507 Bacteria 819
1815 Ga0495608_0000033 3300046511 Bacteria 141349
1816 Ga0495608_0000646 3300046511 Bacteria 24033
1817 Ga0495608_0008945 3300046511 Bacteria 7001
1818 Ga0495608_0012384 3300046511 Bacteria 5923
1819 Ga0495608_0037629 3300046511 Bacteria 3253
1820 Ga0495608_0086016 3300046511 Bacteria 2038
1821 Ga0495608_0086204 3300046511 Bacteria 2035
1822 Ga0495608_0091299 3300046511 Bacteria 1970
1823 Ga0495608_0366209 3300046511 Bacteria 885
1824 Ga0495610_0001243 3300046512 Bacteria 22894
1825 Ga0495610_0063720 3300046512 Bacteria 1744
1826 Ga0495610_0078245 3300046512 Bacteria 1525
1827 Ga0495610_0082157 3300046512 Bacteria 1477
1828 Ga0495610_0189551 3300046512 Bacteria 849
1829 Ga0495616_0009255 3300046513 Bacteria 5775
1830 Ga0495616_0048108 3300046513 Bacteria 2144
1831 Ga0495616_0094648 3300046513 Bacteria 1409
1832 Ga0495616_0139366 3300046513 Bacteria 1105
1833 Ga0495618_0000819 3300046514 Bacteria 21634
1834 Ga0495618_0001132 3300046514 Bacteria 18019
1835 Ga0495618_0043007 3300046514 Bacteria 2849
1836 Ga0495618_0176024 3300046514 Bacteria 1361
1837 Ga0495618_0236081 3300046514 Bacteria 1150
1838 Ga0495620_0005207 3300046515 Bacteria 7277
1839 Ga0495620_0131256 3300046515 Bacteria 983
1840 Ga0495628_0000003 3300046516 Bacteria 470339
1841 Ga0495628_0001902 3300046516 Bacteria 18942
1842 Ga0495628_0020856 3300046516 Bacteria 5399
1843 Ga0495628_0059630 3300046516 Bacteria 2995
1844 Ga0495628_0061372 3300046516 Bacteria 2948
1845 Ga0495628_0066523 3300046516 Bacteria 2817
1846 Ga0495628_0094961 3300046516 Bacteria 2304
1847 Ga0495630_0000351 3300046517 Bacteria 36651
1848 Ga0495630_0003796 3300046517 Bacteria 10535
1849 Ga0495630_0011250 3300046517 Bacteria 6472
1850 Ga0495630_0012651 3300046517 Bacteria 6132
1851 Ga0495630_0029582 3300046517 Bacteria 4072
1852 Ga0495630_0102775 3300046517 Bacteria 2162
1853 Ga0495631_0000031 3300046518 Bacteria 85555
1854 Ga0495631_0018057 3300046518 Bacteria 3325
1855 Ga0495631_0048948 3300046518 Bacteria 1852
1856 Ga0495632_0083710 3300046519 Bacteria 1519
1857 Ga0495632_0112744 3300046519 Bacteria 1276
1858 Ga0495632_0134599 3300046519 Bacteria 1149
1859 Ga0495643_0006299 3300046522 Bacteria 7849
1860 Ga0495643_0058815 3300046522 Bacteria 2044
1861 Ga0495643_0065937 3300046522 Bacteria 1911
1862 Ga0495643_0073957 3300046522 Bacteria 1785
1863 Ga0495644_0066946 3300046523 Bacteria 1349
1864 Ga0495644_0183388 3300046523 Bacteria 805
1865 Ga0495648_0013070 3300046524 Bacteria 6158
1866 Ga0495648_0014658 3300046524 Bacteria 5726
1867 Ga0495648_0039534 3300046524 Bacteria 3001
1868 Ga0495642_0125514 3300046528 Bacteria 1103
1869 Ga0495642_0144540 3300046528 Bacteria 1027
1870 Ga0495652_0000001 3300046529 Bacteria 1045081
1871 Ga0495652_0006130 3300046529 Bacteria 11237
1872 Ga0495652_0006619 3300046529 Bacteria 10760
1873 Ga0495652_0011396 3300046529 Bacteria 8039
1874 Ga0495652_0013582 3300046529 Bacteria 7329
1875 Ga0495652_0030485 3300046529 Bacteria 4730
1876 Ga0495652_0031471 3300046529 Bacteria 4646
1877 Ga0495652_0217719 3300046529 Bacteria 1437
1878 Ga0495652_0283433 3300046529 Bacteria 1212
1879 Ga0495654_0116645 3300046530 Bacteria 1212
1880 Ga0495665_0003088 3300046531 Bacteria 9016
1881 Ga0495665_0009642 3300046531 Bacteria 5231
1882 Ga0495665_0130069 3300046531 Bacteria 1318
1883 Ga0495640_0000012 3300046533 Bacteria 194692
1884 Ga0495640_0004128 3300046533 Bacteria 11620
1885 Ga0495640_0025555 3300046533 Bacteria 4281
1886 Ga0495640_0031230 3300046533 Bacteria 3803
1887 Ga0495640_0036266 3300046533 Bacteria 3484
1888 Ga0495640_0060841 3300046533 Bacteria 2567
1889 Ga0495640_0069028 3300046533 Bacteria 2377
1890 Ga0495640_0087346 3300046533 Bacteria 2063
1891 Ga0495640_0186622 3300046533 Bacteria 1319
1892 Ga0495586_0026612 3300046535 Bacteria 3095
1893 Ga0495586_0350402 3300046535 Bacteria 848
1894 Ga0495587_0000003 3300046536 Bacteria 424188
1895 Ga0495587_0000770 3300046536 Bacteria 21359
1896 Ga0495587_0004600 3300046536 Bacteria 9070
1897 Ga0495587_0010302 3300046536 Bacteria 5958
1898 Ga0495587_0017472 3300046536 Bacteria 4456
1899 Ga0495587_0084599 3300046536 Bacteria 1837
1900 Ga0495598_0044432 3300046537 Bacteria 1312
1901 Ga0495609_0092378 3300046538 Bacteria 1316
1902 Ga0495621_0000738 3300046539 Bacteria 8291
1903 Ga0495621_0067043 3300046539 Bacteria 1314
1904 Ga0495597_0004537 3300046542 Bacteria 7597
1905 Ga0495645_0000004 3300046543 Bacteria 532661
1906 Ga0495645_0001818 3300046543 Bacteria 14501
1907 Ga0495645_0005428 3300046543 Bacteria 8746
1908 Ga0495645_0011417 3300046543 Bacteria 6250
1909 Ga0495645_0020048 3300046543 Bacteria 4820
1910 Ga0495645_0076360 3300046543 Bacteria 2410
1911 Ga0495645_0096944 3300046543 Bacteria 2101
1912 Ga0495645_0130547 3300046543 Bacteria 1761
1913 Ga0495622_0001916 3300046557 Bacteria 10222
1914 Ga0495622_0004642 3300046557 Bacteria 6363
1915 Ga0495622_0023907 3300046557 Bacteria 2851
1916 Ga0495622_0030214 3300046557 Bacteria 2532
1917 Ga0495622_0051967 3300046557 Bacteria 1901
1918 Ga0495622_0096117 3300046557 Bacteria 1359
1919 Ga0495633_0019049 3300046558 Bacteria 3474
1920 Ga0495633_0108632 3300046558 Bacteria 1286
1921 Ga0495633_0159457 3300046558 Bacteria 1041
1922 Ga0495667_0000001 3300046559 Bacteria 834831
1923 Ga0495667_0001615 3300046559 Bacteria 14953
1924 Ga0495667_0010161 3300046559 Bacteria 6372
1925 Ga0495667_0010501 3300046559 Bacteria 6266
1926 Ga0495667_0046003 3300046559 Bacteria 2887
1927 Ga0495667_0063924 3300046559 Bacteria 2408
1928 Ga0495667_0071472 3300046559 Bacteria 2263
1929 Ga0495667_0095320 3300046559 Bacteria 1927
1930 Ga0495656_0084658 3300046615 Bacteria 1439
1931 Ga0495668_0166306 3300046616 Bacteria 1208
1932 Ga0495668_0187187 3300046616 Bacteria 1134
1933 Ga0495668_0231507 3300046616 Bacteria 1012
1934 Ga0495668_0277927 3300046616 Bacteria 917
1935 Ga0495634_0002836 3300046642 Bacteria 14230
1936 Ga0495634_0003907 3300046642 Bacteria 11834
1937 Ga0495634_0005348 3300046642 Bacteria 9893
1938 Ga0495634_0018568 3300046642 Bacteria 4948
1939 Ga0495634_0038637 3300046642 Bacteria 3253
1940 Ga0495634_0079123 3300046642 Bacteria 2153
1941 Ga0495634_0214468 3300046642 Bacteria 1190
1942 Ga0495634_0299124 3300046642 Bacteria 973
1943 Ga0495611_0055476 3300046648 Bacteria 1792
1944 Ga0495625_0008843 3300046660 Bacteria 8522
1945 Ga0495625_0011341 3300046660 Bacteria 7277
1946 Ga0495625_0108923 3300046660 Bacteria 1895
1947 Ga0495625_0184870 3300046660 Bacteria 1383
1948 Ga0495625_0232202 3300046660 Bacteria 1204
1949 Ga0495635_0000015 3300046663 Bacteria 215468
1950 Ga0495635_0000466 3300046663 Bacteria 25585
1951 Ga0495635_0001333 3300046663 Bacteria 16433
1952 Ga0495635_0002411 3300046663 Bacteria 12735
1953 Ga0495635_0007466 3300046663 Bacteria 7631
1954 Ga0495635_0013485 3300046663 Bacteria 5718
1955 Ga0495635_0044353 3300046663 Bacteria 3068
1956 Ga0495635_0051618 3300046663 Bacteria 2833
1957 Ga0495635_0159408 3300046663 Bacteria 1535
1958 Ga0495635_0221844 3300046663 Bacteria 1278
1959 Ga0495635_0301728 3300046663 Bacteria 1074
1960 Ga0495659_0056760 3300046664 Bacteria 1437
1961 Ga0495659_0138969 3300046664 Bacteria 968
1962 Ga0495661_0092961 3300046665 Bacteria 1712
1963 Ga0495588_0014518 3300046674 Bacteria 3772
1964 Ga0495588_0029437 3300046674 Bacteria 2754
1965 Ga0495588_0034106 3300046674 Bacteria 2574
1966 Ga0495588_0049979 3300046674 Bacteria 2151
1967 Ga0495588_0163500 3300046674 Bacteria 1177
1968 Ga0495657_0000674 3300046675 Bacteria 30819
1969 Ga0495657_0001852 3300046675 Bacteria 18026
1970 Ga0495657_0003435 3300046675 Bacteria 12925
1971 Ga0495657_0005171 3300046675 Bacteria 10333
1972 Ga0495657_0060736 3300046675 Bacteria 2503
1973 Ga0495657_0064356 3300046675 Bacteria 2416
1974 Ga0495657_0240259 3300046675 Bacteria 1093
1975 Ga0495657_0358617 3300046675 Bacteria 862
1976 Ga0495599_0000004 3300046678 Bacteria 316231
1977 Ga0495599_0003516 3300046678 Bacteria 9174
1978 Ga0495599_0006472 3300046678 Bacteria 7068
1979 Ga0495599_0079910 3300046678 Bacteria 2042
1980 Ga0495599_0105949 3300046678 Bacteria 1752
1981 Ga0495623_0000020 3300046679 Bacteria 100523
1982 Ga0495623_0001484 3300046679 Bacteria 15894
1983 Ga0495623_0001950 3300046679 Bacteria 13853
1984 Ga0495623_0007010 3300046679 Bacteria 7325
1985 Ga0495623_0026676 3300046679 Bacteria 3717
1986 Ga0495646_0000006 3300046680 Bacteria 258496
1987 Ga0495646_0019582 3300046680 Bacteria 4281
1988 Ga0495646_0019760 3300046680 Bacteria 4259
1989 Ga0495646_0027512 3300046680 Bacteria 3567
1990 Ga0495646_0029744 3300046680 Bacteria 3413
1991 Ga0495646_0095691 3300046680 Bacteria 1708
1992 Ga0495647_0002127 3300046681 Bacteria 6194
1993 Ga0495647_0004175 3300046681 Bacteria 4678
1994 Ga0495647_0006440 3300046681 Bacteria 3886
1995 Ga0495647_0081326 3300046681 Bacteria 1314
1996 Ga0495647_0129778 3300046681 Bacteria 1067
1997 Ga0495658_0001408 3300046683 Bacteria 12626
1998 Ga0495658_0009680 3300046683 Bacteria 4806
1999 Ga0495658_0162453 3300046683 Bacteria 1378
2000 Ga0495658_0200132 3300046683 Bacteria 1245
2001 Ga0495658_0206190 3300046683 Bacteria 1227
2002 Ga0495669_0046408 3300046684 Bacteria 1939
2003 Ga0495669_0052168 3300046684 Bacteria 1836
2004 Ga0495613_0034353 3300046689 Bacteria 3766
2005 Ga0495613_0056346 3300046689 Bacteria 2886
2006 Ga0495613_0063011 3300046689 Bacteria 2713
2007 Ga0495613_0208642 3300046689 Bacteria 1374
2008 Ga0495613_0282867 3300046689 Bacteria 1151
2009 Ga0495624_0000786 3300046690 Bacteria 24993
2010 Ga0495624_0009370 3300046690 Bacteria 6783
2011 Ga0495624_0029116 3300046690 Bacteria 3605
2012 Ga0495624_0042731 3300046690 Bacteria 2896
2013 Ga0495670_0003639 3300046691 Bacteria 7573
2014 Ga0495671_0019894 3300046692 Bacteria 3543
2015 Ga0495649_0030460 3300046694 Bacteria 2980
2016 Ga0495649_0118319 3300046694 Bacteria 1402
2017 Ga0495589_0125134 3300046794 Bacteria 1236
2018 Ga0495600_0000027 3300046809 Bacteria 91645
2019 Ga0495600_0001477 3300046809 Bacteria 13024
2020 Ga0495600_0001955 3300046809 Bacteria 11578
2021 Ga0495600_0012843 3300046809 Bacteria 5246
2022 Ga0495600_0022936 3300046809 Bacteria 4012
2023 Ga0495600_0137036 3300046809 Bacteria 1589
2024 Ga0495600_0231272 3300046809 Bacteria 1180
2025 Ga0495600_0258561 3300046809 Bacteria 1106
2026 Ga0495600_0334816 3300046809 Bacteria 950
2027 Ga0495581_0000095 3300047315 Bacteria 36670
2028 Ga0495581_0025833 3300047315 Bacteria 3406
2029 Ga0495581_0033337 3300047315 Bacteria 2982
2030 Ga0495581_0058247 3300047315 Bacteria 2230
2031 Ga0495581_0129887 3300047315 Bacteria 1468
2032 Ga0495581_0152526 3300047315 Bacteria 1350
2033 Ga0495581_0360456 3300047315 Bacteria 849
2034 Ga0495604_0000018 3300047317 Bacteria 181417
2035 Ga0495604_0000711 3300047317 Bacteria 28174
2036 Ga0495604_0002492 3300047317 Bacteria 14701
2037 Ga0495604_0005251 3300047317 Bacteria 10263
2038 Ga0495604_0024712 3300047317 Bacteria 4793
2039 Ga0495604_0041331 3300047317 Bacteria 3617
2040 Ga0495604_0057682 3300047317 Bacteria 2985
2041 Ga0495604_0137131 3300047317 Bacteria 1752
2042 Ga0495604_0479380 3300047317 Bacteria 809
2043 Ga0495636_0009772 3300047318 Bacteria 3778
2044 Ga0495636_0120203 3300047318 Bacteria 1161
2045 Ga0495674_0000001 3300047319 Bacteria 778665
2046 Ga0495674_0001326 3300047319 Bacteria 24110
2047 Ga0495674_0003170 3300047319 Bacteria 15972
2048 Ga0495674_0006000 3300047319 Bacteria 11663
2049 Ga0495674_0014978 3300047319 Bacteria 7258
2050 Ga0495674_0034595 3300047319 Bacteria 4568
2051 Ga0495674_0041091 3300047319 Bacteria 4133
2052 Ga0495674_0056426 3300047319 Bacteria 3439
2053 Ga0495674_0057098 3300047319 Bacteria 3417
2054 Ga0495674_0057439 3300047319 Bacteria 3405
2055 Ga0495674_0118076 3300047319 Bacteria 2243
2056 Ga0495674_0134357 3300047319 Bacteria 2083
2057 Ga0495672_0006759 3300047320 Bacteria 8793
2058 Ga0495672_0019639 3300047320 Bacteria 4454
2059 Ga0495672_0029155 3300047320 Bacteria 3480
2060 Ga0495672_0094574 3300047320 Bacteria 1633
2061 Ga0495672_0184815 3300047320 Bacteria 1053
2062 Ga0495676_0008104 3300047321 Bacteria 9642
2063 Ga0495676_0030156 3300047321 Bacteria 4609
2064 Ga0495676_0047250 3300047321 Bacteria 3483
2065 Ga0495676_0155965 3300047321 Bacteria 1620
2066 Ga0495676_0208325 3300047321 Bacteria 1354
2067 Ga0495680_0000355 3300047322 Bacteria 51146
2068 Ga0495680_0005136 3300047322 Bacteria 12362
2069 Ga0495680_0007458 3300047322 Bacteria 10026
2070 Ga0495680_0008649 3300047322 Bacteria 9238
2071 Ga0495680_0016513 3300047322 Bacteria 6338
2072 Ga0495680_0047542 3300047322 Bacteria 3374
2073 Ga0495680_0096258 3300047322 Bacteria 2211
2074 Ga0495680_0101063 3300047322 Bacteria 2148
2075 Ga0495683_0003676 3300047323 Bacteria 8887
2076 Ga0495687_007394 3300047443 Bacteria 6474
2077 Ga0495687_009315 3300047443 Bacteria 5503
2078 Ga0495687_125808 3300047443 Bacteria 917
2079 Ga0495675_0000034 3300047444 Bacteria 97963
2080 Ga0495675_0001036 3300047444 Bacteria 16879
2081 Ga0495675_0006578 3300047444 Bacteria 7117
2082 Ga0495675_0084798 3300047444 Bacteria 1992
2083 Ga0495675_0267770 3300047444 Bacteria 1022
2084 Ga0495675_0284245 3300047444 Bacteria 986
2085 Ga0495673_0015827 3300047469 Bacteria 3874
2086 Ga0495673_0158186 3300047469 Bacteria 871
2087 Ga0495681_0008484 3300047470 Bacteria 6442
2088 Ga0495681_0199777 3300047470 Bacteria 812
2089 Ga0495684_0000005 3300047471 Bacteria 291932
2090 Ga0495684_0000357 3300047471 Bacteria 36963
2091 Ga0495684_0019067 3300047471 Bacteria 5282
2092 Ga0495684_0041206 3300047471 Bacteria 3539
2093 Ga0495684_0078834 3300047471 Bacteria 2500
2094 Ga0495684_0148845 3300047471 Bacteria 1751
2095 Ga0495684_0294963 3300047471 Bacteria 1166
2096 Ga0495684_0309627 3300047471 Bacteria 1132
2097 Ga0495686_0047012 3300047472 Bacteria 2726
2098 Ga0495686_0108076 3300047472 Bacteria 1671
2099 Ga0495686_0108119 3300047472 Bacteria 1671
2100 Ga0495686_0135377 3300047472 Bacteria 1457
2101 Ga0495686_0387391 3300047472 Bacteria 753
2102 Ga0495593_0000531 3300047673 Bacteria 21606
2103 Ga0495593_0001114 3300047673 Bacteria 15690
2104 Ga0495593_0008961 3300047673 Bacteria 5807
2105 Ga0495593_0028635 3300047673 Bacteria 3059
2106 Ga0495593_0034246 3300047673 Bacteria 2764
2107 Ga0495593_0080801 3300047673 Bacteria 1681
2108 Ga0495593_0112916 3300047673 Bacteria 1386
2109 Ga0495593_0122237 3300047673 Bacteria 1324
2110 Ga0495602_0000002 3300048088 Bacteria 422216
2111 Ga0495602_0001368 3300048088 Bacteria 24064
2112 Ga0495602_0004923 3300048088 Bacteria 13986
2113 Ga0495602_0008736 3300048088 Bacteria 10574
2114 Ga0495602_0031103 3300048088 Bacteria 5051
2115 Ga0495602_0061680 3300048088 Bacteria 3258
2116 Ga0495602_0185861 3300048088 Bacteria 1598
2117 Ga0495602_0202500 3300048088 Bacteria 1513
2118 Ga0495602_0205740 3300048088 Bacteria 1498
2119 Ga0495602_0266661 3300048088 Bacteria 1268
2120 Ga0495602_0513067 3300048088 Bacteria 836
2121 Ga0495614_0008512 3300048089 Bacteria 4560
2122 Ga0495614_0030835 3300048089 Bacteria 2308
2123 Ga0495626_0029757 3300048091 Bacteria 2640
2124 Ga0495626_0044213 3300048091 Bacteria 2086
2125 Ga0495626_0107812 3300048091 Bacteria 1208
2126 Ga0496100_0007026 3300048903 Bacteria 6175
2127 Ga0496100_0017746 3300048903 Bacteria 4209
2128 Ga0496100_0058734 3300048903 Bacteria 2525
2129 Ga0496100_0168594 3300048903 Bacteria 1575
2130 Ga0496100_0204298 3300048903 Bacteria 1442
2131 Ga0496100_0321113 3300048903 Bacteria 1163
2132 Ga0496100_0398303 3300048903 Bacteria 1048
2133 Ga0496101_0002722 3300048904 Bacteria 10847
2134 Ga0496101_0007200 3300048904 Bacteria 7200
2135 Ga0496101_0019561 3300048904 Bacteria 4624
2136 Ga0496101_0058967 3300048904 Bacteria 2781
2137 Ga0496101_0086741 3300048904 Bacteria 2322
2138 Ga0496101_0139931 3300048904 Bacteria 1844
2139 Ga0496101_0481365 3300048904 Bacteria 980
2140 Ga0496101_0789781 3300048904 Bacteria 749
2141 Ga0496102_0001456 3300048905 Bacteria 20959
2142 Ga0496102_0006460 3300048905 Bacteria 9999
2143 Ga0496102_0006962 3300048905 Bacteria 9648
2144 Ga0496102_0013794 3300048905 Bacteria 7010
2145 Ga0496102_0014728 3300048905 Bacteria 6798
2146 Ga0496102_0017535 3300048905 Bacteria 6271
2147 Ga0496102_0023779 3300048905 Bacteria 5444
2148 Ga0496102_0038142 3300048905 Bacteria 4335
2149 Ga0496102_0062369 3300048905 Bacteria 3413
2150 Ga0496102_0115847 3300048905 Bacteria 2500
2151 Ga0496102_0121719 3300048905 Bacteria 2437
2152 Ga0496102_0143429 3300048905 Bacteria 2240
2153 Ga0496102_0598256 3300048905 Bacteria 1026
2154 Ga0496102_0930375 3300048905 Bacteria 791
2155 Ga0496103_0002596 3300048906 Bacteria 11311
2156 Ga0496103_0019610 3300048906 Bacteria 4059
2157 Ga0496103_0025456 3300048906 Bacteria 3577
2158 Ga0496103_0039741 3300048906 Bacteria 2891
2159 Ga0496103_0054700 3300048906 Bacteria 2474
2160 Ga0496103_0063663 3300048906 Bacteria 2298
2161 Ga0496103_0071366 3300048906 Bacteria 2173
2162 Ga0496103_0175136 3300048906 Bacteria 1378
2163 Ga0496103_0284457 3300048906 Bacteria 1064
2164 Ga0496103_0317273 3300048906 Bacteria 1002
2165 Ga0496104_0001268 3300048907 Bacteria 21768
2166 Ga0496104_0003748 3300048907 Bacteria 13138
2167 Ga0496104_0007294 3300048907 Bacteria 9756
2168 Ga0496104_0008844 3300048907 Bacteria 8952
2169 Ga0496104_0013086 3300048907 Bacteria 7475
2170 Ga0496104_0013863 3300048907 Bacteria 7272
2171 Ga0496104_0020552 3300048907 Bacteria 6052
2172 Ga0496104_0026919 3300048907 Bacteria 5315
2173 Ga0496104_0061801 3300048907 Bacteria 3551
2174 Ga0496104_0177223 3300048907 Bacteria 2042
2175 Ga0496104_0240489 3300048907 Bacteria 1722
2176 Ga0496104_0341754 3300048907 Bacteria 1410
2177 Ga0496104_0347331 3300048907 Bacteria 1396
2178 Ga0496104_0553344 3300048907 Bacteria 1061
2179 Ga0496105_0002644 3300048908 Bacteria 13039
2180 Ga0496105_0003408 3300048908 Bacteria 11760
2181 Ga0496105_0008260 3300048908 Bacteria 8095
2182 Ga0496105_0016122 3300048908 Bacteria 5959
2183 Ga0496105_0026739 3300048908 Bacteria 4710
2184 Ga0496105_0028197 3300048908 Bacteria 4591
2185 Ga0496105_0086384 3300048908 Bacteria 2592
2186 Ga0496105_0093954 3300048908 Bacteria 2477
2187 Ga0496105_0161852 3300048908 Bacteria 1837
2188 Ga0496105_0219135 3300048908 Bacteria 1549
2189 Ga0496105_0235508 3300048908 Bacteria 1487
2190 Ga0496106_0001779 3300048909 Bacteria 16086
2191 Ga0496106_0007345 3300048909 Bacteria 8144
2192 Ga0496106_0010695 3300048909 Bacteria 6781
2193 Ga0496106_0011982 3300048909 Bacteria 6398
2194 Ga0496106_0029872 3300048909 Bacteria 4063
2195 Ga0496106_0030731 3300048909 Bacteria 4003
2196 Ga0496106_0051201 3300048909 Bacteria 3114
2197 Ga0496106_0069575 3300048909 Bacteria 2687
2198 Ga0496106_0070375 3300048909 Bacteria 2672
2199 Ga0496106_0132488 3300048909 Bacteria 1955
2200 Ga0496106_0152046 3300048909 Bacteria 1826
2201 Ga0496106_0332898 3300048909 Bacteria 1219
2202 Ga0496106_0428159 3300048909 Bacteria 1063
2203 Ga0496107_0007359 3300048910 Bacteria 7592
2204 Ga0496107_0009980 3300048910 Bacteria 6586
2205 Ga0496107_0016613 3300048910 Bacteria 5170
2206 Ga0496107_0025096 3300048910 Bacteria 4218
2207 Ga0496107_0028104 3300048910 Bacteria 3996
2208 Ga0496107_0029470 3300048910 Bacteria 3905
2209 Ga0496107_0036686 3300048910 Bacteria 3516
2210 Ga0496107_0053387 3300048910 Bacteria 2915
2211 Ga0496107_0055692 3300048910 Bacteria 2856
2212 Ga0496107_0083866 3300048910 Bacteria 2324
2213 Ga0496107_0095562 3300048910 Bacteria 2174
2214 Ga0496107_0167245 3300048910 Bacteria 1631
2215 Ga0496107_0182933 3300048910 Bacteria 1556
2216 Ga0496107_0218973 3300048910 Bacteria 1416
2217 Ga0496107_0706100 3300048910 Bacteria 741
2218 Ga0496108_0007879 3300048911 Bacteria 8636
2219 Ga0496108_0008415 3300048911 Bacteria 8373
2220 Ga0496108_0014395 3300048911 Bacteria 6458
2221 Ga0496108_0030364 3300048911 Bacteria 4479
2222 Ga0496108_0036356 3300048911 Bacteria 4097
2223 Ga0496108_0048029 3300048911 Bacteria 3568
2224 Ga0496108_0080930 3300048911 Bacteria 2752
2225 Ga0496108_0090239 3300048911 Bacteria 2605
2226 Ga0496108_0154458 3300048911 Bacteria 1981
2227 Ga0496108_0449790 3300048911 Bacteria 1125
2228 Ga0496108_0556765 3300048911 Bacteria 1000
2229 Ga0496109_0015483 3300048912 Bacteria 6647
2230 Ga0496109_0029367 3300048912 Bacteria 4924
2231 Ga0496109_0032449 3300048912 Bacteria 4695
2232 Ga0496109_0054989 3300048912 Bacteria 3631
2233 Ga0496109_0075129 3300048912 Bacteria 3107
2234 Ga0496109_0077534 3300048912 Bacteria 3058
2235 Ga0496109_0082705 3300048912 Bacteria 2959
2236 Ga0496109_0122043 3300048912 Bacteria 2428
2237 Ga0496109_0133521 3300048912 Bacteria 2318
2238 Ga0496109_0164970 3300048912 Bacteria 2076
2239 Ga0496109_0198528 3300048912 Bacteria 1886
2240 Ga0496109_0216639 3300048912 Bacteria 1800
2241 Ga0496109_0357020 3300048912 Bacteria 1381
2242 Ga0496109_0496257 3300048912 Bacteria 1152
2243 Ga0496110_0006503 3300048913 Bacteria 9270
2244 Ga0496110_0014347 3300048913 Bacteria 6575
2245 Ga0496110_0017687 3300048913 Bacteria 5962
2246 Ga0496110_0018349 3300048913 Bacteria 5866
2247 Ga0496110_0022908 3300048913 Bacteria 5307
2248 Ga0496110_0033950 3300048913 Bacteria 4415
2249 Ga0496110_0061580 3300048913 Bacteria 3312
2250 Ga0496110_0065812 3300048913 Bacteria 3204
2251 Ga0496110_0072529 3300048913 Bacteria 3055
2252 Ga0496110_0081046 3300048913 Bacteria 2893
2253 Ga0496110_0100252 3300048913 Bacteria 2596
2254 Ga0496110_0112992 3300048913 Bacteria 2442
2255 Ga0496110_0115019 3300048913 Bacteria 2421
2256 Ga0496110_0133268 3300048913 Bacteria 2244
2257 Ga0496110_0223078 3300048913 Bacteria 1714
2258 Ga0496110_0466197 3300048913 Bacteria 1151
2259 Ga0496110_0628628 3300048913 Bacteria 973
2260 Ga0496111_0024617 3300048914 Bacteria 4242
2261 Ga0496111_0025164 3300048914 Bacteria 4198
2262 Ga0496111_0038429 3300048914 Bacteria 3429
2263 Ga0496111_0039779 3300048914 Bacteria 3373
2264 Ga0496111_0070090 3300048914 Bacteria 2550
2265 Ga0496111_0101777 3300048914 Bacteria 2111
2266 Ga0496111_0116421 3300048914 Bacteria 1971
2267 Ga0496111_0153705 3300048914 Bacteria 1707
2268 Ga0496111_0215847 3300048914 Bacteria 1425
2269 Ga0496111_0225143 3300048914 Bacteria 1393
2270 Ga0496111_0236538 3300048914 Bacteria 1356
2271 Ga0496111_0270274 3300048914 Bacteria 1261
2272 Ga0496111_0285901 3300048914 Bacteria 1223
2273 Ga0496111_0345141 3300048914 Bacteria 1102
2274 Ga0496111_0412313 3300048914 Bacteria 998
2275 Ga0496112_0000004 3300048915 Bacteria 553294
2276 Ga0496112_0011381 3300048915 Bacteria 8122
2277 Ga0496112_0013012 3300048915 Bacteria 7672
2278 Ga0496112_0016876 3300048915 Bacteria 6850
2279 Ga0496112_0023843 3300048915 Bacteria 5852
2280 Ga0496112_0034410 3300048915 Bacteria 4931
2281 Ga0496112_0037237 3300048915 Bacteria 4748
2282 Ga0496112_0062540 3300048915 Bacteria 3672
2283 Ga0496112_0079666 3300048915 Bacteria 3240
2284 Ga0496112_0091129 3300048915 Bacteria 3017
2285 Ga0496112_0091204 3300048915 Bacteria 3016
2286 Ga0496112_0101340 3300048915 Bacteria 2849
2287 Ga0496112_0104503 3300048915 Bacteria 2802
2288 Ga0496112_0180508 3300048915 Bacteria 2075
2289 Ga0496112_0214233 3300048915 Bacteria 1883
2290 Ga0496113_0018281 3300048916 Bacteria 4879
2291 Ga0496113_0053851 3300048916 Bacteria 3009
2292 Ga0496113_0063033 3300048916 Bacteria 2801
2293 Ga0496113_0087782 3300048916 Bacteria 2392
2294 Ga0496113_0113595 3300048916 Bacteria 2111
2295 Ga0496113_0139862 3300048916 Bacteria 1904
2296 Ga0496113_0174762 3300048916 Bacteria 1702
2297 Ga0496113_0189286 3300048916 Bacteria 1633
2298 Ga0496113_0203376 3300048916 Bacteria 1574
2299 Ga0496113_0310213 3300048916 Bacteria 1264
2300 Ga0496113_0626897 3300048916 Bacteria 860
2301 Ga0496114_0002125 3300048917 Bacteria 15068
2302 Ga0496114_0013004 3300048917 Bacteria 6669
2303 Ga0496114_0028089 3300048917 Bacteria 4614
2304 Ga0496114_0061164 3300048917 Bacteria 3149
2305 Ga0496114_0085349 3300048917 Bacteria 2674
2306 Ga0496114_0097250 3300048917 Bacteria 2507
2307 Ga0496114_0103959 3300048917 Bacteria 2428
2308 Ga0496114_0141240 3300048917 Bacteria 2085
2309 Ga0496114_0146998 3300048917 Bacteria 2043
2310 Ga0496114_0212378 3300048917 Bacteria 1697
2311 Ga0496114_0259279 3300048917 Bacteria 1530
2312 Ga0496114_0413833 3300048917 Bacteria 1194
2313 Ga0496115_0002254 3300048918 Bacteria 13806
2314 Ga0496115_0008091 3300048918 Bacteria 7769
2315 Ga0496115_0009208 3300048918 Bacteria 7331
2316 Ga0496115_0012349 3300048918 Bacteria 6423
2317 Ga0496115_0034827 3300048918 Bacteria 3980
2318 Ga0496115_0045681 3300048918 Bacteria 3497
2319 Ga0496115_0096715 3300048918 Bacteria 2418
2320 Ga0496115_0111819 3300048918 Bacteria 2244
2321 Ga0496115_0136373 3300048918 Bacteria 2023
2322 Ga0496115_0178565 3300048918 Bacteria 1755
2323 Ga0496115_0255560 3300048918 Bacteria 1442
2324 Ga0496115_0284551 3300048918 Bacteria 1357
2325 Ga0496115_0645472 3300048918 Bacteria 837
2326 Ga0496116_0002703 3300048919 Bacteria 18271
2327 Ga0496116_0018353 3300048919 Bacteria 5396
2328 Ga0496116_0045503 3300048919 Bacteria 2970
2329 Ga0496116_0056671 3300048919 Bacteria 2567
2330 Ga0496116_0207306 3300048919 Bacteria 1019
2331 Ga0496117_0000066 3300048920 Bacteria 253534
2332 Ga0496117_0000105 3300048920 Bacteria 188970
2333 Ga0496117_0091514 3300048920 Bacteria 1956
2334 Ga0496117_0135237 3300048920 Bacteria 1486
2335 Ga0496118_0000231 3300048921 Bacteria 97930
2336 Ga0496118_0000427 3300048921 Bacteria 69957
2337 Ga0496118_0011620 3300048921 Bacteria 8564
2338 Ga0496118_0016895 3300048921 Bacteria 6667
2339 Ga0496118_0035128 3300048921 Bacteria 4076
2340 Ga0496118_0118636 3300048921 Bacteria 1732
2341 Ga0496118_0121239 3300048921 Bacteria 1704
2342 Ga0496119_0014778 3300048922 Bacteria 6077
2343 Ga0496119_0024379 3300048922 Bacteria 4257
2344 Ga0496120_0000463 3300048923 Bacteria 64041
2345 Ga0496120_0070905 3300048923 Bacteria 1915
2346 Ga0496120_0108158 3300048923 Bacteria 1457
2347 Ga0496120_0165648 3300048923 Bacteria 1098
2348 Ga0496121_0002564 3300048924 Bacteria 27512
2349 Ga0496121_0005471 3300048924 Bacteria 16264
2350 Ga0496121_0007499 3300048924 Bacteria 13165
2351 Ga0496121_0026412 3300048924 Bacteria 5473
2352 Ga0496121_0036105 3300048924 Bacteria 4410
2353 Ga0496121_0038709 3300048924 Bacteria 4216
2354 Ga0496121_0053646 3300048924 Bacteria 3376
2355 Ga0496121_0069598 3300048924 Bacteria 2839
2356 Ga0496121_0081235 3300048924 Bacteria 2566
2357 Ga0496121_0092222 3300048924 Bacteria 2362
2358 Ga0496121_0110966 3300048924 Bacteria 2092
2359 Ga0496121_0133939 3300048924 Bacteria 1849
2360 Ga0496121_0199493 3300048924 Bacteria 1427
2361 Ga0496121_0215342 3300048924 Bacteria 1357
2362 Ga0496121_0266961 3300048924 Bacteria 1178
2363 Ga0496121_0356753 3300048924 Bacteria 972
2364 Ga0496122_0000057 3300048925 Bacteria 253452
2365 Ga0496122_0033178 3300048925 Bacteria 4253
2366 Ga0496122_0040041 3300048925 Bacteria 3730
2367 Ga0496122_0173369 3300048925 Bacteria 1296
2368 Ga0496122_0175913 3300048925 Bacteria 1283
2369 Ga0496123_0000401 3300048926 Bacteria 79665
2370 Ga0496123_0029099 3300048926 Bacteria 4077
2371 Ga0496123_0038178 3300048926 Bacteria 3380
2372 Ga0496123_0142162 3300048926 Bacteria 1310
2373 Ga0496124_0000837 3300048927 Bacteria 50140
2374 Ga0496124_0004181 3300048927 Bacteria 17013
2375 Ga0496124_0069152 3300048927 Bacteria 2932
2376 Ga0496124_0126415 3300048927 Bacteria 2036
2377 Ga0496124_0173846 3300048927 Bacteria 1665
2378 Ga0496124_0221333 3300048927 Bacteria 1423
2379 Ga0496124_0312084 3300048927 Bacteria 1130
2380 Ga0496125_0002607 3300048928 Bacteria 23149
2381 Ga0496125_0005748 3300048928 Bacteria 13643
2382 Ga0496125_0007108 3300048928 Bacteria 11948
2383 Ga0496125_0021531 3300048928 Bacteria 6010
2384 Ga0496125_0045484 3300048928 Bacteria 3693
2385 Ga0496125_0058392 3300048928 Bacteria 3117
2386 Ga0496125_0115835 3300048928 Bacteria 1926
2387 Ga0496125_0126574 3300048928 Bacteria 1809
2388 Ga0496125_0173743 3300048928 Bacteria 1444
2389 Ga0496125_0273410 3300048928 Bacteria 1051
2390 Ga0496125_0291334 3300048928 Bacteria 1005
2391 Ga0496126_0008579 3300048929 Bacteria 11006
2392 Ga0496126_0009003 3300048929 Bacteria 10678
2393 Ga0496126_0009783 3300048929 Bacteria 10150
2394 Ga0496126_0012755 3300048929 Bacteria 8591
2395 Ga0496126_0013528 3300048929 Bacteria 8292
2396 Ga0496126_0018680 3300048929 Bacteria 6860
2397 Ga0496126_0025545 3300048929 Bacteria 5680
2398 Ga0496126_0044721 3300048929 Bacteria 4075
2399 Ga0496126_0082690 3300048929 Bacteria 2836
2400 Ga0496126_0091768 3300048929 Bacteria 2670
2401 Ga0496126_0095872 3300048929 Bacteria 2602
2402 Ga0496126_0111446 3300048929 Bacteria 2383
2403 Ga0496126_0155576 3300048929 Bacteria 1957
2404 Ga0496126_0235437 3300048929 Bacteria 1532
2405 Ga0496126_0244559 3300048929 Bacteria 1497
2406 Ga0496126_0317412 3300048929 Bacteria 1282
2407 Ga0496126_0372282 3300048929 Bacteria 1164
2408 Ga0496126_0439739 3300048929 Bacteria 1051
2409 Ga0496126_0448149 3300048929 Bacteria 1039
2410 Ga0495682_0005723 3300049460 Bacteria 5130
2411 Ga0501031_0001421 3300049568 Bacteria 14827
2412 Ga0501031_0010568 3300049568 Bacteria 6009
2413 Ga0501031_0028856 3300049568 Bacteria 3616
2414 Ga0501031_0045491 3300049568 Bacteria 2864
2415 Ga0501032_0000129 3300049569 Bacteria 62082
2416 Ga0501032_0003564 3300049569 Bacteria 11867
2417 Ga0501032_0006576 3300049569 Bacteria 8534
2418 Ga0501032_0051131 3300049569 Bacteria 2786
2419 Ga0501032_0145344 3300049569 Bacteria 1561
2420 Ga0501032_0182518 3300049569 Bacteria 1373
2421 Ga0501032_0199486 3300049569 Bacteria 1306
2422 Ga0501032_0217566 3300049569 Bacteria 1244
2423 Ga0501032_0240871 3300049569 Bacteria 1175
2424 Ga0501032_0281982 3300049569 Bacteria 1075
2425 Ga0501033_0001179 3300049570 Bacteria 23588
2426 Ga0501033_0002170 3300049570 Bacteria 16951
2427 Ga0501033_0012740 3300049570 Bacteria 6412
2428 Ga0501033_0104189 3300049570 Bacteria 2068
2429 Ga0501033_0116243 3300049570 Bacteria 1943
2430 Ga0501033_0202454 3300049570 Bacteria 1417
2431 Ga0501033_0223222 3300049570 Bacteria 1340
2432 Ga0501034_0000503 3300049571 Bacteria 63099
2433 Ga0501034_0000516 3300049571 Bacteria 62005
2434 Ga0501034_0000608 3300049571 Bacteria 56256
2435 Ga0501034_0012060 3300049571 Bacteria 8935
2436 Ga0501034_0027813 3300049571 Bacteria 5750
2437 Ga0501034_0033400 3300049571 Bacteria 5221
2438 Ga0501034_0038162 3300049571 Bacteria 4864
2439 Ga0501034_0045892 3300049571 Bacteria 4414
2440 Ga0501034_0055553 3300049571 Bacteria 3984
2441 Ga0501034_0056951 3300049571 Bacteria 3931
2442 Ga0501034_0089178 3300049571 Bacteria 3082
2443 Ga0501034_0127267 3300049571 Bacteria 2532
2444 Ga0501034_0230760 3300049571 Bacteria 1800
2445 Ga0501034_0250278 3300049571 Bacteria 1716
2446 Ga0501034_0431275 3300049571 Bacteria 1238
2447 Ga0501036_0000547 3300049572 Bacteria 26976
2448 Ga0501036_0001453 3300049572 Bacteria 18220
2449 Ga0501036_0013517 3300049572 Bacteria 6786
2450 Ga0501036_0023998 3300049572 Bacteria 5140
2451 Ga0501036_0033256 3300049572 Bacteria 4361
2452 Ga0501036_0065773 3300049572 Bacteria 3068
2453 Ga0501036_0081321 3300049572 Bacteria 2738
2454 Ga0501036_0233408 3300049572 Bacteria 1543
2455 Ga0501036_0445041 3300049572 Bacteria 1079
2456 Ga0501036_0456413 3300049572 Bacteria 1064
2457 Ga0501037_0000106 3300049573 Bacteria 79430
2458 Ga0501037_0005891 3300049573 Bacteria 8954
2459 Ga0501037_0020971 3300049573 Bacteria 4828
2460 Ga0501037_0054373 3300049573 Bacteria 2927
2461 Ga0501037_0104905 3300049573 Bacteria 2037
2462 Ga0501037_0293899 3300049573 Bacteria 1129
2463 Ga0501038_0001655 3300049574 Bacteria 20704
2464 Ga0501038_0008504 3300049574 Bacteria 9432
2465 Ga0501038_0014086 3300049574 Bacteria 7284
2466 Ga0501038_0053911 3300049574 Bacteria 3460
2467 Ga0501038_0144473 3300049574 Bacteria 1943
2468 Ga0501038_0313507 3300049574 Bacteria 1228
2469 Ga0501039_0000416 3300049575 Bacteria 30616
2470 Ga0501039_0003067 3300049575 Bacteria 12495
2471 Ga0501039_0010585 3300049575 Bacteria 7028
2472 Ga0501039_0123865 3300049575 Bacteria 2027
2473 Ga0501039_0336546 3300049575 Bacteria 1186
2474 Ga0501039_0536774 3300049575 Bacteria 918
2475 Ga0501040_0024555 3300049576 Bacteria 4045
2476 Ga0501040_0030848 3300049576 Bacteria 3622
2477 Ga0501040_0140750 3300049576 Bacteria 1699
2478 Ga0501041_0142094 3300049577 Bacteria 1497
2479 Ga0501041_0344458 3300049577 Bacteria 941
2480 Ga0501042_0017067 3300049578 Bacteria 5001
2481 Ga0501042_0039520 3300049578 Bacteria 3353
2482 Ga0501042_0163188 3300049578 Bacteria 1607
2483 Ga0501042_0420800 3300049578 Bacteria 968
2484 Ga0501043_0003257 3300049579 Bacteria 13387
2485 Ga0501043_0004728 3300049579 Bacteria 11042
2486 Ga0501043_0016610 3300049579 Bacteria 5769
2487 Ga0501043_0019247 3300049579 Bacteria 5359
2488 Ga0501043_0025549 3300049579 Bacteria 4634
2489 Ga0501043_0044502 3300049579 Bacteria 3490
2490 Ga0501043_0131829 3300049579 Bacteria 1958
2491 Ga0501043_0609313 3300049579 Bacteria 806
2492 Ga0501046_0000235 3300049580 Bacteria 57005
2493 Ga0501046_0003612 3300049580 Bacteria 14167
2494 Ga0501046_0058824 3300049580 Bacteria 3012
2495 Ga0501046_0059092 3300049580 Bacteria 3005
2496 Ga0501046_0061052 3300049580 Bacteria 2949
2497 Ga0501046_0071774 3300049580 Bacteria 2689
2498 Ga0501046_0088728 3300049580 Bacteria 2381
2499 Ga0501046_0126220 3300049580 Bacteria 1943
2500 Ga0501047_0000455 3300049581 Bacteria 45200
2501 Ga0501047_0000844 3300049581 Bacteria 31650
2502 Ga0501047_0006341 3300049581 Bacteria 11123
2503 Ga0501047_0014131 3300049581 Bacteria 7586
2504 Ga0501047_0015400 3300049581 Bacteria 7284
2505 Ga0501047_0038863 3300049581 Bacteria 4603
2506 Ga0501047_0136926 3300049581 Bacteria 2329
2507 Ga0501047_0157598 3300049581 Bacteria 2143
2508 Ga0501047_0198667 3300049581 Bacteria 1866
2509 Ga0501047_0218397 3300049581 Bacteria 1763
2510 Ga0501047_0240312 3300049581 Bacteria 1662
2511 Ga0501047_0270269 3300049581 Bacteria 1546
2512 Ga0501047_0468023 3300049581 Bacteria 1089
2513 Ga0501047_0493631 3300049581 Bacteria 1051
2514 Ga0501047_0535225 3300049581 Bacteria 997
2515 Ga0501048_0001444 3300049582 Bacteria 18038
2516 Ga0501048_0002034 3300049582 Bacteria 15361
2517 Ga0501048_0013490 3300049582 Bacteria 6065
2518 Ga0501048_0117605 3300049582 Bacteria 1878
2519 Ga0501048_0393258 3300049582 Bacteria 990
2520 Ga0501067_0000160 3300049583 Bacteria 37883
2521 Ga0501067_0020942 3300049583 Bacteria 3618
2522 Ga0501067_0048969 3300049583 Bacteria 2342
2523 Ga0501068_0000014 3300049584 Bacteria 62762
2524 Ga0501068_0001689 3300049584 Bacteria 11774
2525 Ga0501068_0015782 3300049584 Bacteria 4345
2526 Ga0501068_0045654 3300049584 Bacteria 2639
2527 Ga0501068_0054899 3300049584 Bacteria 2413
2528 Ga0501068_0082084 3300049584 Bacteria 1979
2529 Ga0501068_0091615 3300049584 Bacteria 1876
2530 Ga0501069_0004593 3300049585 Bacteria 7142
2531 Ga0501069_0042963 3300049585 Bacteria 2501
2532 Ga0501069_0043355 3300049585 Bacteria 2490
2533 Ga0501069_0043823 3300049585 Bacteria 2477
2534 Ga0501069_0063144 3300049585 Bacteria 2068
2535 Ga0501069_0115199 3300049585 Bacteria 1533
2536 Ga0501070_0003132 3300049586 Bacteria 14403
2537 Ga0501070_0003722 3300049586 Bacteria 13172
2538 Ga0501070_0020920 3300049586 Bacteria 5488
2539 Ga0501070_0022310 3300049586 Bacteria 5303
2540 Ga0501070_0034852 3300049586 Bacteria 4206
2541 Ga0501070_0047718 3300049586 Bacteria 3558
2542 Ga0501070_0065508 3300049586 Bacteria 3008
2543 Ga0501070_0122197 3300049586 Bacteria 2152
2544 Ga0501070_0146421 3300049586 Bacteria 1949
2545 Ga0501070_0537592 3300049586 Bacteria 936
2546 Ga0501071_0109529 3300049587 Bacteria 2040
2547 Ga0501071_0153059 3300049587 Bacteria 1721
2548 Ga0501072_0001159 3300049588 Bacteria 19618
2549 Ga0501072_0095919 3300049588 Bacteria 2357
2550 Ga0501072_0219585 3300049588 Bacteria 1515
2551 Ga0501072_0241887 3300049588 Bacteria 1437
2552 Ga0501072_0487385 3300049588 Bacteria 975
2553 Ga0501072_0533043 3300049588 Bacteria 928
2554 Ga0501073_0002573 3300049589 Bacteria 13565
2555 Ga0501073_0019863 3300049589 Bacteria 4847
2556 Ga0501073_0020039 3300049589 Bacteria 4822
2557 Ga0501073_0034051 3300049589 Bacteria 3626
2558 Ga0501073_0046419 3300049589 Bacteria 3055
2559 Ga0501073_0082348 3300049589 Bacteria 2238
2560 Ga0501073_0176214 3300049589 Bacteria 1480
2561 Ga0501073_0196090 3300049589 Bacteria 1397
2562 Ga0501073_0239263 3300049589 Bacteria 1254
2563 Ga0501073_0249679 3300049589 Bacteria 1225
2564 Ga0501074_0000596 3300049590 Bacteria 22464
2565 Ga0501074_0036536 3300049590 Bacteria 3558
2566 Ga0501074_0061843 3300049590 Bacteria 2697
2567 Ga0501074_0157089 3300049590 Bacteria 1624
2568 Ga0501075_0025051 3300049591 Bacteria 4381
2569 Ga0501075_0269332 3300049591 Bacteria 1298
2570 Ga0501076_0111199 3300049592 Bacteria 2214
2571 Ga0501077_0033307 3300049593 Bacteria 3279
2572 Ga0501079_0000261 3300049741 Bacteria 32317
2573 Ga0501079_0020413 3300049741 Bacteria 5064
2574 Ga0501079_0026383 3300049741 Bacteria 4454
2575 Ga0501079_0028695 3300049741 Bacteria 4271
2576 Ga0501079_0580980 3300049741 Bacteria 881
2577 Ga0501080_0000917 3300049742 Bacteria 24141
2578 Ga0501080_0001026 3300049742 Bacteria 22970
2579 Ga0501080_0002860 3300049742 Bacteria 15179
2580 Ga0501080_0016248 3300049742 Bacteria 6873
2581 Ga0501080_0021293 3300049742 Bacteria 6001
2582 Ga0501080_0049006 3300049742 Bacteria 3931
2583 Ga0501080_0100255 3300049742 Bacteria 2687
2584 Ga0501080_0244403 3300049742 Bacteria 1637
2585 Ga0501080_0286137 3300049742 Bacteria 1497
2586 Ga0501081_0019996 3300049743 Bacteria 4462
2587 Ga0501081_0046488 3300049743 Bacteria 2984
2588 Ga0501083_0000301 3300049744 Bacteria 31182
2589 Ga0501083_0010516 3300049744 Bacteria 6511
2590 Ga0501083_0016358 3300049744 Bacteria 5193
2591 Ga0501083_0106640 3300049744 Bacteria 1844
2592 Ga0501083_0121351 3300049744 Bacteria 1714
2593 Ga0501083_0171586 3300049744 Bacteria 1417
2594 Ga0501083_0244487 3300049744 Bacteria 1168
2595 Ga0501083_0312413 3300049744 Bacteria 1022
2596 Ga0501083_0328591 3300049744 Bacteria 994
2597 Ga0501083_0344361 3300049744 Bacteria 969
2598 Ga0501035_0000324 3300049822 Bacteria 55297
2599 Ga0501035_0001156 3300049822 Bacteria 27546
2600 Ga0501035_0005480 3300049822 Bacteria 11991
2601 Ga0501035_0012093 3300049822 Bacteria 7979
2602 Ga0501035_0055816 3300049822 Bacteria 3526
2603 Ga0501035_0069325 3300049822 Bacteria 3126
2604 Ga0501035_0091241 3300049822 Bacteria 2681
2605 Ga0501035_0119276 3300049822 Bacteria 2307
2606 Ga0501035_0203869 3300049822 Bacteria 1695
2607 Ga0501035_0229475 3300049822 Bacteria 1582
2608 Ga0501035_0271327 3300049822 Bacteria 1436
2609 Ga0501035_0450563 3300049822 Bacteria 1064
2610 Ga0501035_0512141 3300049822 Bacteria 987
2611 Ga0501044_0000051 3300049823 Bacteria 143658
2612 Ga0501044_0000084 3300049823 Bacteria 114544
2613 Ga0501044_0006565 3300049823 Bacteria 12844
2614 Ga0501044_0008033 3300049823 Bacteria 11591
2615 Ga0501044_0033271 3300049823 Bacteria 5418
2616 Ga0501044_0036889 3300049823 Bacteria 5112
2617 Ga0501044_0037160 3300049823 Bacteria 5091
2618 Ga0501044_0037167 3300049823 Bacteria 5090
2619 Ga0501044_0051547 3300049823 Bacteria 4242
2620 Ga0501044_0070506 3300049823 Bacteria 3555
2621 Ga0501044_0077568 3300049823 Bacteria 3369
2622 Ga0501044_0088673 3300049823 Bacteria 3122
2623 Ga0501044_0091268 3300049823 Bacteria 3072
2624 Ga0501044_0100663 3300049823 Bacteria 2908
2625 Ga0501044_0151146 3300049823 Bacteria 2304
2626 Ga0501044_0169989 3300049823 Bacteria 2152
2627 Ga0501044_0284637 3300049823 Bacteria 1585
2628 Ga0501044_0464635 3300049823 Bacteria 1170
2629 Ga0501045_0016881 3300049824 Bacteria 5186
2630 Ga0501045_0048136 3300049824 Bacteria 3107
2631 nmdc:mga03683_41483_c1 3300050489 Bacteria 1890
2632 nmdc:mga03683_69184_c1 3300050489 Bacteria 1506
2633 nmdc:mga03683_91166_c1 3300050489 Bacteria 1329
2634 nmdc:mga03n38_11031_c1 3300050490 Bacteria 3351
2635 nmdc:mga03n38_282470_c1 3300050490 Bacteria 886
2636 nmdc:mga03n38_299997_c1 3300050490 Bacteria 862
2637 nmdc:mga03n38_91030_c1 3300050490 Bacteria 1452
2638 nmdc:mga00v17_131991_c1 3300050491 Bacteria 1597
2639 nmdc:mga00v17_159717_c1 3300050491 Bacteria 1450
2640 nmdc:mga00v17_16076_c1 3300050491 Bacteria 4214
2641 nmdc:mga00v17_176043_c1 3300050491 Bacteria 1380
2642 nmdc:mga00v17_184695_c1 3300050491 Bacteria 1346
2643 nmdc:mga00v17_5870_c1 3300050491 Bacteria 6485
2644 nmdc:mga00v17_88041_c1 3300050491 Bacteria 1947
2645 nmdc:mga0yw44_10209_c1 3300050492 Bacteria 4788
2646 nmdc:mga0yw44_105764_c1 3300050492 Bacteria 1798
2647 nmdc:mga0yw44_116394_c1 3300050492 Bacteria 1718
2648 nmdc:mga0yw44_124291_c1 3300050492 Bacteria 1665
2649 nmdc:mga0yw44_141174_c1 3300050492 Bacteria 1566
2650 nmdc:mga0yw44_152552_c1 3300050492 Bacteria 1508
2651 nmdc:mga0yw44_154247_c1 3300050492 Bacteria 1500
2652 nmdc:mga0yw44_26596_c1 3300050492 Bacteria 3307
2653 nmdc:mga0yw44_356161_c1 3300050492 Bacteria 986
2654 nmdc:mga0yw44_887_c1 3300050492 Bacteria 11269
2655 nmdc:mga0k408_110407_c1 3300050493 Bacteria 1626
2656 nmdc:mga0k408_111488_c1 3300050493 Bacteria 1617
2657 nmdc:mga0k408_64818_c1 3300050493 Bacteria 2126
2658 nmdc:mga0k408_80263_c1 3300050493 Bacteria 1909
2659 nmdc:mga06z11_101686_c1 3300050494 Bacteria 1578
2660 nmdc:mga06z11_125362_c1 3300050494 Bacteria 1437
2661 nmdc:mga06z11_126939_c1 3300050494 Bacteria 1428
2662 nmdc:mga06z11_224126_c1 3300050494 Bacteria 1100
2663 nmdc:mga06z11_226025_c1 3300050494 Bacteria 1095
2664 nmdc:mga06z11_235353_c1 3300050494 Bacteria 1074
2665 nmdc:mga06z11_29777_c1 3300050494 Bacteria 2634
2666 nmdc:mga06z11_58188_c1 3300050494 Bacteria 2005
2667 nmdc:mga04h51_11394_c1 3300050495 Bacteria 2467
2668 nmdc:mga04h51_26535_c1 3300050495 Bacteria 1792
2669 nmdc:mga04h51_71258_c1 3300050495 Bacteria 1214
2670 nmdc:mga04h51_75646_c1 3300050495 Bacteria 1185
2671 nmdc:mga07m45_14318_c1 3300050496 Bacteria 4223
2672 nmdc:mga07m45_218385_c1 3300050496 Bacteria 1109
2673 nmdc:mga07m45_221501_c1 3300050496 Bacteria 1101
2674 nmdc:mga07m45_25821_c1 3300050496 Bacteria 3225
2675 nmdc:mga07m45_32763_c2 3300050496 Bacteria 2016
2676 nmdc:mga07m45_33931_c1 3300050496 Bacteria 2835
2677 nmdc:mga07m45_56860_c1 3300050496 Bacteria 2212
2678 nmdc:mga07m45_83386_c1 3300050496 Bacteria 1827
2679 nmdc:mga07m45_86605_c1 3300050496 Bacteria 1792
2680 nmdc:mga05p37_20750_c1 3300050507 Bacteria 7951
2681 nmdc:mga05p37_2742_c1 3300050507 Bacteria 20456
2682 nmdc:mga05p37_302469_c1 3300050507 Bacteria 1900
2683 nmdc:mga05p37_325668_c1 3300050507 Bacteria 1817
2684 nmdc:mga05p37_3855_c1 3300050507 Bacteria 17548
2685 nmdc:mga05p37_40529_c1 3300050507 Bacteria 5719
2686 nmdc:mga05p37_450067_c1 3300050507 Bacteria 1491
2687 nmdc:mga05p37_45113_c1 3300050507 Bacteria 5423
2688 nmdc:mga05p37_51739_c1 3300050507 Bacteria 5050
2689 nmdc:mga05p37_59708_c1 3300050507 Bacteria 4696
2690 nmdc:mga05p37_828_c1 3300050507 Bacteria 34679
2691 nmdc:mga09592_101986_c1 3300050508 Bacteria 1817
2692 nmdc:mga09592_17204_c1 3300050508 Bacteria 5921
2693 nmdc:mga09592_229069_c1 3300050508 Bacteria 1610
2694 nmdc:mga09592_32841_c1 3300050508 Bacteria 4327
2695 nmdc:mga09592_3919_c1 3300050508 Bacteria 11990
2696 nmdc:mga09592_500287_c1 3300050508 Bacteria 1046
2697 nmdc:mga09592_71487_c1 3300050508 Bacteria 2945
2698 nmdc:mga09592_82786_c1 3300050508 Bacteria 2735
2699 nmdc:mga0qj67_125797_c1 3300050509 Bacteria 2075
2700 nmdc:mga0qj67_165_c1 3300050509 Bacteria 44307
2701 nmdc:mga0qj67_20911_c1 3300050509 Bacteria 5014
2702 nmdc:mga0qj67_29170_c1 3300050509 Bacteria 4285
2703 nmdc:mga0qj67_71064_c1 3300050509 Bacteria 2777
2704 nmdc:mga0qj67_936448_c1 3300050509 Bacteria 681
2705 nmdc:mga06r32_14959_c1 3300050510 Bacteria 7043
2706 nmdc:mga06r32_15975_c1 3300050510 Bacteria 6831
2707 nmdc:mga06r32_2962_c1 3300050510 Bacteria 12463
2708 nmdc:mga06r32_313761_c1 3300050510 Bacteria 1554
2709 nmdc:mga06r32_513_c1 3300050510 Bacteria 33328
2710 nmdc:mga06r32_52693_c1 3300050510 Bacteria 3897
2711 nmdc:mga06r32_7280_c1 3300050510 Bacteria 9966
2712 nmdc:mga08y16_1045_c1 3300050511 Bacteria 27157
2713 nmdc:mga08y16_121624_c1 3300050511 Bacteria 2717
2714 nmdc:mga08y16_135539_c1 3300050511 Bacteria 2559
2715 nmdc:mga08y16_145902_c1 3300050511 Bacteria 2460
2716 nmdc:mga08y16_213789_c1 3300050511 Bacteria 1997
2717 nmdc:mga08y16_354861_c1 3300050511 Bacteria 1506
2718 nmdc:mga08y16_373770_c1 3300050511 Bacteria 1462
2719 nmdc:mga08y16_4405_c1 3300050511 Bacteria 14718
2720 nmdc:mga0n895_110849_c1 3300050512 Bacteria 2760
2721 nmdc:mga0n895_1284_c1 3300050512 Bacteria 18562
2722 nmdc:mga0n895_184847_c1 3300050512 Bacteria 2115
2723 nmdc:mga0n895_20210_c1 3300050512 Bacteria 6205
2724 nmdc:mga0n895_2213_c1 3300050512 Bacteria 15039
2725 nmdc:mga0n895_3322_c1 3300050512 Bacteria 12929
2726 nmdc:mga0n895_40795_c1 3300050512 Bacteria 4510
2727 nmdc:mga0n895_444275_c1 3300050512 Bacteria 1310
2728 nmdc:mga0n895_448137_c1 3300050512 Bacteria 1303
2729 nmdc:mga0n895_62290_c1 3300050512 Bacteria 3686
2730 nmdc:mga0n895_933986_c1 3300050512 Bacteria 852
2731 nmdc:mga0rr50_103584_c1 3300050513 Bacteria 2240
2732 nmdc:mga0rr50_1278_c1 3300050513 Bacteria 13714
2733 nmdc:mga0rr50_144241_c1 3300050513 Bacteria 1918
2734 nmdc:mga0rr50_21174_c1 3300050513 Bacteria 4433
2735 nmdc:mga0rr50_2496_c1 3300050513 Bacteria 10402
2736 nmdc:mga08x19_121449_c1 3300050514 Bacteria 1752
2737 nmdc:mga08x19_2261_c1 3300050514 Bacteria 11717
2738 nmdc:mga08x19_3072_c1 3300050514 Bacteria 7376
2739 nmdc:mga08x19_3746_c1 3300050514 Bacteria 9052
2740 nmdc:mga08x19_436922_c1 3300050514 Bacteria 920
2741 nmdc:mga08x19_54430_c1 3300050514 Bacteria 2576
2742 nmdc:mga0a205_10565_c1 3300050515 Bacteria 8483
2743 nmdc:mga0a205_105869_c1 3300050515 Bacteria 2711
2744 nmdc:mga0a205_10612_c1 3300050515 Bacteria 8467
2745 nmdc:mga0a205_1632_c1 3300050515 Bacteria 19295
2746 nmdc:mga0a205_32349_c1 3300050515 Bacteria 5016
2747 nmdc:mga0a205_381697_c1 3300050515 Bacteria 1274
2748 nmdc:mga0a205_6515_c2 3300050515 Bacteria 10082
2749 nmdc:mga0a205_7303_c1 3300050515 Bacteria 9995
2750 nmdc:mga0sz30_115666_c1 3300050516 Bacteria 1177
2751 nmdc:mga0sz30_11655_c1 3300050516 Bacteria 3401
2752 nmdc:mga0sz30_1322_c1 3300050516 Bacteria 6492
2753 nmdc:mga0sz30_33822_c1 3300050516 Bacteria 2126
2754 nmdc:mga0sz30_4022_c1 3300050516 Bacteria 5292
2755 nmdc:mga0sz30_50881_c1 3300050516 Bacteria 1757
2756 nmdc:mga0sz30_570_c1 3300050516 Bacteria 13839
2757 nmdc:mga0sz30_59902_c1 3300050516 Bacteria 948
2758 nmdc:mga0sz30_956_c2 3300050516 Bacteria 8669
2759 Ga0495601_0000003 3300053077 Bacteria 493642
2760 Ga0495601_0000075 3300053077 Bacteria 54434
2761 Ga0495601_0001377 3300053077 Bacteria 13377
2762 Ga0495601_0001804 3300053077 Bacteria 11885
2763 Ga0495601_0003301 3300053077 Bacteria 9227
2764 Ga0495601_0005086 3300053077 Bacteria 7636
2765 Ga0495601_0021970 3300053077 Bacteria 3913
2766 Ga0495601_0063818 3300053077 Bacteria 2341
2767 Ga0495601_0092437 3300053077 Bacteria 1949
2768 Ga0495601_0096139 3300053077 Bacteria 1910
2769 Ga0495601_0129405 3300053077 Bacteria 1643
2770 Ga0495601_0233512 3300053077 Bacteria 1201
2771 Ga0495612_0000007 3300053078 Bacteria 253300
2772 Ga0495612_0004225 3300053078 Bacteria 5958
2773 Ga0495612_0010002 3300053078 Bacteria 3840
2774 Ga0495612_0015920 3300053078 Bacteria 3013
2775 Ga0495612_0066303 3300053078 Bacteria 1501
2776 Ga0495612_0086486 3300053078 Bacteria 1322
2777 Ga0495612_0156839 3300053078 Bacteria 992
2778 Ga0500610_0008035 3300053079 Bacteria 4571
2779 Ga0500610_0189157 3300053079 Bacteria 1001
2780 Ga0500610_0213805 3300053079 Bacteria 919
2781 Ga0500635_0014231 3300053080 Bacteria 2326
2782 Ga0495655_0011038 3300053083 Bacteria 1803
2783 Ga0495655_0030657 3300053083 Bacteria 1303
2784 Ga0495595_0000018 3300053084 Bacteria 126874
2785 Ga0495595_0000253 3300053084 Bacteria 21240
2786 Ga0495595_0001128 3300053084 Bacteria 10339
2787 Ga0495595_0001986 3300053084 Bacteria 7952
2788 Ga0495595_0002088 3300053084 Bacteria 7764
2789 Ga0495595_0004048 3300053084 Bacteria 5868
2790 Ga0495595_0044569 3300053084 Bacteria 2038
2791 Ga0495619_0000009 3300053085 Bacteria 305595
2792 Ga0495619_0000176 3300053085 Bacteria 47128
2793 Ga0495619_0000315 3300053085 Bacteria 33904
2794 Ga0495619_0000907 3300053085 Bacteria 19405
2795 Ga0495619_0002367 3300053085 Bacteria 12397
2796 Ga0495619_0002424 3300053085 Bacteria 12243
2797 Ga0495619_0006236 3300053085 Bacteria 7563
2798 Ga0495619_0007164 3300053085 Bacteria 7065
2799 Ga0495619_0015919 3300053085 Bacteria 4762
2800 Ga0495619_0017210 3300053085 Bacteria 4578
2801 Ga0495619_0019609 3300053085 Bacteria 4300
2802 Ga0495619_0019765 3300053085 Bacteria 4285
2803 Ga0495619_0222045 3300053085 Bacteria 1309
2804 Ga0495619_0339232 3300053085 Bacteria 1040
2805 Ga0495619_0489101 3300053085 Bacteria 847
2806 Ga0500578_0093463 3300053086 Bacteria 1908
2807 Ga0500643_000032 3300053087 Bacteria 200350
2808 Ga0500643_021172 3300053087 Bacteria 2111
2809 Ga0500643_031514 3300053087 Bacteria 1616
2810 Ga0500644_0000616 3300053088 Bacteria 13364
2811 Ga0500644_0026260 3300053088 Bacteria 1800
2812 Ga0500581_036908 3300053089 Bacteria 2504
2813 Ga0500647_0031804 3300053091 Bacteria 2512
2814 Ga0500583_0044935 3300053092 Bacteria 2025
2815 Ga0500651_0126100 3300053093 Bacteria 1551
2816 Ga0500651_0158921 3300053093 Bacteria 1352
2817 Ga0500651_0223819 3300053093 Bacteria 1102
2818 Ga0500566_0000009 3300053094 Bacteria 131668
2819 Ga0500566_0005587 3300053094 Bacteria 7469
2820 Ga0500566_0019862 3300053094 Bacteria 3943
2821 Ga0500566_0039944 3300053094 Bacteria 2712
2822 Ga0500566_0056157 3300053094 Bacteria 2240
2823 Ga0500640_000068 3300053095 Bacteria 17078
2824 Ga0500641_0002050 3300053096 Bacteria 7159
2825 Ga0500641_0003846 3300053096 Bacteria 5306
2826 Ga0500641_0017488 3300053096 Bacteria 2682
2827 Ga0500648_215838 3300053097 Bacteria 946
2828 Ga0500650_0002825 3300053098 Bacteria 5854
2829 Ga0500650_0100149 3300053098 Bacteria 1355
2830 Ga0500650_0167296 3300053098 Bacteria 1012
2831 Ga0500654_056014 3300053099 Bacteria 2070
2832 Ga0500554_002596 3300053102 Bacteria 3578
2833 Ga0500554_003367 3300053102 Bacteria 3265
2834 Ga0500555_007765 3300053103 Bacteria 3051
2835 Ga0500555_070424 3300053103 Bacteria 924
2836 Ga0500556_0000004 3300053104 Bacteria 666287
2837 Ga0500557_000004 3300053105 Bacteria 202318
2838 Ga0500560_003025 3300053107 Bacteria 3328
2839 Ga0500562_038362 3300053108 Bacteria 1272
2840 Ga0500569_001569 3300053109 Bacteria 4342
2841 Ga0500569_005035 3300053109 Bacteria 2819
2842 Ga0500569_054331 3300053109 Bacteria 1218
2843 Ga0500572_000070 3300053111 Bacteria 32133
2844 Ga0500572_001200 3300053111 Bacteria 7382
2845 Ga0500592_001517 3300053116 Bacteria 3759
2846 Ga0500594_0000057 3300053118 Bacteria 34625
2847 Ga0500594_0042078 3300053118 Bacteria 1254
2848 Ga0500595_000002 3300053119 Bacteria 1074388
2849 Ga0500595_000022 3300053119 Bacteria 149029
2850 Ga0500595_000480 3300053119 Bacteria 24621
2851 Ga0500595_000759 3300053119 Bacteria 18981
2852 Ga0500595_004688 3300053119 Bacteria 6076
2853 Ga0500595_004779 3300053119 Bacteria 6002
2854 Ga0500595_007399 3300053119 Bacteria 4557
2855 Ga0500595_022956 3300053119 Bacteria 2198
2856 Ga0500595_024725 3300053119 Bacteria 2093
2857 Ga0500595_064419 3300053119 Bacteria 1099
2858 Ga0500597_037008 3300053120 Bacteria 2038
2859 Ga0500607_023944 3300053121 Bacteria 3414
2860 Ga0500608_001229 3300053122 Bacteria 9146
2861 Ga0500608_018917 3300053122 Bacteria 3150
2862 Ga0500608_071643 3300053122 Bacteria 1648
2863 Ga0500608_125177 3300053122 Bacteria 1160
2864 Ga0500614_003149 3300053123 Bacteria 3576
2865 Ga0500614_003281 3300053123 Bacteria 3498
2866 Ga0500617_131272 3300053124 Bacteria 1019
2867 Ga0500618_034638 3300053125 Bacteria 1174
2868 Ga0500621_074980 3300053126 Bacteria 1361
2869 Ga0500642_0000173 3300053130 Bacteria 26732
2870 Ga0500642_0000186 3300053130 Bacteria 25633
2871 Ga0500642_0017033 3300053130 Bacteria 2775
2872 Ga0500642_0080104 3300053130 Bacteria 1499
2873 Ga0500642_0187719 3300053130 Bacteria 965
2874 Ga0500652_018588 3300053131 Bacteria 2568
2875 Ga0500652_136118 3300053131 Bacteria 1024
2876 Ga0500652_166336 3300053131 Bacteria 909
2877 Ga0500658_0001954 3300053134 Bacteria 8068
2878 Ga0500658_0012242 3300053134 Bacteria 3161
2879 Ga0500559_0006553 3300053136 Bacteria 5252
2880 Ga0500559_0008102 3300053136 Bacteria 4622
2881 Ga0500559_0040023 3300053136 Bacteria 2040
2882 Ga0500559_0073867 3300053136 Bacteria 1539
2883 Ga0500559_0139113 3300053136 Bacteria 1136
2884 Ga0500561_0000056 3300053137 Bacteria 21920
2885 Ga0500568_0000447 3300053139 Bacteria 31023
2886 Ga0500568_0001430 3300053139 Bacteria 15482
2887 Ga0500568_0130791 3300053139 Bacteria 933
2888 Ga0500568_0133055 3300053139 Bacteria 924
2889 Ga0500573_0050606 3300053140 Bacteria 2389
2890 Ga0500577_0000153 3300053142 Bacteria 17131
2891 Ga0500577_0127559 3300053142 Bacteria 1064
2892 Ga0500586_004604 3300053145 Bacteria 3401
2893 Ga0500590_045152 3300053148 Bacteria 2256
2894 Ga0500603_000885 3300053150 Bacteria 7123
2895 Ga0500603_004929 3300053150 Bacteria 2863
2896 Ga0500604_0002499 3300053151 Bacteria 5013
2897 Ga0500604_0007955 3300053151 Bacteria 2812
2898 Ga0500604_0010784 3300053151 Bacteria 2448
2899 Ga0500604_0011473 3300053151 Bacteria 2380
2900 Ga0500616_0000002 3300053153 Bacteria 1611257
2901 Ga0500616_0000014 3300053153 Bacteria 637918
2902 Ga0500616_0000372 3300053153 Bacteria 62890
2903 Ga0500616_0030193 3300053153 Bacteria 2978
2904 Ga0500616_0032283 3300053153 Bacteria 2863
2905 Ga0500616_0037019 3300053153 Bacteria 2644
2906 Ga0500620_004101 3300053155 Bacteria 3209
2907 Ga0500622_0000513 3300053156 Bacteria 35999
2908 Ga0500622_0097644 3300053156 Bacteria 1450
2909 Ga0500627_0025026 3300053158 Bacteria 2449
2910 Ga0500630_000240 3300053159 Bacteria 21822
2911 Ga0500633_0009242 3300053160 Bacteria 2583
2912 Ga0500638_000252 3300053162 Bacteria 11670
2913 Ga0500638_013918 3300053162 Bacteria 3656
2914 Ga0500638_101585 3300053162 Bacteria 1340
2915 Ga0500638_147401 3300053162 Bacteria 1050
2916 Ga0500639_000545 3300053163 Bacteria 18833
2917 Ga0500639_163417 3300053163 Bacteria 1009
2918 Ga0500636_0000122 3300053177 Bacteria 40577
2919 Ga0500636_0001016 3300053177 Bacteria 15031
2920 Ga0500636_0090660 3300053177 Bacteria 1750
2921 Ga0500637_0000142 3300053178 Bacteria 26117
2922 Ga0500637_0001199 3300053178 Bacteria 10807
2923 Ga0500637_0027475 3300053178 Bacteria 3142
2924 Ga0500637_0035511 3300053178 Bacteria 2794
2925 Ga0500637_0233096 3300053178 Bacteria 1036
2926 Ga0500611_010939 3300053727 Bacteria 1486
2927 Ga0500657_073658 3300053728 Bacteria 1488
2928 Ga0500625_014344 3300053729 Bacteria 3659
2929 Ga0500645_000012 3300053730 Bacteria 168579
2930 Ga0500645_009177 3300053730 Bacteria 3335
2931 Ga0500609_004863 3300053731 Bacteria 1843
2932 Ga0500609_006562 3300053731 Bacteria 1585
2933 Ga0500552_002620 3300053733 Bacteria 1767
2934 Ga0500596_000198 3300053735 Bacteria 9955
2935 Ga0500596_008430 3300053735 Bacteria 1644
2936 Ga0500601_000050 3300053737 Bacteria 24752
2937 Ga0501084_0014689 3300054114 Bacteria 6493
2938 Ga0501084_0045232 3300054114 Bacteria 3686
2939 Ga0501084_0178774 3300054114 Bacteria 1791
2940 Ga0501084_0269394 3300054114 Bacteria 1438
2941 Ga0501084_0453071 3300054114 Bacteria 1085
2942 Ga0500661_001246 3300055283 Bacteria 4759
2943 Ga0500661_016936 3300055283 Bacteria 1302
2944 Ga0501082_0072431 3300060353 Bacteria 2968
2945 Ga0501082_0101026 3300060353 Bacteria 2495
2946 Ga0501082_0282250 3300060353 Bacteria 1445
2947 Ga0501082_0442877 3300060353 Bacteria 1135
2948 Ga0501082_0602998 3300060353 Bacteria 961
2949 Ga0466962_0010452 3300061719 Bacteria 4462
2950 2507508415 2507262055 Bacteria 8048963
2951 2508542482 2508501009 Bacteria 7784016
2952 2508691744 2508501042 Bacteria 8719808
2953 2509150524 2508501128 Bacteria 8613869
2954 2509385520 2509276021 Bacteria 7634384
2955 2509448440 2509276033 Bacteria 7180565
2956 2510136529 2510065019 Bacteria 6903379
2957 2510900198 2510461076 Bacteria 8618824
2958 2511400722 2511231028 Bacteria 8046582
2959 2513569618 2513237084 Bacteria 7231967
2960 2513576442 2513237085 Bacteria 7695351
2961 2513625553 2513237092 Bacteria 8341956
2962 2513635284 2513237093 Bacteria 7545552
2963 2513644463 2513237094 Bacteria 8789602
2964 2513645669 2513237095 Bacteria 8976980
2965 2513658002 2513237096 Bacteria 8722461
2966 2513676089 2513237098 Bacteria 9902361
2967 2513692738 2513237101 Bacteria 7952346
2968 2513701112 2513237102 Bacteria 7703324
2969 2513709822 2513237103 Bacteria 7647401
2970 2513717134 2513237104 Bacteria 10034502
2971 2513855704 2513237137 Bacteria 9558895
2972 2513872943 2513237139 Bacteria 8737671
2973 2513893961 2513237141 Bacteria 8496279
2974 2513919904 2513237145 Bacteria 8979722
2975 2514013703 2513237161 Bacteria 8871253
2976 2514018810 2513237162 Bacteria 7468464
2977 2515115102 2515075009 Bacteria 7288508
2978 2515627092 2515154112 Bacteria 8294334
2979 2515633288 2515154113 Bacteria 7807172
2980 2515642513 2515154114 Bacteria 7848616
2981 2515658490 2515154116 Bacteria 7552979
2982 2515741955 2515154134 Bacteria 7220242
2983 2517041898 2516653077 Bacteria 7555578
2984 2517081073 2516653085 Bacteria 7346596
2985 2517098589 2517093000 Bacteria 7412387
2986 2517107782 2517093001 Bacteria 9002274
2987 2517410864 2517287029 Bacteria 6905599
2988 2517892243 2517572143 Bacteria 9484767
2989 2524437523 2524023205 Bacteria 8918781
2990 2524465683 2524023210 Bacteria 9029266
2991 2524540322 2524023228 Bacteria 10118060
2992 2528852401 2528768022 Bacteria 10457665
2993 2530644525 2529292951 Bacteria 6916614
2994 2537875735 2537561587 Bacteria 5425293
2995 2554244838 2554235003 Bacteria 5877155
2996 2559297328 2558860242 Bacteria 5568029
2997 2585539237 2585427528 Bacteria 6842387
2998 2585837191 2585427593 Bacteria 7141551
2999 2599605877 2599185210 Bacteria 5624189
3000 2601611569 2600255279 Bacteria 5605316
3001 2601748879 2600255308 Bacteria 5611129
3002 2603859620 2602042107 Bacteria 6226103
3003 2617347341 2617270735 Bacteria 9163226
3004 2617375574 2617270741 Bacteria 8201522
3005 2643757146 2643221547 Bacteria 4740017
3006 2643921870 2643221582 Bacteria 5804683
3007 2644288820 2643221651 Bacteria 4798932
3008 2644519837 2643221693 Bacteria 5513853
3009 2671120509 2667528175 Bacteria 7532676
3010 2719183793 2718217882 Bacteria 6556348
3011 2719388466 2718217927 Bacteria 6972593
3012 2719668094 2718217997 Bacteria 6740740
3013 2719728234 2718218009 Bacteria 6478651
3014 2720494857 2718218199 Bacteria 6740745
3015 2720611177 2718218232 Bacteria 6720332
3016 2720616350 2718218233 Bacteria 6662049
3017 2720629424 2718218235 Bacteria 6630699
3018 2720771995 2718218269 Bacteria 6906114
3019 2721145095 2718218363 Bacteria 6524337
3020 2721155832 2718218365 Bacteria 6274507
3021 2721167182 2718218366 Bacteria 6425255
3022 2721403089 2718218423 Bacteria 6438183
3023 2722838160 2721755514 Bacteria 6424414
3024 2723029426 2721755556 Bacteria 6745503
3025 2723563041 2721755684 Bacteria 6859907
3026 2723571022 2721755685 Bacteria 6704835
3027 2723844883 2721755755 Bacteria 8322773
3028 2724035446 2721755809 Bacteria 6438790
3029 2724042428 2721755810 Bacteria 6479005
3030 2724086815 2721755819 Bacteria 6906405
3031 2724106973 2721755822 Bacteria 6726041
3032 2724107783 2721755823 Bacteria 6752556
3033 2725946294 2724679232 Bacteria 7646494
3034 2728747402 2728368998 Bacteria 8720350
3035 2730105740 2728369352 Bacteria 6745171
3036 2730161933 2728369365 Bacteria 6555560
3037 2730300939 2728369397 Bacteria 6274511
3038 2739033687 2738541333 Bacteria 7106503
3039 2745076485 2744054633 Bacteria 8678936
3040 2766068409 2765235942 Bacteria 7445910
3041 2776914772 2775507049 Bacteria 6284736
3042 2793065437 2791355196 Bacteria 7323613
3043 2793072416 2791355197 Bacteria 8420563
3044 2793082246
3045 2793298914 2791355256 Bacteria 6798008
3046 2793317184 2791355259 Bacteria 7254731
3047 2793325668 2791355261 Bacteria 6661293
3048 2793333093 2791355262 Bacteria 6774204
3049 2793340103 2791355263 Bacteria 6872478
3050 2793346269 2791355264 Bacteria 6429314
3051 2793355486 2791355265 Bacteria 6539969
3052 2793357774 2791355266 Bacteria 7116587
3053 2793369718 2791355267 Bacteria 7222458
3054 2805915159 2802429603 Bacteria 8777136
3055 2805929078 2802429605 Bacteria 6875453
3056 2805937220 2802429606 Bacteria 6346811
3057 2806044814 2802429633 Bacteria 7341974
3058 2806054026 2802429634 Bacteria 7083200
3059 2806059882 2802429635 Bacteria 7650140
3060 2806066065 2802429636 Bacteria 7597525
3061 2806073353 2802429637 Bacteria 7067217
3062 2808988714 2808606387 Bacteria 5697198
3063 2818238712 2816332527 Bacteria 8933356
3064 2819561423 2818991439 Bacteria 6907412
3065 2824604044 2824600985 Bacteria 8488197
3066 2824610313 2824609381 Bacteria 8672835
3067 2824617906 2824617872 Bacteria 8814715
3068 2824626574 2824626560 Bacteria 8813858
3069 2824638591 2824635225 Bacteria 8785348
3070 2824646059 2824644064 Bacteria 8743947
3071 2824658046 2824653114 Bacteria 8493680
3072 2824668331 2824661429 Bacteria 9877870
3073 2824676870 2824671348 Bacteria 8369588
3074 2824684509 2824679649 Bacteria 8248951
3075 2824693179 2824687955 Bacteria 8360029
3076 2824701811 2824696289 Bacteria 8335049
3077 2824708998 2824704595 Bacteria 9667483
3078 2824716245 2824714736 Bacteria 8717648
3079 2824726544 2824723954 Bacteria 8758240
3080 2824735285 2824732956 Bacteria 7810675
3081 2824746615 2824746037 Bacteria 7911610
3082 2824759580 2824753945 Bacteria 9787441
3083 2824770017 2824763712 Bacteria 9792355
3084 2824775466 2824773399 Bacteria 8360218
3085 2838019489 2838016132 Bacteria 6577831
3086 2838027208 2838022645 Bacteria 6494267
3087 2838045928 2838042994 Bacteria 6046894
3088 2838050594 2838048938 Bacteria 6044578
3089 2838062886 2838061910 Bacteria 6794874
3090 2838071835 2838068647 Bacteria 6208656
3091 2838123565 2838122688 Bacteria 8803140
3092 2838671516 2838668709 Bacteria 6671819
3093 2838679424 2838675328 Bacteria 4909118
3094 2838684436 2838680041 Bacteria 6545511
3095 2838693591 2838686498 Bacteria 7807632
3096 2838699927 2838694306 Bacteria 6853137
3097 2838704217 2838701080 Bacteria 6669771
3098 2838711788 2838707686 Bacteria 6619912
3099 2838718781 2838714209 Bacteria 5525906
3100 2838723779 2838719591 Bacteria 5523910
3101 2838729102 2838724970 Bacteria 4908691
3102 2838735484 2838729681 Bacteria 7400765
3103 2838748386 2838742623 Bacteria 7396178
3104 2841851130 2841846520 Bacteria 5345850
3105 2841858450 2841851746 Bacteria 7532261
3106 2841863935 2841859092 Bacteria 5436171
3107 2841869786 2841864319 Bacteria 6742987
3108 2841946790 2841941048 Bacteria 8688029
3109 2841949665 2841949485 Bacteria 8680857
3110 2841958834 2841957949 Bacteria 8652217
3111 2841971828 2841966195 Bacteria 8673214
3112 2841974826 2841974524 Bacteria 8931498
3113 2841983612 2841983080 Bacteria 8395090
3114 2842038884 2842038055 Bacteria 8002051
3115 2842048170 2842045827 Bacteria 8006841
3116 2842081903 2842077413 Bacteria 6508645
3117 2842115786 2842110456 Bacteria 7656360
3118 2842122479 2842118031 Bacteria 7033875
3119 2842129799 2842124991 Bacteria 5346824
3120 2842134457 2842130223 Bacteria 4909145
3121 2842149165 2842146304 Bacteria 5957337
3122 2842156453 2842152218 Bacteria 4908957
3123 2842162698 2842156927 Bacteria 6894975
3124 2842167069 2842163707 Bacteria 6916235
3125 2842175026 2842170452 Bacteria 5525737
3126 2842179943 2842175837 Bacteria 4908771
3127 2842186202 2842180545 Bacteria 6888678
3128 2842191639 2842187318 Bacteria 5524014
3129 2842195283 2842192696 Bacteria 6147454
3130 2842203419 2842198810 Bacteria 6608673
3131 2842210306 2842205361 Bacteria 6340321
3132 2842215956 2842211629 Bacteria 5523832
3133 2842222222 2842217011 Bacteria 7497767
3134 2842228544 2842224351 Bacteria 5524473
3135 2842236077 2842229732 Bacteria 7475766
3136 2842241200 2842237096 Bacteria 6620661
3137 2842250754 2842243621 Bacteria 7421798
3138 2842253668 2842250916 Bacteria 6579627
3139 2842263304 2842257432 Bacteria 7401195
3140 2842270253 2842264693 Bacteria 6472963
3141 2842278060 2842271015 Bacteria 7807131
3142 2842283760 2842278818 Bacteria 6340002
3143 2842289663 2842285085 Bacteria 6011953
3144 2842295558 2842291075 Bacteria 7076806
3145 2842310018 2842304105 Bacteria 7023636
3146 2842311739 2842311132 Bacteria 6616990
3147 2842319025 2842317721 Bacteria 6793725
3148 2842344020 2842341865 Bacteria 7003929
3149 2842369667 2842363717 Bacteria 6844742
3150 2842376650 2842370503 Bacteria 7038661
3151 2842381666 2842377471 Bacteria 7140707
3152 2842389027 2842384541 Bacteria 7057858
3153 2842396381 2842395702 Bacteria 6780583
3154 2842407196 2842402390 Bacteria 6681310
3155 2842414088 2842409023 Bacteria 6687331
3156 2842420729 2842415677 Bacteria 6596907
3157 2842425468 2842422224 Bacteria 6239196
3158 2842434075 2842428310 Bacteria 6767288
3159 2842440436 2842434925 Bacteria 6502746
3160 2842444009 2842441272 Bacteria 6769273
3161 2842450119 2842447887 Bacteria 6754142
3162 2842468494 2842462802 Bacteria 6588055
3163 2842475012 2842469257 Bacteria 6752936
3164 2842491475 2842489311 Bacteria 6620893
3165 2842499543 2842495871 Bacteria 6820686
3166 2842520717 2842515876 Bacteria 5436280
3167 2844319240 2844315083 Bacteria 8138177
3168 2844461077 2844454524 Bacteria 7952546
3169 2847936393 2847930680 Bacteria 9342022
3170 2847946742 2847939898 Bacteria 8606328
3171 2849079140 2849076700 Bacteria 7039503
3172 2854897431 2854896431 Bacteria 5869725
3173 2854921438 2854916844 Bacteria 5725939
3174 2857514126 2857509624 Bacteria 7472071
3175 2857519210 2857516855 Bacteria 7787325
3176 2857528973 2857524615 Bacteria 6615449
3177 2874598221 2874590934 Bacteria 8299676
3178 2874605397 2874604998 Bacteria 7834745
3179 2874615099 2874612657 Bacteria 8252029
3180 2874627665 2874620515 Bacteria 8290088
3181 2874632031 2874628541 Bacteria 8630250
3182 2874652722 2874645413 Bacteria 8214782
3183 2876763604 2876761206 Bacteria 10111113
3184 2876764692 2876761206 Bacteria 10111113
3185 2876778301 2876771140 Bacteria 8287509
3186 2876809926 2876808645 Bacteria 8824342
3187 2876825830 2876818435 Bacteria 8274608
3188 2879082095 2879074833 Bacteria 8279565
3189 2879090176 2879083081 Bacteria 8587928
3190 2879105729 2879099564 Bacteria 10442239
3191 2879110219 2879110137 Bacteria 8907982
3192 2879135242 2879127579 Bacteria 8294491
3193 2879145399 2879142872 Bacteria 8267021
3194 2881368666 2881364244 Bacteria 7710352
3195 2881673505 2881665667 Bacteria 8175609
3196 2885372987 2885366525 Bacteria 8326213
3197 2885381928 2885374607 Bacteria 8927485
3198 2885390000 2885383462 Bacteria 9473874
3199 2888384240 2888378607 Bacteria 9652610
3200 2888393633 2888388044 Bacteria 7304136
3201 2888424714 2888419890 Bacteria 7857137
3202 2889039649 2889033259 Bacteria 9099371
3203 2893070430 2893066018 Bacteria 6158120
3204 2899794670 2899792073 Bacteria 4926588
3205 2899850392 2899845264 Bacteria 5672268
3206 2903731082 2903727486 Bacteria 8281579
3207 2903749169 2903748898 Bacteria 9972761
3208 2903772427 2903768456 Bacteria 9749579
3209 2904673015 2904666416 Bacteria 8226587
3210 2904694622 2904690495 Bacteria 9412302
3211 2904702401
3212 2904714842 2904711408 Bacteria 9771557
3213 2906607411 2906602504 Bacteria 8295279
3214 2906618776
3215 2906629728 2906626472 Bacteria 8826946
3216 2906643123 2906635258 Bacteria 8601019
3217 2906649010 2906643746 Bacteria 8722424
3218 2906666215 2906660503 Bacteria 8595048
3219 2908742523 2908739725 Bacteria 8628932
3220 2908760177 2908756301 Bacteria 8864324
3221 2908780360 2908775508 Bacteria 8092255
3222 2919076372 2919073203 Bacteria 6531949
3223 2919118845 2919114240 Bacteria 5700270
3224 2922365542 2922361189 Bacteria 7436256
3225 2922374587
3226 2922391165 2922386360 Bacteria 7017218
3227 2922400627 2922393267 Bacteria 8285685
3228 2922430455
3229 2926758134 2926754445 Bacteria 5964435
3230 2926764298 2926760298 Bacteria 5505990
3231 2929618252 2929615660 Bacteria 9193770
3232 2929632440 2929624759 Bacteria 9339455
3233 2932790546 2932784394 Bacteria 9704911
3234 2932799776 2932794094 Bacteria 7915132
3235 2932806973 2932801729 Bacteria 7987968
3236 2932810967 2932809354 Bacteria 9135765
3237 2932823703 2932818245 Bacteria 9955613
3238 2932830177 2932828146 Bacteria 9745859
3239 2933011227 2933006813 Bacteria 4912075
3240 2933016233 2933011516 Bacteria 5439334
3241 2933576459 2933570622 Bacteria 7023390
3242 2933580180 2933577622 Bacteria 9116884
3243 2933591752 2933586486 Bacteria 7667493
3244 2933598947 2933594066 Bacteria 5594265
3245 2933602630 2933599457 Bacteria 5858799
3246 2935609045 2935608549 Bacteria 8203142
3247 2935622597 2935616580 Bacteria 9032984
3248 2935631513 2935630451 Bacteria 8169952
3249 2935642603 2935638405 Bacteria 10015038
3250 2935653246 2935648319 Bacteria 8801166
3251 2935660435 2935656913 Bacteria 8965014
3252 2935668093 2935665750 Bacteria 9571747
3253 2935676126 2935675223 Bacteria 9928132
3254 2935686110 2935684952 Bacteria 9590419
3255 2935701264 2935694250 Bacteria 9291695
3256 2935705953 2935703347 Bacteria 10242284
3257 2935714662 2935713505 Bacteria 9608509
3258 2935725281 2935722832 Bacteria 9608746
3259 2935732359 2935732158 Bacteria 9706831
3260 2935741738 2935741537 Bacteria 9707219
3261 2935752075 2935750917 Bacteria 9590372
3262 2935766423 2935760218 Bacteria 9817913
3263 2935771866 2935769743 Bacteria 7878163
3264 2935778697 2935777560 Bacteria 8077691
3265 2935788917 2935785616 Bacteria 7962367
3266 2935795283 2935793552 Bacteria 8012592
3267 2935802952 2935801545 Bacteria 9301974
3268 2935814269 2935810662 Bacteria 9401221
3269 2935822205 2935819856 Bacteria 8261050
3270 2935831406 2935827899 Bacteria 10038562
3271 2935838266 2935837841 Bacteria 9454360
3272 2935847787 2935847175 Bacteria 8228321
3273 2935860846 2935855204 Bacteria 9035059
3274 2935869817 2935864058 Bacteria 9784707
3275 2935878764 2935873716 Bacteria 9632195
3276 2935886903 2935883170 Bacteria 7964738
3277 2935898224 2935894831 Bacteria 6620579
3278 2935905781 2935901341 Bacteria 7341747
3279 2935908940 2935908558 Bacteria 8568796
3280 2935919658 2935916978 Bacteria 9113783
3281 2935926486 2935926038 Bacteria 8601059
3282 2935934936 2935934488 Bacteria 8602579
3283 2935943386 2935942939 Bacteria 8599779
3284 2935951824 2935951376 Bacteria 8602333
3285 2935960585 2935959822 Bacteria 7869783
3286 2935967949 2935967501 Bacteria 8603075
3287 2935978574 2935975950 Bacteria 8347125
3288 2935987572 2935984226 Bacteria 8302647
3289 2935994840 2935992306 Bacteria 9802711
3290 2936003482 2936002035 Bacteria 9362176
3291 2936016116 2936011229 Bacteria 8801034
3292 2936024749 2936019824 Bacteria 8804134
3293 2936031845 2936028420 Bacteria 8965941
3294 2936039825 2936037263 Bacteria 9446081
3295 2936049706 2936046547 Bacteria 8903709
3296 2936060810 2936055302 Bacteria 8785755
3297 2936370217 2936367885 Bacteria 7324495
3298 2936377889 2936375103 Bacteria 6652732
3299 2936384120 2936381700 Bacteria 7006523
3300 2940557122 2940556831 Bacteria 9590747
3301 2941511307 2941507105 Bacteria 8166816
3302 2941519008 2941515067 Bacteria 8166720
3303 2941526412 2941523033 Bacteria 8169134
3304 2941532996 2941531003 Bacteria 7653939
3305 2941539066 2941538514 Bacteria 9402094
3306 2979090598 2979089926 Bacteria 5670289
3307 2979096124 2979095461 Bacteria 5669583
3308 2979101652 2979100975 Bacteria 5423623
3309 2984510397 2984509177 Bacteria 5274802
3310 2984518899 2984518228 Bacteria 5277463
3311 2984605452 2984601300 Bacteria 5455244
3312 2996896935 2996893221 Bacteria 5823108
3313 3005411711 3005409236 Bacteria 7188837
3314 3005480366 3005474847 Bacteria 9259049
3315 3005484490 3005483717 Bacteria 7877331
3316 3005510505 3005506211 Bacteria 6943378
3317 3005587869 3005587118 Bacteria 7794411
3318 3005599410 3005594810 Bacteria 8716512
3319 3005715068 3005710791 Bacteria 7622528
3320 3005722485 3005718088 Bacteria 8283608
3321 639651751 639633055 Bacteria 7751309
3322 650843761 650716007 Bacteria 5573770
3323 8003573978 8003570095 Bacteria 5747666
3324 8005277181 8005275841 Bacteria 6929066
3325 8005287809 8005282627 Bacteria 6675747
3326 8005289248 8005289223 Bacteria 6634003
3327 8005304991 8005301065 Bacteria 6614431
3328 8005313091 8005307578 Bacteria 7395396
3329 8005381898 8005376324 Bacteria 6590079
3330 8005388449 8005382845 Bacteria 6732062
3331 8005397615 8005395548 Bacteria 6806915
3332 8005436964 8005430974 Bacteria 6689030
3333 8005466829 8005460587 Bacteria 7157962
3334 8005503105 8005497431 Bacteria 6477605
3335 8005562139 8005556819 Bacteria 6908598
3336 8005567102 8005563573 Bacteria 7153261
3337 8005576326 8005570704 Bacteria 6957481
3338 8005625626 8005619151 Bacteria 7030230
3339 8005630646 8005626139 Bacteria 6534237
3340 8005675023 8005668836 Bacteria 6953162
3341 8005689465 8005688590 Bacteria 6610080
3342 8005701907 8005695170 Bacteria 6912330
3343 8006929121 8006926726 Bacteria 6749210
3344 8006940508 8006933436 Bacteria 10410654
3345 8006967133 8006964411 Bacteria 8966052
3346 8006980196 8006973647 Bacteria 10679141
3347 8006986586 8006984368 Bacteria 9651211
3348 8006995829 8006994254 Bacteria 8309700
3349 8016522133 8016511872 Bacteria 9921665
3350 8016529443 8016522445 Bacteria 8156687
3351 8016534652 8016530956 Bacteria 8155261
3352 8016547872 8016539877 Bacteria 8155419
3353 8016554262 8016548790 Bacteria 8155074
3354 8016562636 8016557553 Bacteria 8154380
3355 8016572998 8016566248 Bacteria 8158151
3356 8016577150 8016575299 Bacteria 8154085
3357 8016591555 8016583857 Bacteria 10421953
3358 8016600420 8016595262 Bacteria 8149947
3359 8016610318 8016603502 Bacteria 8731218
3360 8016626385 8016622563 Bacteria 7999408
3361 8016640144 8016630954 Bacteria 9217207
3362 8017063536 8017057580 Bacteria 10023680
3363 8018165933 8018163183 Bacteria 7277977
3364 8018182258 8018176218 Bacteria 6896178
3365 8019534418 8019530166 Bacteria 8155624
3366 8019545051 8019538911 Bacteria 7872763
3367 8019553476 8019547302 Bacteria 7996444
3368 8019556580 8019555841 Bacteria 9642137
3369 8019582855 8019576017 Bacteria 10049540
3370 8019590649 8019586578 Bacteria 10212056
3371 8019600704 8019597564 Bacteria 10041141
3372 8019617846 8019608314 Bacteria 10042931
3373 8019628359 8019619141 Bacteria 9218857
3374 8019634269 8019629233 Bacteria 8687553
3375 8019645464 8019638758 Bacteria 9062356
3376 8019671661 8019668869 Bacteria 8791617
3377 8019684438 8019678201 Bacteria 8863603
3378 8019690248 8019687851 Bacteria 8712826
3379 8023682395 8023680758 Bacteria 7729763
3380 8024483719 8024479707 Bacteria 6954785
3381 8024505608 8024501048 Bacteria 6427847
3382 8055746159 8055742211 Bacteria 9226248
3383 8056375161 8056375014 Bacteria 7006639
3384 8056383545 8056382006 Bacteria 6408074
3385 8056673667 8056673599 Bacteria 7871253
3386 8056686797 8056681323 Bacteria 8472857
3387 8056691351 8056689827 Bacteria 6712655
3388 8056968201 8056967851 Bacteria 9038162
3389 8057878364 8057874678 Bacteria 7494653
3390 Ga0070714_100033046
3391 2214800749
3392 ARcpr5oldR_c000100
3393 ARSoilYngRDRAFT_c00075
3394 ARSoilOldRDRAFT_c000149
3395 ARCol0yngRDRAFT_1000031
3396 JGI24739J22299_10000841
3397 JGI24739J22299_10002406
3398 JGI24737J22298_10000354
3399 JGI24737J22298_10002958
3400 JGI24737J22298_10019467
3401 JGI24750J21931_1000181
3402 JGI24748J21848_1003912
3403 JGI24744J21845_10006346
3404 JGI24742J22300_10000268
3405 JGI25151J46595_10000632
3406 JGI25151J46595_10004763
3407 JGI25406J46586_10000047
3408 JGI25406J46586_10005366
3409 JGI25406J46586_10009471
3410 JGI25406J46586_10017560
3411 JGI25165J46597_1003997
3412 JGI25165J46597_1017345
3413 JGI25153J46596_10000767
3414 JGI25153J46596_10011019
3415 JGI25153J46596_10020476
3416 rootH2_10047947
3417 rootL2_10033369
3418 JGI25160J50197_1000983
3419 JGI25160J50197_1017322
3420 JGI25160J50197_1050312
3421 JGI25407J50210_10020206
3422 JGI25161J50226_1012815
3423 Ga0006562J51391_1007623
3424 JGI25404J52841_10003960
3425 JGI25404J52841_10035142
3426 Ga0055526_1031765
3427 Ga0055526_1047142
3428 Ga0055524_1025219
3429 Ga0058692_1005513
3430 JGI25405J52794_10000287
3431 Ga0055543_1006579
3432 Ga0055543_1007303
3433 Ga0065165_1000348
3434 Ga0065165_1011649
3435 Ga0065165_1029983
3436 Ga0065717_1002491
3437 Ga0065716_1002308
3438 Ga0065704_10079458
3439 Ga0065712_10000390
3440 Ga0065712_10070724
3441 Ga0065712_10076036
3442 Ga0065712_10088603
3443 Ga0065715_10089022
3444 Ga0065715_10089268
3445 Ga0065715_10101385
3446 Ga0070658_10015383
3447 Ga0070658_10122301
3448 Ga0070658_10180480
3449 Ga0070658_10205749
3450 Ga0070658_10216291
3451 Ga0070658_10261583
3452 Ga0070676_10060308
3453 Ga0070676_10062786
3454 Ga0070676_10093190
3455 Ga0070676_10227607
3456 Ga0070683_100001166
3457 Ga0070683_100005419
3458 Ga0070683_100073442
3459 Ga0070683_100089470
3460 Ga0070690_100000577
3461 Ga0070690_100004183
3462 Ga0070690_100025741
3463 Ga0070690_100209535
3464 Ga0070690_100351638
3465 Ga0070690_100493760
3466 Ga0070670_100023361
3467 Ga0070670_100023984
3468 Ga0070670_100027483
3469 Ga0070670_100091837
3470 Ga0070677_10000126
3471 Ga0068869_100017818
3472 Ga0068869_100096406
3473 Ga0070666_10012294
3474 Ga0070666_10323131
3475 Ga0070666_10453982
3476 Ga0070680_100001711
3477 Ga0070680_100005116
3478 Ga0070680_100006307
3479 Ga0070680_100041160
3480 Ga0070680_100255919
3481 Ga0070680_100262175
3482 Ga0070680_100358338
3483 Ga0070680_100378511
3484 Ga0070680_100481602
3485 Ga0070682_100015622
3486 Ga0070682_100037612
3487 Ga0070682_100044167
3488 Ga0070682_100057924
3489 Ga0070682_100086854
3490 Ga0070682_100148252
3491 Ga0068868_100021618
3492 Ga0068868_100083316
3493 Ga0068868_100250395
3494 Ga0070660_100002257
3495 Ga0070660_100004146
3496 Ga0070660_100057471
3497 Ga0070660_100079812
3498 Ga0070660_100142205
3499 Ga0070689_100000578
3500 Ga0070689_100003384
3501 Ga0070689_100010800
3502 Ga0070689_100242805
3503 Ga0070691_10000994
3504 Ga0070691_10015972
3505 Ga0070687_100010103
3506 Ga0070687_100417930
3507 Ga0070661_100000804
3508 Ga0070661_100034764
3509 Ga0070661_100051071
3510 Ga0070661_100057600
3511 Ga0070661_100065791
3512 Ga0070661_100224900
3513 Ga0070692_10000837
3514 Ga0070692_10003900
3515 Ga0070692_10148925
3516 Ga0070668_100001248
3517 Ga0070668_100007317
3518 Ga0070668_100283558
3519 Ga0070669_100129595
3520 Ga0070669_100163550
3521 Ga0070669_100238919
3522 Ga0070669_100421591
3523 Ga0070675_100028323
3524 Ga0070675_100060172
3525 Ga0070675_100161424
3526 Ga0070675_100179745
3527 Ga0070675_100206691
3528 Ga0070675_100222261
3529 Ga0070675_100497197
3530 Ga0070671_100004422
3531 Ga0070671_100008994
3532 Ga0070671_100034544
3533 Ga0070671_100074315
3534 Ga0070671_100160294
3535 Ga0070674_100039368
3536 Ga0070674_100064762
3537 Ga0070674_100081680
3538 Ga0070674_100126935
3539 Ga0070674_100167496
3540 Ga0070673_100000152
3541 Ga0070673_100014377
3542 Ga0070673_100270638
3543 Ga0070688_100000558
3544 Ga0070688_100007486
3545 Ga0070688_100010117
3546 Ga0070688_100048956
3547 Ga0070688_100059436
3548 Ga0070688_100086759
3549 Ga0070688_100667858
3550 Ga0070659_100003307
3551 Ga0070659_100009498
3552 Ga0070659_100055803
3553 Ga0070659_100079952
3554 Ga0070659_100080795
3555 Ga0070659_100187662
3556 Ga0070659_100297639
3557 Ga0070667_100005640
3558 Ga0070667_100018732
3559 Ga0070667_100047274
3560 Ga0070667_100074024
3561 Ga0070667_100183725
3562 Ga0070667_100262914
3563 Ga0070703_10003642
3564 Ga0070709_10000782
3565 Ga0070709_10005372
3566 Ga0070709_10010922
3567 Ga0070709_10016344
3568 Ga0070709_10027248
3569 Ga0070709_10135202
3570 Ga0070709_10137539
3571 Ga0070709_10144826
3572 Ga0070709_10231696
3573 Ga0070709_10266370
3574 Ga0070714_100018005
3575 Ga0070714_100050850
3576 Ga0070714_100119265
3577 Ga0070714_100121603
3578 Ga0070714_100211017
3579 Ga0070714_100281333
3580 Ga0070714_100316487
3581 Ga0070714_100320387
3582 Ga0070714_100394202
3583 Ga0070714_100440951
3584 Ga0070714_100594327
3585 Ga0070713_100002911
3586 Ga0070713_100008027
3587 Ga0070713_100015728
3588 Ga0070713_100027065
3589 Ga0070713_100033179
3590 Ga0070713_100095040
3591 Ga0070713_100119577
3592 Ga0070713_100179251
3593 Ga0070713_100243742
3594 Ga0070713_100320745
3595 Ga0070710_10000207
3596 Ga0070710_10013899
3597 Ga0070710_10023389
3598 Ga0070710_10055347
3599 Ga0070710_10090957
3600 Ga0070710_10147473
3601 Ga0070710_10286330
3602 Ga0070701_10006958
3603 Ga0070701_10059353
3604 Ga0070701_10247617
3605 Ga0070711_100010118
3606 Ga0070711_100039542
3607 Ga0070711_100066166
3608 Ga0070711_100095419
3609 Ga0070711_100206065
3610 Ga0070711_100228999
3611 Ga0070711_100562228
3612 Ga0070705_100091513
3613 Ga0070705_100122453
3614 Ga0070705_100138887
3615 Ga0070705_100186094
3616 Ga0070700_100134066
3617 Ga0070700_100349627
3618 Ga0070694_100015746
3619 Ga0070694_100021938
3620 Ga0070694_100063956
3621 Ga0070694_100100065
3622 Ga0070708_100000402
3623 Ga0070708_100030242
3624 Ga0070708_100043098
3625 Ga0070708_100329551
3626 Ga0070663_100005434
3627 Ga0070663_100038315
3628 Ga0070663_100048294
3629 Ga0070663_100083288
3630 Ga0070663_100124245
3631 Ga0070663_100158417
3632 Ga0070663_100179180
3633 Ga0070663_100204069
3634 Ga0070663_100308231
3635 Ga0070663_100332821
3636 Ga0070678_100004112
3637 Ga0070678_100007751
3638 Ga0070678_100086598
3639 Ga0070678_100102705
3640 Ga0070678_100139865
3641 Ga0070678_100143223
3642 Ga0070678_100260780
3643 Ga0070678_100274721
3644 Ga0070662_100085733
3645 Ga0070662_100086134
3646 Ga0070662_100120408
3647 Ga0070662_100446903
3648 Ga0070662_100561194
3649 Ga0070681_10014894
3650 Ga0070681_10025614
3651 Ga0070681_10030082
3652 Ga0070681_10035776
3653 Ga0070681_10037334
3654 Ga0070681_10042460
3655 Ga0070681_10044070
3656 Ga0070681_10055680
3657 Ga0070681_10099342
3658 Ga0070681_10190201
3659 Ga0070681_10225691
3660 Ga0070681_10263401
3661 Ga0070681_10270276
3662 Ga0068867_100017670
3663 Ga0068867_100030103
3664 Ga0068867_100102330
3665 Ga0070685_10013859
3666 Ga0070685_10015988
3667 Ga0070685_10104305
3668 Ga0070685_10143121
3669 Ga0070685_10156070
3670 Ga0070685_10265134
3671 Ga0070685_10318249
3672 Ga0070706_100008099
3673 Ga0070706_100074414
3674 Ga0070706_100157241
3675 Ga0070706_100167976
3676 Ga0070706_100336666
3677 Ga0070707_100001543
3678 Ga0070707_100005986
3679 Ga0070698_100004215
3680 Ga0070698_100008716
3681 Ga0070698_100166257
3682 Ga0070698_100266593
3683 Ga0070698_100513301
3684 Ga0070699_100000945
3685 Ga0070699_100025311
3686 Ga0070699_100174405
3687 Ga0070679_100005711
3688 Ga0070679_100020690
3689 Ga0070679_100021650
3690 Ga0070679_100029325
3691 Ga0070679_100044073
3692 Ga0070679_100073578
3693 Ga0070679_100100484
3694 Ga0070679_100103859
3695 Ga0070679_100153818
3696 Ga0070679_100212778
3697 Ga0070679_100308150
3698 Ga0070679_100378956
3699 Ga0070679_100546857
3700 Ga0070679_100760959
3701 Ga0070684_100009657
3702 Ga0070684_100035950
3703 Ga0070684_100040713
3704 Ga0070684_100137077
3705 Ga0070684_100309103
3706 Ga0070684_100537840
3707 Ga0070697_100000582
3708 Ga0070697_100340285
3709 Ga0068853_100005841
3710 Ga0068853_100016544
3711 Ga0068853_100038445
3712 Ga0068853_100159443
3713 Ga0068853_100164770
3714 Ga0068853_100296674
3715 Ga0068853_100309640
3716 Ga0068853_100338018
3717 Ga0070672_100016204
3718 Ga0070672_100070477
3719 Ga0070672_100120831
3720 Ga0070672_100317905
3721 Ga0070686_100001565
3722 Ga0070686_100001691
3723 Ga0070686_100013506
3724 Ga0070686_100272813
3725 Ga0070695_100009605
3726 Ga0070695_100021403
3727 Ga0070695_100053539
3728 Ga0070695_100075998
3729 Ga0070695_100157036
3730 Ga0070695_100212054
3731 Ga0070696_100030304
3732 Ga0070696_100039589
3733 Ga0070696_100054727
3734 Ga0070696_100350032
3735 Ga0070696_100383842
3736 Ga0070693_100007514
3737 Ga0070693_100053519
3738 Ga0070665_100023837
3739 Ga0070665_100026731
3740 Ga0070665_100138461
3741 Ga0070665_100219757
3742 Ga0070665_100257120
3743 Ga0070665_100409363
3744 Ga0070704_100000428
3745 Ga0070704_100003017
3746 Ga0070704_100006216
3747 Ga0070704_100040512
3748 Ga0068855_100007720
3749 Ga0068855_100020644
3750 Ga0068855_100025903
3751 Ga0068855_100027404
3752 Ga0068855_100051955
3753 Ga0068855_100066294
3754 Ga0068855_100069332
3755 Ga0068855_100189794
3756 Ga0068855_100283572
3757 Ga0068855_100305283
3758 Ga0068855_100388409
3759 Ga0068855_100595429
3760 Ga0068855_100617164
3761 Ga0068855_100830046
3762 Ga0068855_101204016
3763 Ga0070664_100130014
3764 Ga0068857_100003968
3765 Ga0068857_100004864
3766 Ga0068857_100031478
3767 Ga0068857_100045958
3768 Ga0068857_100048809
3769 Ga0068857_100102510
3770 Ga0068857_100254177
3771 Ga0068857_100330990
3772 Ga0068857_100375815
3773 Ga0068854_100020081
3774 Ga0068854_100097086
3775 Ga0068854_100147894
3776 Ga0068854_100437325
3777 Ga0068854_100486477
3778 Ga0068856_100001367
3779 Ga0068856_100006599
3780 Ga0068856_100020287
3781 Ga0068856_100061243
3782 Ga0068856_100062138
3783 Ga0068856_100098271
3784 Ga0068856_100149912
3785 Ga0068856_100208326
3786 Ga0068856_100751895
3787 Ga0070702_100002620
3788 Ga0070702_100007155
3789 Ga0070702_100278065
3790 Ga0070702_100287218
3791 Ga0068852_100009344
3792 Ga0068852_100015291
3793 Ga0068852_100032482
3794 Ga0068852_100089333
3795 Ga0068852_100295216
3796 Ga0068852_100321595
3797 Ga0068852_100562400
3798 Ga0068859_100006242
3799 Ga0068859_100160203
3800 Ga0068859_100239615
3801 Ga0068859_100278339
3802 Ga0068864_100019207
3803 Ga0068864_100218327
3804 Ga0068864_100294705
3805 Ga0068866_10000301
3806 Ga0068861_100038262
3807 Ga0068861_100152700
3808 Ga0068861_100446622
3809 Ga0068851_10003991
3810 Ga0068870_10121826
3811 Ga0068870_10178263
3812 Ga0068870_10251628
3813 Ga0068863_100000340
3814 Ga0068863_100055280
3815 Ga0068863_100177223
3816 Ga0068863_100245582
3817 Ga0068863_100601333
3818 Ga0068858_100009915
3819 Ga0068858_100050734
3820 Ga0068858_100122486
3821 Ga0068858_100282461
3822 Ga0068858_100311040
3823 Ga0068858_100323371
3824 Ga0068860_100007133
3825 Ga0068860_100009824
3826 Ga0068860_100079139
3827 Ga0068860_100103522
3828 Ga0068860_100112463
3829 Ga0068860_100295567
3830 Ga0068860_100504565
3831 Ga0068860_100847774
3832 Ga0068862_100008991
3833 Ga0068862_100180084
3834 Ga0081455_10000007
3835 Ga0081455_10000982
3836 Ga0081455_10001236
3837 Ga0081455_10001479
3838 Ga0081455_10005102
3839 Ga0081455_10007694
3840 Ga0081455_10029199
3841 Ga0081455_10091911
3842 Ga0081455_10120112
3843 Ga0081455_10193333
3844 Ga0081455_10223522
3845 Ga0081455_10258846
3846 Ga0081538_10004143
3847 Ga0081538_10021648
3848 Ga0081538_10058124
3849 Ga0081538_10121026
3850 Ga0081540_1000430
3851 Ga0081540_1000979
3852 Ga0081540_1002120
3853 Ga0081540_1004971
3854 Ga0081540_1020017
3855 Ga0081540_1035864
3856 Ga0081540_1036383
3857 Ga0081540_1040361
3858 Ga0081540_1082360
3859 Ga0081539_10000009
3860 Ga0081539_10000140
3861 Ga0081539_10000423
3862 Ga0081539_10000496
3863 Ga0081539_10001457
3864 Ga0081539_10016652
3865 Ga0081539_10131852
3866 Ga0070717_10001010
3867 Ga0070717_10004040
3868 Ga0070717_10008664
3869 Ga0070717_10024021
3870 Ga0070717_10047440
3871 Ga0070717_10050455
3872 Ga0070717_10054610
3873 Ga0070717_10202606
3874 Ga0070717_10245678
3875 Ga0070717_10537816
3876 Ga0070717_10594255
3877 Ga0075365_10008429
3878 Ga0075365_10014902
3879 Ga0075365_10014941
3880 Ga0075365_10033601
3881 Ga0075365_10058374
3882 Ga0075365_10066431
3883 Ga0075365_10067098
3884 Ga0075365_10169761
3885 Ga0075365_10219174
3886 Ga0075365_10316764
3887 Ga0075365_10348760
3888 Ga0075368_10001344
3889 Ga0075368_10015526
3890 Ga0075368_10081226
3891 Ga0075368_10100391
3892 Ga0075368_10110550
3893 Ga0075363_100032084
3894 Ga0075363_100034423
3895 Ga0075363_100096491
3896 Ga0075363_100134114
3897 Ga0075363_100184498
3898 Ga0075364_10010235
3899 Ga0075364_10111207
3900 Ga0075364_10131363
3901 Ga0075364_10147114
3902 Ga0075364_10251608
3903 Ga0075432_10003516
3904 Ga0070715_10000384
3905 Ga0070715_10007897
3906 Ga0070715_10038700
3907 Ga0070715_10105027
3908 Ga0070715_10138648
3909 Ga0070716_100002683
3910 Ga0070716_100031449
3911 Ga0070716_100136624
3912 Ga0070716_100223375
3913 Ga0070716_100256142
3914 Ga0070712_100029585
3915 Ga0070712_100039975
3916 Ga0070712_100073082
3917 Ga0070712_100140252
3918 Ga0070712_100144436
3919 Ga0070712_100154674
3920 Ga0070712_100161624
3921 Ga0070712_100166907
3922 Ga0070712_100187099
3923 Ga0070712_100269324
3924 Ga0075362_10003234
3925 Ga0075362_10004260
3926 Ga0075362_10031905
3927 Ga0075362_10073459
3928 Ga0075362_10276865
3929 Ga0075367_10001631
3930 Ga0075367_10005140
3931 Ga0075367_10025671
3932 Ga0075367_10030507
3933 Ga0075367_10100305
3934 Ga0075367_10334591
3935 Ga0075369_10000309
3936 Ga0075369_10004732
3937 Ga0075369_10043763
3938 Ga0075369_10090032
3939 Ga0075369_10169305
3940 Ga0075427_10000215
3941 Ga0075366_10002759
3942 Ga0075366_10023686
3943 Ga0075366_10029384
3944 Ga0075366_10038610
3945 Ga0075366_10195852
3946 Ga0075366_10351209
3947 Ga0097621_100000880
3948 Ga0097621_100010144
3949 Ga0097621_100019547
3950 Ga0097621_100718780
3951 Ga0075370_10003972
3952 Ga0075370_10006733
3953 Ga0075370_10010136
3954 Ga0075370_10031999
3955 Ga0075370_10061765
3956 Ga0075370_10194498
3957 Ga0068871_100000301
3958 Ga0068871_100058078
3959 Ga0068871_100071098
3960 Ga0068871_100296754
3961 Ga0068871_100465748
3962 Ga0075428_100003180
3963 Ga0075428_100010432
3964 Ga0075428_100014642
3965 Ga0075428_100015421
3966 Ga0075428_100028697
3967 Ga0075428_100056741
3968 Ga0075428_100108279
3969 Ga0075428_100149018
3970 Ga0075428_100363717
3971 Ga0075430_100000201
3972 Ga0075430_100010309
3973 Ga0075430_100034856
3974 Ga0075430_100083716
3975 Ga0075430_100135967
3976 Ga0075430_100369797
3977 Ga0075431_100000260
3978 Ga0075431_100000689
3979 Ga0075431_100002486
3980 Ga0075431_100006419
3981 Ga0075431_100012575
3982 Ga0075431_100029122
3983 Ga0075431_100053455
3984 Ga0075431_100348250
3985 Ga0075433_10000007
3986 Ga0075433_10005682
3987 Ga0075433_10006405
3988 Ga0075433_10090718
3989 Ga0075433_10124855
3990 Ga0075433_10144262
3991 Ga0075433_10300544
3992 Ga0075434_100000091
3993 Ga0075434_100007954
3994 Ga0075434_100008472
3995 Ga0075434_100078187
3996 Ga0075434_100097944
3997 Ga0075434_100100400
3998 Ga0075434_100147653
3999 Ga0075434_100184464
4000 Ga0075434_100210667
4001 Ga0075434_100232819
4002 Ga0075434_100378720
4003 Ga0075434_100437183
4004 Ga0075434_100614417
4005 Ga0075429_100001824
4006 Ga0075429_100025360
4007 Ga0075429_100033460
4008 Ga0075429_100074414
4009 Ga0075429_100546581
4010 Ga0068865_100003545
4011 Ga0068865_100091169
4012 Ga0068865_100244320
4013 Ga0075436_100000911
4014 Ga0075436_100004744
4015 Ga0075436_100013383
4016 Ga0075436_100015016
4017 Ga0097620_100006242
4018 Ga0097620_100160199
4019 Ga0097620_100239613
4020 Ga0097620_100278309
4021 Ga0099825_1037418
4022 Ga0099825_1047582
4023 Ga0099824_1006204
4024 Ga0099824_1027442
4025 Ga0099822_1022012
4026 Ga0099823_1052075
4027 Ga0099826_10001282
4028 Ga0099826_10013390
4029 Ga0075435_100010439
4030 Ga0075435_100013156
4031 Ga0075435_100177767
4032 Ga0075435_100262117
4033 Ga0099794_10004713
4034 Ga0099794_10016781
4035 Ga0099794_10031309
4036 Ga0099795_10008607
4037 Ga0099795_10013140
4038 Ga0099795_10021859
4039 Ga0099795_10034530
4040 Ga0099795_10050216
4041 Ga0099795_10052355
4042 Ga0099795_10073784
4043 Ga0099795_10097297
4044 Ga0099795_10124368
4045 Ga0105251_10142346
4046 Ga0105244_10031022
4047 Ga0105250_10010344
4048 Ga0105250_10072694
4049 Ga0105240_10002078
4050 Ga0105240_10008497
4051 Ga0105240_10010726
4052 Ga0105240_10018492
4053 Ga0105240_10049019
4054 Ga0105240_10072340
4055 Ga0105240_10073858
4056 Ga0105240_10359146
4057 Ga0111539_10001672
4058 Ga0111539_10005053
4059 Ga0111539_10013178
4060 Ga0111539_10013469
4061 Ga0111539_10080073
4062 Ga0111539_10096925
4063 Ga0111539_10117210
4064 Ga0111539_10135906
4065 Ga0111539_10150026
4066 Ga0111539_10207765
4067 Ga0111539_10465857
4068 Ga0111539_10513109
4069 Ga0111539_10792160
4070 Ga0105245_10010701
4071 Ga0105245_10060879
4072 Ga0105245_10209089
4073 Ga0105245_10340683
4074 Ga0105245_10438750
4075 Ga0105245_10663566
4076 Ga0105245_10963198
4077 Ga0105247_10002113
4078 Ga0105247_10017859
4079 Ga0105247_10048912
4080 Ga0105247_10071195
4081 Ga0105247_10126326
4082 Ga0114129_10002772
4083 Ga0114129_10002794
4084 Ga0114129_10007261
4085 Ga0114129_10007546
4086 Ga0114129_10008566
4087 Ga0114129_10013314
4088 Ga0114129_10040031
4089 Ga0114129_10063809
4090 Ga0114129_10177583
4091 Ga0114129_10410765
4092 Ga0114129_10560926
4093 Ga0105243_10004021
4094 Ga0105243_10004388
4095 Ga0105243_10484939
4096 Ga0105243_10599478
4097 Ga0105241_10001943
4098 Ga0105241_10071648
4099 Ga0105241_10090226
4100 Ga0105241_10119444
4101 Ga0105241_10139492
4102 Ga0105241_10193359
4103 Ga0105241_10221398
4104 Ga0105242_10007706
4105 Ga0105242_10066498
4106 Ga0105242_10075610
4107 Ga0105248_10003102
4108 Ga0105248_10016902
4109 Ga0105248_10028593
4110 Ga0105248_10091386
4111 Ga0105248_10132194
4112 Ga0105248_10485094
4113 Ga0105248_11237321
4114 Ga0105237_10008804
4115 Ga0105237_10017102
4116 Ga0105237_10023507
4117 Ga0105237_10026985
4118 Ga0105237_10037680
4119 Ga0105237_10042457
4120 Ga0105237_10047336
4121 Ga0105237_10063264
4122 Ga0105237_10070520
4123 Ga0105237_10128445
4124 Ga0105237_10156862
4125 Ga0105237_10241685
4126 Ga0105237_10509819
4127 Ga0105237_10632019
4128 Ga0105237_10781819
4129 Ga0105238_10029110
4130 Ga0105238_10031635
4131 Ga0105238_10040037
4132 Ga0105238_10048490
4133 Ga0105238_10075579
4134 Ga0105238_10141315
4135 Ga0105238_10188485
4136 Ga0105238_10420653
4137 Ga0105249_10001599
4138 Ga0105249_10107423
4139 Ga0105249_10192532
4140 Ga0105249_10215942
4141 Ga0105249_10352903
4142 Ga0105249_10370927
4143 Ga0105249_10633846
4144 Ga0123341_1000115
4145 Ga0123342_1042230
4146 Ga0099796_10005583
4147 Ga0099796_10054629
4148 Ga0099796_10104958
4149 Ga0099796_10111679
4150 Ga0105239_10005426
4151 Ga0105239_10009271
4152 Ga0105239_10009752
4153 Ga0105239_10010937
4154 Ga0105239_10027788
4155 Ga0105239_10049782
4156 Ga0105239_10071911
4157 Ga0105239_10117803
4158 Ga0105239_10202041
4159 Ga0105239_10438958
4160 Ga0105239_10461300
4161 Ga0105239_10531558
4162 Ga0105239_11112449
4163 Ga0105246_10003677
4164 Ga0105246_10103040
4165 Ga0105246_10213527
4166 Ga0105246_10493502
4167 Ga0105246_10678471
4168 Ga0157344_1001670
4169 Ga0157336_1003074
4170 Ga0157335_1001681
4171 Ga0157347_1003344
4172 Ga0157327_1001684
4173 Ga0157373_10000761
4174 Ga0157373_10012576
4175 Ga0157373_10203328
4176 Ga0157373_10215732
4177 Ga0157373_10525250
4178 Ga0157371_10067213
4179 Ga0157371_10169010
4180 Ga0157370_10002006
4181 Ga0157370_10009940
4182 Ga0157370_10018929
4183 Ga0157370_10028738
4184 Ga0157370_10295611
4185 Ga0157370_10330629
4186 Ga0157369_10003343
4187 Ga0157369_10016056
4188 Ga0157369_10050781
4189 Ga0157369_10191299
4190 Ga0157369_10248706
4191 Ga0157369_10256929
4192 Ga0157374_10001695
4193 Ga0157374_10102495
4194 Ga0157374_10123076
4195 Ga0157374_10308095
4196 Ga0157378_10003374
4197 Ga0157378_10010352
4198 Ga0157378_10054648
4199 Ga0157378_10444909
4200 Ga0157378_11205270
4201 Ga0163162_10010828
4202 Ga0163162_10021289
4203 Ga0163162_10036548
4204 Ga0163162_10083180
4205 Ga0163162_10103908
4206 Ga0163162_10497537
4207 Ga0163162_10994381
4208 Ga0163162_11444112
4209 Ga0157372_10004321
4210 Ga0157372_10144832
4211 Ga0157372_10373898
4212 Ga0157372_10401645
4213 Ga0157372_10450612
4214 Ga0157375_10043638
4215 Ga0157375_10102841
4216 Ga0157375_10117294
4217 Ga0157375_10144011
4218 Ga0157375_10437473
4219 Ga0157375_11437515
4220 Ga0163163_10013922
4221 Ga0163163_10130170
4222 Ga0163163_10134865
4223 Ga0163163_10137066
4224 Ga0163163_10259466
4225 Ga0163163_10530928
4226 Ga0157380_10000891
4227 Ga0157380_10083169
4228 Ga0157380_10131678
4229 Ga0182008_10003568
4230 Ga0157377_10000517
4231 Ga0157377_10007948
4232 Ga0157377_10100674
4233 Ga0157377_10189732
4234 Ga0157379_10006391
4235 Ga0157379_10041791
4236 Ga0157379_10110359
4237 Ga0157376_10082196
4238 Ga0157376_10100398
4239 Ga0157376_10570416
4240 Ga0182006_1061042
4241 Ga0182007_10004862
4242 Ga0182007_10037820
4243 Ga0163161_10009345
4244 Ga0163161_10015874
4245 Ga0163161_10052525
4246 Ga0163161_10177779
4247 Ga0163161_10212177
4248 Ga0214544_1000002
4249 Ga0214542_1000001
4250 Ga0214545_1000001
4251 Ga0214543_1000001
4252 Ga0213876_10078532
4253 Ga0213876_10097493
4254 Ga0213876_10136121
4255 Ga0213876_10172015
4256 Ga0213875_10000091
4257 Ga0213875_10033782
4258 Ga0213875_10152345
4259 Ga0209563_100864
4260 Ga0207425_1003944
4261 Ga0207425_1006454
4262 Ga0209677_100423
4263 Ga0209677_104828
4264 Ga0209148_1000841
4265 Ga0209233_1004815
4266 Ga0209233_1006073
4267 Ga0209233_1014046
4268 Ga0207666_1000059
4269 Ga0209455_1004004
4270 Ga0209455_1014846
4271 Ga0209673_1001741
4272 Ga0209673_1064092
4273 Ga0207673_1000333
4274 Ga0209025_1000072
4275 Ga0209025_1000277
4276 Ga0209025_1060560
4277 Ga0209564_1002118
4278 Ga0209564_1003264
4279 Ga0209758_1000053
4280 Ga0209758_1000140
4281 Ga0209758_1000164
4282 Ga0209758_1000628
4283 Ga0209758_1001346
4284 Ga0209758_1002251
4285 Ga0209758_1002853
4286 Ga0209758_1003241
4287 Ga0209758_1019965
4288 Ga0209256_1006146
4289 Ga0209256_1048974
4290 Ga0207426_1000035
4291 Ga0207426_1000822
4292 Ga0207426_1002280
4293 Ga0207426_1002722
4294 Ga0207426_1011102
4295 Ga0209051_1000062
4296 Ga0209051_1007606
4297 Ga0209257_1002192
4298 Ga0209257_1002227
4299 Ga0207697_10016374
4300 Ga0207697_10030409
4301 Ga0207697_10045084
4302 Ga0207656_10094325
4303 Ga0207653_10002470
4304 Ga0207692_10000214
4305 Ga0207692_10000549
4306 Ga0207692_10001653
4307 Ga0207692_10041664
4308 Ga0207692_10300358
4309 Ga0207692_10341178
4310 Ga0207642_10002010
4311 Ga0207710_10003499
4312 Ga0207710_10040784
4313 Ga0207710_10251011
4314 Ga0207688_10000167
4315 Ga0207688_10012456
4316 Ga0207688_10037781
4317 Ga0207688_10062780
4318 Ga0207688_10100357
4319 Ga0207688_10165814
4320 Ga0207680_10042699
4321 Ga0207680_10539338
4322 Ga0207647_10000712
4323 Ga0207647_10021442
4324 Ga0207647_10025278
4325 Ga0207647_10063221
4326 Ga0207647_10135897
4327 Ga0207685_10056378
4328 Ga0207685_10085059
4329 Ga0207699_10000379
4330 Ga0207699_10001444
4331 Ga0207699_10018629
4332 Ga0207699_10027860
4333 Ga0207699_10037725
4334 Ga0207699_10118069
4335 Ga0207699_10191024
4336 Ga0207699_10227305
4337 Ga0207645_10041500
4338 Ga0207645_10093821
4339 Ga0207645_10398653
4340 Ga0207643_10000007
4341 Ga0207643_10055849
4342 Ga0207705_10010007
4343 Ga0207705_10035725
4344 Ga0207705_10044960
4345 Ga0207705_10161176
4346 Ga0207705_10285018
4347 Ga0207705_10329457
4348 Ga0207705_10353393
4349 Ga0207684_10000370
4350 Ga0207684_10002538
4351 Ga0207684_10094372
4352 Ga0207684_10240125
4353 Ga0207654_10002421
4354 Ga0207654_10012820
4355 Ga0207654_10049594
4356 Ga0207654_10112452
4357 Ga0207654_10179424
4358 Ga0207654_10189913
4359 Ga0207654_10191643
4360 Ga0207654_10199582
4361 Ga0207707_10002327
4362 Ga0207707_10008501
4363 Ga0207707_10013561
4364 Ga0207707_10019379
4365 Ga0207707_10023051
4366 Ga0207707_10033610
4367 Ga0207707_10041272
4368 Ga0207707_10077717
4369 Ga0207707_10127177
4370 Ga0207707_10127768
4371 Ga0207707_10206500
4372 Ga0207695_10000910
4373 Ga0207695_10001998
4374 Ga0207695_10069051
4375 Ga0207695_10094888
4376 Ga0207695_10157943
4377 Ga0207695_10252228
4378 Ga0207695_10560391
4379 Ga0207671_10006943
4380 Ga0207671_10016287
4381 Ga0207671_10020564
4382 Ga0207671_10025479
4383 Ga0207671_10052004
4384 Ga0207671_10063661
4385 Ga0207671_10066849
4386 Ga0207671_10106600
4387 Ga0207671_10158090
4388 Ga0207671_10279121
4389 Ga0207671_10330476
4390 Ga0207671_10398178
4391 Ga0207693_10002705
4392 Ga0207693_10005995
4393 Ga0207693_10008772
4394 Ga0207693_10009172
4395 Ga0207693_10024965
4396 Ga0207693_10026683
4397 Ga0207693_10047611
4398 Ga0207693_10069177
4399 Ga0207693_10077879
4400 Ga0207693_10086904
4401 Ga0207693_10095753
4402 Ga0207693_10130348
4403 Ga0207693_10141278
4404 Ga0207693_10219164
4405 Ga0207693_10257103
4406 Ga0207663_10039729
4407 Ga0207663_10160610
4408 Ga0207663_10206225
4409 Ga0207663_10494534
4410 Ga0207660_10002332
4411 Ga0207660_10010845
4412 Ga0207660_10082827
4413 Ga0207660_10161945
4414 Ga0207660_10203637
4415 Ga0207660_10230487
4416 Ga0207660_10245363
4417 Ga0207660_10261735
4418 Ga0207660_10502736
4419 Ga0207662_10000195
4420 Ga0207662_10028750
4421 Ga0207657_10002386
4422 Ga0207657_10008747
4423 Ga0207657_10011584
4424 Ga0207657_10016670
4425 Ga0207657_10058476
4426 Ga0207657_10083360
4427 Ga0207657_10155807
4428 Ga0207657_10186323
4429 Ga0207657_10279449
4430 Ga0207649_10000944
4431 Ga0207649_10044696
4432 Ga0207649_10127013
4433 Ga0207649_10207708
4434 Ga0207652_10004942
4435 Ga0207652_10010833
4436 Ga0207652_10024031
4437 Ga0207652_10033023
4438 Ga0207652_10053721
4439 Ga0207652_10077551
4440 Ga0207652_10111765
4441 Ga0207652_10176395
4442 Ga0207652_10179839
4443 Ga0207652_10452151
4444 Ga0207646_10000466
4445 Ga0207646_10007223
4446 Ga0207646_10101595
4447 Ga0207681_10007509
4448 Ga0207681_10105247
4449 Ga0207681_10167967
4450 Ga0207681_10297065
4451 Ga0207694_10000157
4452 Ga0207694_10015529
4453 Ga0207694_10055037
4454 Ga0207694_10055889
4455 Ga0207694_10138329
4456 Ga0207694_10200051
4457 Ga0207694_10373063
4458 Ga0207650_10001317
4459 Ga0207650_10015847
4460 Ga0207650_10609690
4461 Ga0207659_10027512
4462 Ga0207659_10058686
4463 Ga0207659_10380271
4464 Ga0207687_10000072
4465 Ga0207687_10065041
4466 Ga0207687_10152426
4467 Ga0207687_10446443
4468 Ga0207700_10003964
4469 Ga0207700_10033119
4470 Ga0207700_10036417
4471 Ga0207700_10043564
4472 Ga0207700_10092959
4473 Ga0207700_10226812
4474 Ga0207700_10270055
4475 Ga0207700_10394985
4476 Ga0207700_10487580
4477 Ga0207664_10009594
4478 Ga0207664_10025036
4479 Ga0207664_10027649
4480 Ga0207664_10042081
4481 Ga0207664_10047718
4482 Ga0207664_10077102
4483 Ga0207664_10171444
4484 Ga0207664_10284032
4485 Ga0207664_10291382
4486 Ga0207644_10002402
4487 Ga0207644_10040831
4488 Ga0207644_10077073
4489 Ga0207644_10371212
4490 Ga0207690_10023472
4491 Ga0207690_10283892
4492 Ga0207690_10347958
4493 Ga0207690_10348024
4494 Ga0207690_10458217
4495 Ga0207706_10022595
4496 Ga0207706_10079345
4497 Ga0207686_10001034
4498 Ga0207686_10176727
4499 Ga0207686_10177780
4500 Ga0207686_10223801
4501 Ga0207709_10021477
4502 Ga0207670_10000792
4503 Ga0207670_10012298
4504 Ga0207670_10062250
4505 Ga0207670_10257139
4506 Ga0207669_10000176
4507 Ga0207669_10028450
4508 Ga0207704_10053582
4509 Ga0207704_10057976
4510 Ga0207704_10102449
4511 Ga0207704_10700379
4512 Ga0207665_10000872
4513 Ga0207665_10003514
4514 Ga0207665_10026788
4515 Ga0207665_10028369
4516 Ga0207665_10028429
4517 Ga0207665_10093042
4518 Ga0207665_10143833
4519 Ga0207691_10036748
4520 Ga0207691_10179741
4521 Ga0207691_10236997
4522 Ga0207691_10253609
4523 Ga0207711_10001106
4524 Ga0207711_10025866
4525 Ga0207711_10126085
4526 Ga0207711_10131951
4527 Ga0207711_10361668
4528 Ga0207689_10000366
4529 Ga0207689_10209795
4530 Ga0207661_10006099
4531 Ga0207661_10037631
4532 Ga0207661_10045590
4533 Ga0207661_10055205
4534 Ga0207661_10144897
4535 Ga0207661_10171199
4536 Ga0207679_10000029
4537 Ga0207679_10071063
4538 Ga0207679_10107476
4539 Ga0207679_10254089
4540 Ga0207679_10300147
4541 Ga0207667_10011520
4542 Ga0207667_10016633
4543 Ga0207667_10027880
4544 Ga0207667_10029315
4545 Ga0207667_10032031
4546 Ga0207667_10037424
4547 Ga0207667_10099559
4548 Ga0207667_10172584
4549 Ga0207667_10207765
4550 Ga0207667_10336320
4551 Ga0207667_10566526
4552 Ga0207651_10011383
4553 Ga0207651_10095426
4554 Ga0207712_10384215
4555 Ga0207668_10016219
4556 Ga0207668_10026431
4557 Ga0207668_10030484
4558 Ga0207668_10116433
4559 Ga0207640_10001667
4560 Ga0207640_10077475
4561 Ga0207640_10078611
4562 Ga0207640_10334952
4563 Ga0207658_10019541
4564 Ga0207658_10074005
4565 Ga0207658_10088668
4566 Ga0207658_10099238
4567 Ga0207677_10005872
4568 Ga0207677_10033442
4569 Ga0207677_10044918
4570 Ga0207677_10207323
4571 Ga0207677_10256022
4572 Ga0207677_10283556
4573 Ga0207703_10009816
4574 Ga0207703_10067369
4575 Ga0207703_10218947
4576 Ga0207703_10247021
4577 Ga0207703_10340568
4578 Ga0207703_10357947
4579 Ga0207703_10375033
4580 Ga0207703_10508721
4581 Ga0207639_10014940
4582 Ga0207639_10055535
4583 Ga0207639_10055995
4584 Ga0207639_10073737
4585 Ga0207639_10085694
4586 Ga0207639_10120582
4587 Ga0207639_10164905
4588 Ga0207639_10171439
4589 Ga0207639_10284515
4590 Ga0207678_10003198
4591 Ga0207678_10007352
4592 Ga0207678_10016139
4593 Ga0207678_10025988
4594 Ga0207678_10132969
4595 Ga0207678_10146684
4596 Ga0207678_10160446
4597 Ga0207678_10265400
4598 Ga0207678_10276120
4599 Ga0207678_10302514
4600 Ga0207678_10326914
4601 Ga0207678_10429780
4602 Ga0207678_10489001
4603 Ga0207708_10031621
4604 Ga0207708_10078856
4605 Ga0207702_10000002
4606 Ga0207702_10000761
4607 Ga0207702_10039386
4608 Ga0207702_10044507
4609 Ga0207702_10112569
4610 Ga0207702_10168087
4611 Ga0207702_10185719
4612 Ga0207702_10305397
4613 Ga0207702_10399516
4614 Ga0207702_10427072
4615 Ga0207702_10530684
4616 Ga0207641_10049558
4617 Ga0207641_10093441
4618 Ga0207641_10202804
4619 Ga0207641_10249600
4620 Ga0207641_10985035
4621 Ga0207648_10049096
4622 Ga0207648_10199900
4623 Ga0207676_10011025
4624 Ga0207676_10087095
4625 Ga0207676_10131033
4626 Ga0207676_10179758
4627 Ga0207674_10007304
4628 Ga0207674_10009531
4629 Ga0207674_10032607
4630 Ga0207674_10035480
4631 Ga0207674_10036525
4632 Ga0207674_10070209
4633 Ga0207674_10141097
4634 Ga0207674_10197551
4635 Ga0207675_100005465
4636 Ga0207675_100057399
4637 Ga0207675_100543894
4638 Ga0207683_10005003
4639 Ga0207683_10019699
4640 Ga0207683_10034410
4641 Ga0207683_10170010
4642 Ga0207683_10245545
4643 Ga0207683_10270199
4644 Ga0207683_10354920
4645 Ga0207698_10015437
4646 Ga0207698_10063007
4647 Ga0207698_10091051
4648 Ga0207698_10137597
4649 Ga0207698_10398835
4650 Ga0207698_10426141
4651 Ga0207698_10907852
4652 Ga0209389_1000061
4653 Ga0209389_1000201
4654 Ga0209371_1000035
4655 Ga0209371_1002757
4656 Ga0209589_1000001
4657 Ga0209589_1000465
4658 Ga0209489_100001
4659 Ga0209489_100006
4660 Ga0209489_100035
4661 Ga0209700_100001
4662 Ga0209700_100005
4663 Ga0209996_1010248
4664 Ga0209995_1008058
4665 Ga0209970_1005707
4666 Ga0210002_1000397
4667 Ga0210002_1004078
4668 Ga0209282_1000173
4669 Ga0209282_1033066
4670 Ga0209588_1004305
4671 Ga0209588_1006241
4672 Ga0209971_1025258
4673 Ga0209966_1000488
4674 Ga0209966_1007934
4675 Ga0209998_10001963
4676 Ga0209998_10004329
4677 Ga0209813_10006996
4678 Ga0209813_10027816
4679 Ga0209813_10032548
4680 Ga0209974_10000736
4681 Ga0209974_10011388
4682 Ga0209974_10015099
4683 Ga0207428_10000115
4684 Ga0207428_10000119
4685 Ga0207428_10000228
4686 Ga0207428_10001793
4687 Ga0207428_10064578
4688 Ga0207428_10166459
4689 Ga0207428_10204458
4690 Ga0207428_10501278
4691 Ga0207428_10537328
4692 Ga0268266_10003390
4693 Ga0268266_10016724
4694 Ga0268266_10019122
4695 Ga0268266_10047487
4696 Ga0268266_10053036
4697 Ga0268266_10125805
4698 Ga0268266_10174703
4699 Ga0268266_10225690
4700 Ga0268266_10518942
4701 Ga0268265_10036239
4702 Ga0268265_10081296
4703 Ga0268265_10197226
4704 Ga0268265_10242957
4705 Ga0268265_10655818
4706 Ga0268264_10000149
4707 Ga0268264_10086370
4708 Ga0268264_10186362
4709 Ga0268264_10198056
4710 Ga0268264_10382454
4711 Ga0265337_1011528
4712 Ga0265326_10002417
4713 Ga0265319_1003112
4714 Ga0265334_10004574
4715 Ga0265318_10002252
4716 Ga0265323_10000280
4717 Ga0265322_10014531
4718 Ga0265336_10000434
4719 Ga0307517_10011552
4720 Ga0307517_10149715
4721 Ga0307515_10000006
4722 Ga0307515_10000176
4723 Ga0307515_10053707
4724 Ga0307515_10076623
4725 Ga0307515_10110548
4726 Ga0265338_10000776
4727 Ga0265338_10013590
4728 Ga0265338_10163725
4729 Ga0265324_10004764
4730 Ga0268256_1000037
4731 Ga0268256_1005826
4732 Ga0316181_1167445
4733 Ga0265760_10032847
4734 Ga0265330_10004928
4735 Ga0265330_10027061
4736 Ga0265330_10050224
4737 Ga0265332_10009521
4738 Ga0265332_10039774
4739 Ga0265325_10000533
4740 Ga0265325_10001355
4741 Ga0265325_10009757
4742 Ga0265325_10019350
4743 Ga0265325_10020316
4744 Ga0265340_10000710
4745 Ga0265339_10011400
4746 Ga0265339_10043156
4747 Ga0265339_10096182
4748 Ga0265339_10116265
4749 Ga0265331_10070418
4750 Ga0265331_10071852
4751 Ga0265331_10113589
4752 Ga0265327_10000409
4753 Ga0265316_10332060
4754 Ga0307509_10093588
4755 Ga0307408_100410083
4756 Ga0307408_100415758
4757 Ga0265313_10000251
4758 Ga0265313_10016098
4759 Ga0265313_10080588
4760 Ga0265313_10113235
4761 Ga0307508_10000009
4762 Ga0307508_10009580
4763 Ga0307508_10044235
4764 Ga0307508_10111959
4765 Ga0316575_10024525
4766 Ga0265314_10006179
4767 Ga0265314_10025825
4768 Ga0265314_10030417
4769 Ga0265314_10051642
4770 Ga0265314_10164678
4771 Ga0265342_10005706
4772 Ga0265342_10023698
4773 Ga0265342_10050434
4774 Ga0265342_10051164
4775 Ga0265342_10113152
4776 Ga0265342_10148148
4777 Ga0316576_10031265
4778 Ga0316578_10003963
4779 Ga0316578_10016422
4780 Ga0307516_10002828
4781 Ga0307516_10008211
4782 Ga0307516_10044284
4783 Ga0307516_10052133
4784 Ga0307516_10100062
4785 Ga0307410_10234493
4786 Ga0307412_10035375
4787 Ga0307412_10068659
4788 Ga0307412_10264995
4789 Ga0307409_100254278
4790 Ga0307409_100414580
4791 Ga0307409_100581707
4792 Ga0307416_100095977
4793 Ga0307416_100113109
4794 Ga0307416_100367627
4795 Ga0307414_10436817
4796 Ga0307411_10107028
4797 Ga0307411_10126807
4798 Ga0307415_100170678
4799 Ga0307507_10099505
4800 Ga0307510_10005184
4801 Ga0307510_10052336
4802 Ga0307510_10063180
4803 Ga0307510_10064293
4804 Ga0315911_1000006
4805 Ga0316215_1000454
4806 Ga0373930_0000193
4807 Ga0373930_0007999
4808 Ga0373930_0019964
4809 Ga0373950_0014938
4810 Ga0373958_0000120
4811 Ga0373958_0000654
4812 Ga0373959_0002191
4813 Ga0373938_0000272
4814 Ga0373938_0002483
4815 Ga0373938_0012749
4816 Ga0373938_0042745
4817 Ga0373926_0002200
4818 Ga0373926_0015814
4819 Ga0373926_0064125
4820 Ga0373928_0000209
4821 Ga0373928_0007184
4822 Ga0373929_0000164
4823 Ga0373929_0008483
4824 Ga0373929_0012164
4825 Ga0373929_0018963
4826 Ga0373934_0011816
4827 Ga0373934_0015364
4828 Ga0373934_0020467
4829 Ga0373940_0024995
4830 Ga0373944_0041265
4831 Ga0373949_0000798
4832 Ga0373949_0004138
4833 Ga0373949_0041832
4834 Ga0373951_0000288
4835 Ga0373951_0004006
4836 Ga0373952_0000289
4837 Ga0373952_0003744
4838 Ga0373952_0024274
4839 Ga0373923_0001901
4840 Ga0373923_0003839
4841 Ga0373923_0023040
4842 Ga0373923_0058755
4843 Ga0373923_0076644
4844 Ga0373932_0000818
4845 Ga0373932_0002835
4846 Ga0373932_0096930
4847 Ga0373936_0000311
4848 Ga0373936_0012550
4849 Ga0373936_0095975
4850 Ga0373936_0113187
4851 Ga0373936_0133874
4852 Ga0373936_0160493
4853 Ga0373939_0001805
4854 Ga0373939_0002107
4855 Ga0373939_0037814
4856 Ga0373941_0000513
4857 Ga0373941_0006287
4858 Ga0373945_0007021
4859 Ga0373945_0008578
4860 Ga0373953_0018550
4861 Ga0373953_0020421
4862 Ga0373953_0031174
4863 Ga0373954_0001502
4864 Ga0373954_0011301
4865 Ga0373954_0015057
4866 Ga0373954_0015610
4867 Ga0373954_0017814
4868 Ga0373954_0035383
4869 Ga0373954_0060395
4870 Ga0373954_0066420
4871 Ga0373954_0170363
4872 Ga0373956_0006863
4873 Ga0373956_0009778
4874 Ga0373956_0046454
4875 Ga0373956_0085482
4876 Ga0373957_0010573
4877 Ga0373957_0016267
4878 Ga0373957_0037905
4879 Ga0373957_0039897
4880 Ga0373960_0108659
4881 Ga0373943_0001913
4882 Ga0373943_0002342
4883 Ga0373943_0015577
4884 Ga0373943_0028239
4885 Ga0373943_0046733
4886 Ga0373943_0048727
4887 Ga0373946_0003909
4888 Ga0373946_0005256
4889 Ga0373946_0005318
4890 Ga0373946_0009447
4891 Ga0373946_0023791
4892 Ga0373946_0026456
4893 Ga0373946_0154702
4894 Ga0373946_0175518
4895 Ga0373946_0182050
4896 Ga0373946_0209885
4897 Ga0373955_0000367
4898 Ga0373955_0000424
4899 Ga0373955_0000593
4900 Ga0373955_0001743
4901 Ga0373955_0005474
4902 Ga0373955_0046006
4903 Ga0373955_0232349
4904 Ga0373942_0099018
4905 Ga0373961_0000196
4906 Ga0373961_0010213
4907 Ga0373961_0018104
4908 Ga0373961_0019220
4909 Ga0373961_0027175
4910 Ga0373961_0030025
4911 Ga0373962_0000667
4912 Ga0373962_0000793
4913 Ga0373962_0011451
4914 Ga0316574_0002397
4915 Ga0316574_0022360
4916 Ga0373924_0000989
4917 Ga0373924_0005031
4918 Ga0373924_0010401
4919 Ga0373924_0012620
4920 Ga0373924_0018693
4921 Ga0373924_0114024
4922 Ga0373931_0001664
4923 Ga0373931_0003298
4924 Ga0373931_0010248
4925 Ga0373931_0018423
4926 Ga0373931_0028120
4927 Ga0373931_0090060
4928 Ga0373931_0287849
4929 Ga0373935_0000602
4930 Ga0373935_0000644
4931 Ga0373935_0008200
4932 Ga0373935_0020975
4933 Ga0373935_0051822
4934 Ga0373927_0000069
4935 Ga0373927_0009820
4936 Ga0373927_0032735
4937 Ga0373927_0045167
4938 Ga0373927_0051893
4939 Ga0373927_0057647
4940 Ga0373927_0058470
4941 Ga0373927_0105981
4942 Ga0373927_0124048
4943 Ga0373927_0161597
4944 Ga0373933_0000445
4945 Ga0373933_0000588
4946 Ga0373933_0002509
4947 Ga0373933_0005388
4948 Ga0373933_0006376
4949 Ga0373933_0009054
4950 Ga0373933_0040462
4951 Ga0373933_0091342
4952 Ga0373947_0000288
4953 Ga0373947_0000385
4954 Ga0373947_0001014
4955 Ga0373947_0001401
4956 Ga0373947_0024081
4957 Ga0373947_0025175
4958 Ga0373947_0042886
4959 Ga0373947_0111249
4960 Ga0373947_0128475
4961 Ga0373947_0143861
4962 Ga0373947_0345954
4963 Ga0373937_0000073
4964 Ga0373937_0000996
4965 Ga0373937_0001508
4966 Ga0373937_0001798
4967 Ga0373937_0038193
4968 Ga0373937_0040386
4969 Ga0373937_0069584
4970 Ga0373937_0165478
4971 Ga0373937_0205404
4972 Ga0373937_0340176
4973 Ga0316582_0173380
4974 Ga0316584_0020146
4975 Ga0316584_0063209
4976 Ga0373925_0000055
4977 Ga0373925_0001787
4978 Ga0373925_0002967
4979 Ga0373925_0023950
4980 Ga0373925_0031253
4981 Ga0373925_0047380
4982 Ga0373925_0054013
4983 Ga0373925_0093009
4984 Ga0373925_0106834
4985 Ga0373925_0414618
4986 Ga0373925_0661327
4987 Ga0395899_0072113
4988 Ga0395899_0091057
4989 Ga0395899_0093488
4990 Ga0395899_0116923
4991 Ga0395899_0387096
4992 Ga0395900_0003151
4993 Ga0395900_0007859
4994 Ga0395900_0019170
4995 Ga0395900_0022268
4996 Ga0395900_0057396
4997 Ga0395900_0396471
4998 Ga0395900_0608930
4999 Ga0395900_0679561
5000 Ga0395898_0002243
5001 Ga0395898_0002749
5002 Ga0395898_0009024
5003 Ga0395898_0030570
5004 Ga0395898_0073653
5005 Ga0395898_0159575
5006 Ga0395898_0186442
5007 Ga0395898_0188310
5008 Ga0395898_0248528
5009 Ga0395898_0506490
5010 Ga0395898_0614965
5011 Ga0395898_0624824
5012 Ga0395905_0038754
5013 Ga0395905_0560285
5014 Ga0395905_0598851
5015 Ga0436364_0154921
5016 Ga0436364_0914936
5017 Ga0436364_1198940
5018 Ga0436364_1490833
5019 Ga0436364_1553220
5020 Ga0395901_0005463
5021 Ga0395901_0015298
5022 Ga0395901_0028377
5023 Ga0395901_0066722
5024 Ga0395901_0112837
5025 Ga0395901_0369533
5026 Ga0395901_0378724
5027 Ga0395901_0955708
5028 Ga0436365_0011601
5029 Ga0436365_0088563
5030 Ga0436365_0100417
5031 Ga0436365_0606602
5032 Ga0436365_0613407
5033 Ga0436365_0638285
5034 Ga0436365_0952142
5035 Ga0436365_0991224
5036 Ga0436365_1156283
5037 Ga0436365_1678428
5038 Ga0436365_1704080
5039 Ga0436360_0827604
5040 Ga0436360_1055266
5041 Ga0436360_1105678
5042 Ga0436361_0031089
5043 Ga0436361_0090327
5044 Ga0436361_0211396
5045 Ga0436361_0713381
5046 Ga0436361_1027368
5047 Ga0436363_0631544
5048 Ga0436363_1327161
5049 Ga0436362_0054978
5050 Ga0436362_0227087
5051 Ga0436362_1231365
5052 Ga0439453_0009873
5053 Ga0439465_0053487
5054 Ga0451797_1242110
5055 Ga0451833_0043958
5056 Ga0451833_1331165
5057 Ga0451835_0654905
5058 Ga0451839_0188649
5059 Ga0451839_0648225
5060 Ga0451841_1200378
5061 Ga0451845_0542334
5062 Ga0451847_0191157
5063 Ga0451843_0434796
5064 Ga0451853_0212274
5065 Ga0439441_000256
5066 Ga0439448_0024228
5067 Ga0439450_001710
5068 Ga0439455_0032483
5069 Ga0439456_008814
5070 Ga0450911_007104
5071 Ga0450923_018482
5072 Ga0439444_0000843
5073 Ga0439460_0010710
5074 Ga0439460_0013080
5075 Ga0451577_0001635
5076 Ga0451577_0142797
5077 Ga0466969_0012275
5078 Ga0466969_0155954
5079 Ga0466972_0000189
5080 Ga0466972_0019592
5081 Ga0453683_0005758
5082 Ga0453683_0006980
5083 Ga0466965_0137646
5084 Ga0466966_0000196
5085 Ga0466966_0016313
5086 Ga0466966_0064302
5087 Ga0466961_0000239
5088 Ga0466963_0035708
5089 Ga0466963_0077082
5090 Ga0466963_0081881
5091 Ga0466963_0188018
5092 Ga0466964_0249136
5093 Ga0453684_0026520
5094 Ga0466971_0083555
5095 Ga0466968_0003867
5096 Ga0466970_0093988
5097 Ga0466957_0054521
5098 Ga0466957_0361451
5099 Ga0466960_0068898
5100 Ga0466959_0012195
5101 Ga0466959_0021923
5102 Ga0466959_0242055
5103 Ga0451576_0138866
5104 Ga0451576_0158822
5105 Ga0466967_0153889
5106 Ga0466967_0175380
5107 Ga0466967_0217970
5108 Ga0466967_0303736
5109 Ga0495592_0000408
5110 Ga0495592_0001873
5111 Ga0495592_0005376
5112 Ga0495592_0006702
5113 Ga0495592_0047310
5114 Ga0495592_0057851
5115 Ga0495592_0104215
5116 Ga0495592_0105939
5117 Ga0495592_0174373
5118 Ga0495592_0178499
5119 Ga0495603_0000429
5120 Ga0495603_0000847
5121 Ga0495603_0004251
5122 Ga0495603_0006331
5123 Ga0495603_0008544
5124 Ga0495603_0017980
5125 Ga0495603_0086940
5126 Ga0495603_0099034
5127 Ga0495629_0000083
5128 Ga0495629_0000183
5129 Ga0495629_0002130
5130 Ga0495629_0009616
5131 Ga0495629_0014325
5132 Ga0495629_0023416
5133 Ga0495629_0205058
5134 Ga0495629_0236505
5135 Ga0495629_0292959
5136 Ga0495638_0000399
5137 Ga0495638_0019634
5138 Ga0495638_0086100
5139 Ga0495638_0089498
5140 Ga0495641_0007011
5141 Ga0495641_0024188
5142 Ga0495641_0091479
5143 Ga0495641_0127686
5144 Ga0495651_0001256
5145 Ga0495651_0004686
5146 Ga0495651_0009898
5147 Ga0495651_0013879
5148 Ga0495651_0040157
5149 Ga0495651_0051027
5150 Ga0495651_0058133
5151 Ga0495651_0064718
5152 Ga0495651_0072710
5153 Ga0495653_0000003
5154 Ga0495653_0001017
5155 Ga0495653_0027582
5156 Ga0495653_0074698
5157 Ga0495653_0091118
5158 Ga0495653_0109805
5159 Ga0495653_0131991
5160 Ga0495653_0249709
5161 Ga0495580_0000716
5162 Ga0495580_0004389
5163 Ga0495580_0017791
5164 Ga0495580_0024614
5165 Ga0495580_0198453
5166 Ga0495582_0000094
5167 Ga0495582_0006958
5168 Ga0495582_0034865
5169 Ga0495582_0056861
5170 Ga0495582_0107487
5171 Ga0495605_0123978
5172 Ga0495605_0134445
5173 Ga0495639_0000150
5174 Ga0495639_0000831
5175 Ga0495639_0002285
5176 Ga0495639_0061139
5177 Ga0495639_0077182
5178 Ga0495639_0093781
5179 Ga0495662_0000080
5180 Ga0495662_0007312
5181 Ga0495662_0032263
5182 Ga0495662_0071163
5183 Ga0495664_0000001
5184 Ga0495664_0004418
5185 Ga0495664_0006189
5186 Ga0495664_0009459
5187 Ga0495664_0029728
5188 Ga0495664_0030301
5189 Ga0495664_0076148
5190 Ga0495664_0251473
5191 Ga0495664_0374405
5192 Ga0495584_0042407
5193 Ga0495594_0001325
5194 Ga0495594_0001874
5195 Ga0495594_0005553
5196 Ga0495594_0097085
5197 Ga0495594_0239238
5198 Ga0495607_0032661
5199 Ga0495583_0003795
5200 Ga0495583_0087782
5201 Ga0495606_0001591
5202 Ga0495606_0002520
5203 Ga0495606_0328432
5204 Ga0495608_0000033
5205 Ga0495608_0000646
5206 Ga0495608_0008945
5207 Ga0495608_0012384
5208 Ga0495608_0037629
5209 Ga0495608_0086016
5210 Ga0495608_0086204
5211 Ga0495608_0091299
5212 Ga0495608_0366209
5213 Ga0495610_0001243
5214 Ga0495610_0063720
5215 Ga0495610_0078245
5216 Ga0495610_0082157
5217 Ga0495610_0189551
5218 Ga0495616_0009255
5219 Ga0495616_0048108
5220 Ga0495616_0094648
5221 Ga0495616_0139366
5222 Ga0495618_0000819
5223 Ga0495618_0001132
5224 Ga0495618_0043007
5225 Ga0495618_0176024
5226 Ga0495618_0236081
5227 Ga0495620_0005207
5228 Ga0495620_0131256
5229 Ga0495628_0000003
5230 Ga0495628_0001902
5231 Ga0495628_0020856
5232 Ga0495628_0059630
5233 Ga0495628_0061372
5234 Ga0495628_0066523
5235 Ga0495628_0094961
5236 Ga0495630_0000351
5237 Ga0495630_0003796
5238 Ga0495630_0011250
5239 Ga0495630_0012651
5240 Ga0495630_0029582
5241 Ga0495630_0102775
5242 Ga0495631_0000031
5243 Ga0495631_0018057
5244 Ga0495631_0048948
5245 Ga0495632_0083710
5246 Ga0495632_0112744
5247 Ga0495632_0134599
5248 Ga0495643_0006299
5249 Ga0495643_0058815
5250 Ga0495643_0065937
5251 Ga0495643_0073957
5252 Ga0495644_0066946
5253 Ga0495644_0183388
5254 Ga0495648_0013070
5255 Ga0495648_0014658
5256 Ga0495648_0039534
5257 Ga0495642_0125514
5258 Ga0495642_0144540
5259 Ga0495652_0000001
5260 Ga0495652_0006130
5261 Ga0495652_0006619
5262 Ga0495652_0011396
5263 Ga0495652_0013582
5264 Ga0495652_0030485
5265 Ga0495652_0031471
5266 Ga0495652_0217719
5267 Ga0495652_0283433
5268 Ga0495654_0116645
5269 Ga0495665_0003088
5270 Ga0495665_0009642
5271 Ga0495665_0130069
5272 Ga0495640_0000012
5273 Ga0495640_0004128
5274 Ga0495640_0025555
5275 Ga0495640_0031230
5276 Ga0495640_0036266
5277 Ga0495640_0060841
5278 Ga0495640_0069028
5279 Ga0495640_0087346
5280 Ga0495640_0186622
5281 Ga0495586_0026612
5282 Ga0495586_0350402
5283 Ga0495587_0000003
5284 Ga0495587_0000770
5285 Ga0495587_0004600
5286 Ga0495587_0010302
5287 Ga0495587_0017472
5288 Ga0495587_0084599
5289 Ga0495598_0044432
5290 Ga0495609_0092378
5291 Ga0495621_0000738
5292 Ga0495621_0067043
5293 Ga0495597_0004537
5294 Ga0495645_0000004
5295 Ga0495645_0001818
5296 Ga0495645_0005428
5297 Ga0495645_0011417
5298 Ga0495645_0020048
5299 Ga0495645_0076360
5300 Ga0495645_0096944
5301 Ga0495645_0130547
5302 Ga0495622_0001916
5303 Ga0495622_0004642
5304 Ga0495622_0023907
5305 Ga0495622_0030214
5306 Ga0495622_0051967
5307 Ga0495622_0096117
5308 Ga0495633_0019049
5309 Ga0495633_0108632
5310 Ga0495633_0159457
5311 Ga0495667_0000001
5312 Ga0495667_0001615
5313 Ga0495667_0010161
5314 Ga0495667_0010501
5315 Ga0495667_0046003
5316 Ga0495667_0063924
5317 Ga0495667_0071472
5318 Ga0495667_0095320
5319 Ga0495656_0084658
5320 Ga0495668_0166306
5321 Ga0495668_0187187
5322 Ga0495668_0231507
5323 Ga0495668_0277927
5324 Ga0495634_0002836
5325 Ga0495634_0003907
5326 Ga0495634_0005348
5327 Ga0495634_0018568
5328 Ga0495634_0038637
5329 Ga0495634_0079123
5330 Ga0495634_0214468
5331 Ga0495634_0299124
5332 Ga0495611_0055476
5333 Ga0495625_0008843
5334 Ga0495625_0011341
5335 Ga0495625_0108923
5336 Ga0495625_0184870
5337 Ga0495625_0232202
5338 Ga0495635_0000015
5339 Ga0495635_0000466
5340 Ga0495635_0001333
5341 Ga0495635_0002411
5342 Ga0495635_0007466
5343 Ga0495635_0013485
5344 Ga0495635_0044353
5345 Ga0495635_0051618
5346 Ga0495635_0159408
5347 Ga0495635_0221844
5348 Ga0495635_0301728
5349 Ga0495659_0056760
5350 Ga0495659_0138969
5351 Ga0495661_0092961
5352 Ga0495588_0014518
5353 Ga0495588_0029437
5354 Ga0495588_0034106
5355 Ga0495588_0049979
5356 Ga0495588_0163500
5357 Ga0495657_0000674
5358 Ga0495657_0001852
5359 Ga0495657_0003435
5360 Ga0495657_0005171
5361 Ga0495657_0060736
5362 Ga0495657_0064356
5363 Ga0495657_0240259
5364 Ga0495657_0358617
5365 Ga0495599_0000004
5366 Ga0495599_0003516
5367 Ga0495599_0006472
5368 Ga0495599_0079910
5369 Ga0495599_0105949
5370 Ga0495623_0000020
5371 Ga0495623_0001484
5372 Ga0495623_0001950
5373 Ga0495623_0007010
5374 Ga0495623_0026676
5375 Ga0495646_0000006
5376 Ga0495646_0019582
5377 Ga0495646_0019760
5378 Ga0495646_0027512
5379 Ga0495646_0029744
5380 Ga0495646_0095691
5381 Ga0495647_0002127
5382 Ga0495647_0004175
5383 Ga0495647_0006440
5384 Ga0495647_0081326
5385 Ga0495647_0129778
5386 Ga0495658_0001408
5387 Ga0495658_0009680
5388 Ga0495658_0162453
5389 Ga0495658_0200132
5390 Ga0495658_0206190
5391 Ga0495669_0046408
5392 Ga0495669_0052168
5393 Ga0495613_0034353
5394 Ga0495613_0056346
5395 Ga0495613_0063011
5396 Ga0495613_0208642
5397 Ga0495613_0282867
5398 Ga0495624_0000786
5399 Ga0495624_0009370
5400 Ga0495624_0029116
5401 Ga0495624_0042731
5402 Ga0495670_0003639
5403 Ga0495671_0019894
5404 Ga0495649_0030460
5405 Ga0495649_0118319
5406 Ga0495589_0125134
5407 Ga0495600_0000027
5408 Ga0495600_0001477
5409 Ga0495600_0001955
5410 Ga0495600_0012843
5411 Ga0495600_0022936
5412 Ga0495600_0137036
5413 Ga0495600_0231272
5414 Ga0495600_0258561
5415 Ga0495600_0334816
5416 Ga0495581_0000095
5417 Ga0495581_0025833
5418 Ga0495581_0033337
5419 Ga0495581_0058247
5420 Ga0495581_0129887
5421 Ga0495581_0152526
5422 Ga0495581_0360456
5423 Ga0495604_0000018
5424 Ga0495604_0000711
5425 Ga0495604_0002492
5426 Ga0495604_0005251
5427 Ga0495604_0024712
5428 Ga0495604_0041331
5429 Ga0495604_0057682
5430 Ga0495604_0137131
5431 Ga0495604_0479380
5432 Ga0495636_0009772
5433 Ga0495636_0120203
5434 Ga0495674_0000001
5435 Ga0495674_0001326
5436 Ga0495674_0003170
5437 Ga0495674_0006000
5438 Ga0495674_0014978
5439 Ga0495674_0034595
5440 Ga0495674_0041091
5441 Ga0495674_0056426
5442 Ga0495674_0057098
5443 Ga0495674_0057439
5444 Ga0495674_0118076
5445 Ga0495674_0134357
5446 Ga0495672_0006759
5447 Ga0495672_0019639
5448 Ga0495672_0029155
5449 Ga0495672_0094574
5450 Ga0495672_0184815
5451 Ga0495676_0008104
5452 Ga0495676_0030156
5453 Ga0495676_0047250
5454 Ga0495676_0155965
5455 Ga0495676_0208325
5456 Ga0495680_0000355
5457 Ga0495680_0005136
5458 Ga0495680_0007458
5459 Ga0495680_0008649
5460 Ga0495680_0016513
5461 Ga0495680_0047542
5462 Ga0495680_0096258
5463 Ga0495680_0101063
5464 Ga0495683_0003676
5465 Ga0495687_007394
5466 Ga0495687_009315
5467 Ga0495687_125808
5468 Ga0495675_0000034
5469 Ga0495675_0001036
5470 Ga0495675_0006578
5471 Ga0495675_0084798
5472 Ga0495675_0267770
5473 Ga0495675_0284245
5474 Ga0495673_0015827
5475 Ga0495673_0158186
5476 Ga0495681_0008484
5477 Ga0495681_0199777
5478 Ga0495684_0000005
5479 Ga0495684_0000357
5480 Ga0495684_0019067
5481 Ga0495684_0041206
5482 Ga0495684_0078834
5483 Ga0495684_0148845
5484 Ga0495684_0294963
5485 Ga0495684_0309627
5486 Ga0495686_0047012
5487 Ga0495686_0108076
5488 Ga0495686_0108119
5489 Ga0495686_0135377
5490 Ga0495686_0387391
5491 Ga0495593_0000531
5492 Ga0495593_0001114
5493 Ga0495593_0008961
5494 Ga0495593_0028635
5495 Ga0495593_0034246
5496 Ga0495593_0080801
5497 Ga0495593_0112916
5498 Ga0495593_0122237
5499 Ga0495602_0000002
5500 Ga0495602_0001368
5501 Ga0495602_0004923
5502 Ga0495602_0008736
5503 Ga0495602_0031103
5504 Ga0495602_0061680
5505 Ga0495602_0185861
5506 Ga0495602_0202500
5507 Ga0495602_0205740
5508 Ga0495602_0266661
5509 Ga0495602_0513067
5510 Ga0495614_0008512
5511 Ga0495614_0030835
5512 Ga0495626_0029757
5513 Ga0495626_0044213
5514 Ga0495626_0107812
5515 Ga0496100_0007026
5516 Ga0496100_0017746
5517 Ga0496100_0058734
5518 Ga0496100_0168594
5519 Ga0496100_0204298
5520 Ga0496100_0321113
5521 Ga0496100_0398303
5522 Ga0496101_0002722
5523 Ga0496101_0007200
5524 Ga0496101_0019561
5525 Ga0496101_0058967
5526 Ga0496101_0086741
5527 Ga0496101_0139931
5528 Ga0496101_0481365
5529 Ga0496101_0789781
5530 Ga0496102_0001456
5531 Ga0496102_0006460
5532 Ga0496102_0006962
5533 Ga0496102_0013794
5534 Ga0496102_0014728
5535 Ga0496102_0017535
5536 Ga0496102_0023779
5537 Ga0496102_0038142
5538 Ga0496102_0062369
5539 Ga0496102_0115847
5540 Ga0496102_0121719
5541 Ga0496102_0143429
5542 Ga0496102_0598256
5543 Ga0496102_0930375
5544 Ga0496103_0002596
5545 Ga0496103_0019610
5546 Ga0496103_0025456
5547 Ga0496103_0039741
5548 Ga0496103_0054700
5549 Ga0496103_0063663
5550 Ga0496103_0071366
5551 Ga0496103_0175136
5552 Ga0496103_0284457
5553 Ga0496103_0317273
5554 Ga0496104_0001268
5555 Ga0496104_0003748
5556 Ga0496104_0007294
5557 Ga0496104_0008844
5558 Ga0496104_0013086
5559 Ga0496104_0013863
5560 Ga0496104_0020552
5561 Ga0496104_0026919
5562 Ga0496104_0061801
5563 Ga0496104_0177223
5564 Ga0496104_0240489
5565 Ga0496104_0341754
5566 Ga0496104_0347331
5567 Ga0496104_0553344
5568 Ga0496105_0002644
5569 Ga0496105_0003408
5570 Ga0496105_0008260
5571 Ga0496105_0016122
5572 Ga0496105_0026739
5573 Ga0496105_0028197
5574 Ga0496105_0086384
5575 Ga0496105_0093954
5576 Ga0496105_0161852
5577 Ga0496105_0219135
5578 Ga0496105_0235508
5579 Ga0496106_0001779
5580 Ga0496106_0007345
5581 Ga0496106_0010695
5582 Ga0496106_0011982
5583 Ga0496106_0029872
5584 Ga0496106_0030731
5585 Ga0496106_0051201
5586 Ga0496106_0069575
5587 Ga0496106_0070375
5588 Ga0496106_0132488
5589 Ga0496106_0152046
5590 Ga0496106_0332898
5591 Ga0496106_0428159
5592 Ga0496107_0007359
5593 Ga0496107_0009980
5594 Ga0496107_0016613
5595 Ga0496107_0025096
5596 Ga0496107_0028104
5597 Ga0496107_0029470
5598 Ga0496107_0036686
5599 Ga0496107_0053387
5600 Ga0496107_0055692
5601 Ga0496107_0083866
5602 Ga0496107_0095562
5603 Ga0496107_0167245
5604 Ga0496107_0182933
5605 Ga0496107_0218973
5606 Ga0496107_0706100
5607 Ga0496108_0007879
5608 Ga0496108_0008415
5609 Ga0496108_0014395
5610 Ga0496108_0030364
5611 Ga0496108_0036356
5612 Ga0496108_0048029
5613 Ga0496108_0080930
5614 Ga0496108_0090239
5615 Ga0496108_0154458
5616 Ga0496108_0449790
5617 Ga0496108_0556765
5618 Ga0496109_0015483
5619 Ga0496109_0029367
5620 Ga0496109_0032449
5621 Ga0496109_0054989
5622 Ga0496109_0075129
5623 Ga0496109_0077534
5624 Ga0496109_0082705
5625 Ga0496109_0122043
5626 Ga0496109_0133521
5627 Ga0496109_0164970
5628 Ga0496109_0198528
5629 Ga0496109_0216639
5630 Ga0496109_0357020
5631 Ga0496109_0496257
5632 Ga0496110_0006503
5633 Ga0496110_0014347
5634 Ga0496110_0017687
5635 Ga0496110_0018349
5636 Ga0496110_0022908
5637 Ga0496110_0033950
5638 Ga0496110_0061580
5639 Ga0496110_0065812
5640 Ga0496110_0072529
5641 Ga0496110_0081046
5642 Ga0496110_0100252
5643 Ga0496110_0112992
5644 Ga0496110_0115019
5645 Ga0496110_0133268
5646 Ga0496110_0223078
5647 Ga0496110_0466197
5648 Ga0496110_0628628
5649 Ga0496111_0024617
5650 Ga0496111_0025164
5651 Ga0496111_0038429
5652 Ga0496111_0039779
5653 Ga0496111_0070090
5654 Ga0496111_0101777
5655 Ga0496111_0116421
5656 Ga0496111_0153705
5657 Ga0496111_0215847
5658 Ga0496111_0225143
5659 Ga0496111_0236538
5660 Ga0496111_0270274
5661 Ga0496111_0285901
5662 Ga0496111_0345141
5663 Ga0496111_0412313
5664 Ga0496112_0000004
5665 Ga0496112_0011381
5666 Ga0496112_0013012
5667 Ga0496112_0016876
5668 Ga0496112_0023843
5669 Ga0496112_0034410
5670 Ga0496112_0037237
5671 Ga0496112_0062540
5672 Ga0496112_0079666
5673 Ga0496112_0091129
5674 Ga0496112_0091204
5675 Ga0496112_0101340
5676 Ga0496112_0104503
5677 Ga0496112_0180508
5678 Ga0496112_0214233
5679 Ga0496113_0018281
5680 Ga0496113_0053851
5681 Ga0496113_0063033
5682 Ga0496113_0087782
5683 Ga0496113_0113595
5684 Ga0496113_0139862
5685 Ga0496113_0174762
5686 Ga0496113_0189286
5687 Ga0496113_0203376
5688 Ga0496113_0310213
5689 Ga0496113_0626897
5690 Ga0496114_0002125
5691 Ga0496114_0013004
5692 Ga0496114_0028089
5693 Ga0496114_0061164
5694 Ga0496114_0085349
5695 Ga0496114_0097250
5696 Ga0496114_0103959
5697 Ga0496114_0141240
5698 Ga0496114_0146998
5699 Ga0496114_0212378
5700 Ga0496114_0259279
5701 Ga0496114_0413833
5702 Ga0496115_0002254
5703 Ga0496115_0008091
5704 Ga0496115_0009208
5705 Ga0496115_0012349
5706 Ga0496115_0034827
5707 Ga0496115_0045681
5708 Ga0496115_0096715
5709 Ga0496115_0111819
5710 Ga0496115_0136373
5711 Ga0496115_0178565
5712 Ga0496115_0255560
5713 Ga0496115_0284551
5714 Ga0496115_0645472
5715 Ga0496116_0002703
5716 Ga0496116_0018353
5717 Ga0496116_0045503
5718 Ga0496116_0056671
5719 Ga0496116_0207306
5720 Ga0496117_0000066
5721 Ga0496117_0000105
5722 Ga0496117_0091514
5723 Ga0496117_0135237
5724 Ga0496118_0000231
5725 Ga0496118_0000427
5726 Ga0496118_0011620
5727 Ga0496118_0016895
5728 Ga0496118_0035128
5729 Ga0496118_0118636
5730 Ga0496118_0121239
5731 Ga0496119_0014778
5732 Ga0496119_0024379
5733 Ga0496120_0000463
5734 Ga0496120_0070905
5735 Ga0496120_0108158
5736 Ga0496120_0165648
5737 Ga0496121_0002564
5738 Ga0496121_0005471
5739 Ga0496121_0007499
5740 Ga0496121_0026412
5741 Ga0496121_0036105
5742 Ga0496121_0038709
5743 Ga0496121_0053646
5744 Ga0496121_0069598
5745 Ga0496121_0081235
5746 Ga0496121_0092222
5747 Ga0496121_0110966
5748 Ga0496121_0133939
5749 Ga0496121_0199493
5750 Ga0496121_0215342
5751 Ga0496121_0266961
5752 Ga0496121_0356753
5753 Ga0496122_0000057
5754 Ga0496122_0033178
5755 Ga0496122_0040041
5756 Ga0496122_0173369
5757 Ga0496122_0175913
5758 Ga0496123_0000401
5759 Ga0496123_0029099
5760 Ga0496123_0038178
5761 Ga0496123_0142162
5762 Ga0496124_0000837
5763 Ga0496124_0004181
5764 Ga0496124_0069152
5765 Ga0496124_0126415
5766 Ga0496124_0173846
5767 Ga0496124_0221333
5768 Ga0496124_0312084
5769 Ga0496125_0002607
5770 Ga0496125_0005748
5771 Ga0496125_0007108
5772 Ga0496125_0021531
5773 Ga0496125_0045484
5774 Ga0496125_0058392
5775 Ga0496125_0115835
5776 Ga0496125_0126574
5777 Ga0496125_0173743
5778 Ga0496125_0273410
5779 Ga0496125_0291334
5780 Ga0496126_0008579
5781 Ga0496126_0009003
5782 Ga0496126_0009783
5783 Ga0496126_0012755
5784 Ga0496126_0013528
5785 Ga0496126_0018680
5786 Ga0496126_0025545
5787 Ga0496126_0044721
5788 Ga0496126_0082690
5789 Ga0496126_0091768
5790 Ga0496126_0095872
5791 Ga0496126_0111446
5792 Ga0496126_0155576
5793 Ga0496126_0235437
5794 Ga0496126_0244559
5795 Ga0496126_0317412
5796 Ga0496126_0372282
5797 Ga0496126_0439739
5798 Ga0496126_0448149
5799 Ga0495682_0005723
5800 Ga0501031_0001421
5801 Ga0501031_0010568
5802 Ga0501031_0028856
5803 Ga0501031_0045491
5804 Ga0501032_0000129
5805 Ga0501032_0003564
5806 Ga0501032_0006576
5807 Ga0501032_0051131
5808 Ga0501032_0145344
5809 Ga0501032_0182518
5810 Ga0501032_0199486
5811 Ga0501032_0217566
5812 Ga0501032_0240871
5813 Ga0501032_0281982
5814 Ga0501033_0001179
5815 Ga0501033_0002170
5816 Ga0501033_0012740
5817 Ga0501033_0104189
5818 Ga0501033_0116243
5819 Ga0501033_0202454
5820 Ga0501033_0223222
5821 Ga0501034_0000503
5822 Ga0501034_0000516
5823 Ga0501034_0000608
5824 Ga0501034_0012060
5825 Ga0501034_0027813
5826 Ga0501034_0033400
5827 Ga0501034_0038162
5828 Ga0501034_0045892
5829 Ga0501034_0055553
5830 Ga0501034_0056951
5831 Ga0501034_0089178
5832 Ga0501034_0127267
5833 Ga0501034_0230760
5834 Ga0501034_0250278
5835 Ga0501034_0431275
5836 Ga0501036_0000547
5837 Ga0501036_0001453
5838 Ga0501036_0013517
5839 Ga0501036_0023998
5840 Ga0501036_0033256
5841 Ga0501036_0065773
5842 Ga0501036_0081321
5843 Ga0501036_0233408
5844 Ga0501036_0445041
5845 Ga0501036_0456413
5846 Ga0501037_0000106
5847 Ga0501037_0005891
5848 Ga0501037_0020971
5849 Ga0501037_0054373
5850 Ga0501037_0104905
5851 Ga0501037_0293899
5852 Ga0501038_0001655
5853 Ga0501038_0008504
5854 Ga0501038_0014086
5855 Ga0501038_0053911
5856 Ga0501038_0144473
5857 Ga0501038_0313507
5858 Ga0501039_0000416
5859 Ga0501039_0003067
5860 Ga0501039_0010585
5861 Ga0501039_0123865
5862 Ga0501039_0336546
5863 Ga0501039_0536774
5864 Ga0501040_0024555
5865 Ga0501040_0030848
5866 Ga0501040_0140750
5867 Ga0501041_0142094
5868 Ga0501041_0344458
5869 Ga0501042_0017067
5870 Ga0501042_0039520
5871 Ga0501042_0163188
5872 Ga0501042_0420800
5873 Ga0501043_0003257
5874 Ga0501043_0004728
5875 Ga0501043_0016610
5876 Ga0501043_0019247
5877 Ga0501043_0025549
5878 Ga0501043_0044502
5879 Ga0501043_0131829
5880 Ga0501043_0609313
5881 Ga0501046_0000235
5882 Ga0501046_0003612
5883 Ga0501046_0058824
5884 Ga0501046_0059092
5885 Ga0501046_0061052
5886 Ga0501046_0071774
5887 Ga0501046_0088728
5888 Ga0501046_0126220
5889 Ga0501047_0000455
5890 Ga0501047_0000844
5891 Ga0501047_0006341
5892 Ga0501047_0014131
5893 Ga0501047_0015400
5894 Ga0501047_0038863
5895 Ga0501047_0136926
5896 Ga0501047_0157598
5897 Ga0501047_0198667
5898 Ga0501047_0218397
5899 Ga0501047_0240312
5900 Ga0501047_0270269
5901 Ga0501047_0468023
5902 Ga0501047_0493631
5903 Ga0501047_0535225
5904 Ga0501048_0001444
5905 Ga0501048_0002034
5906 Ga0501048_0013490
5907 Ga0501048_0117605
5908 Ga0501048_0393258
5909 Ga0501067_0000160
5910 Ga0501067_0020942
5911 Ga0501067_0048969
5912 Ga0501068_0000014
5913 Ga0501068_0001689
5914 Ga0501068_0015782
5915 Ga0501068_0045654
5916 Ga0501068_0054899
5917 Ga0501068_0082084
5918 Ga0501068_0091615
5919 Ga0501069_0004593
5920 Ga0501069_0042963
5921 Ga0501069_0043355
5922 Ga0501069_0043823
5923 Ga0501069_0063144
5924 Ga0501069_0115199
5925 Ga0501070_0003132
5926 Ga0501070_0003722
5927 Ga0501070_0020920
5928 Ga0501070_0022310
5929 Ga0501070_0034852
5930 Ga0501070_0047718
5931 Ga0501070_0065508
5932 Ga0501070_0122197
5933 Ga0501070_0146421
5934 Ga0501070_0537592
5935 Ga0501071_0109529
5936 Ga0501071_0153059
5937 Ga0501072_0001159
5938 Ga0501072_0095919
5939 Ga0501072_0219585
5940 Ga0501072_0241887
5941 Ga0501072_0487385
5942 Ga0501072_0533043
5943 Ga0501073_0002573
5944 Ga0501073_0019863
5945 Ga0501073_0020039
5946 Ga0501073_0034051
5947 Ga0501073_0046419
5948 Ga0501073_0082348
5949 Ga0501073_0176214
5950 Ga0501073_0196090
5951 Ga0501073_0239263
5952 Ga0501073_0249679
5953 Ga0501074_0000596
5954 Ga0501074_0036536
5955 Ga0501074_0061843
5956 Ga0501074_0157089
5957 Ga0501075_0025051
5958 Ga0501075_0269332
5959 Ga0501076_0111199
5960 Ga0501077_0033307
5961 Ga0501079_0000261
5962 Ga0501079_0020413
5963 Ga0501079_0026383
5964 Ga0501079_0028695
5965 Ga0501079_0580980
5966 Ga0501080_0000917
5967 Ga0501080_0001026
5968 Ga0501080_0002860
5969 Ga0501080_0016248
5970 Ga0501080_0021293
5971 Ga0501080_0049006
5972 Ga0501080_0100255
5973 Ga0501080_0244403
5974 Ga0501080_0286137
5975 Ga0501081_0019996
5976 Ga0501081_0046488
5977 Ga0501083_0000301
5978 Ga0501083_0010516
5979 Ga0501083_0016358
5980 Ga0501083_0106640
5981 Ga0501083_0121351
5982 Ga0501083_0171586
5983 Ga0501083_0244487
5984 Ga0501083_0312413
5985 Ga0501083_0328591
5986 Ga0501083_0344361
5987 Ga0501035_0000324
5988 Ga0501035_0001156
5989 Ga0501035_0005480
5990 Ga0501035_0012093
5991 Ga0501035_0055816
5992 Ga0501035_0069325
5993 Ga0501035_0091241
5994 Ga0501035_0119276
5995 Ga0501035_0203869
5996 Ga0501035_0229475
5997 Ga0501035_0271327
5998 Ga0501035_0450563
5999 Ga0501035_0512141
6000 Ga0501044_0000051
6001 Ga0501044_0000084
6002 Ga0501044_0006565
6003 Ga0501044_0008033
6004 Ga0501044_0033271
6005 Ga0501044_0036889
6006 Ga0501044_0037160
6007 Ga0501044_0037167
6008 Ga0501044_0051547
6009 Ga0501044_0070506
6010 Ga0501044_0077568
6011 Ga0501044_0088673
6012 Ga0501044_0091268
6013 Ga0501044_0100663
6014 Ga0501044_0151146
6015 Ga0501044_0169989
6016 Ga0501044_0284637
6017 Ga0501044_0464635
6018 Ga0501045_0016881
6019 Ga0501045_0048136
6020 nmdc:mga03683_41483_c1
6021 nmdc:mga03683_69184_c1
6022 nmdc:mga03683_91166_c1
6023 nmdc:mga03n38_11031_c1
6024 nmdc:mga03n38_282470_c1
6025 nmdc:mga03n38_299997_c1
6026 nmdc:mga03n38_91030_c1
6027 nmdc:mga00v17_131991_c1
6028 nmdc:mga00v17_159717_c1
6029 nmdc:mga00v17_16076_c1
6030 nmdc:mga00v17_176043_c1
6031 nmdc:mga00v17_184695_c1
6032 nmdc:mga00v17_5870_c1
6033 nmdc:mga00v17_88041_c1
6034 nmdc:mga0yw44_10209_c1
6035 nmdc:mga0yw44_105764_c1
6036 nmdc:mga0yw44_116394_c1
6037 nmdc:mga0yw44_124291_c1
6038 nmdc:mga0yw44_141174_c1
6039 nmdc:mga0yw44_152552_c1
6040 nmdc:mga0yw44_154247_c1
6041 nmdc:mga0yw44_26596_c1
6042 nmdc:mga0yw44_356161_c1
6043 nmdc:mga0yw44_887_c1
6044 nmdc:mga0k408_110407_c1
6045 nmdc:mga0k408_111488_c1
6046 nmdc:mga0k408_64818_c1
6047 nmdc:mga0k408_80263_c1
6048 nmdc:mga06z11_101686_c1
6049 nmdc:mga06z11_125362_c1
6050 nmdc:mga06z11_126939_c1
6051 nmdc:mga06z11_224126_c1
6052 nmdc:mga06z11_226025_c1
6053 nmdc:mga06z11_235353_c1
6054 nmdc:mga06z11_29777_c1
6055 nmdc:mga06z11_58188_c1
6056 nmdc:mga04h51_11394_c1
6057 nmdc:mga04h51_26535_c1
6058 nmdc:mga04h51_71258_c1
6059 nmdc:mga04h51_75646_c1
6060 nmdc:mga07m45_14318_c1
6061 nmdc:mga07m45_218385_c1
6062 nmdc:mga07m45_221501_c1
6063 nmdc:mga07m45_25821_c1
6064 nmdc:mga07m45_32763_c2
6065 nmdc:mga07m45_33931_c1
6066 nmdc:mga07m45_56860_c1
6067 nmdc:mga07m45_83386_c1
6068 nmdc:mga07m45_86605_c1
6069 nmdc:mga05p37_20750_c1
6070 nmdc:mga05p37_2742_c1
6071 nmdc:mga05p37_302469_c1
6072 nmdc:mga05p37_325668_c1
6073 nmdc:mga05p37_3855_c1
6074 nmdc:mga05p37_40529_c1
6075 nmdc:mga05p37_450067_c1
6076 nmdc:mga05p37_45113_c1
6077 nmdc:mga05p37_51739_c1
6078 nmdc:mga05p37_59708_c1
6079 nmdc:mga05p37_828_c1
6080 nmdc:mga09592_101986_c1
6081 nmdc:mga09592_17204_c1
6082 nmdc:mga09592_229069_c1
6083 nmdc:mga09592_32841_c1
6084 nmdc:mga09592_3919_c1
6085 nmdc:mga09592_500287_c1
6086 nmdc:mga09592_71487_c1
6087 nmdc:mga09592_82786_c1
6088 nmdc:mga0qj67_125797_c1
6089 nmdc:mga0qj67_165_c1
6090 nmdc:mga0qj67_20911_c1
6091 nmdc:mga0qj67_29170_c1
6092 nmdc:mga0qj67_71064_c1
6093 nmdc:mga0qj67_936448_c1
6094 nmdc:mga06r32_14959_c1
6095 nmdc:mga06r32_15975_c1
6096 nmdc:mga06r32_2962_c1
6097 nmdc:mga06r32_313761_c1
6098 nmdc:mga06r32_513_c1
6099 nmdc:mga06r32_52693_c1
6100 nmdc:mga06r32_7280_c1
6101 nmdc:mga08y16_1045_c1
6102 nmdc:mga08y16_121624_c1
6103 nmdc:mga08y16_135539_c1
6104 nmdc:mga08y16_145902_c1
6105 nmdc:mga08y16_213789_c1
6106 nmdc:mga08y16_354861_c1
6107 nmdc:mga08y16_373770_c1
6108 nmdc:mga08y16_4405_c1
6109 nmdc:mga0n895_110849_c1
6110 nmdc:mga0n895_1284_c1
6111 nmdc:mga0n895_184847_c1
6112 nmdc:mga0n895_20210_c1
6113 nmdc:mga0n895_2213_c1
6114 nmdc:mga0n895_3322_c1
6115 nmdc:mga0n895_40795_c1
6116 nmdc:mga0n895_444275_c1
6117 nmdc:mga0n895_448137_c1
6118 nmdc:mga0n895_62290_c1
6119 nmdc:mga0n895_933986_c1
6120 nmdc:mga0rr50_103584_c1
6121 nmdc:mga0rr50_1278_c1
6122 nmdc:mga0rr50_144241_c1
6123 nmdc:mga0rr50_21174_c1
6124 nmdc:mga0rr50_2496_c1
6125 nmdc:mga08x19_121449_c1
6126 nmdc:mga08x19_2261_c1
6127 nmdc:mga08x19_3072_c1
6128 nmdc:mga08x19_3746_c1
6129 nmdc:mga08x19_436922_c1
6130 nmdc:mga08x19_54430_c1
6131 nmdc:mga0a205_10565_c1
6132 nmdc:mga0a205_105869_c1
6133 nmdc:mga0a205_10612_c1
6134 nmdc:mga0a205_1632_c1
6135 nmdc:mga0a205_32349_c1
6136 nmdc:mga0a205_381697_c1
6137 nmdc:mga0a205_6515_c2
6138 nmdc:mga0a205_7303_c1
6139 nmdc:mga0sz30_115666_c1
6140 nmdc:mga0sz30_11655_c1
6141 nmdc:mga0sz30_1322_c1
6142 nmdc:mga0sz30_33822_c1
6143 nmdc:mga0sz30_4022_c1
6144 nmdc:mga0sz30_50881_c1
6145 nmdc:mga0sz30_570_c1
6146 nmdc:mga0sz30_59902_c1
6147 nmdc:mga0sz30_956_c2
6148 Ga0495601_0000003
6149 Ga0495601_0000075
6150 Ga0495601_0001377
6151 Ga0495601_0001804
6152 Ga0495601_0003301
6153 Ga0495601_0005086
6154 Ga0495601_0021970
6155 Ga0495601_0063818
6156 Ga0495601_0092437
6157 Ga0495601_0096139
6158 Ga0495601_0129405
6159 Ga0495601_0233512
6160 Ga0495612_0000007
6161 Ga0495612_0004225
6162 Ga0495612_0010002
6163 Ga0495612_0015920
6164 Ga0495612_0066303
6165 Ga0495612_0086486
6166 Ga0495612_0156839
6167 Ga0500610_0008035
6168 Ga0500610_0189157
6169 Ga0500610_0213805
6170 Ga0500635_0014231
6171 Ga0495655_0011038
6172 Ga0495655_0030657
6173 Ga0495595_0000018
6174 Ga0495595_0000253
6175 Ga0495595_0001128
6176 Ga0495595_0001986
6177 Ga0495595_0002088
6178 Ga0495595_0004048
6179 Ga0495595_0044569
6180 Ga0495619_0000009
6181 Ga0495619_0000176
6182 Ga0495619_0000315
6183 Ga0495619_0000907
6184 Ga0495619_0002367
6185 Ga0495619_0002424
6186 Ga0495619_0006236
6187 Ga0495619_0007164
6188 Ga0495619_0015919
6189 Ga0495619_0017210
6190 Ga0495619_0019609
6191 Ga0495619_0019765
6192 Ga0495619_0222045
6193 Ga0495619_0339232
6194 Ga0495619_0489101
6195 Ga0500578_0093463
6196 Ga0500643_000032
6197 Ga0500643_021172
6198 Ga0500643_031514
6199 Ga0500644_0000616
6200 Ga0500644_0026260
6201 Ga0500581_036908
6202 Ga0500647_0031804
6203 Ga0500583_0044935
6204 Ga0500651_0126100
6205 Ga0500651_0158921
6206 Ga0500651_0223819
6207 Ga0500566_0000009
6208 Ga0500566_0005587
6209 Ga0500566_0019862
6210 Ga0500566_0039944
6211 Ga0500566_0056157
6212 Ga0500640_000068
6213 Ga0500641_0002050
6214 Ga0500641_0003846
6215 Ga0500641_0017488
6216 Ga0500648_215838
6217 Ga0500650_0002825
6218 Ga0500650_0100149
6219 Ga0500650_0167296
6220 Ga0500654_056014
6221 Ga0500554_002596
6222 Ga0500554_003367
6223 Ga0500555_007765
6224 Ga0500555_070424
6225 Ga0500556_0000004
6226 Ga0500557_000004
6227 Ga0500560_003025
6228 Ga0500562_038362
6229 Ga0500569_001569
6230 Ga0500569_005035
6231 Ga0500569_054331
6232 Ga0500572_000070
6233 Ga0500572_001200
6234 Ga0500592_001517
6235 Ga0500594_0000057
6236 Ga0500594_0042078
6237 Ga0500595_000002
6238 Ga0500595_000022
6239 Ga0500595_000480
6240 Ga0500595_000759
6241 Ga0500595_004688
6242 Ga0500595_004779
6243 Ga0500595_007399
6244 Ga0500595_022956
6245 Ga0500595_024725
6246 Ga0500595_064419
6247 Ga0500597_037008
6248 Ga0500607_023944
6249 Ga0500608_001229
6250 Ga0500608_018917
6251 Ga0500608_071643
6252 Ga0500608_125177
6253 Ga0500614_003149
6254 Ga0500614_003281
6255 Ga0500617_131272
6256 Ga0500618_034638
6257 Ga0500621_074980
6258 Ga0500642_0000173
6259 Ga0500642_0000186
6260 Ga0500642_0017033
6261 Ga0500642_0080104
6262 Ga0500642_0187719
6263 Ga0500652_018588
6264 Ga0500652_136118
6265 Ga0500652_166336
6266 Ga0500658_0001954
6267 Ga0500658_0012242
6268 Ga0500559_0006553
6269 Ga0500559_0008102
6270 Ga0500559_0040023
6271 Ga0500559_0073867
6272 Ga0500559_0139113
6273 Ga0500561_0000056
6274 Ga0500568_0000447
6275 Ga0500568_0001430
6276 Ga0500568_0130791
6277 Ga0500568_0133055
6278 Ga0500573_0050606
6279 Ga0500577_0000153
6280 Ga0500577_0127559
6281 Ga0500586_004604
6282 Ga0500590_045152
6283 Ga0500603_000885
6284 Ga0500603_004929
6285 Ga0500604_0002499
6286 Ga0500604_0007955
6287 Ga0500604_0010784
6288 Ga0500604_0011473
6289 Ga0500616_0000002
6290 Ga0500616_0000014
6291 Ga0500616_0000372
6292 Ga0500616_0030193
6293 Ga0500616_0032283
6294 Ga0500616_0037019
6295 Ga0500620_004101
6296 Ga0500622_0000513
6297 Ga0500622_0097644
6298 Ga0500627_0025026
6299 Ga0500630_000240
6300 Ga0500633_0009242
6301 Ga0500638_000252
6302 Ga0500638_013918
6303 Ga0500638_101585
6304 Ga0500638_147401
6305 Ga0500639_000545
6306 Ga0500639_163417
6307 Ga0500636_0000122
6308 Ga0500636_0001016
6309 Ga0500636_0090660
6310 Ga0500637_0000142
6311 Ga0500637_0001199
6312 Ga0500637_0027475
6313 Ga0500637_0035511
6314 Ga0500637_0233096
6315 Ga0500611_010939
6316 Ga0500657_073658
6317 Ga0500625_014344
6318 Ga0500645_000012
6319 Ga0500645_009177
6320 Ga0500609_004863
6321 Ga0500609_006562
6322 Ga0500552_002620
6323 Ga0500596_000198
6324 Ga0500596_008430
6325 Ga0500601_000050
6326 Ga0501084_0014689
6327 Ga0501084_0045232
6328 Ga0501084_0178774
6329 Ga0501084_0269394
6330 Ga0501084_0453071
6331 Ga0500661_001246
6332 Ga0500661_016936
6333 Ga0501082_0072431
6334 Ga0501082_0101026
6335 Ga0501082_0282250
6336 Ga0501082_0442877
6337 Ga0501082_0602998
6338 Ga0466962_0010452
6339 2507508415
6340 2508542482
6341 2508691744
6342 2509150524
6343 2509385520
6344 2509448440
6345 2510136529
6346 2510900198
6347 2511400722
6348 2513569618
6349 2513576442
6350 2513625553
6351 2513635284
6352 2513644463
6353 2513645669
6354 2513658002
6355 2513676089
6356 2513692738
6357 2513701112
6358 2513709822
6359 2513717134
6360 2513855704
6361 2513872943
6362 2513893961
6363 2513919904
6364 2514013703
6365 2514018810
6366 2515115102
6367 2515627092
6368 2515633288
6369 2515642513
6370 2515658490
6371 2515741955
6372 2517041898
6373 2517081073
6374 2517098589
6375 2517107782
6376 2517410864
6377 2517892243
6378 2524437523
6379 2524465683
6380 2524540322
6381 2528852401
6382 2530644525
6383 2537875735
6384 2554244838
6385 2559297328
6386 2585539237
6387 2585837191
6388 2599605877
6389 2601611569
6390 2601748879
6391 2603859620
6392 2617347341
6393 2617375574
6394 2643757146
6395 2643921870
6396 2644288820
6397 2644519837
6398 2671120509
6399 2719183793
6400 2719388466
6401 2719668094
6402 2719728234
6403 2720494857
6404 2720611177
6405 2720616350
6406 2720629424
6407 2720771995
6408 2721145095
6409 2721155832
6410 2721167182
6411 2721403089
6412 2722838160
6413 2723029426
6414 2723563041
6415 2723571022
6416 2723844883
6417 2724035446
6418 2724042428
6419 2724086815
6420 2724106973
6421 2724107783
6422 2725946294
6423 2728747402
6424 2730105740
6425 2730161933
6426 2730300939
6427 2739033687
6428 2745076485
6429 2766068409
6430 2776914772
6431 2793065437
6432 2793072416
6433 2793082246
6434 2793298914
6435 2793317184
6436 2793325668
6437 2793333093
6438 2793340103
6439 2793346269
6440 2793355486
6441 2793357774
6442 2793369718
6443 2805915159
6444 2805929078
6445 2805937220
6446 2806044814
6447 2806054026
6448 2806059882
6449 2806066065
6450 2806073353
6451 2808988714
6452 2818238712
6453 2819561423
6454 2824604044
6455 2824610313
6456 2824617906
6457 2824626574
6458 2824638591
6459 2824646059
6460 2824658046
6461 2824668331
6462 2824676870
6463 2824684509
6464 2824693179
6465 2824701811
6466 2824708998
6467 2824716245
6468 2824726544
6469 2824735285
6470 2824746615
6471 2824759580
6472 2824770017
6473 2824775466
6474 2838019489
6475 2838027208
6476 2838045928
6477 2838050594
6478 2838062886
6479 2838071835
6480 2838123565
6481 2838671516
6482 2838679424
6483 2838684436
6484 2838693591
6485 2838699927
6486 2838704217
6487 2838711788
6488 2838718781
6489 2838723779
6490 2838729102
6491 2838735484
6492 2838748386
6493 2841851130
6494 2841858450
6495 2841863935
6496 2841869786
6497 2841946790
6498 2841949665
6499 2841958834
6500 2841971828
6501 2841974826
6502 2841983612
6503 2842038884
6504 2842048170
6505 2842081903
6506 2842115786
6507 2842122479
6508 2842129799
6509 2842134457
6510 2842149165
6511 2842156453
6512 2842162698
6513 2842167069
6514 2842175026
6515 2842179943
6516 2842186202
6517 2842191639
6518 2842195283
6519 2842203419
6520 2842210306
6521 2842215956
6522 2842222222
6523 2842228544
6524 2842236077
6525 2842241200
6526 2842250754
6527 2842253668
6528 2842263304
6529 2842270253
6530 2842278060
6531 2842283760
6532 2842289663
6533 2842295558
6534 2842310018
6535 2842311739
6536 2842319025
6537 2842344020
6538 2842369667
6539 2842376650
6540 2842381666
6541 2842389027
6542 2842396381
6543 2842407196
6544 2842414088
6545 2842420729
6546 2842425468
6547 2842434075
6548 2842440436
6549 2842444009
6550 2842450119
6551 2842468494
6552 2842475012
6553 2842491475
6554 2842499543
6555 2842520717
6556 2844319240
6557 2844461077
6558 2847936393
6559 2847946742
6560 2849079140
6561 2854897431
6562 2854921438
6563 2857514126
6564 2857519210
6565 2857528973
6566 2874598221
6567 2874605397
6568 2874615099
6569 2874627665
6570 2874632031
6571 2874652722
6572 2876763604
6573 2876764692
6574 2876778301
6575 2876809926
6576 2876825830
6577 2879082095
6578 2879090176
6579 2879105729
6580 2879110219
6581 2879135242
6582 2879145399
6583 2881368666
6584 2881673505
6585 2885372987
6586 2885381928
6587 2885390000
6588 2888384240
6589 2888393633
6590 2888424714
6591 2889039649
6592 2893070430
6593 2899794670
6594 2899850392
6595 2903731082
6596 2903749169
6597 2903772427
6598 2904673015
6599 2904694622
6600 2904702401
6601 2904714842
6602 2906607411
6603 2906618776
6604 2906629728
6605 2906643123
6606 2906649010
6607 2906666215
6608 2908742523
6609 2908760177
6610 2908780360
6611 2919076372
6612 2919118845
6613 2922365542
6614 2922374587
6615 2922391165
6616 2922400627
6617 2922430455
6618 2926758134
6619 2926764298
6620 2929618252
6621 2929632440
6622 2932790546
6623 2932799776
6624 2932806973
6625 2932810967
6626 2932823703
6627 2932830177
6628 2933011227
6629 2933016233
6630 2933576459
6631 2933580180
6632 2933591752
6633 2933598947
6634 2933602630
6635 2935609045
6636 2935622597
6637 2935631513
6638 2935642603
6639 2935653246
6640 2935660435
6641 2935668093
6642 2935676126
6643 2935686110
6644 2935701264
6645 2935705953
6646 2935714662
6647 2935725281
6648 2935732359
6649 2935741738
6650 2935752075
6651 2935766423
6652 2935771866
6653 2935778697
6654 2935788917
6655 2935795283
6656 2935802952
6657 2935814269
6658 2935822205
6659 2935831406
6660 2935838266
6661 2935847787
6662 2935860846
6663 2935869817
6664 2935878764
6665 2935886903
6666 2935898224
6667 2935905781
6668 2935908940
6669 2935919658
6670 2935926486
6671 2935934936
6672 2935943386
6673 2935951824
6674 2935960585
6675 2935967949
6676 2935978574
6677 2935987572
6678 2935994840
6679 2936003482
6680 2936016116
6681 2936024749
6682 2936031845
6683 2936039825
6684 2936049706
6685 2936060810
6686 2936370217
6687 2936377889
6688 2936384120
6689 2940557122
6690 2941511307
6691 2941519008
6692 2941526412
6693 2941532996
6694 2941539066
6695 2979090598
6696 2979096124
6697 2979101652
6698 2984510397
6699 2984518899
6700 2984605452
6701 2996896935
6702 3005411711
6703 3005480366
6704 3005484490
6705 3005510505
6706 3005587869
6707 3005599410
6708 3005715068
6709 3005722485
6710 639651751
6711 650843761
6712 8003573978
6713 8005277181
6714 8005287809
6715 8005289248
6716 8005304991
6717 8005313091
6718 8005381898
6719 8005388449
6720 8005397615
6721 8005436964
6722 8005466829
6723 8005503105
6724 8005562139
6725 8005567102
6726 8005576326
6727 8005625626
6728 8005630646
6729 8005675023
6730 8005689465
6731 8005701907
6732 8006929121
6733 8006940508
6734 8006967133
6735 8006980196
6736 8006986586
6737 8006995829
6738 8016522133
6739 8016529443
6740 8016534652
6741 8016547872
6742 8016554262
6743 8016562636
6744 8016572998
6745 8016577150
6746 8016591555
6747 8016600420
6748 8016610318
6749 8016626385
6750 8016640144
6751 8017063536
6752 8018165933
6753 8018182258
6754 8019534418
6755 8019545051
6756 8019553476
6757 8019556580
6758 8019582855
6759 8019590649
6760 8019600704
6761 8019617846
6762 8019628359
6763 8019634269
6764 8019645464
6765 8019671661
6766 8019684438
6767 8019690248
6768 8023682395
6769 8024483719
6770 8024505608
6771 8055746159
6772 8056375161
6773 8056383545
6774 8056673667
6775 8056686797
6776 8056691351
6777 8056968201
6778 8057878364

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

56

198

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ji0-assembly1.cif.gz_A crystal structure analysis of the abc transporter from thermotoga maritima 0.9172 1 238
1ji0-assembly1.cif.gz_A crystal structure analysis of the abc transporter from thermotoga maritima 0.9135 1 238
4yer-assembly1.cif.gz_B crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.8905 6 227
4yer-assembly1.cif.gz_A crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.8887 6 227
2awo-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) 0.8838 9 225
ID Description Score Start End Superfamily
af_Q58664_1_235_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9028 9 237 3.40.50.300
af_Q9TXV8_581_832_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8985 6 228 3.40.50.300
1ji0A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8969 7 238 3.40.50.300
af_P22731_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8926 6 238 3.40.50.300
af_P78363_1926_2175_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8888 6 228 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A1B1CKP2-F1-model_v4 ABC transporter ATP-binding protein 0.9903 6 238 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A1B1CKP2-F1-model_v4 ABC transporter ATP-binding protein 0.9819 6 238 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A132EYC1-F1-model_v4 ABC transporter ATP-binding protein 0.9722 8 238 GO:0005524
GO:0005886
GO:0015658
GO:0015807
GO:0016887
AF-A0A7W1WM10-F1-model_v4 ABC transporter ATP-binding protein 0.9688 9 238 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A7S7UT03-F1-model_v4 ABC transporter ATP-binding protein 0.9633 9 238 GO:0005524
GO:0015658
GO:0015807
GO:0016887

Map