F497323

General Info

Members Datasets Scaffolds Average Seq Length
3488 1535 2612 418

Family's Representative Sequence

Representative Sequence 3300053085|Ga0495619_0056935|Ga0495619_0056935_363_1673
Length 424
Sequence MTEHYFPPKFPSMCETEIVAAPRQRRESVGVRVGSGRGAVVVGXXAPVVVQSMTNTDTADVDSTVQQVAALARAGSELVRITVDRDEAAAAVPRIREKLDAMGISTPLVGDFHYIGHKLLADHPACAEALAKYRINPGNVGFKEKKDKQFGAIVELAIKHDKAVRIGANWGSLDQEMLTHLMDENAVATRPIDARLSAGRAEEIGLSRDRIILSAKVSGVQDLISVYRMVAQRSDYALHLGLTEAGMGSKGIVASSAALGILLQEGIGDTIRVSLTPEPGGDRTIEVQVAQEILQTMGFRTFVPLVAACPGCGRTTSTVFQELARDIQSLIRDRMPAWKKVYPGVETLNVAVMGCIVNGPGESKHADIGISLPGTGETPAAPVFIDGKKAMTLRGEGIAQEFEKIVEDYVAKRFGGEADASLPN

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
3 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
4 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
5 2508501050 Microvirga lupini Lut6 Isolate Nodule
6 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
7 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
8 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
9 2509276019 Ensifer aridi TW10 Isolate Nodule
10 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
11 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
12 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
13 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
14 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
15 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
16 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
17 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
18 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
19 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
20 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
21 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
22 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
23 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
24 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
25 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
26 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
27 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
28 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
29 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
30 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
31 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
32 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
33 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
34 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
35 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
36 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
37 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
38 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
39 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
40 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
41 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
42 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
43 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
44 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
45 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
46 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
47 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
48 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
49 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
50 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
51 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
52 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
53 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
54 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
55 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
56 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
57 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
58 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
59 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
60 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
61 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
62 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
63 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
64 2516143018 Ensifer sp. BR816 Isolate Nodule
65 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
66 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
67 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
68 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
69 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
70 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
71 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
72 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
73 2519899620 Rhizobium sp. Pop5 Isolate Nodule
74 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
75 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
76 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
77 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
78 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
79 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
80 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
81 2534681786 Brucella suis 92/29 Isolate Unclassified
82 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
83 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
84 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
85 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
86 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
87 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
88 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
89 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
90 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
91 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
92 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
93 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
94 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
95 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
96 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
97 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
98 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
99 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
100 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
101 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
102 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
103 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
104 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
105 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
106 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
107 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
108 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
109 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
110 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
111 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
112 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
113 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
114 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
115 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
116 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
117 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
118 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
119 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
120 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
121 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
122 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
123 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
124 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
125 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
126 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
127 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
128 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
129 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
130 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
131 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
132 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
133 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
134 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
135 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
136 2643221557 Ensifer sp. Root558 Isolate Unclassified
137 2643221558 Rhizobium sp. Root149 Isolate Unclassified
138 2643221568 Rhizobium sp. Root564 Isolate Unclassified
139 2643221580 Devosia sp. Root635 Isolate Unclassified
140 2643221582 Rhizobium sp. Root651 Isolate Unclassified
141 2643221591 Devosia sp. Root685 Isolate Unclassified
142 2643221594 Achromobacter sp. Root170 Isolate Unclassified
143 2643221599 Rhizobium sp. Root708 Isolate Unclassified
144 2643221607 Rhizobium sp. Root73 Isolate Unclassified
145 2643221610 Ensifer sp. Root74 Isolate Unclassified
146 2643221618 Ensifer sp. Root231 Isolate Unclassified
147 2643221621 Achromobacter sp. Root83 Isolate Unclassified
148 2643221626 Ensifer sp. Root31 Isolate Unclassified
149 2643221629 Devosia sp. Root105 Isolate Unclassified
150 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
151 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
152 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
153 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
154 2643221651 Afipia sp. Root123D2 Isolate Unclassified
155 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
156 2643221655 Ensifer sp. Root1252 Isolate Unclassified
157 2643221659 Ensifer sp. Root127 Isolate Unclassified
158 2643221662 Devosia sp. Root413D1 Isolate Unclassified
159 2643221668 Ensifer sp. Root423 Isolate Unclassified
160 2643221674 Devosia sp. Root436 Isolate Unclassified
161 2643221675 Ensifer sp. Root1298 Isolate Unclassified
162 2643221680 Ensifer sp. Root1312 Isolate Unclassified
163 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
164 2643221688 Rhizobium sp. Root482 Isolate Unclassified
165 2643221693 Rhizobium sp. Root491 Isolate Unclassified
166 2643221698 Ensifer sp. Root142 Isolate Unclassified
167 2643221712 Ensifer sp. Root258 Isolate Unclassified
168 2643221718 Rhizobium sp. Root268 Isolate Unclassified
169 2643221719 Rhizobium sp. Root274 Isolate Unclassified
170 2643221723 Ensifer sp. Root278 Isolate Unclassified
171 2643221726 Ensifer sp. Root954 Isolate Unclassified
172 2643221733 Bosea sp. Root381 Isolate Unclassified
173 2643221734 Bosea sp. Root670 Isolate Unclassified
174 2643221736 Bosea sp. Root483D1 Isolate Unclassified
175 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
176 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
177 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
178 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
179 2718217882 Rhizobium sp. N741 Isolate Nodule
180 2718217927 Rhizobium sp. N324 Isolate Nodule
181 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
182 2718218009 Rhizobium sp. N561 Isolate Nodule
183 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
184 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
185 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
186 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
187 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
188 2718218363 Rhizobium sp. N113 Isolate Nodule
189 2718218365 Rhizobium sp. N731 Isolate Nodule
190 2718218366 Rhizobium sp. N621 Isolate Nodule
191 2718218423 Rhizobium sp. N941 Isolate Nodule
192 2721755514 Rhizobium sp. N6212 Isolate Nodule
193 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
194 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
195 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
196 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
197 2721755809 Rhizobium sp. N541 Isolate Nodule
198 2721755810 Rhizobium sp. N871 Isolate Nodule
199 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
200 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
201 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
202 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
203 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
204 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
205 2728369365 Rhizobium sp. N1341 Isolate Nodule
206 2728369397 Rhizobium sp. N1314 Isolate Nodule
207 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
208 2738541293 Rhizobium sp. GV031 Isolate Unclassified
209 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
210 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
211 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
212 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
213 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
214 2751185800 Brucella pituitosa AA2 Isolate Unclassified
215 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
216 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
217 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
218 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
219 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
220 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
221 2773857925 Microvirga vignae BR3299 Isolate Unclassified
222 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
223 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
224 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
225 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
226 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
227 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
228 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
229 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
230 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
231 2791355199
232 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
233 2791355256 Rhizobium sp. M10 Isolate Nodule
234 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
235 2791355260 Rhizobium sp. L9 Isolate Nodule
236 2791355261 Rhizobium sp. J15 Isolate Nodule
237 2791355262 Rhizobium sp. M1 Isolate Nodule
238 2791355263 Rhizobium chutanense C5 Isolate Nodule
239 2791355264 Rhizobium sp. S9 Isolate Nodule
240 2791355265 Rhizobium sp. H4 Isolate Nodule
241 2791355266 Rhizobium sp. L43 Isolate Nodule
242 2791355267 Rhizobium sp. L18 Isolate Nodule
243 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
244 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
245 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
246 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
247 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
248 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
249 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
250 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
251 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
252 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
253 2802429633 Rhizobium anhuiense J3 Isolate Nodule
254 2802429634 Rhizobium anhuiense S10 Isolate Nodule
255 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
256 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
257 2802429637 Rhizobium anhuiense C15 Isolate Nodule
258 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
259 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
260 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
261 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
262 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
263 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
264 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
265 2818991467 Bosea vestrisii 3192 Isolate Unclassified
266 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
267 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
268 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
269 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
270 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
271 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
272 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
273 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
274 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
275 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
276 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
277 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
278 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
279 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
280 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
281 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
282 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
283 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
284 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
285 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
286 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
287 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
288 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
289 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
290 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
291 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
292 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
293 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
294 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
295 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
296 2838048938 Rhizobium pisi 27/80 Isolate Nodule
297 2838061910 Rhizobium phaseoli L15 Isolate Nodule
298 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
299 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
300 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
301 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
302 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
303 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
304 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
305 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
306 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
307 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
308 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
309 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
310 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
311 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
312 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
313 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
314 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
315 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
316 2841760612 Bosea sp. Tri-49 Isolate Nodule
317 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
318 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
319 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
320 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
321 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
322 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
323 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
324 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
325 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
326 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
327 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
328 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
329 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
330 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
331 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
332 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
333 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
334 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
335 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
336 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
337 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
338 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
339 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
340 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
341 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
342 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
343 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
344 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
345 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
346 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
347 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
348 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
349 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
350 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
351 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
352 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
353 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
354 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
355 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
356 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
357 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
358 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
359 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
360 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
361 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
362 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
363 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
364 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
365 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
366 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
367 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
368 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
369 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
370 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
371 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
372 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
373 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
374 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
375 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
376 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
377 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
378 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
379 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
380 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
381 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
382 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
383 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
384 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
385 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
386 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
387 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
388 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
389 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
390 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
391 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
392 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
393 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
394 2844104063 Bosea sp. Tri-39 Isolate Nodule
395 2844163670 Ensifer sp. 1H6 Isolate Unclassified
396 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
397 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
398 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
399 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
400 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
401 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
402 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
403 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
404 2851182111 Bosea sp. Tri-44 Isolate Nodule
405 2851246043 Bosea sp. Tri-54 Isolate Nodule
406 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
407 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
408 2854911287 Brucella lupini LUP21 Isolate Unclassified
409 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
410 2855730933 Achromobacter sp. HZ28 Isolate Nodule
411 2855767633 Achromobacter sp. HZ34 Isolate Nodule
412 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
413 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
414 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
415 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
416 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
417 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
418 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
419 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
420 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
421 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
422 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
423 2858950400 Achromobacter sp. K91 Isolate Unclassified
424 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
425 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
426 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
427 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
428 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
429 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
430 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
431 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
432 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
433 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
434 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
435 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
436 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
437 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
438 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
439 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
440 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
441 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
442 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
443 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
444 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
445 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
446 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
447 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
448 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
449 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
450 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
451 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
452 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
453 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
454 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
455 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
456 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
457 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
458 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
459 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
460 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
461 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
462 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
463 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
464 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
465 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
466 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
467 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
468 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
469 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
470 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
471 2904699407
472 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
473 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
474 2906610324
475 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
476 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
477 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
478 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
479 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
480 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
481 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
482 2909042592 Labrys sp. LIt4 Isolate Nodule
483 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
484 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
485 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
486 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
487 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
488 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
489 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
490 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
491 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
492 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
493 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
494 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
495 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
496 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
497 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
498 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
499 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
500 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
501 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
502 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
503 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
504 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
505 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
506 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
507 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
508 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
509 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
510 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
511 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
512 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
513 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
514 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
515 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
516 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
517 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
518 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
519 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
520 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
521 2922368715
522 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
523 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
524 2922425934
525 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
526 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
527 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
528 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
529 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
530 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
531 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
532 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
533 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
534 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
535 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
536 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
537 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
538 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
539 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
540 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
541 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
542 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
543 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
544 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
545 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
546 2932401849 Devosia sp. 2618 Isolate Rhizosphere
547 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
548 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
549 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
550 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
551 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
552 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
553 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
554 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
555 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
556 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
557 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
558 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
559 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
560 2933599457 Rhizobium phaseoli M3 Isolate Nodule
561 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
562 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
563 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
564 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
565 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
566 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
567 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
568 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
569 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
570 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
571 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
572 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
573 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
574 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
575 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
576 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
577 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
578 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
579 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
580 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
581 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
582 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
583 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
584 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
585 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
586 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
587 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
588 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
589 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
590 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
591 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
592 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
593 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
594 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
595 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
596 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
597 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
598 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
599 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
600 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
601 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
602 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
603 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
604 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
605 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
606 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
607 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
608 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
609 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
610 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
611 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
612 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
613 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
614 2936381700 Rhizobium chutanense C16 Isolate Unclassified
615 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
616 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
617 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
618 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
619 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
620 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
621 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
622 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
623 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
624 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
625 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
626 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
627 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
628 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
629 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
630 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
631 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
632 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
633 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
634 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
635 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
636 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
637 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
638 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
639 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
640 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
641 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
642 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
643 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
644 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
645 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
646 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
647 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
648 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
649 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
650 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
651 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
652 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
653 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
654 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
655 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
656 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
657 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
658 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
659 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
660 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
661 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
662 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
663 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
664 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
665 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
666 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
667 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
668 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
669 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
670 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
671 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
672 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
673 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
674 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
675 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
676 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
677 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
678 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
679 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
680 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
681 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
682 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
683 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
684 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
685 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
686 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
687 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
688 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
689 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
690 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
691 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
692 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
693 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
694 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
695 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
696 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
697 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
698 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
699 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
700 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
701 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
702 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
703 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
704 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
705 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
706 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
707 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
708 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
709 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
710 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
711 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
712 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
713 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
714 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
715 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
716 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
717 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
718 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
719 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
720 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
721 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
722 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
723 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
724 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
725 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
726 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
727 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
728 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
729 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
730 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
731 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
732 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
733 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
734 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
735 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
736 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
737 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
738 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
739 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
740 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
741 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
742 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
743 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
744 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
745 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
746 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
747 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
748 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
749 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
750 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
751 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
752 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
753 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
754 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
755 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
756 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
757 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
758 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
759 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
760 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
761 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
762 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
763 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
764 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
765 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
766 2996887358 Rhizobium sp. R711 Isolate Nodule
767 2996893221 Rhizobium sp. R635 Isolate Nodule
768 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
769 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
770 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
771 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
772 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
773 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
774 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
775 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
776 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
777 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
778 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
779 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
780 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
781 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
782 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
783 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
784 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
785 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
786 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
787 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
788 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
789 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
790 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
791 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
792 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
793 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
794 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
795 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
796 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
797 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
798 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
799 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
800 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
801 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
802 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
803 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
804 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
805 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
806 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
807 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
808 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
809 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
810 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
811 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
812 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
813 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
814 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
815 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
816 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
817 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
818 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
819 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
820 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
821 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
822 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
823 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
824 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
825 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
826 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
827 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
828 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
829 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
830 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
831 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
832 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
833 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
834 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
835 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
836 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
837 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
838 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
839 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
840 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
841 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
842 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
843 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
844 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
845 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
846 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
847 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
848 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
849 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
850 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
851 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
852 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
853 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
854 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
855 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
856 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
857 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
858 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
859 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
860 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
861 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
862 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
863 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
864 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
865 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
866 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
867 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
868 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
869 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
870 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
871 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
872 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
873 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
874 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
875 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
876 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
877 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
878 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
879 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
880 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
881 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
882 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
883 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
884 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
885 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
886 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
887 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
888 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
889 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
890 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
891 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
892 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
893 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
894 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
895 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
896 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
897 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
898 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
899 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
900 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
901 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
902 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
903 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
904 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
905 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
906 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
907 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
908 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
909 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
910 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
911 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
912 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
913 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
914 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
915 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
916 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
917 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
918 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
919 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
920 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
921 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
922 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
923 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
924 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
925 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
926 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
927 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
928 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
929 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
930 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
931 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
932 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
933 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
934 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
935 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
936 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
937 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
938 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
939 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
940 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
941 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
942 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
943 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
944 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
945 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
946 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
947 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
948 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
949 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
950 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
951 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
952 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
953 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
954 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
955 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
956 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
957 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
958 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
959 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
960 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
961 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
962 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
963 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
964 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
965 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
966 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
967 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
968 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
969 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
970 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
971 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
972 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
973 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
974 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
975 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
976 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
977 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
978 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
979 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
980 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
981 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
982 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
983 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
984 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
985 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
986 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
987 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
988 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
989 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
990 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
991 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
992 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
993 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
994 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
995 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
996 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
997 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
998 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
999 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
1000 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
1001 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
1002 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
1003 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
1004 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
1005 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
1006 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
1007 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
1008 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
1009 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
1010 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
1011 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
1012 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
1013 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
1014 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
1015 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
1016 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
1017 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
1018 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
1019 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
1020 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
1021 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
1022 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1023 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1024 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1025 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
1026 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1027 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
1028 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1029 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
1030 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1031 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1032 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1033 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
1034 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1035 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1036 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
1037 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1038 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1039 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1040 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1041 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
1042 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
1043 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1044 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1045 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
1046 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1047 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1048 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1049 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1050 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1051 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1052 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1053 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1054 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1055 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1056 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1057 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1058 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
1059 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1060 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
1061 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1062 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1063 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1064 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
1065 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
1066 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1067 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
1068 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1069 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1070 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1071 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
1072 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1073 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
1074 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
1075 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
1076 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1077 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1078 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
1079 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
1080 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
1081 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
1082 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
1083 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
1084 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1085 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
1086 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
1087 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
1088 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
1089 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
1090 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
1091 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
1092 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
1093 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
1094 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
1095 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
1096 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
1097 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
1098 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
1099 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1100 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
1101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
1102 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
1103 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
1104 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
1105 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
1106 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
1107 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
1108 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
1109 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
1110 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
1111 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
1112 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
1113 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
1114 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
1115 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
1116 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
1117 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
1118 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
1119 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
1120 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
1121 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
1122 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
1123 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
1124 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
1125 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
1126 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
1127 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
1128 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
1129 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
1130 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
1131 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
1132 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
1133 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
1134 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
1135 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
1136 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
1137 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
1138 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
1139 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
1140 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
1141 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
1142 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
1143 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
1144 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
1145 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
1146 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
1147 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
1148 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
1149 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
1150 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
1151 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
1152 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
1153 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
1154 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
1155 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
1156 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
1157 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
1158 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
1159 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
1160 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
1161 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
1162 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
1163 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
1164 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
1165 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
1166 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
1167 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
1168 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
1169 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
1170 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
1171 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
1172 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
1173 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
1174 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
1175 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
1176 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
1177 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
1178 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
1179 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
1180 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
1181 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
1182 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
1183 3300036242 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
1184 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
1185 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
1186 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
1187 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
1188 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
1189 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
1190 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
1191 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
1192 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
1193 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
1194 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
1195 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
1196 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
1197 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
1198 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
1199 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
1200 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
1201 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
1202 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
1203 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
1204 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
1205 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
1206 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
1207 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
1208 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
1209 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
1210 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
1211 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
1212 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
1213 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
1214 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
1215 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
1216 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
1217 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
1218 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
1219 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
1220 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
1221 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
1222 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
1223 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
1224 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
1225 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
1226 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
1227 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
1228 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
1229 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
1230 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
1231 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
1232 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
1233 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
1234 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
1235 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
1236 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
1237 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
1238 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
1239 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
1240 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
1241 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
1242 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
1243 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
1244 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
1245 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
1246 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
1247 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
1248 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
1249 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
1250 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
1251 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
1252 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
1253 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
1254 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
1255 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
1256 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
1257 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
1258 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
1259 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
1260 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
1261 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
1262 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
1263 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
1264 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
1265 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
1266 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
1267 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
1268 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
1269 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
1270 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
1271 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
1272 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
1273 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
1274 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
1275 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
1276 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
1277 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
1278 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
1279 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
1280 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
1281 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
1282 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
1283 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
1284 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
1285 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
1286 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
1287 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
1288 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
1289 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
1290 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
1291 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
1292 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
1293 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
1294 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
1295 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
1296 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
1297 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
1298 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
1299 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
1300 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
1301 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
1302 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
1303 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
1304 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
1305 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
1306 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
1307 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
1308 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
1309 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
1310 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
1311 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
1312 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
1313 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
1314 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
1315 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
1316 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
1317 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
1318 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
1319 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
1320 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
1321 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
1322 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
1323 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
1324 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
1325 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
1326 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
1327 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
1328 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
1329 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
1330 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
1331 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
1332 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
1333 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
1334 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
1335 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
1336 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
1337 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
1338 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
1339 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
1340 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
1341 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
1342 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
1343 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
1344 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
1345 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
1346 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
1347 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
1348 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
1349 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
1350 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
1351 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
1352 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
1353 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
1354 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
1355 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
1356 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
1357 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
1358 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
1359 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
1360 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
1361 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
1362 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
1363 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
1364 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
1365 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
1366 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
1367 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
1368 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
1369 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
1370 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
1371 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
1372 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
1373 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
1374 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
1375 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
1376 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
1377 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
1378 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
1379 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
1380 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
1381 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
1382 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
1383 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
1384 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
1385 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
1386 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
1387 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
1388 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
1389 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
1390 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
1391 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
1392 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
1393 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
1394 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
1395 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
1396 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
1397 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
1398 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
1399 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
1400 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
1401 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
1402 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
1403 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
1404 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
1405 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
1406 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
1407 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
1408 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
1409 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
1410 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
1411 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
1412 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
1413 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
1414 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
1415 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
1416 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
1417 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
1418 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
1419 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
1420 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
1421 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
1422 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
1423 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
1424 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
1425 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
1426 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
1427 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
1428 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
1429 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
1430 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
1431 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
1432 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
1433 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
1434 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
1435 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
1436 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
1437 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
1438 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
1439 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
1440 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
1441 641522639 Methylobacterium sp. 4-46 Isolate Nodule
1442 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
1443 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
1444 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
1445 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
1446 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
1447 8002060224 Methylocystis sp. Sn-Cys Isolate Unclassified
1448 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
1449 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
1450 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
1451 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
1452 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
1453 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
1454 8005258706 Rhizobium sp. R693 Isolate Nodule
1455 8005275841 Rhizobium sp. N4311 Isolate Nodule
1456 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
1457 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
1458 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
1459 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
1460 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
1461 8005321885 Rhizobium sp. R72 Isolate Nodule
1462 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
1463 8005382845 Rhizobium sp. R634 Isolate Nodule
1464 8005395548 Rhizobium sp. R339 Isolate Nodule
1465 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
1466 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
1467 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
1468 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
1469 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
1470 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
1471 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
1472 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
1473 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
1474 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
1475 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
1476 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
1477 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
1478 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
1479 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
1480 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
1481 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
1482 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
1483 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
1484 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
1485 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
1486 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
1487 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
1488 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
1489 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
1490 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
1491 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
1492 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
1493 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
1494 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
1495 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
1496 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
1497 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
1498 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
1499 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
1500 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
1501 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
1502 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
1503 8018176218 Rhizobium sp. N122 Isolate Nodule
1504 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
1505 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
1506 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
1507 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
1508 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
1509 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
1510 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
1511 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
1512 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
1513 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
1514 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
1515 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
1516 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
1517 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
1518 8024501048 Rhizobium sp. H4 Isolate Nodule
1519 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
1520 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
1521 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
1522 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
1523 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
1524 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere
1525 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
1526 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
1527 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
1528 8056382006 Rhizobium croatiense 13T Isolate Nodule
1529 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
1530 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
1531 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
1532 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
1533 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule
1534 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
1535 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 74.88
Metatranscriptomes 0.11
Isolates 25.01

Biome Distribution

Category Percentage (%)
Aerial Root 0.14
Bulb 0
Endosphere 10.21
Nodule 18.29
Rhizoplane 5.79
Rhizosphere 55.3
Stem 0
Stem Tuber 0
Unclassified 10.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214939646 2209111006 Bacteria 6311
2 ARcpr5oldR_c000422 3300000041 Bacteria 5699
3 ARSoilYngRDRAFT_c00290 3300000042 Bacteria 7362
4 ARSoilOldRDRAFT_c000309 3300000044 Bacteria 6623
5 ARCol0yngRDRAFT_1000109 3300000652 Bacteria 15268
6 JGI24746J21847_1000682 3300001977 Bacteria 5202
7 JGI24747J21853_1000356 3300001978 Bacteria 2680
8 JGI24740J21852_10000317 3300001979 Bacteria 20540
9 JGI24740J21852_10001515 3300001979 Bacteria 10677
10 JGI24739J22299_10000366 3300001989 Bacteria 15485
11 JGI24739J22299_10014257 3300001989 Bacteria 2893
12 JGI24739J22299_10021252 3300001989 Bacteria 2312
13 JGI24737J22298_10017133 3300001990 Bacteria 2336
14 JGI24737J22298_10020002 3300001990 Bacteria 2140
15 JGI24737J22298_10020559 3300001990 Bacteria 2108
16 JGI24743J22301_10010100 3300001991 Bacteria 1681
17 JGI24750J21931_1000233 3300002070 Bacteria 9448
18 JGI24745J21846_1000067 3300002073 Bacteria 7229
19 JGI24738J21930_10000230 3300002075 Bacteria 15194
20 JGI24035J26624_1004197 3300002126 Bacteria 1365
21 JGI24033J26618_1000616 3300002155 Bacteria 3419
22 JGI25155J39150_1000004 3300002704 Bacteria 269098
23 JGI25156J39149_1000015 3300002705 Bacteria 181949
24 JGI25162J39368_1000199 3300002737 Bacteria 63139
25 JGI25162J39368_1000207 3300002737 Bacteria 62123
26 JGI25154J39366_1000026 3300002738 Bacteria 200613
27 JGI25158J39367_1000004 3300002739 Bacteria 69006
28 JGI25158J39367_1004769 3300002739 Bacteria 2021
29 JGI25157J39369_1000005 3300002741 Bacteria 269089
30 JGI25152J39213_1000550 3300002773 Bacteria 20595
31 JGI25152J39213_1000815 3300002773 Bacteria 15561
32 JGI25152J39213_1001458 3300002773 Bacteria 10140
33 JGI25152J39213_1005316 3300002773 Bacteria 3796
34 JGI25150J39212_1000171 3300002774 Bacteria 36637
35 JGI25150J39212_1000433 3300002774 Bacteria 18809
36 JGI25150J39212_1001193 3300002774 Bacteria 7700
37 JGI25159J45721_1000017 3300002987 Bacteria 136127
38 JGI25159J45721_1001077 3300002987 Bacteria 11669
39 JGI25159J45721_1001645 3300002987 Bacteria 9087
40 JGI25159J45721_1015273 3300002987 Bacteria 1691
41 JGI25151J46595_10000034 3300003187 Bacteria 192271
42 JGI25151J46595_10000039 3300003187 Bacteria 180051
43 JGI25151J46595_10000350 3300003187 Bacteria 49262
44 JGI25151J46595_10004445 3300003187 Bacteria 7419
45 JGI25151J46595_10005968 3300003187 Bacteria 6202
46 JGI25151J46595_10025448 3300003187 Bacteria 2408
47 JGI25406J46586_10000037 3300003203 Bacteria 60422
48 JGI25406J46586_10028126 3300003203 Bacteria 2145
49 JGI25165J46597_1000307 3300003214 Bacteria 59794
50 JGI25165J46597_1002547 3300003214 Bacteria 5685
51 JGI25153J46596_10003425 3300003215 Bacteria 8881
52 JGI25153J46596_10005782 3300003215 Bacteria 6434
53 JGI25153J46596_10008355 3300003215 Bacteria 4962
54 JGI25153J46596_10012088 3300003215 Bacteria 3761
55 JGI25153J46596_10019745 3300003215 Bacteria 2570
56 JGI25160J50197_1000027 3300003354 Bacteria 182809
57 JGI25160J50197_1000109 3300003354 Bacteria 77318
58 JGI25160J50197_1000493 3300003354 Bacteria 23579
59 JGI25160J50197_1000586 3300003354 Bacteria 20466
60 JGI25161J50226_1000011 3300003374 Bacteria 210140
61 JGI25161J50226_1000038 3300003374 Bacteria 131804
62 JGI25161J50226_1000160 3300003374 Bacteria 47045
63 JGI25161J50226_1002409 3300003374 Bacteria 4813
64 JGI25161J50226_1002572 3300003374 Bacteria 4575
65 JGI25161J50226_1006982 3300003374 Bacteria 1965
66 Ga0006562J51391_1017287 3300003578 Bacteria 3250
67 Ga0006562J51391_1019599 3300003578 Bacteria 2263
68 Ga0055533_1000006 3300003756 Bacteria 635559
69 Ga0055525_1000677 3300003759 Bacteria 12912
70 Ga0055526_1000090 3300003771 Bacteria 83051
71 Ga0055526_1000361 3300003771 Bacteria 36774
72 Ga0055526_1001895 3300003771 Bacteria 14505
73 Ga0055526_1002754 3300003771 Bacteria 11662
74 Ga0055526_1004369 3300003771 Bacteria 8528
75 Ga0055526_1004469 3300003771 Bacteria 8385
76 Ga0055526_1009807 3300003771 Bacteria 4551
77 Ga0055537_1000143 3300003773 Bacteria 53762
78 Ga0055537_1005109 3300003773 Bacteria 3584
79 Ga0055524_1000104 3300003775 Bacteria 104549
80 Ga0055524_1000782 3300003775 Bacteria 21292
81 Ga0055524_1002424 3300003775 Bacteria 9620
82 Ga0055524_1006330 3300003775 Bacteria 5146
83 Ga0055524_1006944 3300003775 Bacteria 4867
84 Ga0055524_1012395 3300003775 Bacteria 3273
85 Ga0055536_1000711 3300003781 Bacteria 22317
86 Ga0055534_1000226 3300003784 Bacteria 40702
87 Ga0055534_1002614 3300003784 Bacteria 6135
88 Ga0055528_1000543 3300003790 Bacteria 28761
89 Ga0055528_1002580 3300003790 Bacteria 9594
90 Ga0055528_1002586 3300003790 Bacteria 9582
91 Ga0055528_1003048 3300003790 Bacteria 8628
92 Ga0055528_1003134 3300003790 Bacteria 8482
93 Ga0055528_1005705 3300003790 Bacteria 5741
94 Ga0055528_1020707 3300003790 Bacteria 2123
95 Ga0055530_10005385 3300003791 Bacteria 6115
96 Ga0055540_1000945 3300003792 Bacteria 18897
97 Ga0055540_1016785 3300003792 Bacteria 2067
98 Ga0055531_10003856 3300003794 Bacteria 9386
99 Ga0055531_10012212 3300003794 Bacteria 4060
100 Ga0055531_10029233 3300003794 Bacteria 1881
101 Ga0058692_1001723 3300003856 Bacteria 7799
102 Ga0058692_1001864 3300003856 Bacteria 7399
103 Ga0055543_1000071 3300004625 Bacteria 91797
104 Ga0055543_1000106 3300004625 Bacteria 73351
105 Ga0055543_1000307 3300004625 Bacteria 34189
106 Ga0055543_1001699 3300004625 Bacteria 8316
107 Ga0055543_1002954 3300004625 Bacteria 5295
108 Ga0065165_1000014 3300005262 Bacteria 292366
109 Ga0065165_1000122 3300005262 Bacteria 132524
110 Ga0065165_1000135 3300005262 Bacteria 127785
111 Ga0065165_1002898 3300005262 Bacteria 13161
112 Ga0065165_1005783 3300005262 Bacteria 6760
113 Ga0065165_1010156 3300005262 Bacteria 4111
114 Ga0065704_10090546 3300005289 Bacteria 2779
115 Ga0065712_10068383 3300005290 Bacteria 11044
116 Ga0065712_10086212 3300005290 Bacteria 2648
117 Ga0065715_10000448 3300005293 Bacteria 14743
118 Ga0065715_10016705 3300005293 Bacteria 4415
119 Ga0070658_10025059 3300005327 Bacteria 4782
120 Ga0070658_10099819 3300005327 Bacteria 2399
121 Ga0070658_10215013 3300005327 Bacteria 1624
122 Ga0070676_10000318 3300005328 Bacteria 21810
123 Ga0070676_10024392 3300005328 Bacteria 3406
124 Ga0070676_10046326 3300005328 Bacteria 2536
125 Ga0070676_10123609 3300005328 Bacteria 1628
126 Ga0070683_100000075 3300005329 Bacteria 67998
127 Ga0070683_100209871 3300005329 Bacteria 1850
128 Ga0070690_100002180 3300005330 Bacteria 10461
129 Ga0070690_100027937 3300005330 Bacteria 3491
130 Ga0070690_100031212 3300005330 Bacteria 3317
131 Ga0070690_100032811 3300005330 Bacteria 3246
132 Ga0070670_100000061 3300005331 Bacteria 113254
133 Ga0070670_100004993 3300005331 Bacteria 11163
134 Ga0070670_100012349 3300005331 Bacteria 7308
135 Ga0070670_100034700 3300005331 Bacteria 4341
136 Ga0070677_10018292 3300005333 Bacteria 2522
137 Ga0068869_100000395 3300005334 Bacteria 23763
138 Ga0068869_100159483 3300005334 Bacteria 1755
139 Ga0068869_100229192 3300005334 Bacteria 1475
140 Ga0070666_10009311 3300005335 Bacteria 6118
141 Ga0070666_10026117 3300005335 Bacteria 3813
142 Ga0070680_100001357 3300005336 Bacteria 17696
143 Ga0070680_100006931 3300005336 Bacteria 8633
144 Ga0070680_100016861 3300005336 Bacteria 5749
145 Ga0070680_100173223 3300005336 Bacteria 1816
146 Ga0070682_100000144 3300005337 Bacteria 56618
147 Ga0070682_100018545 3300005337 Bacteria 4072
148 Ga0068868_100007459 3300005338 Bacteria 7790
149 Ga0068868_100011607 3300005338 Bacteria 6417
150 Ga0070660_100001798 3300005339 Bacteria 14720
151 Ga0070660_100008772 3300005339 Bacteria 7080
152 Ga0070660_100025451 3300005339 Bacteria 4399
153 Ga0070660_100026571 3300005339 Bacteria 4311
154 Ga0070689_100000388 3300005340 Bacteria 25778
155 Ga0070689_100005891 3300005340 Bacteria 8428
156 Ga0070689_100033578 3300005340 Bacteria 3910
157 Ga0070689_100086468 3300005340 Bacteria 2466
158 Ga0070689_100104347 3300005340 Bacteria 2247
159 Ga0070689_100132734 3300005340 Bacteria 1997
160 Ga0070689_100153105 3300005340 Bacteria 1860
161 Ga0070691_10000600 3300005341 Bacteria 13799
162 Ga0070691_10009340 3300005341 Bacteria 4480
163 Ga0070691_10019727 3300005341 Bacteria 3113
164 Ga0070691_10060814 3300005341 Bacteria 1816
165 Ga0070691_10076519 3300005341 Bacteria 1632
166 Ga0070691_10077573 3300005341 Bacteria 1622
167 Ga0070691_10087360 3300005341 Bacteria 1533
168 Ga0070687_100000016 3300005343 Bacteria 55051
169 Ga0070687_100006064 3300005343 Bacteria 4931
170 Ga0070687_100013352 3300005343 Bacteria 3659
171 Ga0070687_100087824 3300005343 Bacteria 1712
172 Ga0070661_100000249 3300005344 Bacteria 44246
173 Ga0070661_100048736 3300005344 Bacteria 3101
174 Ga0070661_100051352 3300005344 Bacteria 3018
175 Ga0070661_100192612 3300005344 Bacteria 1555
176 Ga0070692_10003282 3300005345 Bacteria 6528
177 Ga0070668_100001568 3300005347 Bacteria 16513
178 Ga0070668_100027231 3300005347 Bacteria 4339
179 Ga0070668_100032024 3300005347 Bacteria 4000
180 Ga0070668_100114249 3300005347 Bacteria 2151
181 Ga0070668_100165771 3300005347 Bacteria 1795
182 Ga0070669_100000145 3300005353 Bacteria 63377
183 Ga0070669_100033079 3300005353 Bacteria 3737
184 Ga0070669_100179938 3300005353 Bacteria 1653
185 Ga0070669_100242768 3300005353 Bacteria 1432
186 Ga0070675_100000081 3300005354 Bacteria 56087
187 Ga0070675_100067254 3300005354 Bacteria 2965
188 Ga0070675_100109969 3300005354 Bacteria 2330
189 Ga0070675_100234284 3300005354 Bacteria 1602
190 Ga0070671_100000144 3300005355 Bacteria 46097
191 Ga0070671_100015298 3300005355 Bacteria 6196
192 Ga0070674_100000102 3300005356 Bacteria 39445
193 Ga0070674_100002874 3300005356 Bacteria 9520
194 Ga0070674_100033570 3300005356 Bacteria 3418
195 Ga0070674_100092501 3300005356 Bacteria 2186
196 Ga0070674_100098257 3300005356 Bacteria 2128
197 Ga0070674_100104402 3300005356 Bacteria 2071
198 Ga0070673_100000068 3300005364 Bacteria 43540
199 Ga0070673_100016081 3300005364 Bacteria 5279
200 Ga0070673_100147539 3300005364 Bacteria 1989
201 Ga0070673_100273055 3300005364 Bacteria 1480
202 Ga0070688_100001094 3300005365 Bacteria 13546
203 Ga0070688_100001524 3300005365 Bacteria 11566
204 Ga0070688_100004421 3300005365 Bacteria 7313
205 Ga0070688_100009682 3300005365 Bacteria 5284
206 Ga0070688_100017211 3300005365 Bacteria 4146
207 Ga0070688_100066334 3300005365 Bacteria 2296
208 Ga0070659_100000144 3300005366 Bacteria 55051
209 Ga0070659_100007211 3300005366 Bacteria 8068
210 Ga0070659_100011030 3300005366 Bacteria 6675
211 Ga0070659_100019746 3300005366 Bacteria 5113
212 Ga0070659_100036270 3300005366 Bacteria 3843
213 Ga0070659_100040574 3300005366 Bacteria 3638
214 Ga0070659_100059306 3300005366 Bacteria 3022
215 Ga0070667_100001663 3300005367 Bacteria 19857
216 Ga0070667_100002536 3300005367 Bacteria 15895
217 Ga0070667_100014994 3300005367 Bacteria 6404
218 Ga0070667_100033624 3300005367 Bacteria 4287
219 Ga0070709_10000008 3300005434 Bacteria 181034
220 Ga0070709_10001411 3300005434 Bacteria 13022
221 Ga0070709_10001813 3300005434 Bacteria 11578
222 Ga0070709_10005023 3300005434 Bacteria 7150
223 Ga0070714_100003683 3300005435 Bacteria 11470
224 Ga0070714_100009803 3300005435 Bacteria 7550
225 Ga0070714_100021478 3300005435 Bacteria 5282
226 Ga0070714_100021907 3300005435 Bacteria 5232
227 Ga0070714_100082383 3300005435 Bacteria 2803
228 Ga0070714_100110299 3300005435 Bacteria 2435
229 Ga0070713_100005168 3300005436 Bacteria 8885
230 Ga0070713_100012693 3300005436 Bacteria 6190
231 Ga0070713_100080567 3300005436 Bacteria 2776
232 Ga0070713_100083304 3300005436 Bacteria 2734
233 Ga0070713_100152730 3300005436 Bacteria 2055
234 Ga0070710_10000787 3300005437 Bacteria 15188
235 Ga0070710_10006112 3300005437 Bacteria 5761
236 Ga0070710_10028328 3300005437 Bacteria 2995
237 Ga0070701_10001040 3300005438 Bacteria 10116
238 Ga0070701_10100428 3300005438 Bacteria 1602
239 Ga0070711_100001385 3300005439 Bacteria 13233
240 Ga0070711_100002026 3300005439 Bacteria 11416
241 Ga0070711_100004812 3300005439 Bacteria 8009
242 Ga0070711_100017221 3300005439 Bacteria 4598
243 Ga0070711_100019865 3300005439 Bacteria 4319
244 Ga0070711_100034302 3300005439 Bacteria 3384
245 Ga0070705_100000222 3300005440 Bacteria 33817
246 Ga0070705_100003053 3300005440 Bacteria 8249
247 Ga0070705_100012761 3300005440 Bacteria 4281
248 Ga0070705_100034860 3300005440 Bacteria 2817
249 Ga0070700_100000100 3300005441 Bacteria 54110
250 Ga0070700_100016266 3300005441 Bacteria 4236
251 Ga0070700_100023748 3300005441 Bacteria 3590
252 Ga0070700_100044425 3300005441 Bacteria 2736
253 Ga0070700_100045417 3300005441 Bacteria 2710
254 Ga0070700_100052907 3300005441 Bacteria 2533
255 Ga0070694_100000041 3300005444 Bacteria 59039
256 Ga0070694_100010080 3300005444 Bacteria 5811
257 Ga0070694_100012093 3300005444 Bacteria 5359
258 Ga0070694_100097543 3300005444 Bacteria 2074
259 Ga0070708_100016844 3300005445 Bacteria 6076
260 Ga0070708_100031035 3300005445 Bacteria 4623
261 Ga0070708_100284460 3300005445 Bacteria 1556
262 Ga0070663_100000071 3300005455 Bacteria 44246
263 Ga0070663_100013319 3300005455 Bacteria 5239
264 Ga0070663_100015859 3300005455 Bacteria 4876
265 Ga0070663_100019686 3300005455 Bacteria 4456
266 Ga0070663_100071295 3300005455 Bacteria 2528
267 Ga0070663_100092346 3300005455 Bacteria 2244
268 Ga0070663_100130358 3300005455 Bacteria 1909
269 Ga0070663_100222150 3300005455 Bacteria 1483
270 Ga0070678_100000093 3300005456 Bacteria 34270
271 Ga0070678_100004826 3300005456 Bacteria 7697
272 Ga0070678_100105108 3300005456 Bacteria 2197
273 Ga0070678_100120982 3300005456 Bacteria 2064
274 Ga0070662_100005696 3300005457 Bacteria 7972
275 Ga0070662_100008556 3300005457 Bacteria 6675
276 Ga0070662_100013628 3300005457 Bacteria 5413
277 Ga0070662_100243701 3300005457 Bacteria 1442
278 Ga0070681_10000485 3300005458 Bacteria 32421
279 Ga0070681_10011156 3300005458 Bacteria 8891
280 Ga0070681_10025654 3300005458 Bacteria 5928
281 Ga0070681_10030392 3300005458 Bacteria 5420
282 Ga0070681_10063269 3300005458 Bacteria 3672
283 Ga0070681_10078430 3300005458 Bacteria 3260
284 Ga0068867_100021542 3300005459 Bacteria 4599
285 Ga0068867_100028591 3300005459 Bacteria 4015
286 Ga0068867_100180076 3300005459 Bacteria 1680
287 Ga0070685_10000918 3300005466 Bacteria 15855
288 Ga0070685_10006291 3300005466 Bacteria 6051
289 Ga0070706_100254940 3300005467 Bacteria 1638
290 Ga0070707_100037010 3300005468 Bacteria 4657
291 Ga0070698_100009726 3300005471 Bacteria 10279
292 Ga0070699_100109575 3300005518 Bacteria 2423
293 Ga0070679_100002856 3300005530 Bacteria 15694
294 Ga0070679_100010661 3300005530 Bacteria 8721
295 Ga0070679_100033033 3300005530 Bacteria 5121
296 Ga0070679_100036379 3300005530 Bacteria 4884
297 Ga0070679_100053137 3300005530 Bacteria 4033
298 Ga0070679_100158535 3300005530 Bacteria 2237
299 Ga0070679_100207363 3300005530 Bacteria 1924
300 Ga0070684_100000099 3300005535 Bacteria 56087
301 Ga0070684_100075729 3300005535 Bacteria 2969
302 Ga0070684_100083030 3300005535 Bacteria 2838
303 Ga0070684_100128477 3300005535 Bacteria 2285
304 Ga0070697_100001409 3300005536 Bacteria 18254
305 Ga0070697_100017478 3300005536 Bacteria 5644
306 Ga0068853_100002155 3300005539 Bacteria 14649
307 Ga0068853_100004757 3300005539 Bacteria 10556
308 Ga0068853_100007846 3300005539 Bacteria 8560
309 Ga0068853_100037287 3300005539 Bacteria 4136
310 Ga0068853_100041320 3300005539 Bacteria 3938
311 Ga0068853_100044558 3300005539 Bacteria 3797
312 Ga0068853_100063484 3300005539 Bacteria 3199
313 Ga0068853_100099222 3300005539 Bacteria 2573
314 Ga0070672_100000035 3300005543 Bacteria 60570
315 Ga0070672_100003513 3300005543 Bacteria 10158
316 Ga0070672_100018387 3300005543 Bacteria 5053
317 Ga0070672_100210917 3300005543 Bacteria 1627
318 Ga0070686_100000086 3300005544 Bacteria 65438
319 Ga0070686_100005106 3300005544 Bacteria 7246
320 Ga0070686_100038021 3300005544 Bacteria 2990
321 Ga0070695_100000036 3300005545 Bacteria 51060
322 Ga0070695_100013150 3300005545 Bacteria 4972
323 Ga0070695_100017309 3300005545 Bacteria 4369
324 Ga0070696_100005176 3300005546 Bacteria 8715
325 Ga0070696_100033284 3300005546 Bacteria 3540
326 Ga0070693_100001155 3300005547 Bacteria 11854
327 Ga0070693_100075999 3300005547 Bacteria 1990
328 Ga0070693_100099171 3300005547 Bacteria 1771
329 Ga0070665_100000961 3300005548 Bacteria 36670
330 Ga0070665_100006101 3300005548 Bacteria 12320
331 Ga0070665_100022659 3300005548 Bacteria 6324
332 Ga0070665_100044075 3300005548 Bacteria 4481
333 Ga0070665_100083903 3300005548 Bacteria 3191
334 Ga0070665_100242115 3300005548 Bacteria 1804
335 Ga0070704_100000280 3300005549 Bacteria 22434
336 Ga0070704_100011293 3300005549 Bacteria 5471
337 Ga0070704_100020612 3300005549 Bacteria 4255
338 Ga0070704_100099989 3300005549 Bacteria 2183
339 Ga0068855_100027849 3300005563 Bacteria 6759
340 Ga0068855_100028788 3300005563 Bacteria 6647
341 Ga0068855_100029470 3300005563 Bacteria 6560
342 Ga0068855_100030375 3300005563 Bacteria 6464
343 Ga0068855_100040067 3300005563 Bacteria 5561
344 Ga0068855_100045338 3300005563 Bacteria 5200
345 Ga0068855_100087048 3300005563 Bacteria 3611
346 Ga0068855_100164178 3300005563 Bacteria 2519
347 Ga0068855_100187217 3300005563 Bacteria 2337
348 Ga0070664_100000480 3300005564 Bacteria 30207
349 Ga0070664_100014548 3300005564 Bacteria 6419
350 Ga0070664_100158941 3300005564 Bacteria 1998
351 Ga0070664_100164935 3300005564 Bacteria 1962
352 Ga0070664_100177561 3300005564 Bacteria 1891
353 Ga0068857_100001341 3300005577 Bacteria 19389
354 Ga0068857_100003061 3300005577 Bacteria 13826
355 Ga0068857_100004888 3300005577 Bacteria 11367
356 Ga0068857_100010388 3300005577 Bacteria 8089
357 Ga0068857_100090980 3300005577 Bacteria 2731
358 Ga0068854_100000311 3300005578 Bacteria 32061
359 Ga0068854_100003846 3300005578 Bacteria 9404
360 Ga0068854_100091552 3300005578 Bacteria 2263
361 Ga0068854_100149097 3300005578 Bacteria 1802
362 Ga0068854_100240471 3300005578 Bacteria 1441
363 Ga0068856_100000013 3300005614 Bacteria 165611
364 Ga0068856_100001380 3300005614 Bacteria 25539
365 Ga0068856_100002467 3300005614 Bacteria 19046
366 Ga0068856_100039704 3300005614 Bacteria 4621
367 Ga0068856_100235098 3300005614 Bacteria 1848
368 Ga0070702_100010139 3300005615 Bacteria 4631
369 Ga0070702_100045405 3300005615 Bacteria 2485
370 Ga0070702_100055083 3300005615 Bacteria 2291
371 Ga0068852_100000344 3300005616 Bacteria 31408
372 Ga0068852_100014464 3300005616 Bacteria 6078
373 Ga0068852_100042687 3300005616 Bacteria 3840
374 Ga0068852_100077518 3300005616 Bacteria 2938
375 Ga0068859_100005828 3300005617 Bacteria 12510
376 Ga0068859_100020601 3300005617 Bacteria 6617
377 Ga0068859_100028027 3300005617 Bacteria 5648
378 Ga0068859_100030696 3300005617 Bacteria 5393
379 Ga0068859_100084982 3300005617 Bacteria 3209
380 Ga0068859_100112114 3300005617 Bacteria 2790
381 Ga0068864_100005269 3300005618 Bacteria 10596
382 Ga0068864_100018414 3300005618 Bacteria 5835
383 Ga0068864_100087925 3300005618 Bacteria 2736
384 Ga0068864_100103785 3300005618 Bacteria 2524
385 Ga0068864_100238949 3300005618 Bacteria 1683
386 Ga0068866_10000550 3300005718 Bacteria 17138
387 Ga0068866_10011469 3300005718 Bacteria 3835
388 Ga0068866_10068565 3300005718 Bacteria 1866
389 Ga0068861_100000580 3300005719 Bacteria 21652
390 Ga0068861_100003527 3300005719 Bacteria 10399
391 Ga0068861_100004999 3300005719 Bacteria 8935
392 Ga0068861_100032768 3300005719 Bacteria 3828
393 Ga0068861_100056550 3300005719 Bacteria 2995
394 Ga0068851_10022202 3300005834 Bacteria 3088
395 Ga0068851_10038908 3300005834 Bacteria 2388
396 Ga0068870_10000439 3300005840 Bacteria 15774
397 Ga0068870_10035153 3300005840 Bacteria 2569
398 Ga0068863_100001408 3300005841 Bacteria 23845
399 Ga0068863_100022927 3300005841 Bacteria 5966
400 Ga0068863_100077621 3300005841 Bacteria 3143
401 Ga0068863_100224470 3300005841 Bacteria 1810
402 Ga0068858_100004902 3300005842 Bacteria 13117
403 Ga0068858_100025484 3300005842 Bacteria 5502
404 Ga0068858_100055890 3300005842 Bacteria 3648
405 Ga0068858_100062517 3300005842 Bacteria 3443
406 Ga0068858_100151890 3300005842 Bacteria 2178
407 Ga0068860_100001139 3300005843 Bacteria 29182
408 Ga0068860_100002680 3300005843 Bacteria 18541
409 Ga0068860_100015025 3300005843 Bacteria 7566
410 Ga0068860_100052879 3300005843 Bacteria 3863
411 Ga0068860_100096258 3300005843 Bacteria 2822
412 Ga0068862_100003661 3300005844 Bacteria 13145
413 Ga0068862_100044685 3300005844 Bacteria 3779
414 Ga0068862_100056403 3300005844 Bacteria 3366
415 Ga0081455_10000007 3300005937 Bacteria 269394
416 Ga0081455_10001108 3300005937 Bacteria 33842
417 Ga0081455_10001309 3300005937 Bacteria 30858
418 Ga0081455_10005384 3300005937 Bacteria 14049
419 Ga0081455_10012343 3300005937 Bacteria 8525
420 Ga0081455_10013086 3300005937 Bacteria 8225
421 Ga0081455_10028767 3300005937 Bacteria 5074
422 Ga0081455_10030645 3300005937 Bacteria 4883
423 Ga0081455_10037372 3300005937 Bacteria 4314
424 Ga0081455_10069942 3300005937 Bacteria 2916
425 Ga0081538_10002248 3300005981 Bacteria 19113
426 Ga0081538_10003840 3300005981 Bacteria 14036
427 Ga0081538_10015217 3300005981 Bacteria 5969
428 Ga0081540_1000453 3300005983 Bacteria 40674
429 Ga0081540_1001109 3300005983 Bacteria 23852
430 Ga0081540_1007725 3300005983 Bacteria 7623
431 Ga0081540_1008051 3300005983 Bacteria 7414
432 Ga0081540_1027256 3300005983 Bacteria 3241
433 Ga0081540_1030603 3300005983 Bacteria 2978
434 Ga0081540_1033713 3300005983 Bacteria 2775
435 Ga0081540_1041288 3300005983 Bacteria 2394
436 Ga0081540_1042547 3300005983 Bacteria 2342
437 Ga0081539_10000129 3300005985 Bacteria 178675
438 Ga0081539_10000522 3300005985 Bacteria 79973
439 Ga0081539_10002840 3300005985 Bacteria 23102
440 Ga0081539_10055480 3300005985 Bacteria 2204
441 Ga0070717_10009219 3300006028 Bacteria 7417
442 Ga0070717_10011634 3300006028 Bacteria 6692
443 Ga0070717_10020456 3300006028 Bacteria 5206
444 Ga0070717_10165725 3300006028 Bacteria 1919
445 Ga0070717_10297275 3300006028 Bacteria 1435
446 Ga0070717_10314831 3300006028 Bacteria 1393
447 Ga0075365_10001556 3300006038 Bacteria 10499
448 Ga0075365_10004337 3300006038 Bacteria 7494
449 Ga0075365_10005164 3300006038 Bacteria 7018
450 Ga0075365_10056876 3300006038 Bacteria 2601
451 Ga0075365_10175711 3300006038 Bacteria 1496
452 Ga0075368_10005011 3300006042 Bacteria 4528
453 Ga0075363_100000348 3300006048 Bacteria 13858
454 Ga0075363_100016408 3300006048 Bacteria 3657
455 Ga0075363_100114436 3300006048 Bacteria 1502
456 Ga0075364_10000198 3300006051 Bacteria 27838
457 Ga0075364_10005491 3300006051 Bacteria 7374
458 Ga0075364_10058898 3300006051 Bacteria 2517
459 Ga0075364_10148742 3300006051 Bacteria 1578
460 Ga0075432_10000446 3300006058 Bacteria 12162
461 Ga0070715_10003544 3300006163 Bacteria 4991
462 Ga0070715_10078485 3300006163 Bacteria 1493
463 Ga0070716_100010038 3300006173 Bacteria 4736
464 Ga0070716_100024144 3300006173 Bacteria 3233
465 Ga0070712_100001745 3300006175 Bacteria 13294
466 Ga0070712_100004674 3300006175 Bacteria 8469
467 Ga0070712_100010515 3300006175 Bacteria 5842
468 Ga0075362_10046844 3300006177 Bacteria 1924
469 Ga0075367_10002178 3300006178 Bacteria 8819
470 Ga0075367_10011888 3300006178 Bacteria 4623
471 Ga0075367_10015553 3300006178 Bacteria 4141
472 Ga0075367_10019918 3300006178 Bacteria 3728
473 Ga0075367_10026314 3300006178 Bacteria 3299
474 Ga0075367_10045594 3300006178 Bacteria 2573
475 Ga0075367_10074102 3300006178 Bacteria 2052
476 Ga0075369_10014661 3300006186 Bacteria 3136
477 Ga0075366_10002009 3300006195 Bacteria 10317
478 Ga0075366_10010703 3300006195 Bacteria 5156
479 Ga0075366_10021523 3300006195 Bacteria 3749
480 Ga0075366_10069535 3300006195 Bacteria 2096
481 Ga0097621_100000047 3300006237 Bacteria 63910
482 Ga0075370_10069008 3300006353 Bacteria 2020
483 Ga0068871_100000651 3300006358 Bacteria 23875
484 Ga0075428_100003846 3300006844 Bacteria 16484
485 Ga0075428_100158985 3300006844 Bacteria 2453
486 Ga0075428_100161345 3300006844 Bacteria 2433
487 Ga0075428_100173899 3300006844 Bacteria 2333
488 Ga0075428_100215198 3300006844 Bacteria 2076
489 Ga0075430_100000163 3300006846 Bacteria 43947
490 Ga0075430_100157645 3300006846 Bacteria 1889
491 Ga0075431_100088143 3300006847 Bacteria 3202
492 Ga0075431_100125030 3300006847 Bacteria 2654
493 Ga0075433_10001479 3300006852 Bacteria 17340
494 Ga0075433_10053810 3300006852 Bacteria 3510
495 Ga0075433_10071256 3300006852 Bacteria 3055
496 Ga0075433_10079168 3300006852 Bacteria 2896
497 Ga0075433_10139267 3300006852 Bacteria 2157
498 Ga0075434_100000362 3300006871 Bacteria 32982
499 Ga0075434_100022014 3300006871 Bacteria 6204
500 Ga0075434_100024327 3300006871 Bacteria 5920
501 Ga0075434_100039048 3300006871 Bacteria 4704
502 Ga0075434_100040777 3300006871 Bacteria 4598
503 Ga0075429_100003394 3300006880 Bacteria 13573
504 Ga0075429_100004003 3300006880 Bacteria 12620
505 Ga0068865_100000233 3300006881 Bacteria 30830
506 Ga0068865_100052101 3300006881 Bacteria 2835
507 Ga0068865_100054473 3300006881 Bacteria 2779
508 Ga0068865_100099864 3300006881 Bacteria 2122
509 Ga0075436_100003587 3300006914 Bacteria 10631
510 Ga0075436_100053073 3300006914 Bacteria 2798
511 Ga0075436_100200088 3300006914 Bacteria 1415
512 Ga0097620_100005828 3300006931 Bacteria 12510
513 Ga0097620_100020600 3300006931 Bacteria 6617
514 Ga0097620_100028028 3300006931 Bacteria 5648
515 Ga0097620_100030694 3300006931 Bacteria 5393
516 Ga0097620_100084988 3300006931 Bacteria 3209
517 Ga0097620_100112111 3300006931 Bacteria 2790
518 Ga0099825_1021428 3300006941 Bacteria 4379
519 Ga0099824_1012461 3300006942 Bacteria 9257
520 Ga0099824_1013833 3300006942 Bacteria 8240
521 Ga0099822_1000008 3300006943 Bacteria 76583
522 Ga0079104_1000103 3300006946 Bacteria 124578
523 Ga0079104_1004556 3300006946 Bacteria 5871
524 Ga0099826_10000120 3300006948 Bacteria 35923
525 Ga0099826_10015703 3300006948 Bacteria 5721
526 Ga0075435_100007644 3300007076 Bacteria 7718
527 Ga0075435_100014990 3300007076 Bacteria 5815
528 Ga0075435_100019992 3300007076 Bacteria 5119
529 Ga0075435_100180971 3300007076 Bacteria 1781
530 Ga0099794_10010756 3300007265 Bacteria 3894
531 Ga0099794_10022333 3300007265 Bacteria 2884
532 Ga0099795_10000833 3300007788 Bacteria 6131
533 Ga0099795_10011850 3300007788 Bacteria 2623
534 Ga0105251_10021244 3300009011 Bacteria 3393
535 Ga0105251_10021318 3300009011 Bacteria 3386
536 Ga0105240_10000013 3300009093 Bacteria 483458
537 Ga0105240_10013956 3300009093 Bacteria 10999
538 Ga0105240_10016913 3300009093 Bacteria 9857
539 Ga0105240_10021261 3300009093 Bacteria 8633
540 Ga0105240_10027723 3300009093 Bacteria 7412
541 Ga0105240_10048419 3300009093 Bacteria 5372
542 Ga0105240_10072194 3300009093 Bacteria 4267
543 Ga0105240_10161045 3300009093 Bacteria 2665
544 Ga0105240_10216467 3300009093 Bacteria 2234
545 Ga0111539_10000185 3300009094 Bacteria 72688
546 Ga0111539_10002902 3300009094 Bacteria 22764
547 Ga0111539_10057903 3300009094 Bacteria 4600
548 Ga0111539_10127816 3300009094 Bacteria 2976
549 Ga0111539_10159696 3300009094 Bacteria 2637
550 Ga0105245_10000213 3300009098 Bacteria 55096
551 Ga0105245_10061403 3300009098 Bacteria 3388
552 Ga0105247_10002622 3300009101 Bacteria 12145
553 Ga0105247_10003104 3300009101 Bacteria 10984
554 Ga0105247_10007807 3300009101 Bacteria 6545
555 Ga0105247_10025413 3300009101 Bacteria 3572
556 Ga0105247_10046261 3300009101 Bacteria 2671
557 Ga0114129_10003018 3300009147 Bacteria 23603
558 Ga0114129_10040263 3300009147 Bacteria 6587
559 Ga0114129_10106624 3300009147 Bacteria 3870
560 Ga0105243_10000175 3300009148 Bacteria 73728
561 Ga0105243_10007195 3300009148 Bacteria 8553
562 Ga0105243_10007988 3300009148 Bacteria 8127
563 Ga0105243_10064941 3300009148 Bacteria 2930
564 Ga0105241_10000950 3300009174 Bacteria 21904
565 Ga0105241_10006537 3300009174 Bacteria 8589
566 Ga0105241_10099264 3300009174 Bacteria 2312
567 Ga0105242_10000831 3300009176 Bacteria 24028
568 Ga0105242_10010754 3300009176 Bacteria 7024
569 Ga0105242_10051464 3300009176 Bacteria 3356
570 Ga0105248_10002898 3300009177 Bacteria 19034
571 Ga0105248_10003421 3300009177 Bacteria 17630
572 Ga0105248_10010753 3300009177 Bacteria 10102
573 Ga0105248_10018295 3300009177 Bacteria 7737
574 Ga0105248_10152568 3300009177 Bacteria 2607
575 Ga0105248_10249474 3300009177 Bacteria 1998
576 Ga0105237_10000878 3300009545 Bacteria 40706
577 Ga0105237_10000949 3300009545 Bacteria 38978
578 Ga0105237_10006980 3300009545 Bacteria 12450
579 Ga0105237_10012841 3300009545 Bacteria 8806
580 Ga0105237_10035995 3300009545 Bacteria 5008
581 Ga0105237_10186819 3300009545 Bacteria 2072
582 Ga0105238_10001968 3300009551 Bacteria 20683
583 Ga0105238_10003568 3300009551 Bacteria 15510
584 Ga0105238_10041496 3300009551 Bacteria 4660
585 Ga0105238_10047244 3300009551 Bacteria 4342
586 Ga0105249_10000200 3300009553 Bacteria 68748
587 Ga0105249_10041909 3300009553 Bacteria 4163
588 Ga0105249_10125158 3300009553 Bacteria 2447
589 Ga0105249_10146245 3300009553 Bacteria 2271
590 Ga0105249_10248664 3300009553 Bacteria 1762
591 Ga0123341_1000021 3300009765 Bacteria 79283
592 Ga0123342_1009449 3300009766 Bacteria 11679
593 Ga0123342_1020489 3300009766 Bacteria 4822
594 Ga0099796_10015517 3300010159 Bacteria 2228
595 Ga0105239_10002407 3300010375 Bacteria 23845
596 Ga0105239_10002945 3300010375 Bacteria 21233
597 Ga0105239_10005003 3300010375 Bacteria 15648
598 Ga0105239_10010104 3300010375 Bacteria 10579
599 Ga0105239_10049300 3300010375 Bacteria 4618
600 Ga0105239_10090150 3300010375 Bacteria 3383
601 Ga0105246_10000306 3300011119 Bacteria 25976
602 Ga0105246_10019357 3300011119 Bacteria 4348
603 Ga0105246_10045760 3300011119 Bacteria 2982
604 Ga0157315_1000261 3300012508 Bacteria 2363
605 Ga0157373_10004518 3300013100 Bacteria 10461
606 Ga0157373_10055120 3300013100 Bacteria 2824
607 Ga0157371_10000108 3300013102 Bacteria 126288
608 Ga0157371_10006295 3300013102 Bacteria 9832
609 Ga0157371_10013035 3300013102 Bacteria 6330
610 Ga0157371_10047188 3300013102 Bacteria 3062
611 Ga0157371_10055016 3300013102 Bacteria 2824
612 Ga0157371_10100220 3300013102 Bacteria 2054
613 Ga0157370_10000324 3300013104 Bacteria 59791
614 Ga0157370_10003808 3300013104 Bacteria 17596
615 Ga0157370_10007741 3300013104 Bacteria 11648
616 Ga0157370_10117475 3300013104 Bacteria 2484
617 Ga0157369_10008988 3300013105 Bacteria 11445
618 Ga0157369_10014310 3300013105 Bacteria 8963
619 Ga0157369_10029380 3300013105 Bacteria 6075
620 Ga0157369_10235695 3300013105 Bacteria 1912
621 Ga0171463_1004 3300013249 Bacteria 437207
622 Ga0171462_1008 3300013250 Bacteria 384318
623 Ga0157374_10002304 3300013296 Bacteria 16087
624 Ga0157374_10003330 3300013296 Bacteria 13505
625 Ga0157374_10048783 3300013296 Bacteria 3930
626 Ga0157374_10223538 3300013296 Bacteria 1848
627 Ga0157378_10000717 3300013297 Bacteria 30971
628 Ga0157378_10107027 3300013297 Bacteria 2558
629 Ga0157378_10107962 3300013297 Bacteria 2548
630 Ga0157378_10143035 3300013297 Bacteria 2223
631 Ga0157378_10308482 3300013297 Bacteria 1534
632 Ga0163162_10002380 3300013306 Bacteria 17677
633 Ga0163162_10006589 3300013306 Bacteria 11251
634 Ga0163162_10012633 3300013306 Bacteria 8245
635 Ga0163162_10284854 3300013306 Bacteria 1784
636 Ga0157372_10014204 3300013307 Bacteria 8509
637 Ga0157372_10031292 3300013307 Bacteria 5826
638 Ga0157372_10102896 3300013307 Bacteria 3263
639 Ga0157372_10212034 3300013307 Bacteria 2244
640 Ga0157375_10000355 3300013308 Bacteria 41608
641 Ga0157375_10006749 3300013308 Bacteria 9995
642 Ga0157375_10009498 3300013308 Bacteria 8539
643 Ga0157375_10051570 3300013308 Bacteria 4041
644 Ga0163163_10004739 3300014325 Bacteria 11655
645 Ga0163163_10055138 3300014325 Bacteria 3928
646 Ga0163163_10060151 3300014325 Bacteria 3761
647 Ga0157380_10000166 3300014326 Bacteria 38031
648 Ga0157380_10005442 3300014326 Bacteria 8899
649 Ga0182008_10008431 3300014497 Bacteria 5626
650 Ga0182008_10050169 3300014497 Bacteria 2071
651 Ga0157377_10000207 3300014745 Bacteria 32216
652 Ga0157377_10007280 3300014745 Bacteria 5333
653 Ga0157379_10000036 3300014968 Bacteria 81888
654 Ga0157379_10007524 3300014968 Bacteria 9426
655 Ga0157379_10038245 3300014968 Bacteria 4281
656 Ga0157379_10062781 3300014968 Bacteria 3322
657 Ga0157379_10222843 3300014968 Bacteria 1709
658 Ga0157376_10000062 3300014969 Bacteria 89308
659 Ga0157376_10001823 3300014969 Bacteria 14182
660 Ga0157376_10013905 3300014969 Bacteria 6018
661 Ga0157376_10230164 3300014969 Bacteria 1721
662 Ga0182007_10004002 3300015262 Bacteria 6800
663 Ga0182005_1004548 3300015265 Bacteria 4464
664 Ga0183363_1088 3300015690 Bacteria 27664
665 Ga0163161_10001670 3300017792 Bacteria 16269
666 Ga0163161_10002298 3300017792 Bacteria 13707
667 Ga0206356_11609129 3300020070 Bacteria 1549
668 Ga0214544_1000003 3300021320 Bacteria 643752
669 Ga0214544_1000079 3300021320 Bacteria 121742
670 Ga0214542_1000003 3300021321 Bacteria 435700
671 Ga0214542_1000064 3300021321 Bacteria 127681
672 Ga0214542_1014779 3300021321 Bacteria 8511
673 Ga0214545_1000004 3300021324 Bacteria 453352
674 Ga0214543_1000007 3300021327 Bacteria 414744
675 Ga0214543_1000015 3300021327 Bacteria 305679
676 Ga0214543_1000063 3300021327 Bacteria 127694
677 Ga0213874_10008081 3300021377 Bacteria 2551
678 Ga0213874_10011993 3300021377 Bacteria 2212
679 Ga0213876_10000566 3300021384 Bacteria 27577
680 Ga0213876_10000882 3300021384 Bacteria 20073
681 Ga0213876_10102757 3300021384 Bacteria 1515
682 Ga0213875_10000036 3300021388 Bacteria 166707
683 Ga0213875_10018859 3300021388 Bacteria 3321
684 Ga0213875_10035814 3300021388 Bacteria 2341
685 Ga0228711_1000004 3300022739 Bacteria 250146
686 Ga0228710_1000002 3300022740 Bacteria 287279
687 Ga0209435_100009 3300025206 Bacteria 476614
688 Ga0209760_101544 3300025207 Bacteria 2380
689 Ga0209436_100045 3300025208 Bacteria 69503
690 Ga0209436_100074 3300025208 Bacteria 50572
691 Ga0209436_102742 3300025208 Bacteria 5047
692 Ga0209674_100003 3300025226 Bacteria 2196646
693 Ga0209563_100010 3300025230 Bacteria 1337457
694 Ga0209563_102386 3300025230 Bacteria 4277
695 Ga0209563_105564 3300025230 Bacteria 2264
696 Ga0209437_100182 3300025233 Bacteria 130514
697 Ga0209437_100204 3300025233 Bacteria 115781
698 Ga0207425_1000001 3300025245 Bacteria 2525432
699 Ga0207425_1000035 3300025245 Bacteria 225942
700 Ga0207425_1000089 3300025245 Bacteria 91267
701 Ga0207425_1005085 3300025245 Bacteria 3812
702 Ga0207425_1009843 3300025245 Bacteria 2355
703 Ga0209646_1000018 3300025246 Bacteria 476716
704 Ga0209026_1000043 3300025250 Bacteria 269142
705 Ga0209677_100274 3300025253 Bacteria 34497
706 Ga0209677_100611 3300025253 Bacteria 19140
707 Ga0209677_102993 3300025253 Bacteria 5846
708 Ga0209148_1000334 3300025254 Bacteria 64148
709 Ga0209759_1000007 3300025256 Bacteria 476614
710 Ga0209129_1000001 3300025258 Bacteria 1452436
711 Ga0209129_1000029 3300025258 Bacteria 401149
712 Ga0209129_1000050 3300025258 Bacteria 267408
713 Ga0209129_1000565 3300025258 Bacteria 25563
714 Ga0209129_1000823 3300025258 Bacteria 19517
715 Ga0209129_1000925 3300025258 Bacteria 17875
716 Ga0209129_1003167 3300025258 Bacteria 7365
717 Ga0209129_1003665 3300025258 Bacteria 6536
718 Ga0209233_1000231 3300025261 Bacteria 97534
719 Ga0209233_1001118 3300025261 Bacteria 10964
720 Ga0209233_1007161 3300025261 Bacteria 3551
721 Ga0209565_1000009 3300025263 Bacteria 751701
722 Ga0209565_1000311 3300025263 Bacteria 45199
723 Ga0209565_1005543 3300025263 Bacteria 3647
724 Ga0207666_1000029 3300025271 Bacteria 31521
725 Ga0209455_1000787 3300025272 Bacteria 17683
726 Ga0209455_1003869 3300025272 Bacteria 5111
727 Ga0209455_1005215 3300025272 Bacteria 4066
728 Ga0209673_1000019 3300025273 Bacteria 449094
729 Ga0209673_1000033 3300025273 Bacteria 335369
730 Ga0209673_1000050 3300025273 Bacteria 285287
731 Ga0209673_1000052 3300025273 Bacteria 279795
732 Ga0209673_1001744 3300025273 Bacteria 18213
733 Ga0209673_1001945 3300025273 Bacteria 16246
734 Ga0209673_1002003 3300025273 Bacteria 15758
735 Ga0209673_1004219 3300025273 Bacteria 7826
736 Ga0209673_1005234 3300025273 Bacteria 6606
737 Ga0209673_1027002 3300025273 Bacteria 1874
738 Ga0209130_1000009 3300025284 Bacteria 498952
739 Ga0209130_1000024 3300025284 Bacteria 354212
740 Ga0209130_1000027 3300025284 Bacteria 327700
741 Ga0209130_1000058 3300025284 Bacteria 210250
742 Ga0209130_1000460 3300025284 Bacteria 42703
743 Ga0209130_1004145 3300025284 Bacteria 5683
744 Ga0209130_1010105 3300025284 Bacteria 2624
745 Ga0207673_1000274 3300025290 Bacteria 5250
746 Ga0209675_1000028 3300025291 Bacteria 281253
747 Ga0209675_1000452 3300025291 Bacteria 31792
748 Ga0209676_1000956 3300025292 Bacteria 35128
749 Ga0209676_1006574 3300025292 Bacteria 5697
750 Ga0209676_1013494 3300025292 Bacteria 3139
751 Ga0209025_1000003 3300025294 Bacteria 1366495
752 Ga0209025_1000008 3300025294 Bacteria 1130876
753 Ga0209025_1000042 3300025294 Bacteria 370577
754 Ga0209025_1000132 3300025294 Bacteria 197432
755 Ga0209025_1000487 3300025294 Bacteria 76541
756 Ga0209025_1000591 3300025294 Bacteria 65471
757 Ga0209025_1001158 3300025294 Bacteria 37312
758 Ga0209025_1001580 3300025294 Bacteria 28793
759 Ga0209025_1003440 3300025294 Bacteria 14990
760 Ga0209025_1004756 3300025294 Bacteria 11529
761 Ga0209025_1005664 3300025294 Bacteria 10063
762 Ga0209025_1007555 3300025294 Bacteria 8066
763 Ga0209025_1007819 3300025294 Bacteria 7857
764 Ga0209025_1020735 3300025294 Bacteria 3574
765 Ga0209025_1037646 3300025294 Bacteria 2142
766 Ga0209564_1000015 3300025295 Bacteria 615324
767 Ga0209564_1000043 3300025295 Bacteria 388153
768 Ga0209564_1000058 3300025295 Bacteria 332955
769 Ga0209564_1000193 3300025295 Bacteria 141731
770 Ga0209564_1000236 3300025295 Bacteria 120648
771 Ga0209564_1000795 3300025295 Bacteria 43436
772 Ga0209564_1001506 3300025295 Bacteria 23365
773 Ga0209564_1002373 3300025295 Bacteria 15128
774 Ga0209564_1006490 3300025295 Bacteria 6293
775 Ga0209564_1007526 3300025295 Bacteria 5609
776 Ga0209564_1016597 3300025295 Bacteria 2917
777 Ga0209758_1000015 3300025297 Bacteria 851943
778 Ga0209758_1000116 3300025297 Bacteria 198356
779 Ga0209758_1000255 3300025297 Bacteria 106892
780 Ga0209758_1000337 3300025297 Bacteria 87295
781 Ga0209758_1001072 3300025297 Bacteria 35613
782 Ga0209758_1001193 3300025297 Bacteria 32816
783 Ga0209758_1001212 3300025297 Bacteria 32452
784 Ga0209758_1002254 3300025297 Bacteria 19990
785 Ga0209758_1002939 3300025297 Bacteria 16405
786 Ga0209758_1003339 3300025297 Bacteria 14744
787 Ga0209758_1004072 3300025297 Bacteria 12568
788 Ga0209758_1004594 3300025297 Bacteria 11355
789 Ga0209758_1007787 3300025297 Bacteria 7166
790 Ga0209758_1014598 3300025297 Bacteria 4161
791 Ga0209758_1017770 3300025297 Bacteria 3519
792 Ga0209758_1022699 3300025297 Bacteria 2864
793 Ga0209050_1001086 3300025298 Bacteria 33175
794 Ga0209050_1001220 3300025298 Bacteria 30004
795 Ga0209050_1001334 3300025298 Bacteria 27430
796 Ga0209256_1000062 3300025299 Bacteria 253433
797 Ga0209256_1000093 3300025299 Bacteria 209318
798 Ga0209256_1000250 3300025299 Bacteria 95262
799 Ga0209256_1000279 3300025299 Bacteria 89712
800 Ga0209256_1000374 3300025299 Bacteria 71875
801 Ga0209256_1000488 3300025299 Bacteria 58638
802 Ga0209256_1000563 3300025299 Bacteria 53065
803 Ga0209256_1000847 3300025299 Bacteria 38207
804 Ga0209256_1001067 3300025299 Bacteria 31762
805 Ga0209256_1002578 3300025299 Bacteria 14456
806 Ga0209256_1002849 3300025299 Bacteria 13180
807 Ga0209256_1011433 3300025299 Bacteria 3550
808 Ga0207426_1000041 3300025302 Bacteria 433536
809 Ga0207426_1000070 3300025302 Bacteria 331559
810 Ga0207426_1000072 3300025302 Bacteria 327700
811 Ga0207426_1000131 3300025302 Bacteria 210250
812 Ga0207426_1000201 3300025302 Bacteria 143975
813 Ga0207426_1000798 3300025302 Bacteria 34125
814 Ga0207426_1001330 3300025302 Bacteria 21009
815 Ga0207426_1013438 3300025302 Bacteria 3034
816 Ga0207426_1014914 3300025302 Bacteria 2838
817 Ga0209051_1000118 3300025303 Bacteria 149426
818 Ga0209051_1000818 3300025303 Bacteria 32237
819 Ga0209051_1001035 3300025303 Bacteria 26319
820 Ga0209051_1001484 3300025303 Bacteria 19726
821 Ga0209051_1002026 3300025303 Bacteria 15428
822 Ga0209051_1003381 3300025303 Bacteria 10483
823 Ga0209051_1012362 3300025303 Bacteria 4136
824 Ga0209051_1031934 3300025303 Bacteria 2017
825 Ga0209257_1001369 3300025304 Bacteria 29387
826 Ga0209257_1001382 3300025304 Bacteria 29095
827 Ga0209257_1001682 3300025304 Bacteria 24884
828 Ga0209257_1002038 3300025304 Bacteria 21525
829 Ga0209257_1008647 3300025304 Bacteria 5707
830 Ga0207697_10000208 3300025315 Bacteria 31492
831 Ga0207697_10008476 3300025315 Bacteria 4494
832 Ga0207656_10001876 3300025321 Bacteria 6991
833 Ga0207656_10011344 3300025321 Bacteria 3365
834 Ga0207656_10034179 3300025321 Bacteria 2122
835 Ga0207653_10026121 3300025885 Bacteria 1871
836 Ga0207682_10000004 3300025893 Bacteria 104760
837 Ga0207682_10001050 3300025893 Bacteria 12713
838 Ga0207682_10047215 3300025893 Bacteria 1772
839 Ga0207692_10001635 3300025898 Bacteria 8464
840 Ga0207692_10004470 3300025898 Bacteria 5540
841 Ga0207692_10005805 3300025898 Bacteria 4972
842 Ga0207692_10023265 3300025898 Bacteria 2863
843 Ga0207642_10000631 3300025899 Bacteria 10797
844 Ga0207642_10012285 3300025899 Bacteria 3087
845 Ga0207710_10017122 3300025900 Bacteria 3072
846 Ga0207710_10019327 3300025900 Bacteria 2907
847 Ga0207688_10000155 3300025901 Bacteria 29298
848 Ga0207688_10001807 3300025901 Bacteria 11384
849 Ga0207688_10017612 3300025901 Bacteria 3885
850 Ga0207688_10019774 3300025901 Bacteria 3671
851 Ga0207688_10024469 3300025901 Bacteria 3311
852 Ga0207680_10000818 3300025903 Bacteria 14667
853 Ga0207680_10046288 3300025903 Bacteria 2571
854 Ga0207680_10069953 3300025903 Bacteria 2170
855 Ga0207647_10000681 3300025904 Bacteria 26676
856 Ga0207647_10033366 3300025904 Bacteria 3296
857 Ga0207647_10067552 3300025904 Bacteria 2166
858 Ga0207685_10001890 3300025905 Bacteria 4612
859 Ga0207685_10021800 3300025905 Bacteria 2153
860 Ga0207699_10000005 3300025906 Bacteria 534560
861 Ga0207699_10001412 3300025906 Bacteria 11395
862 Ga0207699_10012376 3300025906 Bacteria 4340
863 Ga0207699_10112318 3300025906 Bacteria 1748
864 Ga0207645_10000061 3300025907 Bacteria 77457
865 Ga0207645_10001769 3300025907 Bacteria 17481
866 Ga0207645_10032413 3300025907 Bacteria 3359
867 Ga0207645_10097113 3300025907 Bacteria 1899
868 Ga0207643_10000012 3300025908 Bacteria 133318
869 Ga0207643_10006932 3300025908 Bacteria 6076
870 Ga0207705_10000988 3300025909 Bacteria 23188
871 Ga0207705_10030993 3300025909 Bacteria 3816
872 Ga0207705_10063858 3300025909 Bacteria 2661
873 Ga0207705_10139317 3300025909 Bacteria 1811
874 Ga0207654_10000221 3300025911 Bacteria 35023
875 Ga0207654_10001023 3300025911 Bacteria 15282
876 Ga0207654_10036360 3300025911 Bacteria 2751
877 Ga0207707_10000405 3300025912 Bacteria 45114
878 Ga0207707_10001049 3300025912 Bacteria 26514
879 Ga0207707_10001381 3300025912 Bacteria 22531
880 Ga0207707_10016386 3300025912 Bacteria 6464
881 Ga0207707_10040737 3300025912 Bacteria 4056
882 Ga0207707_10043837 3300025912 Bacteria 3900
883 Ga0207707_10204605 3300025912 Bacteria 1720
884 Ga0207695_10000044 3300025913 Bacteria 440819
885 Ga0207695_10000065 3300025913 Bacteria 336949
886 Ga0207695_10001260 3300025913 Bacteria 43127
887 Ga0207695_10004482 3300025913 Bacteria 19022
888 Ga0207695_10037557 3300025913 Bacteria 5225
889 Ga0207695_10196479 3300025913 Bacteria 1933
890 Ga0207671_10000043 3300025914 Bacteria 206915
891 Ga0207671_10023237 3300025914 Bacteria 4677
892 Ga0207671_10032725 3300025914 Bacteria 3868
893 Ga0207671_10051369 3300025914 Bacteria 3055
894 Ga0207671_10129952 3300025914 Bacteria 1933
895 Ga0207693_10001597 3300025915 Bacteria 20035
896 Ga0207693_10001757 3300025915 Bacteria 19030
897 Ga0207693_10002389 3300025915 Bacteria 16295
898 Ga0207693_10004047 3300025915 Bacteria 12458
899 Ga0207693_10006006 3300025915 Bacteria 10068
900 Ga0207693_10006151 3300025915 Bacteria 9956
901 Ga0207693_10026745 3300025915 Bacteria 4565
902 Ga0207693_10097226 3300025915 Bacteria 2309
903 Ga0207693_10103321 3300025915 Bacteria 2235
904 Ga0207663_10000181 3300025916 Bacteria 28019
905 Ga0207663_10006068 3300025916 Bacteria 6145
906 Ga0207663_10014178 3300025916 Bacteria 4356
907 Ga0207663_10025098 3300025916 Bacteria 3441
908 Ga0207663_10044706 3300025916 Bacteria 2720
909 Ga0207663_10046873 3300025916 Bacteria 2665
910 Ga0207663_10095463 3300025916 Bacteria 1984
911 Ga0207663_10192919 3300025916 Bacteria 1464
912 Ga0207660_10000008 3300025917 Bacteria 98521
913 Ga0207660_10002412 3300025917 Bacteria 12275
914 Ga0207660_10099090 3300025917 Bacteria 2174
915 Ga0207660_10167846 3300025917 Bacteria 1697
916 Ga0207662_10000196 3300025918 Bacteria 28281
917 Ga0207662_10018022 3300025918 Bacteria 4000
918 Ga0207662_10023389 3300025918 Bacteria 3550
919 Ga0207662_10024803 3300025918 Bacteria 3451
920 Ga0207662_10075522 3300025918 Bacteria 2047
921 Ga0207657_10000522 3300025919 Bacteria 40660
922 Ga0207657_10001135 3300025919 Bacteria 28283
923 Ga0207657_10004263 3300025919 Bacteria 15154
924 Ga0207657_10004432 3300025919 Bacteria 14858
925 Ga0207657_10006481 3300025919 Bacteria 12130
926 Ga0207657_10029853 3300025919 Bacteria 4956
927 Ga0207657_10029869 3300025919 Bacteria 4955
928 Ga0207657_10084964 3300025919 Bacteria 2652
929 Ga0207649_10000491 3300025920 Bacteria 28063
930 Ga0207649_10027301 3300025920 Bacteria 3348
931 Ga0207652_10011982 3300025921 Bacteria 6997
932 Ga0207652_10012842 3300025921 Bacteria 6771
933 Ga0207652_10053276 3300025921 Bacteria 3475
934 Ga0207652_10074485 3300025921 Bacteria 2956
935 Ga0207681_10001185 3300025923 Bacteria 16789
936 Ga0207681_10009656 3300025923 Bacteria 5902
937 Ga0207681_10012775 3300025923 Bacteria 5189
938 Ga0207681_10092740 3300025923 Bacteria 2160
939 Ga0207694_10000256 3300025924 Bacteria 50550
940 Ga0207694_10082719 3300025924 Bacteria 2524
941 Ga0207650_10001296 3300025925 Bacteria 18141
942 Ga0207650_10005632 3300025925 Bacteria 8553
943 Ga0207650_10006337 3300025925 Bacteria 8063
944 Ga0207650_10061739 3300025925 Bacteria 2799
945 Ga0207650_10130471 3300025925 Bacteria 1966
946 Ga0207659_10000023 3300025926 Bacteria 142947
947 Ga0207659_10014032 3300025926 Bacteria 5156
948 Ga0207659_10230241 3300025926 Bacteria 1494
949 Ga0207659_10247041 3300025926 Bacteria 1446
950 Ga0207687_10001111 3300025927 Bacteria 18286
951 Ga0207687_10044574 3300025927 Bacteria 3062
952 Ga0207687_10128977 3300025927 Bacteria 1903
953 Ga0207700_10000499 3300025928 Bacteria 22988
954 Ga0207700_10013652 3300025928 Bacteria 5294
955 Ga0207700_10018161 3300025928 Bacteria 4718
956 Ga0207664_10009878 3300025929 Bacteria 6719
957 Ga0207664_10014099 3300025929 Bacteria 5765
958 Ga0207664_10035801 3300025929 Bacteria 3833
959 Ga0207664_10070924 3300025929 Bacteria 2805
960 Ga0207664_10071859 3300025929 Bacteria 2788
961 Ga0207664_10091550 3300025929 Bacteria 2494
962 Ga0207664_10153590 3300025929 Bacteria 1958
963 Ga0207644_10000286 3300025931 Bacteria 33249
964 Ga0207644_10033579 3300025931 Bacteria 3587
965 Ga0207644_10047549 3300025931 Bacteria 3062
966 Ga0207644_10047954 3300025931 Bacteria 3051
967 Ga0207644_10109092 3300025931 Bacteria 2090
968 Ga0207690_10000105 3300025932 Bacteria 68515
969 Ga0207690_10040988 3300025932 Bacteria 3031
970 Ga0207690_10048542 3300025932 Bacteria 2824
971 Ga0207690_10049856 3300025932 Bacteria 2792
972 Ga0207690_10085633 3300025932 Bacteria 2213
973 Ga0207690_10089898 3300025932 Bacteria 2166
974 Ga0207706_10000545 3300025933 Bacteria 39978
975 Ga0207706_10001378 3300025933 Bacteria 24289
976 Ga0207706_10001736 3300025933 Bacteria 21437
977 Ga0207706_10099499 3300025933 Bacteria 2558
978 Ga0207686_10004085 3300025934 Bacteria 7837
979 Ga0207686_10023814 3300025934 Bacteria 3539
980 Ga0207709_10000264 3300025935 Bacteria 62258
981 Ga0207709_10020341 3300025935 Bacteria 3743
982 Ga0207709_10030477 3300025935 Bacteria 3138
983 Ga0207670_10000108 3300025936 Bacteria 56906
984 Ga0207670_10001838 3300025936 Bacteria 11075
985 Ga0207670_10024411 3300025936 Bacteria 3778
986 Ga0207670_10046309 3300025936 Bacteria 2888
987 Ga0207670_10198741 3300025936 Bacteria 1522
988 Ga0207669_10000515 3300025937 Bacteria 16910
989 Ga0207669_10031362 3300025937 Bacteria 2968
990 Ga0207669_10042345 3300025937 Bacteria 2657
991 Ga0207704_10000535 3300025938 Bacteria 16953
992 Ga0207704_10013224 3300025938 Bacteria 4124
993 Ga0207704_10022815 3300025938 Bacteria 3361
994 Ga0207704_10097329 3300025938 Bacteria 1951
995 Ga0207704_10112604 3300025938 Bacteria 1843
996 Ga0207665_10000578 3300025939 Bacteria 24653
997 Ga0207665_10011230 3300025939 Bacteria 5878
998 Ga0207665_10013838 3300025939 Bacteria 5306
999 Ga0207665_10021238 3300025939 Bacteria 4268
1000 Ga0207691_10000674 3300025940 Bacteria 33730
1001 Ga0207691_10000986 3300025940 Bacteria 28281
1002 Ga0207691_10023057 3300025940 Bacteria 5864
1003 Ga0207711_10021859 3300025941 Bacteria 5344
1004 Ga0207711_10088256 3300025941 Bacteria 2722
1005 Ga0207711_10114779 3300025941 Bacteria 2399
1006 Ga0207711_10122306 3300025941 Bacteria 2325
1007 Ga0207711_10149557 3300025941 Bacteria 2106
1008 Ga0207689_10000008 3300025942 Bacteria 127942
1009 Ga0207689_10013235 3300025942 Bacteria 7038
1010 Ga0207689_10034313 3300025942 Bacteria 4215
1011 Ga0207689_10040799 3300025942 Bacteria 3840
1012 Ga0207689_10222689 3300025942 Bacteria 1559
1013 Ga0207661_10000053 3300025944 Bacteria 90600
1014 Ga0207661_10003004 3300025944 Bacteria 11670
1015 Ga0207661_10091121 3300025944 Bacteria 2540
1016 Ga0207661_10103672 3300025944 Bacteria 2394
1017 Ga0207679_10000053 3300025945 Bacteria 109038
1018 Ga0207679_10131539 3300025945 Bacteria 2008
1019 Ga0207679_10137794 3300025945 Bacteria 1968
1020 Ga0207679_10141456 3300025945 Bacteria 1945
1021 Ga0207667_10008231 3300025949 Bacteria 12408
1022 Ga0207667_10011663 3300025949 Bacteria 10198
1023 Ga0207667_10019161 3300025949 Bacteria 7652
1024 Ga0207667_10019628 3300025949 Bacteria 7538
1025 Ga0207667_10068592 3300025949 Bacteria 3692
1026 Ga0207667_10145332 3300025949 Bacteria 2441
1027 Ga0207667_10183129 3300025949 Bacteria 2150
1028 Ga0207667_10290324 3300025949 Bacteria 1671
1029 Ga0207651_10000052 3300025960 Bacteria 53826
1030 Ga0207651_10062435 3300025960 Bacteria 2596
1031 Ga0207712_10000317 3300025961 Bacteria 44165
1032 Ga0207712_10045246 3300025961 Bacteria 3047
1033 Ga0207712_10204016 3300025961 Bacteria 1570
1034 Ga0207668_10000638 3300025972 Bacteria 21611
1035 Ga0207668_10033225 3300025972 Bacteria 3415
1036 Ga0207668_10121336 3300025972 Bacteria 1980
1037 Ga0207640_10000232 3300025981 Bacteria 38513
1038 Ga0207640_10028827 3300025981 Bacteria 3399
1039 Ga0207640_10029317 3300025981 Bacteria 3377
1040 Ga0207640_10064224 3300025981 Bacteria 2443
1041 Ga0207658_10001329 3300025986 Bacteria 19362
1042 Ga0207658_10045732 3300025986 Bacteria 3192
1043 Ga0207658_10158921 3300025986 Bacteria 1850
1044 Ga0207677_10004039 3300026023 Bacteria 7833
1045 Ga0207677_10056707 3300026023 Bacteria 2685
1046 Ga0207677_10100915 3300026023 Bacteria 2123
1047 Ga0207703_10004297 3300026035 Bacteria 11718
1048 Ga0207703_10032924 3300026035 Bacteria 4106
1049 Ga0207703_10061361 3300026035 Bacteria 3078
1050 Ga0207703_10337259 3300026035 Bacteria 1384
1051 Ga0207639_10000704 3300026041 Bacteria 22942
1052 Ga0207639_10001359 3300026041 Bacteria 16504
1053 Ga0207639_10007341 3300026041 Bacteria 7511
1054 Ga0207639_10010574 3300026041 Bacteria 6393
1055 Ga0207639_10021364 3300026041 Bacteria 4648
1056 Ga0207639_10073866 3300026041 Bacteria 2675
1057 Ga0207639_10122374 3300026041 Bacteria 2139
1058 Ga0207678_10000830 3300026067 Bacteria 28281
1059 Ga0207678_10005223 3300026067 Bacteria 11632
1060 Ga0207678_10017070 3300026067 Bacteria 6373
1061 Ga0207678_10026652 3300026067 Bacteria 5043
1062 Ga0207678_10028664 3300026067 Bacteria 4859
1063 Ga0207678_10043516 3300026067 Bacteria 3885
1064 Ga0207678_10052917 3300026067 Bacteria 3500
1065 Ga0207678_10161380 3300026067 Bacteria 1914
1066 Ga0207708_10000369 3300026075 Bacteria 35238
1067 Ga0207708_10000581 3300026075 Bacteria 28281
1068 Ga0207708_10000940 3300026075 Bacteria 21810
1069 Ga0207708_10018519 3300026075 Bacteria 5246
1070 Ga0207708_10175768 3300026075 Bacteria 1698
1071 Ga0207702_10000090 3300026078 Bacteria 104566
1072 Ga0207702_10000297 3300026078 Bacteria 57296
1073 Ga0207702_10000453 3300026078 Bacteria 46229
1074 Ga0207702_10010553 3300026078 Bacteria 7722
1075 Ga0207702_10065644 3300026078 Bacteria 3109
1076 Ga0207702_10114222 3300026078 Bacteria 2406
1077 Ga0207702_10234868 3300026078 Bacteria 1715
1078 Ga0207641_10001618 3300026088 Bacteria 21978
1079 Ga0207641_10072336 3300026088 Bacteria 2969
1080 Ga0207641_10132018 3300026088 Bacteria 2243
1081 Ga0207641_10239973 3300026088 Bacteria 1688
1082 Ga0207641_10324759 3300026088 Bacteria 1460
1083 Ga0207648_10001259 3300026089 Bacteria 28281
1084 Ga0207648_10011963 3300026089 Bacteria 8146
1085 Ga0207648_10020540 3300026089 Bacteria 5946
1086 Ga0207648_10034904 3300026089 Bacteria 4434
1087 Ga0207648_10066392 3300026089 Bacteria 3146
1088 Ga0207648_10154258 3300026089 Bacteria 2027
1089 Ga0207676_10000182 3300026095 Bacteria 55544
1090 Ga0207676_10025512 3300026095 Bacteria 4385
1091 Ga0207676_10146632 3300026095 Bacteria 2028
1092 Ga0207676_10303120 3300026095 Bacteria 1459
1093 Ga0207674_10001329 3300026116 Bacteria 32070
1094 Ga0207674_10003979 3300026116 Bacteria 17966
1095 Ga0207674_10007138 3300026116 Bacteria 13049
1096 Ga0207674_10007679 3300026116 Bacteria 12556
1097 Ga0207674_10050250 3300026116 Bacteria 4261
1098 Ga0207674_10170923 3300026116 Bacteria 2127
1099 Ga0207675_100000924 3300026118 Bacteria 29298
1100 Ga0207675_100048218 3300026118 Bacteria 3977
1101 Ga0207675_100063904 3300026118 Bacteria 3439
1102 Ga0207675_100115042 3300026118 Bacteria 2541
1103 Ga0207675_100176893 3300026118 Bacteria 2042
1104 Ga0207683_10000006 3300026121 Bacteria 181260
1105 Ga0207683_10004947 3300026121 Bacteria 11464
1106 Ga0207683_10008593 3300026121 Bacteria 8738
1107 Ga0207683_10010296 3300026121 Bacteria 7972
1108 Ga0207683_10057258 3300026121 Bacteria 3421
1109 Ga0207683_10083289 3300026121 Bacteria 2842
1110 Ga0207698_10000669 3300026142 Bacteria 19841
1111 Ga0207698_10025383 3300026142 Bacteria 4174
1112 Ga0207698_10161442 3300026142 Bacteria 1960
1113 Ga0207698_10209645 3300026142 Bacteria 1752
1114 Ga0209281_1000030 3300027111 Bacteria 425931
1115 Ga0209281_1000144 3300027111 Bacteria 172471
1116 Ga0209281_1000362 3300027111 Bacteria 74146
1117 Ga0209389_1000051 3300027296 Bacteria 110364
1118 Ga0209389_1000064 3300027296 Bacteria 102177
1119 Ga0209371_1000037 3300027312 Bacteria 367074
1120 Ga0209371_1000686 3300027312 Bacteria 29005
1121 Ga0209371_1011883 3300027312 Bacteria 2556
1122 Ga0209589_1000012 3300027357 Bacteria 229451
1123 Ga0209589_1000013 3300027357 Bacteria 229273
1124 Ga0209589_1000026 3300027357 Bacteria 158154
1125 Ga0209489_100013 3300027361 Bacteria 229831
1126 Ga0209489_100046 3300027361 Bacteria 158154
1127 Ga0209489_102226 3300027361 Bacteria 39655
1128 Ga0209700_100014 3300027363 Bacteria 299349
1129 Ga0209700_100047 3300027363 Bacteria 158154
1130 Ga0209179_1001531 3300027512 Bacteria 2861
1131 Ga0209282_1000004 3300027666 Bacteria 425931
1132 Ga0209282_1020473 3300027666 Bacteria 4191
1133 Ga0209588_1024492 3300027671 Bacteria 1906
1134 Ga0209971_1004456 3300027682 Bacteria 3324
1135 Ga0209998_10000772 3300027717 Bacteria 8316
1136 Ga0209998_10001021 3300027717 Bacteria 7049
1137 Ga0209813_10002400 3300027866 Bacteria 4292
1138 Ga0207428_10000112 3300027907 Bacteria 110733
1139 Ga0207428_10000847 3300027907 Bacteria 34454
1140 Ga0207428_10006016 3300027907 Bacteria 11227
1141 Ga0207428_10015144 3300027907 Bacteria 6674
1142 Ga0268266_10003225 3300028379 Bacteria 16480
1143 Ga0268266_10004165 3300028379 Bacteria 13945
1144 Ga0268266_10004472 3300028379 Bacteria 13365
1145 Ga0268266_10028142 3300028379 Bacteria 4778
1146 Ga0268266_10066370 3300028379 Bacteria 3120
1147 Ga0268266_10076560 3300028379 Bacteria 2908
1148 Ga0268266_10088697 3300028379 Bacteria 2707
1149 Ga0268266_10113831 3300028379 Bacteria 2399
1150 Ga0268266_10116675 3300028379 Bacteria 2371
1151 Ga0268266_10360369 3300028379 Bacteria 1368
1152 Ga0268265_10000257 3300028380 Bacteria 60485
1153 Ga0268265_10030071 3300028380 Bacteria 3907
1154 Ga0268264_10000050 3300028381 Bacteria 323697
1155 Ga0268264_10000579 3300028381 Bacteria 44364
1156 Ga0268264_10020186 3300028381 Bacteria 5446
1157 Ga0268264_10159519 3300028381 Bacteria 2030
1158 Ga0265334_10024268 3300028573 Bacteria 2461
1159 Ga0265323_10007422 3300028653 Bacteria 4557
1160 Ga0265336_10000355 3300028666 Bacteria 29857
1161 Ga0307517_10002340 3300028786 Bacteria 30587
1162 Ga0307515_10003252 3300028794 Bacteria 34391
1163 Ga0307515_10007398 3300028794 Bacteria 21710
1164 Ga0307515_10009143 3300028794 Bacteria 19211
1165 Ga0307515_10016062 3300028794 Bacteria 13741
1166 Ga0307515_10026153 3300028794 Bacteria 10059
1167 Ga0307515_10126691 3300028794 Bacteria 2846
1168 Ga0265338_10000256 3300028800 Bacteria 97079
1169 Ga0265338_10019026 3300028800 Bacteria 7314
1170 Ga0265338_10100418 3300028800 Bacteria 2360
1171 Ga0265338_10110723 3300028800 Bacteria 2212
1172 Ga0265338_10204405 3300028800 Bacteria 1487
1173 Ga0265324_10000928 3300029957 Bacteria 18416
1174 Ga0265324_10006036 3300029957 Bacteria 5117
1175 Ga0265324_10017887 3300029957 Bacteria 2574
1176 Ga0268256_1000039 3300030500 Bacteria 354969
1177 Ga0268256_1002437 3300030500 Bacteria 9496
1178 Ga0268256_1012217 3300030500 Bacteria 2668
1179 Ga0307511_10061899 3300030521 Bacteria 2846
1180 Ga0316181_1283596 3300030744 Bacteria 4143
1181 Ga0265330_10013072 3300031235 Bacteria 3873
1182 Ga0265330_10017374 3300031235 Bacteria 3314
1183 Ga0265332_10000616 3300031238 Bacteria 23188
1184 Ga0265328_10000282 3300031239 Bacteria 23767
1185 Ga0265328_10000684 3300031239 Bacteria 15747
1186 Ga0265328_10001206 3300031239 Bacteria 11980
1187 Ga0265328_10002032 3300031239 Bacteria 9152
1188 Ga0265328_10005546 3300031239 Bacteria 5397
1189 Ga0265328_10025218 3300031239 Bacteria 2241
1190 Ga0265320_10101125 3300031240 Bacteria 1327
1191 Ga0265325_10000162 3300031241 Bacteria 47234
1192 Ga0265325_10006034 3300031241 Bacteria 7411
1193 Ga0265325_10016048 3300031241 Bacteria 4191
1194 Ga0265325_10031982 3300031241 Bacteria 2813
1195 Ga0265325_10068660 3300031241 Bacteria 1784
1196 Ga0265329_10006611 3300031242 Bacteria 4587
1197 Ga0265340_10001157 3300031247 Bacteria 15092
1198 Ga0265340_10018523 3300031247 Bacteria 3591
1199 Ga0265339_10000068 3300031249 Bacteria 91555
1200 Ga0265339_10001455 3300031249 Bacteria 17539
1201 Ga0265339_10001689 3300031249 Bacteria 16287
1202 Ga0265339_10042357 3300031249 Bacteria 2521
1203 Ga0265339_10081348 3300031249 Bacteria 1712
1204 Ga0265331_10000061 3300031250 Bacteria 168963
1205 Ga0265331_10012049 3300031250 Bacteria 4707
1206 Ga0265327_10015122 3300031251 Bacteria 5002
1207 Ga0265327_10027038 3300031251 Bacteria 3309
1208 Ga0265327_10030185 3300031251 Bacteria 3069
1209 Ga0265327_10033929 3300031251 Bacteria 2838
1210 Ga0265316_10016131 3300031344 Bacteria 6496
1211 Ga0307513_10001043 3300031456 Bacteria 40213
1212 Ga0307513_10022564 3300031456 Bacteria 7392
1213 Ga0307513_10136816 3300031456 Bacteria 2384
1214 Ga0307513_10159766 3300031456 Bacteria 2148
1215 Ga0307509_10014275 3300031507 Bacteria 9348
1216 Ga0307408_100055235 3300031548 Bacteria 2874
1217 Ga0265313_10000020 3300031595 Bacteria 145873
1218 Ga0265313_10000062 3300031595 Bacteria 106169
1219 Ga0265313_10001715 3300031595 Bacteria 20184
1220 Ga0265313_10005225 3300031595 Bacteria 9619
1221 Ga0265313_10009591 3300031595 Bacteria 6263
1222 Ga0265313_10013976 3300031595 Bacteria 4779
1223 Ga0265313_10020357 3300031595 Bacteria 3662
1224 Ga0307508_10000199 3300031616 Bacteria 72296
1225 Ga0307508_10020920 3300031616 Bacteria 5945
1226 Ga0307508_10052241 3300031616 Bacteria 3631
1227 Ga0316575_10007938 3300031665 Bacteria 3852
1228 Ga0265314_10002042 3300031711 Bacteria 21355
1229 Ga0265314_10002666 3300031711 Bacteria 17890
1230 Ga0265314_10005463 3300031711 Bacteria 11468
1231 Ga0265314_10008333 3300031711 Bacteria 8888
1232 Ga0265314_10040218 3300031711 Bacteria 3358
1233 Ga0265314_10113701 3300031711 Bacteria 1716
1234 Ga0265314_10119362 3300031711 Bacteria 1662
1235 Ga0265342_10000082 3300031712 Bacteria 102532
1236 Ga0265342_10000139 3300031712 Bacteria 81785
1237 Ga0265342_10028648 3300031712 Bacteria 3465
1238 Ga0265342_10058454 3300031712 Bacteria 2279
1239 Ga0307516_10025488 3300031730 Bacteria 6021
1240 Ga0307516_10148264 3300031730 Bacteria 2109
1241 Ga0307405_10000319 3300031731 Bacteria 17826
1242 Ga0307410_10158348 3300031852 Bacteria 1694
1243 Ga0307410_10259058 3300031852 Bacteria 1356
1244 Ga0307406_10005642 3300031901 Bacteria 6842
1245 Ga0307412_10003405 3300031911 Bacteria 8835
1246 Ga0307412_10071752 3300031911 Bacteria 2365
1247 Ga0315914_1000001 3300031967 Bacteria 416633
1248 Ga0307409_100238779 3300031995 Bacteria 1653
1249 Ga0307414_10005179 3300032004 Bacteria 7156
1250 Ga0307414_10204856 3300032004 Bacteria 1608
1251 Ga0307415_100231521 3300032126 Bacteria 1488
1252 Ga0316583_10001130 3300032133 Bacteria 8717
1253 Ga0316583_10001744 3300032133 Bacteria 7386
1254 Ga0307507_10026668 3300033179 Bacteria 6218
1255 Ga0307510_10013982 3300033180 Bacteria 9501
1256 Ga0307510_10130356 3300033180 Bacteria 2190
1257 Ga0315913_1000004 3300033430 Bacteria 192741
1258 Ga0315911_1000019 3300033442 Bacteria 146597
1259 Ga0315915_1000002 3300033464 Bacteria 425854
1260 Ga0373930_0000855 3300034816 Bacteria 4337
1261 Ga0373948_0000427 3300034817 Bacteria 5193
1262 Ga0373948_0001630 3300034817 Bacteria 3165
1263 Ga0373950_0000407 3300034818 Bacteria 5265
1264 Ga0373958_0000933 3300034819 Bacteria 3781
1265 Ga0373959_0001537 3300034820 Bacteria 3672
1266 Ga0373959_0005521 3300034820 Bacteria 2075
1267 Ga0373938_0000284 3300034957 Bacteria 8126
1268 Ga0373926_0057784 3300035083 Bacteria 1409
1269 Ga0373928_0000447 3300035084 Bacteria 8150
1270 Ga0373928_0002599 3300035084 Bacteria 3495
1271 Ga0373929_0000896 3300035085 Bacteria 5808
1272 Ga0373934_0056216 3300035086 Bacteria 1565
1273 Ga0373944_0001375 3300035089 Bacteria 6132
1274 Ga0373944_0007598 3300035089 Bacteria 2909
1275 Ga0373944_0011824 3300035089 Bacteria 2397
1276 Ga0373949_0001957 3300035090 Bacteria 5537
1277 Ga0373949_0013353 3300035090 Bacteria 1820
1278 Ga0373951_0000431 3300035091 Bacteria 12309
1279 Ga0373951_0002271 3300035091 Bacteria 4886
1280 Ga0373952_0001128 3300035092 Bacteria 4877
1281 Ga0373952_0003885 3300035092 Bacteria 2703
1282 Ga0373952_0004273 3300035092 Bacteria 2585
1283 Ga0373952_0007790 3300035092 Bacteria 2017
1284 Ga0373923_0004799 3300035111 Bacteria 4525
1285 Ga0373923_0009517 3300035111 Bacteria 3510
1286 Ga0373932_0000364 3300035112 Bacteria 13982
1287 Ga0373932_0033283 3300035112 Bacteria 1446
1288 Ga0373932_0045512 3300035112 Bacteria 1283
1289 Ga0373936_0000685 3300035113 Bacteria 11818
1290 Ga0373936_0006238 3300035113 Bacteria 4496
1291 Ga0373936_0010212 3300035113 Bacteria 3546
1292 Ga0373936_0015159 3300035113 Bacteria 2951
1293 Ga0373939_0000262 3300035114 Bacteria 14133
1294 Ga0373939_0001568 3300035114 Bacteria 5548
1295 Ga0373939_0041662 3300035114 Bacteria 1385
1296 Ga0373941_0000914 3300035115 Bacteria 6075
1297 Ga0373941_0003796 3300035115 Bacteria 3456
1298 Ga0373941_0003953 3300035115 Bacteria 3395
1299 Ga0373941_0007351 3300035115 Bacteria 2692
1300 Ga0373941_0010185 3300035115 Bacteria 2392
1301 Ga0373945_0008561 3300035116 Bacteria 3336
1302 Ga0373945_0018457 3300035116 Bacteria 2373
1303 Ga0373945_0021338 3300035116 Bacteria 2225
1304 Ga0373945_0049866 3300035116 Bacteria 1537
1305 Ga0373953_0006564 3300035117 Bacteria 3841
1306 Ga0373954_0004003 3300035118 Bacteria 6300
1307 Ga0373954_0025295 3300035118 Bacteria 2713
1308 Ga0373954_0051934 3300035118 Bacteria 1926
1309 Ga0373954_0062050 3300035118 Bacteria 1765
1310 Ga0373956_0027504 3300035119 Bacteria 2469
1311 Ga0373957_0000707 3300035120 Bacteria 8663
1312 Ga0373957_0002081 3300035120 Bacteria 5612
1313 Ga0373960_0003528 3300035121 Bacteria 3545
1314 Ga0373960_0004964 3300035121 Bacteria 3066
1315 Ga0373960_0019107 3300035121 Bacteria 1796
1316 Ga0373943_0000193 3300035170 Bacteria 24677
1317 Ga0373943_0001390 3300035170 Bacteria 10911
1318 Ga0373943_0009002 3300035170 Bacteria 4475
1319 Ga0373943_0015415 3300035170 Bacteria 3471
1320 Ga0373946_0003060 3300035171 Bacteria 5920
1321 Ga0373946_0003391 3300035171 Bacteria 5656
1322 Ga0373946_0096612 3300035171 Bacteria 1317
1323 Ga0373955_0010574 3300035172 Bacteria 4362
1324 Ga0373955_0020387 3300035172 Bacteria 3332
1325 Ga0373955_0023840 3300035172 Bacteria 3122
1326 Ga0373955_0027625 3300035172 Bacteria 2935
1327 Ga0373955_0064582 3300035172 Bacteria 2029
1328 Ga0373955_0074746 3300035172 Bacteria 1903
1329 Ga0373955_0091788 3300035172 Bacteria 1732
1330 Ga0373955_0095774 3300035172 Bacteria 1698
1331 Ga0373942_0001043 3300035207 Bacteria 7491
1332 Ga0373942_0001281 3300035207 Bacteria 6574
1333 Ga0373942_0015922 3300035207 Bacteria 1838
1334 Ga0373961_0001729 3300035241 Bacteria 6073
1335 Ga0373961_0004127 3300035241 Bacteria 3532
1336 Ga0373961_0022465 3300035241 Bacteria 1688
1337 Ga0373961_0023688 3300035241 Bacteria 1654
1338 Ga0373962_0000973 3300035242 Bacteria 6618
1339 Ga0373962_0001478 3300035242 Bacteria 5569
1340 Ga0373962_0007935 3300035242 Bacteria 2606
1341 Ga0373924_0000735 3300035410 Bacteria 10209
1342 Ga0373924_0001157 3300035410 Bacteria 8463
1343 Ga0373924_0021352 3300035410 Bacteria 2524
1344 Ga0373931_0000182 3300035691 Bacteria 27346
1345 Ga0373931_0000619 3300035691 Bacteria 14703
1346 Ga0373931_0002195 3300035691 Bacteria 8620
1347 Ga0373931_0003796 3300035691 Bacteria 6835
1348 Ga0373931_0006373 3300035691 Bacteria 5510
1349 Ga0373931_0019966 3300035691 Bacteria 3349
1350 Ga0373935_0000514 3300035692 Bacteria 20101
1351 Ga0373935_0011008 3300035692 Bacteria 5434
1352 Ga0373935_0072671 3300035692 Bacteria 2221
1353 Ga0373935_0093570 3300035692 Bacteria 1971
1354 Ga0373935_0185454 3300035692 Bacteria 1430
1355 Ga0373927_0003318 3300035695 Bacteria 11579
1356 Ga0373927_0003594 3300035695 Bacteria 11057
1357 Ga0373927_0003709 3300035695 Bacteria 10858
1358 Ga0373927_0008391 3300035695 Bacteria 6949
1359 Ga0373927_0009076 3300035695 Bacteria 6673
1360 Ga0373927_0012386 3300035695 Bacteria 5677
1361 Ga0373927_0014795 3300035695 Bacteria 5159
1362 Ga0373927_0026965 3300035695 Bacteria 3754
1363 Ga0373927_0036139 3300035695 Bacteria 3213
1364 Ga0373927_0037323 3300035695 Bacteria 3158
1365 Ga0373927_0106518 3300035695 Bacteria 1825
1366 Ga0373933_0000173 3300035724 Bacteria 42306
1367 Ga0373933_0000565 3300035724 Bacteria 23136
1368 Ga0373933_0003738 3300035724 Bacteria 8413
1369 Ga0373933_0010982 3300035724 Bacteria 4974
1370 Ga0373933_0022257 3300035724 Bacteria 3607
1371 Ga0373933_0024387 3300035724 Bacteria 3463
1372 Ga0373933_0043832 3300035724 Bacteria 2648
1373 Ga0373933_0094322 3300035724 Bacteria 1850
1374 Ga0373933_0108205 3300035724 Bacteria 1731
1375 Ga0373933_0114124 3300035724 Bacteria 1687
1376 Ga0373947_0000076 3300035725 Bacteria 49938
1377 Ga0373947_0000761 3300035725 Bacteria 19322
1378 Ga0373947_0001894 3300035725 Bacteria 12778
1379 Ga0373947_0003322 3300035725 Bacteria 9532
1380 Ga0373947_0006054 3300035725 Bacteria 7049
1381 Ga0373947_0020231 3300035725 Bacteria 3842
1382 Ga0373947_0127385 3300035725 Bacteria 1623
1383 Ga0373947_0140676 3300035725 Bacteria 1548
1384 Ga0310104_02843 3300036242 Bacteria 1495
1385 Ga0373937_0000005 3300036401 Bacteria 199965
1386 Ga0373937_0001940 3300036401 Bacteria 17308
1387 Ga0373937_0006584 3300036401 Bacteria 10030
1388 Ga0373937_0065228 3300036401 Bacteria 3351
1389 Ga0373937_0090634 3300036401 Bacteria 2831
1390 Ga0373937_0186133 3300036401 Bacteria 1950
1391 Ga0316582_0031383 3300036647 Bacteria 3247
1392 Ga0316582_0084872 3300036647 Bacteria 2074
1393 Ga0316584_0070324 3300036712 Bacteria 2624
1394 Ga0373925_0000007 3300037068 Bacteria 257023
1395 Ga0373925_0001364 3300037068 Bacteria 21294
1396 Ga0373925_0005204 3300037068 Bacteria 9727
1397 Ga0373925_0005607 3300037068 Bacteria 9345
1398 Ga0373925_0008156 3300037068 Bacteria 7627
1399 Ga0373925_0035545 3300037068 Bacteria 3676
1400 Ga0373925_0069228 3300037068 Bacteria 2665
1401 Ga0373925_0120937 3300037068 Bacteria 2032
1402 Ga0395899_0000028 3300037312 Bacteria 334378
1403 Ga0395899_0002676 3300037312 Bacteria 14366
1404 Ga0395899_0048268 3300037312 Bacteria 3169
1405 Ga0395900_0000404 3300037418 Bacteria 62102
1406 Ga0395900_0005078 3300037418 Bacteria 13811
1407 Ga0395900_0019554 3300037418 Bacteria 6904
1408 Ga0395900_0019750 3300037418 Bacteria 6868
1409 Ga0395900_0019840 3300037418 Bacteria 6852
1410 Ga0395900_0026868 3300037418 Bacteria 5890
1411 Ga0395900_0028835 3300037418 Bacteria 5690
1412 Ga0395900_0105359 3300037418 Bacteria 2897
1413 Ga0395900_0268640 3300037418 Bacteria 1701
1414 Ga0395898_0001221 3300037466 Bacteria 38634
1415 Ga0395898_0023811 3300037466 Bacteria 6183
1416 Ga0395898_0104048 3300037466 Bacteria 2723
1417 Ga0395898_0186306 3300037466 Bacteria 1983
1418 Ga0395898_0233200 3300037466 Bacteria 1755
1419 Ga0395905_0001780 3300037471 Bacteria 24999
1420 Ga0395905_0002795 3300037471 Bacteria 19112
1421 Ga0395905_0024591 3300037471 Bacteria 5684
1422 Ga0395905_0417245 3300037471 Bacteria 1238
1423 Ga0436364_0177909 3300037853 Bacteria 2251
1424 Ga0436364_0245439 3300037853 Bacteria 33775
1425 Ga0436364_0249156 3300037853 Bacteria 9310
1426 Ga0436364_0707111 3300037853 Bacteria 2998
1427 Ga0436364_0839632 3300037853 Bacteria 3535
1428 Ga0395901_0007034 3300038443 Bacteria 11371
1429 Ga0395901_0026762 3300038443 Bacteria 5921
1430 Ga0395901_0038318 3300038443 Bacteria 4957
1431 Ga0395901_0121596 3300038443 Bacteria 2744
1432 Ga0400483_165206 3300039062 Bacteria 4837
1433 Ga0436365_0330576 3300039437 Bacteria 1760
1434 Ga0436365_0414414 3300039437 Bacteria 44510
1435 Ga0436365_0441549 3300039437 Bacteria 5709
1436 Ga0436365_0479730 3300039437 Bacteria 2108
1437 Ga0436365_0800699 3300039437 Bacteria 10148
1438 Ga0436365_0994189 3300039437 Bacteria 4522
1439 Ga0436365_1146135 3300039437 Bacteria 43423
1440 Ga0436365_1213591 3300039437 Bacteria 1798
1441 Ga0436365_1822426 3300039437 Bacteria 12503
1442 Ga0436365_1845112 3300039437 Bacteria 5042
1443 Ga0436360_0422410 3300039438 Bacteria 2656
1444 Ga0436361_0641333 3300039447 Bacteria 3417
1445 Ga0436363_0310436 3300039450 Bacteria 6789
1446 Ga0436363_0311986 3300039450 Bacteria 4108
1447 Ga0436363_0466725 3300039450 Bacteria 1897
1448 Ga0436363_0910224 3300039450 Bacteria 4710
1449 Ga0436363_1497563 3300039450 Bacteria 3399
1450 Ga0436362_0511152 3300039453 Bacteria 2872
1451 Ga0436362_1277031 3300039453 Bacteria 2722
1452 Ga0439439_0019889 3300041406 Bacteria 1668
1453 Ga0439453_0002197 3300041408 Bacteria 2655
1454 Ga0439465_0018843 3300041413 Bacteria 2157
1455 Ga0451845_0530672 3300041501 Bacteria 4723
1456 Ga0451851_0818185 3300041507 Bacteria 1394
1457 Ga0439448_0001298 3300042005 Bacteria 6394
1458 Ga0450904_001213 3300042139 Bacteria 3882
1459 Ga0450906_005481 3300042145 Bacteria 2606
1460 Ga0439458_0017551 3300042157 Bacteria 1636
1461 Ga0439435_0003133 3300042436 Bacteria 3397
1462 Ga0439464_0009999 3300042439 Bacteria 2502
1463 Ga0451577_0000457 3300042876 Bacteria 71078
1464 Ga0451577_0109070 3300042876 Bacteria 2475
1465 Ga0451577_0115420 3300042876 Bacteria 2404
1466 Ga0466972_0000059 3300044658 Bacteria 110350
1467 Ga0466972_0006116 3300044658 Bacteria 6047
1468 Ga0453683_0016829 3300044673 Bacteria 4714
1469 Ga0453683_0029063 3300044673 Bacteria 3498
1470 Ga0466965_0021541 3300044683 Bacteria 3104
1471 Ga0466965_0040806 3300044683 Bacteria 2286
1472 Ga0466966_0047162 3300044684 Bacteria 2749
1473 Ga0466966_0084282 3300044684 Bacteria 1977
1474 Ga0466966_0099309 3300044684 Bacteria 1801
1475 Ga0466961_0000019 3300044693 Bacteria 107624
1476 Ga0466963_0004164 3300044694 Bacteria 8370
1477 Ga0466963_0097280 3300044694 Bacteria 2011
1478 Ga0453684_0000005 3300044712 Bacteria 1431632
1479 Ga0453684_0000069 3300044712 Bacteria 456439
1480 Ga0453684_0011680 3300044712 Bacteria 14651
1481 Ga0453684_0199049 3300044712 Bacteria 2336
1482 Ga0466968_0018315 3300044735 Bacteria 2808
1483 Ga0466968_0045456 3300044735 Bacteria 1863
1484 Ga0466968_0058531 3300044735 Bacteria 1658
1485 Ga0466957_0047073 3300044842 Bacteria 2620
1486 Ga0466957_0102611 3300044842 Bacteria 1805
1487 Ga0466960_0036700 3300044901 Bacteria 2296
1488 Ga0466959_0099473 3300045049 Bacteria 2082
1489 Ga0451576_0001449 3300045051 Bacteria 40328
1490 Ga0451576_0016224 3300045051 Bacteria 8227
1491 Ga0451576_0018100 3300045051 Bacteria 7731
1492 Ga0451576_0030359 3300045051 Bacteria 5777
1493 Ga0451576_0073785 3300045051 Bacteria 3551
1494 Ga0451576_0132950 3300045051 Bacteria 2593
1495 Ga0451576_0266888 3300045051 Bacteria 1789
1496 Ga0466967_0012157 3300045976 Bacteria 6567
1497 Ga0466967_0044462 3300045976 Bacteria 3853
1498 Ga0466967_0073350 3300045976 Bacteria 3071
1499 Ga0466967_0118079 3300045976 Bacteria 2446
1500 Ga0495617_004305 3300046452 Bacteria 5186
1501 Ga0495592_0000165 3300046454 Bacteria 58936
1502 Ga0495592_0000595 3300046454 Bacteria 25585
1503 Ga0495592_0015083 3300046454 Bacteria 5869
1504 Ga0495592_0048804 3300046454 Bacteria 3148
1505 Ga0495592_0078958 3300046454 Bacteria 2383
1506 Ga0495603_0000026 3300046455 Bacteria 61348
1507 Ga0495603_0000068 3300046455 Bacteria 45309
1508 Ga0495603_0000736 3300046455 Bacteria 18661
1509 Ga0495603_0023660 3300046455 Bacteria 3716
1510 Ga0495603_0027172 3300046455 Bacteria 3454
1511 Ga0495603_0034454 3300046455 Bacteria 3043
1512 Ga0495603_0057691 3300046455 Bacteria 2297
1513 Ga0495603_0069177 3300046455 Bacteria 2077
1514 Ga0495603_0080546 3300046455 Bacteria 1908
1515 Ga0495591_000596 3300046458 Bacteria 27314
1516 Ga0495591_021370 3300046458 Bacteria 2113
1517 Ga0495629_0001467 3300046459 Bacteria 18588
1518 Ga0495629_0001993 3300046459 Bacteria 15861
1519 Ga0495629_0004611 3300046459 Bacteria 10318
1520 Ga0495629_0004630 3300046459 Bacteria 10298
1521 Ga0495629_0009583 3300046459 Bacteria 7076
1522 Ga0495629_0020215 3300046459 Bacteria 4755
1523 Ga0495629_0044110 3300046459 Bacteria 3130
1524 Ga0495629_0190849 3300046459 Bacteria 1418
1525 Ga0495638_0001230 3300046460 Bacteria 24246
1526 Ga0495638_0005696 3300046460 Bacteria 9175
1527 Ga0495638_0031248 3300046460 Bacteria 3423
1528 Ga0495638_0058973 3300046460 Bacteria 2377
1529 Ga0495638_0111246 3300046460 Bacteria 1627
1530 Ga0495641_0005110 3300046461 Bacteria 8993
1531 Ga0495641_0006743 3300046461 Bacteria 7370
1532 Ga0495641_0008803 3300046461 Bacteria 6086
1533 Ga0495641_0010843 3300046461 Bacteria 5241
1534 Ga0495651_0000136 3300046462 Bacteria 54665
1535 Ga0495651_0000237 3300046462 Bacteria 42533
1536 Ga0495651_0000836 3300046462 Bacteria 23937
1537 Ga0495651_0003936 3300046462 Bacteria 11353
1538 Ga0495651_0005160 3300046462 Bacteria 9959
1539 Ga0495651_0023239 3300046462 Bacteria 4821
1540 Ga0495651_0056832 3300046462 Bacteria 3005
1541 Ga0495651_0138808 3300046462 Bacteria 1765
1542 Ga0495653_0000103 3300046463 Bacteria 69772
1543 Ga0495653_0001743 3300046463 Bacteria 17165
1544 Ga0495653_0003759 3300046463 Bacteria 12274
1545 Ga0495653_0005473 3300046463 Bacteria 10340
1546 Ga0495653_0015717 3300046463 Bacteria 6171
1547 Ga0495653_0016165 3300046463 Bacteria 6080
1548 Ga0495653_0043872 3300046463 Bacteria 3473
1549 Ga0495653_0130924 3300046463 Bacteria 1776
1550 Ga0495580_0002524 3300046472 Bacteria 15974
1551 Ga0495580_0011805 3300046472 Bacteria 6743
1552 Ga0495580_0047427 3300046472 Bacteria 3045
1553 Ga0495580_0070690 3300046472 Bacteria 2438
1554 Ga0495580_0148683 3300046472 Bacteria 1623
1555 Ga0495580_0160798 3300046472 Bacteria 1554
1556 Ga0495582_0000385 3300046473 Bacteria 24035
1557 Ga0495582_0000679 3300046473 Bacteria 18714
1558 Ga0495582_0000793 3300046473 Bacteria 17488
1559 Ga0495582_0037338 3300046473 Bacteria 2672
1560 Ga0495582_0095002 3300046473 Bacteria 1665
1561 Ga0495605_0011002 3300046474 Bacteria 5054
1562 Ga0495639_0000161 3300046475 Bacteria 34648
1563 Ga0495639_0000233 3300046475 Bacteria 27728
1564 Ga0495639_0013398 3300046475 Bacteria 3540
1565 Ga0495639_0042076 3300046475 Bacteria 2059
1566 Ga0495639_0055393 3300046475 Bacteria 1809
1567 Ga0495662_0002657 3300046476 Bacteria 9034
1568 Ga0495662_0004884 3300046476 Bacteria 6717
1569 Ga0495662_0006646 3300046476 Bacteria 5769
1570 Ga0495664_0000003 3300046477 Bacteria 551602
1571 Ga0495664_0009236 3300046477 Bacteria 5512
1572 Ga0495664_0017860 3300046477 Bacteria 4056
1573 Ga0495664_0044447 3300046477 Bacteria 2632
1574 Ga0495664_0063331 3300046477 Bacteria 2203
1575 Ga0495664_0105692 3300046477 Bacteria 1697
1576 Ga0495584_0004151 3300046491 Bacteria 7819
1577 Ga0495584_0005330 3300046491 Bacteria 6816
1578 Ga0495584_0027038 3300046491 Bacteria 2907
1579 Ga0495584_0051421 3300046491 Bacteria 2075
1580 Ga0495585_0006974 3300046492 Bacteria 6954
1581 Ga0495585_0007162 3300046492 Bacteria 6849
1582 Ga0495585_0036945 3300046492 Bacteria 2752
1583 Ga0495585_0038672 3300046492 Bacteria 2684
1584 Ga0495585_0041580 3300046492 Bacteria 2577
1585 Ga0495594_0000255 3300046499 Bacteria 25909
1586 Ga0495594_0002249 3300046499 Bacteria 10050
1587 Ga0495607_0002872 3300046501 Bacteria 13617
1588 Ga0495607_0005625 3300046501 Bacteria 8939
1589 Ga0495583_0008791 3300046506 Bacteria 6125
1590 Ga0495606_0013420 3300046507 Bacteria 6471
1591 Ga0495606_0035648 3300046507 Bacteria 3398
1592 Ga0495606_0035855 3300046507 Bacteria 3386
1593 Ga0495606_0093185 3300046507 Bacteria 1848
1594 Ga0495608_0000072 3300046511 Bacteria 76887
1595 Ga0495608_0000282 3300046511 Bacteria 35820
1596 Ga0495608_0001255 3300046511 Bacteria 18042
1597 Ga0495608_0013731 3300046511 Bacteria 5618
1598 Ga0495608_0101568 3300046511 Bacteria 1854
1599 Ga0495608_0124634 3300046511 Bacteria 1651
1600 Ga0495610_0000530 3300046512 Bacteria 38418
1601 Ga0495610_0001267 3300046512 Bacteria 22640
1602 Ga0495618_0000019 3300046514 Bacteria 136770
1603 Ga0495618_0007700 3300046514 Bacteria 6513
1604 Ga0495618_0098373 3300046514 Bacteria 1872
1605 Ga0495628_0000080 3300046516 Bacteria 75108
1606 Ga0495628_0004979 3300046516 Bacteria 11671
1607 Ga0495628_0015875 3300046516 Bacteria 6286
1608 Ga0495628_0033397 3300046516 Bacteria 4148
1609 Ga0495628_0057951 3300046516 Bacteria 3046
1610 Ga0495628_0107627 3300046516 Bacteria 2146
1611 Ga0495630_0008279 3300046517 Bacteria 7468
1612 Ga0495630_0017710 3300046517 Bacteria 5223
1613 Ga0495630_0024068 3300046517 Bacteria 4503
1614 Ga0495630_0038629 3300046517 Bacteria 3570
1615 Ga0495630_0122282 3300046517 Bacteria 1975
1616 Ga0495631_0005295 3300046518 Bacteria 6775
1617 Ga0495631_0027980 3300046518 Bacteria 2574
1618 Ga0495631_0048290 3300046518 Bacteria 1867
1619 Ga0495631_0062505 3300046518 Bacteria 1613
1620 Ga0495632_0005390 3300046519 Bacteria 8461
1621 Ga0495632_0023573 3300046519 Bacteria 3285
1622 Ga0495637_0000004 3300046520 Bacteria 589740
1623 Ga0495637_0027801 3300046520 Bacteria 2527
1624 Ga0495637_0071812 3300046520 Bacteria 1395
1625 Ga0495643_0023035 3300046522 Bacteria 3544
1626 Ga0495643_0049524 3300046522 Bacteria 2265
1627 Ga0495643_0080428 3300046522 Bacteria 1696
1628 Ga0495648_0000382 3300046524 Bacteria 48626
1629 Ga0495648_0002308 3300046524 Bacteria 17765
1630 Ga0495648_0013844 3300046524 Bacteria 5941
1631 Ga0495648_0017029 3300046524 Bacteria 5215
1632 Ga0495663_0023010 3300046525 Bacteria 1802
1633 Ga0495663_0031713 3300046525 Bacteria 1571
1634 Ga0495666_0008457 3300046526 Bacteria 5162
1635 Ga0495666_0030379 3300046526 Bacteria 2652
1636 Ga0495666_0062568 3300046526 Bacteria 1777
1637 Ga0495652_0000006 3300046529 Bacteria 459709
1638 Ga0495652_0005586 3300046529 Bacteria 11817
1639 Ga0495652_0011158 3300046529 Bacteria 8138
1640 Ga0495652_0024608 3300046529 Bacteria 5327
1641 Ga0495652_0032370 3300046529 Bacteria 4574
1642 Ga0495652_0039570 3300046529 Bacteria 4077
1643 Ga0495652_0039885 3300046529 Bacteria 4059
1644 Ga0495652_0114031 3300046529 Bacteria 2169
1645 Ga0495654_0001982 3300046530 Bacteria 13493
1646 Ga0495665_0002175 3300046531 Bacteria 10601
1647 Ga0495665_0004399 3300046531 Bacteria 7607
1648 Ga0495665_0015137 3300046531 Bacteria 4156
1649 Ga0495665_0024507 3300046531 Bacteria 3241
1650 Ga0495665_0089653 3300046531 Bacteria 1616
1651 Ga0495640_0000002 3300046533 Bacteria 646434
1652 Ga0495640_0001369 3300046533 Bacteria 19192
1653 Ga0495640_0003966 3300046533 Bacteria 11848
1654 Ga0495640_0016407 3300046533 Bacteria 5541
1655 Ga0495640_0023451 3300046533 Bacteria 4495
1656 Ga0495640_0033195 3300046533 Bacteria 3669
1657 Ga0495640_0040413 3300046533 Bacteria 3266
1658 Ga0495640_0043960 3300046533 Bacteria 3108
1659 Ga0495640_0078013 3300046533 Bacteria 2207
1660 Ga0495640_0087467 3300046533 Bacteria 2061
1661 Ga0495586_0064927 3300046535 Bacteria 1990
1662 Ga0495587_0000001 3300046536 Bacteria 724132
1663 Ga0495587_0000314 3300046536 Bacteria 34436
1664 Ga0495587_0001140 3300046536 Bacteria 17405
1665 Ga0495587_0010772 3300046536 Bacteria 5806
1666 Ga0495587_0030897 3300046536 Bacteria 3246
1667 Ga0495587_0052418 3300046536 Bacteria 2407
1668 Ga0495609_0051638 3300046538 Bacteria 1830
1669 Ga0495621_0009389 3300046539 Bacteria 2968
1670 Ga0495597_0011889 3300046542 Bacteria 4211
1671 Ga0495597_0023795 3300046542 Bacteria 2832
1672 Ga0495645_0000284 3300046543 Bacteria 37169
1673 Ga0495645_0013793 3300046543 Bacteria 5726
1674 Ga0495645_0030779 3300046543 Bacteria 3910
1675 Ga0495645_0044736 3300046543 Bacteria 3229
1676 Ga0495645_0055053 3300046543 Bacteria 2889
1677 Ga0495645_0058653 3300046543 Bacteria 2792
1678 Ga0495645_0097767 3300046543 Bacteria 2090
1679 Ga0495622_0000481 3300046557 Bacteria 25103
1680 Ga0495622_0003266 3300046557 Bacteria 7667
1681 Ga0495622_0008864 3300046557 Bacteria 4658
1682 Ga0495622_0013013 3300046557 Bacteria 3861
1683 Ga0495622_0041972 3300046557 Bacteria 2127
1684 Ga0495622_0064935 3300046557 Bacteria 1688
1685 Ga0495633_0018493 3300046558 Bacteria 3539
1686 Ga0495633_0038118 3300046558 Bacteria 2297
1687 Ga0495633_0063273 3300046558 Bacteria 1731
1688 Ga0495667_0000021 3300046559 Bacteria 180625
1689 Ga0495667_0000392 3300046559 Bacteria 27924
1690 Ga0495667_0003673 3300046559 Bacteria 10325
1691 Ga0495667_0013071 3300046559 Bacteria 5623
1692 Ga0495667_0017614 3300046559 Bacteria 4825
1693 Ga0495667_0025523 3300046559 Bacteria 3981
1694 Ga0495667_0107560 3300046559 Bacteria 1802
1695 Ga0495668_0008589 3300046616 Bacteria 6357
1696 Ga0495668_0086649 3300046616 Bacteria 1718
1697 Ga0495634_0000396 3300046642 Bacteria 42784
1698 Ga0495634_0008801 3300046642 Bacteria 7486
1699 Ga0495634_0010485 3300046642 Bacteria 6786
1700 Ga0495634_0012404 3300046642 Bacteria 6169
1701 Ga0495634_0013214 3300046642 Bacteria 5969
1702 Ga0495634_0021617 3300046642 Bacteria 4545
1703 Ga0495634_0066382 3300046642 Bacteria 2389
1704 Ga0495634_0114137 3300046642 Bacteria 1735
1705 Ga0495611_0029517 3300046648 Bacteria 2405
1706 Ga0495611_0092552 3300046648 Bacteria 1398
1707 Ga0495625_0016626 3300046660 Bacteria 5781
1708 Ga0495625_0047456 3300046660 Bacteria 3096
1709 Ga0495635_0000001 3300046663 Bacteria 704901
1710 Ga0495635_0000722 3300046663 Bacteria 21330
1711 Ga0495635_0001197 3300046663 Bacteria 17285
1712 Ga0495635_0001645 3300046663 Bacteria 15067
1713 Ga0495635_0025607 3300046663 Bacteria 4110
1714 Ga0495635_0035758 3300046663 Bacteria 3444
1715 Ga0495588_0009402 3300046674 Bacteria 4518
1716 Ga0495588_0016615 3300046674 Bacteria 3559
1717 Ga0495588_0018029 3300046674 Bacteria 3437
1718 Ga0495588_0039713 3300046674 Bacteria 2398
1719 Ga0495588_0115870 3300046674 Bacteria 1412
1720 Ga0495657_0000088 3300046675 Bacteria 81307
1721 Ga0495657_0002613 3300046675 Bacteria 15065
1722 Ga0495657_0005123 3300046675 Bacteria 10397
1723 Ga0495657_0005203 3300046675 Bacteria 10304
1724 Ga0495657_0006519 3300046675 Bacteria 9127
1725 Ga0495657_0020196 3300046675 Bacteria 4792
1726 Ga0495657_0036037 3300046675 Bacteria 3423
1727 Ga0495657_0045394 3300046675 Bacteria 2982
1728 Ga0495657_0070709 3300046675 Bacteria 2280
1729 Ga0495599_0000025 3300046678 Bacteria 120337
1730 Ga0495599_0001552 3300046678 Bacteria 13225
1731 Ga0495599_0001956 3300046678 Bacteria 11938
1732 Ga0495599_0002003 3300046678 Bacteria 11777
1733 Ga0495599_0027883 3300046678 Bacteria 3538
1734 Ga0495623_0000058 3300046679 Bacteria 68197
1735 Ga0495623_0001489 3300046679 Bacteria 15874
1736 Ga0495623_0015704 3300046679 Bacteria 4893
1737 Ga0495623_0024957 3300046679 Bacteria 3851
1738 Ga0495623_0033995 3300046679 Bacteria 3270
1739 Ga0495623_0039940 3300046679 Bacteria 2997
1740 Ga0495646_0000003 3300046680 Bacteria 287773
1741 Ga0495647_0003355 3300046681 Bacteria 5130
1742 Ga0495647_0004330 3300046681 Bacteria 4602
1743 Ga0495647_0006295 3300046681 Bacteria 3924
1744 Ga0495647_0028614 3300046681 Bacteria 2056
1745 Ga0495658_0000229 3300046683 Bacteria 32147
1746 Ga0495658_0001094 3300046683 Bacteria 14309
1747 Ga0495658_0004563 3300046683 Bacteria 6811
1748 Ga0495658_0008841 3300046683 Bacteria 5007
1749 Ga0495669_0043990 3300046684 Bacteria 1988
1750 Ga0495613_0000386 3300046689 Bacteria 38025
1751 Ga0495613_0007259 3300046689 Bacteria 8249
1752 Ga0495613_0008404 3300046689 Bacteria 7664
1753 Ga0495613_0017342 3300046689 Bacteria 5366
1754 Ga0495613_0055986 3300046689 Bacteria 2896
1755 Ga0495613_0059035 3300046689 Bacteria 2813
1756 Ga0495613_0067773 3300046689 Bacteria 2604
1757 Ga0495624_0001906 3300046690 Bacteria 15879
1758 Ga0495624_0042986 3300046690 Bacteria 2884
1759 Ga0495624_0046742 3300046690 Bacteria 2752
1760 Ga0495624_0079178 3300046690 Bacteria 2038
1761 Ga0495624_0095797 3300046690 Bacteria 1829
1762 Ga0495670_0000125 3300046691 Bacteria 33077
1763 Ga0495670_0073465 3300046691 Bacteria 1733
1764 Ga0495671_0031197 3300046692 Bacteria 2725
1765 Ga0495671_0044218 3300046692 Bacteria 2234
1766 Ga0495671_0055100 3300046692 Bacteria 1970
1767 Ga0495671_0055615 3300046692 Bacteria 1960
1768 Ga0495600_0000042 3300046809 Bacteria 74873
1769 Ga0495600_0007908 3300046809 Bacteria 6516
1770 Ga0495600_0021576 3300046809 Bacteria 4126
1771 Ga0495600_0031165 3300046809 Bacteria 3453
1772 Ga0495600_0037198 3300046809 Bacteria 3164
1773 Ga0495600_0041246 3300046809 Bacteria 3007
1774 Ga0495600_0045335 3300046809 Bacteria 2869
1775 Ga0495600_0055342 3300046809 Bacteria 2591
1776 Ga0495660_0022496 3300046810 Bacteria 3599
1777 Ga0495660_0080201 3300046810 Bacteria 1713
1778 Ga0495581_0000121 3300047315 Bacteria 33464
1779 Ga0495581_0005283 3300047315 Bacteria 7469
1780 Ga0495581_0015433 3300047315 Bacteria 4434
1781 Ga0495581_0029748 3300047315 Bacteria 3165
1782 Ga0495581_0117941 3300047315 Bacteria 1544
1783 Ga0495604_0000008 3300047317 Bacteria 341160
1784 Ga0495604_0000168 3300047317 Bacteria 57429
1785 Ga0495604_0013564 3300047317 Bacteria 6499
1786 Ga0495604_0091587 3300047317 Bacteria 2254
1787 Ga0495604_0177352 3300047317 Bacteria 1493
1788 Ga0495674_0000028 3300047319 Bacteria 124722
1789 Ga0495674_0000573 3300047319 Bacteria 34362
1790 Ga0495674_0005253 3300047319 Bacteria 12425
1791 Ga0495674_0018268 3300047319 Bacteria 6529
1792 Ga0495674_0052639 3300047319 Bacteria 3581
1793 Ga0495674_0064963 3300047319 Bacteria 3171
1794 Ga0495674_0132557 3300047319 Bacteria 2099
1795 Ga0495672_0015658 3300047320 Bacteria 5139
1796 Ga0495672_0034520 3300047320 Bacteria 3124
1797 Ga0495672_0052337 3300047320 Bacteria 2399
1798 Ga0495672_0088634 3300047320 Bacteria 1704
1799 Ga0495676_0007864 3300047321 Bacteria 9779
1800 Ga0495676_0027874 3300047321 Bacteria 4838
1801 Ga0495676_0051409 3300047321 Bacteria 3297
1802 Ga0495676_0125008 3300047321 Bacteria 1865
1803 Ga0495676_0127912 3300047321 Bacteria 1838
1804 Ga0495676_0200205 3300047321 Bacteria 1388
1805 Ga0495680_0000285 3300047322 Bacteria 56843
1806 Ga0495680_0000711 3300047322 Bacteria 37349
1807 Ga0495680_0006090 3300047322 Bacteria 11263
1808 Ga0495680_0016476 3300047322 Bacteria 6346
1809 Ga0495680_0018505 3300047322 Bacteria 5909
1810 Ga0495680_0023560 3300047322 Bacteria 5117
1811 Ga0495680_0040575 3300047322 Bacteria 3707
1812 Ga0495680_0044275 3300047322 Bacteria 3520
1813 Ga0495680_0047821 3300047322 Bacteria 3362
1814 Ga0495680_0088775 3300047322 Bacteria 2322
1815 Ga0495680_0093221 3300047322 Bacteria 2255
1816 Ga0495683_0000248 3300047323 Bacteria 48653
1817 Ga0495687_005553 3300047443 Bacteria 7997
1818 Ga0495687_029152 3300047443 Bacteria 2558
1819 Ga0495675_0000511 3300047444 Bacteria 25141
1820 Ga0495675_0001085 3300047444 Bacteria 16486
1821 Ga0495675_0011969 3300047444 Bacteria 5452
1822 Ga0495675_0070146 3300047444 Bacteria 2212
1823 Ga0495675_0142347 3300047444 Bacteria 1485
1824 Ga0495677_0009375 3300047445 Bacteria 3615
1825 Ga0495679_007638 3300047446 Bacteria 4487
1826 Ga0495685_030260 3300047447 Bacteria 1862
1827 Ga0495673_0040145 3300047469 Bacteria 2117
1828 Ga0495681_0002823 3300047470 Bacteria 12290
1829 Ga0495684_0000002 3300047471 Bacteria 341216
1830 Ga0495684_0000803 3300047471 Bacteria 25497
1831 Ga0495684_0012024 3300047471 Bacteria 6674
1832 Ga0495684_0026256 3300047471 Bacteria 4475
1833 Ga0495684_0035297 3300047471 Bacteria 3835
1834 Ga0495684_0096102 3300047471 Bacteria 2242
1835 Ga0495684_0179447 3300047471 Bacteria 1570
1836 Ga0495686_0002420 3300047472 Bacteria 17652
1837 Ga0495686_0003490 3300047472 Bacteria 13592
1838 Ga0495686_0021146 3300047472 Bacteria 4327
1839 Ga0495686_0036677 3300047472 Bacteria 3146
1840 Ga0495686_0061046 3300047472 Bacteria 2342
1841 Ga0495686_0147368 3300047472 Bacteria 1384
1842 Ga0495593_0000379 3300047673 Bacteria 24569
1843 Ga0495593_0000434 3300047673 Bacteria 23326
1844 Ga0495593_0000763 3300047673 Bacteria 18697
1845 Ga0495593_0001424 3300047673 Bacteria 14031
1846 Ga0495593_0062052 3300047673 Bacteria 1954
1847 Ga0495593_0089574 3300047673 Bacteria 1585
1848 Ga0495593_0093930 3300047673 Bacteria 1543
1849 Ga0495593_0098761 3300047673 Bacteria 1499
1850 Ga0495602_0000468 3300048088 Bacteria 37400
1851 Ga0495602_0002627 3300048088 Bacteria 18358
1852 Ga0495602_0005586 3300048088 Bacteria 13201
1853 Ga0495602_0018448 3300048088 Bacteria 6968
1854 Ga0495602_0050209 3300048088 Bacteria 3729
1855 Ga0495602_0057794 3300048088 Bacteria 3400
1856 Ga0495602_0079676 3300048088 Bacteria 2761
1857 Ga0495602_0086241 3300048088 Bacteria 2621
1858 Ga0495614_0008914 3300048089 Bacteria 4451
1859 Ga0495626_0000085 3300048091 Bacteria 125255
1860 Ga0495626_0033198 3300048091 Bacteria 2475
1861 Ga0495626_0075245 3300048091 Bacteria 1509
1862 Ga0496100_0000249 3300048903 Bacteria 27845
1863 Ga0496100_0003697 3300048903 Bacteria 8009
1864 Ga0496100_0011928 3300048903 Bacteria 4964
1865 Ga0496100_0011981 3300048903 Bacteria 4955
1866 Ga0496100_0022664 3300048903 Bacteria 3802
1867 Ga0496100_0027384 3300048903 Bacteria 3505
1868 Ga0496100_0034966 3300048903 Bacteria 3157
1869 Ga0496100_0040740 3300048903 Bacteria 2957
1870 Ga0496100_0141206 3300048903 Bacteria 1707
1871 Ga0496100_0158338 3300048903 Bacteria 1621
1872 Ga0496100_0166284 3300048903 Bacteria 1585
1873 Ga0496101_0000599 3300048904 Bacteria 21979
1874 Ga0496101_0001698 3300048904 Bacteria 13177
1875 Ga0496101_0002247 3300048904 Bacteria 11805
1876 Ga0496101_0007434 3300048904 Bacteria 7100
1877 Ga0496101_0026708 3300048904 Bacteria 4015
1878 Ga0496101_0043411 3300048904 Bacteria 3214
1879 Ga0496101_0062367 3300048904 Bacteria 2710
1880 Ga0496101_0109991 3300048904 Bacteria 2073
1881 Ga0496101_0119052 3300048904 Bacteria 1995
1882 Ga0496101_0128557 3300048904 Bacteria 1922
1883 Ga0496101_0140038 3300048904 Bacteria 1843
1884 Ga0496102_0000433 3300048905 Bacteria 48390
1885 Ga0496102_0001207 3300048905 Bacteria 23463
1886 Ga0496102_0006852 3300048905 Bacteria 9724
1887 Ga0496102_0011364 3300048905 Bacteria 7672
1888 Ga0496102_0028773 3300048905 Bacteria 4967
1889 Ga0496102_0039332 3300048905 Bacteria 4273
1890 Ga0496102_0041696 3300048905 Bacteria 4158
1891 Ga0496102_0073655 3300048905 Bacteria 3138
1892 Ga0496102_0126553 3300048905 Bacteria 2388
1893 Ga0496102_0138854 3300048905 Bacteria 2278
1894 Ga0496102_0311711 3300048905 Bacteria 1483
1895 Ga0496103_0000849 3300048906 Bacteria 22358
1896 Ga0496103_0019786 3300048906 Bacteria 4041
1897 Ga0496103_0021414 3300048906 Bacteria 3888
1898 Ga0496103_0037523 3300048906 Bacteria 2969
1899 Ga0496103_0052115 3300048906 Bacteria 2534
1900 Ga0496103_0058356 3300048906 Bacteria 2397
1901 Ga0496104_0000311 3300048907 Bacteria 43387
1902 Ga0496104_0000352 3300048907 Bacteria 41135
1903 Ga0496104_0000900 3300048907 Bacteria 25552
1904 Ga0496104_0002052 3300048907 Bacteria 17490
1905 Ga0496104_0004221 3300048907 Bacteria 12478
1906 Ga0496104_0014004 3300048907 Bacteria 7235
1907 Ga0496104_0014512 3300048907 Bacteria 7116
1908 Ga0496104_0018509 3300048907 Bacteria 6355
1909 Ga0496104_0019479 3300048907 Bacteria 6209
1910 Ga0496104_0029954 3300048907 Bacteria 5053
1911 Ga0496104_0042931 3300048907 Bacteria 4246
1912 Ga0496104_0046825 3300048907 Bacteria 4074
1913 Ga0496104_0048911 3300048907 Bacteria 3988
1914 Ga0496104_0063578 3300048907 Bacteria 3500
1915 Ga0496104_0073044 3300048907 Bacteria 3263
1916 Ga0496104_0077323 3300048907 Bacteria 3171
1917 Ga0496104_0087001 3300048907 Bacteria 2984
1918 Ga0496104_0097204 3300048907 Bacteria 2818
1919 Ga0496104_0122319 3300048907 Bacteria 2498
1920 Ga0496104_0142135 3300048907 Bacteria 2306
1921 Ga0496104_0155751 3300048907 Bacteria 2192
1922 Ga0496105_0000363 3300048908 Bacteria 30056
1923 Ga0496105_0004311 3300048908 Bacteria 10711
1924 Ga0496105_0007594 3300048908 Bacteria 8405
1925 Ga0496105_0012656 3300048908 Bacteria 6682
1926 Ga0496105_0017159 3300048908 Bacteria 5798
1927 Ga0496105_0021111 3300048908 Bacteria 5267
1928 Ga0496105_0024665 3300048908 Bacteria 4887
1929 Ga0496105_0030126 3300048908 Bacteria 4446
1930 Ga0496105_0032869 3300048908 Bacteria 4257
1931 Ga0496105_0034406 3300048908 Bacteria 4166
1932 Ga0496105_0042410 3300048908 Bacteria 3751
1933 Ga0496105_0061549 3300048908 Bacteria 3098
1934 Ga0496105_0080673 3300048908 Bacteria 2688
1935 Ga0496105_0102493 3300048908 Bacteria 2363
1936 Ga0496105_0156961 3300048908 Bacteria 1868
1937 Ga0496105_0163028 3300048908 Bacteria 1830
1938 Ga0496105_0272165 3300048908 Bacteria 1367
1939 Ga0496106_0001807 3300048909 Bacteria 15990
1940 Ga0496106_0003291 3300048909 Bacteria 12070
1941 Ga0496106_0003451 3300048909 Bacteria 11777
1942 Ga0496106_0008474 3300048909 Bacteria 7606
1943 Ga0496106_0009134 3300048909 Bacteria 7326
1944 Ga0496106_0013977 3300048909 Bacteria 5936
1945 Ga0496106_0074745 3300048909 Bacteria 2594
1946 Ga0496106_0169976 3300048909 Bacteria 1727
1947 Ga0496107_0000078 3300048910 Bacteria 46997
1948 Ga0496107_0003003 3300048910 Bacteria 11176
1949 Ga0496107_0011933 3300048910 Bacteria 6067
1950 Ga0496107_0012977 3300048910 Bacteria 5821
1951 Ga0496107_0017121 3300048910 Bacteria 5096
1952 Ga0496107_0021779 3300048910 Bacteria 4528
1953 Ga0496107_0043107 3300048910 Bacteria 3241
1954 Ga0496107_0091251 3300048910 Bacteria 2226
1955 Ga0496107_0104427 3300048910 Bacteria 2079
1956 Ga0496107_0132191 3300048910 Bacteria 1843
1957 Ga0496107_0229894 3300048910 Bacteria 1380
1958 Ga0496108_0000256 3300048911 Bacteria 46076
1959 Ga0496108_0001039 3300048911 Bacteria 21656
1960 Ga0496108_0001178 3300048911 Bacteria 20397
1961 Ga0496108_0004093 3300048911 Bacteria 11705
1962 Ga0496108_0005723 3300048911 Bacteria 10061
1963 Ga0496108_0006129 3300048911 Bacteria 9726
1964 Ga0496108_0013891 3300048911 Bacteria 6568
1965 Ga0496108_0027851 3300048911 Bacteria 4672
1966 Ga0496108_0028010 3300048911 Bacteria 4660
1967 Ga0496108_0047343 3300048911 Bacteria 3594
1968 Ga0496108_0055851 3300048911 Bacteria 3316
1969 Ga0496108_0061998 3300048911 Bacteria 3148
1970 Ga0496108_0094442 3300048911 Bacteria 2545
1971 Ga0496108_0342193 3300048911 Bacteria 1305
1972 Ga0496109_0000567 3300048912 Bacteria 30903
1973 Ga0496109_0000730 3300048912 Bacteria 27368
1974 Ga0496109_0001475 3300048912 Bacteria 19522
1975 Ga0496109_0005690 3300048912 Bacteria 10433
1976 Ga0496109_0025359 3300048912 Bacteria 5283
1977 Ga0496109_0039192 3300048912 Bacteria 4287
1978 Ga0496109_0050473 3300048912 Bacteria 3789
1979 Ga0496109_0108637 3300048912 Bacteria 2578
1980 Ga0496109_0139271 3300048912 Bacteria 2268
1981 Ga0496109_0186100 3300048912 Bacteria 1951
1982 Ga0496110_0003430 3300048913 Bacteria 12132
1983 Ga0496110_0004642 3300048913 Bacteria 10677
1984 Ga0496110_0007215 3300048913 Bacteria 8852
1985 Ga0496110_0010645 3300048913 Bacteria 7486
1986 Ga0496110_0022510 3300048913 Bacteria 5353
1987 Ga0496110_0037247 3300048913 Bacteria 4227
1988 Ga0496110_0043177 3300048913 Bacteria 3936
1989 Ga0496110_0043511 3300048913 Bacteria 3921
1990 Ga0496110_0045002 3300048913 Bacteria 3856
1991 Ga0496110_0074619 3300048913 Bacteria 3012
1992 Ga0496110_0094998 3300048913 Bacteria 2670
1993 Ga0496110_0101204 3300048913 Bacteria 2583
1994 Ga0496110_0121857 3300048913 Bacteria 2350
1995 Ga0496110_0213022 3300048913 Bacteria 1757
1996 Ga0496111_0001190 3300048914 Bacteria 14505
1997 Ga0496111_0004420 3300048914 Bacteria 8888
1998 Ga0496111_0004667 3300048914 Bacteria 8682
1999 Ga0496111_0009069 3300048914 Bacteria 6622
2000 Ga0496111_0017583 3300048914 Bacteria 4943
2001 Ga0496111_0025302 3300048914 Bacteria 4188
2002 Ga0496111_0069931 3300048914 Bacteria 2552
2003 Ga0496111_0075617 3300048914 Bacteria 2454
2004 Ga0496111_0159886 3300048914 Bacteria 1672
2005 Ga0496112_0000015 3300048915 Bacteria 206423
2006 Ga0496112_0002924 3300048915 Bacteria 13914
2007 Ga0496112_0003013 3300048915 Bacteria 13767
2008 Ga0496112_0012837 3300048915 Bacteria 7710
2009 Ga0496112_0013962 3300048915 Bacteria 7433
2010 Ga0496112_0022734 3300048915 Bacteria 5981
2011 Ga0496112_0023921 3300048915 Bacteria 5844
2012 Ga0496112_0034816 3300048915 Bacteria 4901
2013 Ga0496112_0037020 3300048915 Bacteria 4762
2014 Ga0496112_0049874 3300048915 Bacteria 4103
2015 Ga0496112_0100146 3300048915 Bacteria 2867
2016 Ga0496112_0146057 3300048915 Bacteria 2333
2017 Ga0496112_0158369 3300048915 Bacteria 2231
2018 Ga0496112_0260257 3300048915 Bacteria 1684
2019 Ga0496113_0001666 3300048916 Bacteria 12560
2020 Ga0496113_0003159 3300048916 Bacteria 9806
2021 Ga0496113_0005719 3300048916 Bacteria 7789
2022 Ga0496113_0011593 3300048916 Bacteria 5890
2023 Ga0496113_0051264 3300048916 Bacteria 3079
2024 Ga0496113_0058744 3300048916 Bacteria 2895
2025 Ga0496113_0072224 3300048916 Bacteria 2626
2026 Ga0496113_0104622 3300048916 Bacteria 2197
2027 Ga0496113_0128553 3300048916 Bacteria 1986
2028 Ga0496113_0137141 3300048916 Bacteria 1923
2029 Ga0496113_0244634 3300048916 Bacteria 1431
2030 Ga0496113_0277964 3300048916 Bacteria 1338
2031 Ga0496114_0001673 3300048917 Bacteria 16833
2032 Ga0496114_0002231 3300048917 Bacteria 14760
2033 Ga0496114_0002873 3300048917 Bacteria 13208
2034 Ga0496114_0020390 3300048917 Bacteria 5381
2035 Ga0496114_0030544 3300048917 Bacteria 4433
2036 Ga0496114_0104570 3300048917 Bacteria 2421
2037 Ga0496114_0108460 3300048917 Bacteria 2376
2038 Ga0496114_0190488 3300048917 Bacteria 1794
2039 Ga0496114_0196767 3300048917 Bacteria 1764
2040 Ga0496115_0000437 3300048918 Bacteria 33699
2041 Ga0496115_0000541 3300048918 Bacteria 29407
2042 Ga0496115_0001012 3300048918 Bacteria 20389
2043 Ga0496115_0007765 3300048918 Bacteria 7910
2044 Ga0496115_0076799 3300048918 Bacteria 2715
2045 Ga0496115_0085978 3300048918 Bacteria 2565
2046 Ga0496115_0121284 3300048918 Bacteria 2151
2047 Ga0496115_0123878 3300048918 Bacteria 2128
2048 Ga0496115_0155249 3300048918 Bacteria 1891
2049 Ga0496115_0231510 3300048918 Bacteria 1523
2050 Ga0496115_0266918 3300048918 Bacteria 1407
2051 Ga0496116_0000057 3300048919 Bacteria 281652
2052 Ga0496116_0002318 3300048919 Bacteria 20175
2053 Ga0496116_0015322 3300048919 Bacteria 6064
2054 Ga0496116_0022830 3300048919 Bacteria 4675
2055 Ga0496116_0066889 3300048919 Bacteria 2297
2056 Ga0496117_0000031 3300048920 Bacteria 381048
2057 Ga0496117_0003614 3300048920 Bacteria 17814
2058 Ga0496117_0008139 3300048920 Bacteria 10023
2059 Ga0496117_0014441 3300048920 Bacteria 6803
2060 Ga0496117_0020411 3300048920 Bacteria 5402
2061 Ga0496117_0023711 3300048920 Bacteria 4878
2062 Ga0496117_0027983 3300048920 Bacteria 4372
2063 Ga0496117_0088586 3300048920 Bacteria 2002
2064 Ga0496118_0000899 3300048921 Bacteria 46663
2065 Ga0496118_0004165 3300048921 Bacteria 17449
2066 Ga0496118_0005042 3300048921 Bacteria 15233
2067 Ga0496118_0009394 3300048921 Bacteria 9890
2068 Ga0496118_0011865 3300048921 Bacteria 8442
2069 Ga0496118_0013833 3300048921 Bacteria 7597
2070 Ga0496118_0064361 3300048921 Bacteria 2691
2071 Ga0496119_0000483 3300048922 Bacteria 54518
2072 Ga0496119_0007259 3300048922 Bacteria 10024
2073 Ga0496119_0019218 3300048922 Bacteria 5045
2074 Ga0496119_0116419 3300048922 Bacteria 1475
2075 Ga0496120_0000337 3300048923 Bacteria 78140
2076 Ga0496120_0021409 3300048923 Bacteria 4088
2077 Ga0496120_0086695 3300048923 Bacteria 1682
2078 Ga0496121_0000034 3300048924 Bacteria 377095
2079 Ga0496121_0000435 3300048924 Bacteria 82421
2080 Ga0496121_0000453 3300048924 Bacteria 80749
2081 Ga0496121_0002503 3300048924 Bacteria 27924
2082 Ga0496121_0003229 3300048924 Bacteria 23446
2083 Ga0496121_0005291 3300048924 Bacteria 16613
2084 Ga0496121_0008351 3300048924 Bacteria 12223
2085 Ga0496121_0010238 3300048924 Bacteria 10611
2086 Ga0496121_0017251 3300048924 Bacteria 7388
2087 Ga0496121_0017810 3300048924 Bacteria 7215
2088 Ga0496121_0022569 3300048924 Bacteria 6099
2089 Ga0496121_0023721 3300048924 Bacteria 5896
2090 Ga0496121_0170934 3300048924 Bacteria 1579
2091 Ga0496122_0000023 3300048925 Bacteria 381035
2092 Ga0496122_0000074 3300048925 Bacteria 219900
2093 Ga0496122_0001772 3300048925 Bacteria 33099
2094 Ga0496122_0005603 3300048925 Bacteria 14856
2095 Ga0496122_0009256 3300048925 Bacteria 10419
2096 Ga0496122_0012716 3300048925 Bacteria 8335
2097 Ga0496122_0022157 3300048925 Bacteria 5657
2098 Ga0496122_0026121 3300048925 Bacteria 5049
2099 Ga0496122_0081963 3300048925 Bacteria 2243
2100 Ga0496122_0089191 3300048925 Bacteria 2109
2101 Ga0496122_0130036 3300048925 Bacteria 1602
2102 Ga0496122_0143320 3300048925 Bacteria 1490
2103 Ga0496123_0000027 3300048926 Bacteria 306773
2104 Ga0496123_0000062 3300048926 Bacteria 219882
2105 Ga0496123_0001756 3300048926 Bacteria 28612
2106 Ga0496123_0003477 3300048926 Bacteria 17605
2107 Ga0496123_0023676 3300048926 Bacteria 4693
2108 Ga0496123_0024129 3300048926 Bacteria 4632
2109 Ga0496123_0047485 3300048926 Bacteria 2899
2110 Ga0496123_0055394 3300048926 Bacteria 2602
2111 Ga0496124_0000155 3300048927 Bacteria 138529
2112 Ga0496124_0000174 3300048927 Bacteria 129228
2113 Ga0496124_0002790 3300048927 Bacteria 22160
2114 Ga0496124_0004778 3300048927 Bacteria 15594
2115 Ga0496124_0009391 3300048927 Bacteria 10077
2116 Ga0496124_0014268 3300048927 Bacteria 7692
2117 Ga0496124_0111111 3300048927 Bacteria 2205
2118 Ga0496124_0203961 3300048927 Bacteria 1501
2119 Ga0496124_0214986 3300048927 Bacteria 1451
2120 Ga0496125_0000030 3300048928 Bacteria 375023
2121 Ga0496125_0000398 3300048928 Bacteria 81112
2122 Ga0496125_0004399 3300048928 Bacteria 16305
2123 Ga0496125_0006845 3300048928 Bacteria 12222
2124 Ga0496125_0009727 3300048928 Bacteria 9817
2125 Ga0496125_0020756 3300048928 Bacteria 6157
2126 Ga0496125_0034144 3300048928 Bacteria 4487
2127 Ga0496125_0039635 3300048928 Bacteria 4053
2128 Ga0496125_0167215 3300048928 Bacteria 1484
2129 Ga0496126_0000892 3300048929 Bacteria 52105
2130 Ga0496126_0003241 3300048929 Bacteria 20805
2131 Ga0496126_0004111 3300048929 Bacteria 17610
2132 Ga0496126_0010756 3300048929 Bacteria 9554
2133 Ga0496126_0016310 3300048929 Bacteria 7432
2134 Ga0496126_0027644 3300048929 Bacteria 5415
2135 Ga0496126_0030387 3300048929 Bacteria 5118
2136 Ga0496126_0031901 3300048929 Bacteria 4971
2137 Ga0496126_0040027 3300048929 Bacteria 4346
2138 Ga0496126_0044458 3300048929 Bacteria 4089
2139 Ga0496126_0056292 3300048929 Bacteria 3555
2140 Ga0496126_0061667 3300048929 Bacteria 3368
2141 Ga0496126_0064232 3300048929 Bacteria 3289
2142 Ga0496126_0067841 3300048929 Bacteria 3186
2143 Ga0496126_0079093 3300048929 Bacteria 2912
2144 Ga0496126_0105376 3300048929 Bacteria 2462
2145 Ga0496126_0108834 3300048929 Bacteria 2416
2146 Ga0496126_0121679 3300048929 Bacteria 2262
2147 Ga0496126_0151904 3300048929 Bacteria 1984
2148 Ga0496126_0166147 3300048929 Bacteria 1883
2149 Ga0496126_0198058 3300048929 Bacteria 1697
2150 Ga0496126_0287273 3300048929 Bacteria 1361
2151 Ga0496126_0304707 3300048929 Bacteria 1313
2152 Ga0495678_000439 3300049459 Bacteria 41538
2153 Ga0501031_0000598 3300049568 Bacteria 21233
2154 Ga0501031_0002850 3300049568 Bacteria 11039
2155 Ga0501031_0019447 3300049568 Bacteria 4425
2156 Ga0501031_0039066 3300049568 Bacteria 3096
2157 Ga0501031_0092239 3300049568 Bacteria 1976
2158 Ga0501031_0138670 3300049568 Bacteria 1589
2159 Ga0501032_0000150 3300049569 Bacteria 56406
2160 Ga0501032_0007205 3300049569 Bacteria 8135
2161 Ga0501032_0007475 3300049569 Bacteria 7982
2162 Ga0501032_0013894 3300049569 Bacteria 5712
2163 Ga0501032_0016542 3300049569 Bacteria 5187
2164 Ga0501032_0024318 3300049569 Bacteria 4184
2165 Ga0501032_0030574 3300049569 Bacteria 3696
2166 Ga0501032_0053013 3300049569 Bacteria 2732
2167 Ga0501032_0133515 3300049569 Bacteria 1636
2168 Ga0501033_0000075 3300049570 Bacteria 94239
2169 Ga0501033_0000469 3300049570 Bacteria 38207
2170 Ga0501033_0005482 3300049570 Bacteria 10046
2171 Ga0501033_0005793 3300049570 Bacteria 9724
2172 Ga0501033_0015297 3300049570 Bacteria 5820
2173 Ga0501033_0021230 3300049570 Bacteria 4899
2174 Ga0501033_0042182 3300049570 Bacteria 3402
2175 Ga0501033_0050348 3300049570 Bacteria 3090
2176 Ga0501033_0062452 3300049570 Bacteria 2743
2177 Ga0501033_0171390 3300049570 Bacteria 1558
2178 Ga0501034_0000113 3300049571 Bacteria 149824
2179 Ga0501034_0001253 3300049571 Bacteria 34491
2180 Ga0501034_0003747 3300049571 Bacteria 17175
2181 Ga0501034_0024599 3300049571 Bacteria 6126
2182 Ga0501034_0054795 3300049571 Bacteria 4013
2183 Ga0501034_0054907 3300049571 Bacteria 4009
2184 Ga0501034_0057340 3300049571 Bacteria 3916
2185 Ga0501034_0078547 3300049571 Bacteria 3304
2186 Ga0501034_0087240 3300049571 Bacteria 3120
2187 Ga0501034_0090948 3300049571 Bacteria 3049
2188 Ga0501034_0114283 3300049571 Bacteria 2688
2189 Ga0501034_0230011 3300049571 Bacteria 1803
2190 Ga0501034_0241343 3300049571 Bacteria 1753
2191 Ga0501034_0380588 3300049571 Bacteria 1336
2192 Ga0501036_0000059 3300049572 Bacteria 72347
2193 Ga0501036_0008929 3300049572 Bacteria 8238
2194 Ga0501036_0020295 3300049572 Bacteria 5581
2195 Ga0501036_0040701 3300049572 Bacteria 3930
2196 Ga0501036_0049500 3300049572 Bacteria 3558
2197 Ga0501036_0060519 3300049572 Bacteria 3208
2198 Ga0501036_0069645 3300049572 Bacteria 2975
2199 Ga0501036_0134891 3300049572 Bacteria 2083
2200 Ga0501036_0215937 3300049572 Bacteria 1611
2201 Ga0501036_0229654 3300049572 Bacteria 1557
2202 Ga0501036_0249791 3300049572 Bacteria 1487
2203 Ga0501037_0000302 3300049573 Bacteria 41778
2204 Ga0501037_0002854 3300049573 Bacteria 12531
2205 Ga0501037_0004321 3300049573 Bacteria 10307
2206 Ga0501037_0006349 3300049573 Bacteria 8641
2207 Ga0501037_0026515 3300049573 Bacteria 4283
2208 Ga0501037_0082799 3300049573 Bacteria 2324
2209 Ga0501037_0125283 3300049573 Bacteria 1845
2210 Ga0501037_0157358 3300049573 Bacteria 1621
2211 Ga0501038_0000580 3300049574 Bacteria 32444
2212 Ga0501038_0001565 3300049574 Bacteria 21184
2213 Ga0501038_0005993 3300049574 Bacteria 11243
2214 Ga0501038_0012461 3300049574 Bacteria 7771
2215 Ga0501038_0021411 3300049574 Bacteria 5804
2216 Ga0501038_0069287 3300049574 Bacteria 2996
2217 Ga0501038_0080561 3300049574 Bacteria 2744
2218 Ga0501038_0088438 3300049574 Bacteria 2600
2219 Ga0501038_0132981 3300049574 Bacteria 2040
2220 Ga0501038_0193283 3300049574 Bacteria 1636
2221 Ga0501038_0222942 3300049574 Bacteria 1503
2222 Ga0501039_0000067 3300049575 Bacteria 79511
2223 Ga0501039_0002320 3300049575 Bacteria 14131
2224 Ga0501039_0007921 3300049575 Bacteria 8095
2225 Ga0501039_0026740 3300049575 Bacteria 4434
2226 Ga0501039_0029863 3300049575 Bacteria 4200
2227 Ga0501039_0063214 3300049575 Bacteria 2868
2228 Ga0501039_0201549 3300049575 Bacteria 1564
2229 Ga0501040_0010829 3300049576 Bacteria 5962
2230 Ga0501040_0013750 3300049576 Bacteria 5325
2231 Ga0501040_0017414 3300049576 Bacteria 4769
2232 Ga0501040_0040136 3300049576 Bacteria 3184
2233 Ga0501040_0046525 3300049576 Bacteria 2962
2234 Ga0501040_0149937 3300049576 Bacteria 1645
2235 Ga0501042_0015506 3300049578 Bacteria 5219
2236 Ga0501042_0028811 3300049578 Bacteria 3916
2237 Ga0501042_0040774 3300049578 Bacteria 3300
2238 Ga0501042_0045522 3300049578 Bacteria 3127
2239 Ga0501042_0099527 3300049578 Bacteria 2090
2240 Ga0501042_0110947 3300049578 Bacteria 1975
2241 Ga0501043_0000006 3300049579 Bacteria 234413
2242 Ga0501043_0000017 3300049579 Bacteria 166630
2243 Ga0501043_0002138 3300049579 Bacteria 16873
2244 Ga0501043_0024078 3300049579 Bacteria 4777
2245 Ga0501043_0065633 3300049579 Bacteria 2850
2246 Ga0501043_0077835 3300049579 Bacteria 2605
2247 Ga0501043_0077912 3300049579 Bacteria 2604
2248 Ga0501043_0119756 3300049579 Bacteria 2064
2249 Ga0501043_0207583 3300049579 Bacteria 1518
2250 Ga0501043_0211370 3300049579 Bacteria 1503
2251 Ga0501046_0000838 3300049580 Bacteria 29972
2252 Ga0501046_0010020 3300049580 Bacteria 8162
2253 Ga0501046_0012094 3300049580 Bacteria 7359
2254 Ga0501046_0017926 3300049580 Bacteria 5901
2255 Ga0501046_0042801 3300049580 Bacteria 3610
2256 Ga0501046_0043027 3300049580 Bacteria 3597
2257 Ga0501046_0064386 3300049580 Bacteria 2862
2258 Ga0501046_0110298 3300049580 Bacteria 2103
2259 Ga0501047_0000181 3300049581 Bacteria 76945
2260 Ga0501047_0000384 3300049581 Bacteria 49644
2261 Ga0501047_0001719 3300049581 Bacteria 21291
2262 Ga0501047_0003718 3300049581 Bacteria 14367
2263 Ga0501047_0020399 3300049581 Bacteria 6365
2264 Ga0501047_0026599 3300049581 Bacteria 5567
2265 Ga0501047_0047642 3300049581 Bacteria 4140
2266 Ga0501047_0153725 3300049581 Bacteria 2175
2267 Ga0501048_0000071 3300049582 Bacteria 52466
2268 Ga0501048_0000074 3300049582 Bacteria 51762
2269 Ga0501048_0019318 3300049582 Bacteria 5000
2270 Ga0501048_0029448 3300049582 Bacteria 3982
2271 Ga0501048_0094486 3300049582 Bacteria 2109
2272 Ga0501067_0000196 3300049583 Bacteria 34030
2273 Ga0501067_0012549 3300049583 Bacteria 4701
2274 Ga0501067_0020429 3300049583 Bacteria 3665
2275 Ga0501068_0000210 3300049584 Bacteria 28155
2276 Ga0501068_0077121 3300049584 Bacteria 2040
2277 Ga0501068_0111971 3300049584 Bacteria 1697
2278 Ga0501069_0000024 3300049585 Bacteria 117140
2279 Ga0501069_0008631 3300049585 Bacteria 5364
2280 Ga0501069_0021941 3300049585 Bacteria 3469
2281 Ga0501069_0025052 3300049585 Bacteria 3258
2282 Ga0501070_0000093 3300049586 Bacteria 76623
2283 Ga0501070_0002397 3300049586 Bacteria 16442
2284 Ga0501070_0003457 3300049586 Bacteria 13698
2285 Ga0501070_0005902 3300049586 Bacteria 10444
2286 Ga0501070_0007368 3300049586 Bacteria 9342
2287 Ga0501070_0010222 3300049586 Bacteria 7939
2288 Ga0501070_0014212 3300049586 Bacteria 6699
2289 Ga0501070_0020486 3300049586 Bacteria 5547
2290 Ga0501070_0020720 3300049586 Bacteria 5515
2291 Ga0501070_0053253 3300049586 Bacteria 3357
2292 Ga0501070_0084335 3300049586 Bacteria 2631
2293 Ga0501070_0146274 3300049586 Bacteria 1950
2294 Ga0501070_0268234 3300049586 Bacteria 1394
2295 Ga0501071_0009884 3300049587 Bacteria 6371
2296 Ga0501071_0014973 3300049587 Bacteria 5314
2297 Ga0501071_0025240 3300049587 Bacteria 4161
2298 Ga0501071_0069793 3300049587 Bacteria 2559
2299 Ga0501071_0074257 3300049587 Bacteria 2481
2300 Ga0501071_0231709 3300049587 Bacteria 1391
2301 Ga0501072_0000275 3300049588 Bacteria 37187
2302 Ga0501072_0039495 3300049588 Bacteria 3705
2303 Ga0501072_0041802 3300049588 Bacteria 3600
2304 Ga0501072_0071385 3300049588 Bacteria 2743
2305 Ga0501072_0082328 3300049588 Bacteria 2551
2306 Ga0501072_0274845 3300049588 Bacteria 1340
2307 Ga0501073_0000054 3300049589 Bacteria 71831
2308 Ga0501073_0036453 3300049589 Bacteria 3494
2309 Ga0501073_0052052 3300049589 Bacteria 2868
2310 Ga0501073_0070142 3300049589 Bacteria 2441
2311 Ga0501073_0121374 3300049589 Bacteria 1811
2312 Ga0501073_0131413 3300049589 Bacteria 1735
2313 Ga0501073_0167387 3300049589 Bacteria 1522
2314 Ga0501074_0000073 3300049590 Bacteria 48551
2315 Ga0501074_0000216 3300049590 Bacteria 31702
2316 Ga0501074_0001376 3300049590 Bacteria 16127
2317 Ga0501074_0015532 3300049590 Bacteria 5534
2318 Ga0501074_0015582 3300049590 Bacteria 5525
2319 Ga0501074_0018888 3300049590 Bacteria 5006
2320 Ga0501074_0042994 3300049590 Bacteria 3270
2321 Ga0501074_0047669 3300049590 Bacteria 3096
2322 Ga0501074_0061089 3300049590 Bacteria 2715
2323 Ga0501075_0006476 3300049591 Bacteria 8059
2324 Ga0501075_0063401 3300049591 Bacteria 2786
2325 Ga0501075_0148363 3300049591 Bacteria 1788
2326 Ga0501075_0174953 3300049591 Bacteria 1638
2327 Ga0501076_0007396 3300049592 Bacteria 7993
2328 Ga0501076_0010040 3300049592 Bacteria 7006
2329 Ga0501076_0073178 3300049592 Bacteria 2743
2330 Ga0501076_0168614 3300049592 Bacteria 1784
2331 Ga0501077_0006840 3300049593 Bacteria 7015
2332 Ga0501077_0049506 3300049593 Bacteria 2670
2333 Ga0501077_0107859 3300049593 Bacteria 1764
2334 Ga0501238_003209 3300049671 Bacteria 2001
2335 Ga0501079_0007319 3300049741 Bacteria 8341
2336 Ga0501079_0021846 3300049741 Bacteria 4899
2337 Ga0501079_0024563 3300049741 Bacteria 4625
2338 Ga0501079_0047913 3300049741 Bacteria 3297
2339 Ga0501079_0100373 3300049741 Bacteria 2244
2340 Ga0501079_0120485 3300049741 Bacteria 2040
2341 Ga0501079_0122955 3300049741 Bacteria 2018
2342 Ga0501079_0136163 3300049741 Bacteria 1912
2343 Ga0501079_0177867 3300049741 Bacteria 1660
2344 Ga0501080_0000146 3300049742 Bacteria 50230
2345 Ga0501080_0001148 3300049742 Bacteria 21848
2346 Ga0501080_0003412 3300049742 Bacteria 14006
2347 Ga0501080_0020553 3300049742 Bacteria 6114
2348 Ga0501080_0039828 3300049742 Bacteria 4385
2349 Ga0501080_0042992 3300049742 Bacteria 4206
2350 Ga0501080_0048906 3300049742 Bacteria 3935
2351 Ga0501080_0099518 3300049742 Bacteria 2698
2352 Ga0501080_0199432 3300049742 Bacteria 1837
2353 Ga0501080_0313056 3300049742 Bacteria 1422
2354 Ga0501080_0313078 3300049742 Bacteria 1422
2355 Ga0501081_0034274 3300049743 Bacteria 3453
2356 Ga0501081_0050347 3300049743 Bacteria 2869
2357 Ga0501081_0075766 3300049743 Bacteria 2349
2358 Ga0501081_0082479 3300049743 Bacteria 2252
2359 Ga0501081_0252193 3300049743 Bacteria 1288
2360 Ga0501083_0000541 3300049744 Bacteria 24115
2361 Ga0501083_0000817 3300049744 Bacteria 20380
2362 Ga0501083_0021039 3300049744 Bacteria 4534
2363 Ga0501083_0087690 3300049744 Bacteria 2057
2364 Ga0501083_0088417 3300049744 Bacteria 2048
2365 Ga0501083_0136610 3300049744 Bacteria 1606
2366 Ga0501280_001879 3300049776 Bacteria 3671
2367 Ga0501035_0000068 3300049822 Bacteria 128392
2368 Ga0501035_0000371 3300049822 Bacteria 51668
2369 Ga0501035_0000490 3300049822 Bacteria 44423
2370 Ga0501035_0003166 3300049822 Bacteria 15806
2371 Ga0501035_0009505 3300049822 Bacteria 9040
2372 Ga0501035_0010676 3300049822 Bacteria 8501
2373 Ga0501035_0018388 3300049822 Bacteria 6439
2374 Ga0501035_0030849 3300049822 Bacteria 4884
2375 Ga0501035_0035358 3300049822 Bacteria 4534
2376 Ga0501035_0039257 3300049822 Bacteria 4285
2377 Ga0501035_0043458 3300049822 Bacteria 4049
2378 Ga0501035_0078741 3300049822 Bacteria 2911
2379 Ga0501035_0104108 3300049822 Bacteria 2489
2380 Ga0501035_0188105 3300049822 Bacteria 1776
2381 Ga0501035_0332977 3300049822 Bacteria 1273
2382 Ga0501044_0000096 3300049823 Bacteria 109532
2383 Ga0501044_0000387 3300049823 Bacteria 54729
2384 Ga0501044_0000509 3300049823 Bacteria 47320
2385 Ga0501044_0001031 3300049823 Bacteria 33572
2386 Ga0501044_0002617 3300049823 Bacteria 20451
2387 Ga0501044_0004945 3300049823 Bacteria 14906
2388 Ga0501044_0023347 3300049823 Bacteria 6578
2389 Ga0501044_0034204 3300049823 Bacteria 5332
2390 Ga0501044_0037292 3300049823 Bacteria 5082
2391 Ga0501044_0037446 3300049823 Bacteria 5071
2392 Ga0501044_0043184 3300049823 Bacteria 4684
2393 Ga0501044_0049618 3300049823 Bacteria 4332
2394 Ga0501044_0057886 3300049823 Bacteria 3976
2395 Ga0501044_0117296 3300049823 Bacteria 2666
2396 Ga0501044_0176070 3300049823 Bacteria 2108
2397 Ga0501044_0224194 3300049823 Bacteria 1829
2398 Ga0501044_0291063 3300049823 Bacteria 1564
2399 Ga0501044_0333709 3300049823 Bacteria 1438
2400 Ga0501045_0004468 3300049824 Bacteria 9659
2401 Ga0501045_0011682 3300049824 Bacteria 6167
2402 Ga0501045_0034657 3300049824 Bacteria 3665
2403 Ga0501045_0044669 3300049824 Bacteria 3227
2404 Ga0501045_0109722 3300049824 Bacteria 2045
2405 Ga0501045_0124502 3300049824 Bacteria 1914
2406 Ga0501045_0139827 3300049824 Bacteria 1800
2407 nmdc:mga03683_13882_c1 3300050489 Bacteria 2971
2408 nmdc:mga03683_98196_c1 3300050489 Bacteria 1285
2409 nmdc:mga03n38_9629_c1 3300050490 Bacteria 3522
2410 nmdc:mga00v17_10_c2 3300050491 Bacteria 136802
2411 nmdc:mga00v17_145631_c1 3300050491 Bacteria 1520
2412 nmdc:mga00v17_32480_c1 3300050491 Bacteria 3086
2413 nmdc:mga00v17_3261_c1 3300050491 Bacteria 8362
2414 nmdc:mga00v17_99588_c1 3300050491 Bacteria 1833
2415 nmdc:mga0yw44_123974_c1 3300050492 Bacteria 1667
2416 nmdc:mga0yw44_126820_c1 3300050492 Bacteria 1649
2417 nmdc:mga0yw44_154622_c1 3300050492 Bacteria 1498
2418 nmdc:mga0yw44_2725_c1 3300050492 Bacteria 7639
2419 nmdc:mga0yw44_35449_c1 3300050492 Bacteria 2932
2420 nmdc:mga0yw44_7017_c1 3300050492 Bacteria 5509
2421 nmdc:mga0k408_13090_c1 3300050493 Bacteria 4544
2422 nmdc:mga0k408_30291_c1 3300050493 Bacteria 3085
2423 nmdc:mga0k408_30488_c1 3300050493 Bacteria 3075
2424 nmdc:mga0k408_7846_c1 3300050493 Bacteria 5709
2425 nmdc:mga0k408_8464_c1 3300050493 Bacteria 5525
2426 nmdc:mga06z11_19399_c1 3300050494 Bacteria 3125
2427 nmdc:mga06z11_2960_c1 3300050494 Bacteria 6543
2428 nmdc:mga06z11_45125_c1 3300050494 Bacteria 2227
2429 nmdc:mga06z11_6093_c1 3300050494 Bacteria 4880
2430 nmdc:mga06z11_6158_c1 3300050494 Bacteria 4859
2431 nmdc:mga07m45_67920_c1 3300050496 Bacteria 2026
2432 nmdc:mga07m45_72804_c1 3300050496 Bacteria 1956
2433 nmdc:mga05p37_101291_c1 3300050507 Bacteria 3547
2434 nmdc:mga05p37_10559_c1 3300050507 Bacteria 10950
2435 nmdc:mga05p37_125558_c1 3300050507 Bacteria 2330
2436 nmdc:mga05p37_427_c1 3300050507 Bacteria 45535
2437 nmdc:mga05p37_4601_c1 3300050507 Bacteria 16127
2438 nmdc:mga05p37_60233_c1 3300050507 Bacteria 4675
2439 nmdc:mga05p37_71742_c1 3300050507 Bacteria 4261
2440 nmdc:mga05p37_91996_c1 3300050507 Bacteria 3737
2441 nmdc:mga09592_163393_c1 3300050508 Bacteria 1924
2442 nmdc:mga09592_2295_c1 3300050508 Bacteria 15416
2443 nmdc:mga0qj67_128_c1 3300050509 Bacteria 50095
2444 nmdc:mga0qj67_209269_c1 3300050509 Bacteria 1584
2445 nmdc:mga0qj67_28496_c1 3300050509 Bacteria 4335
2446 nmdc:mga0qj67_55452_c1 3300050509 Bacteria 3140
2447 nmdc:mga06r32_107250_c1 3300050510 Bacteria 2745
2448 nmdc:mga06r32_140977_c1 3300050510 Bacteria 2387
2449 nmdc:mga06r32_181519_c1 3300050510 Bacteria 2090
2450 nmdc:mga06r32_192073_c1 3300050510 Bacteria 2029
2451 nmdc:mga06r32_316_c1 3300050510 Bacteria 40391
2452 nmdc:mga06r32_44334_c1 3300050510 Bacteria 4235
2453 nmdc:mga08y16_119924_c1 3300050511 Bacteria 2738
2454 nmdc:mga08y16_133508_c1 3300050511 Bacteria 2580
2455 nmdc:mga08y16_31396_c1 3300050511 Bacteria 5586
2456 nmdc:mga08y16_66128_c1 3300050511 Bacteria 3773
2457 nmdc:mga08y16_6764_c1 3300050511 Bacteria 12028
2458 nmdc:mga08y16_90_c1 3300050511 Bacteria 76458
2459 nmdc:mga0n895_1005_c1 3300050512 Bacteria 20477
2460 nmdc:mga0n895_1829_c1 3300050512 Bacteria 16213
2461 nmdc:mga0n895_47257_c1 3300050512 Bacteria 4208
2462 nmdc:mga0n895_47479_c1 3300050512 Bacteria 4198
2463 nmdc:mga0n895_55742_c1 3300050512 Bacteria 3891
2464 nmdc:mga0rr50_13503_c1 3300050513 Bacteria 5319
2465 nmdc:mga0rr50_23086_c1 3300050513 Bacteria 4283
2466 nmdc:mga0rr50_5482_c1 3300050513 Bacteria 7576
2467 nmdc:mga0rr50_73151_c1 3300050513 Bacteria 2620
2468 nmdc:mga08x19_55560_c1 3300050514 Bacteria 2552
2469 nmdc:mga0a205_245107_c1 3300050515 Bacteria 1672
2470 nmdc:mga0a205_47157_c1 3300050515 Bacteria 4157
2471 nmdc:mga0a205_7042_c1 3300050515 Bacteria 10159
2472 nmdc:mga0a205_9319_c2 3300050515 Bacteria 3642
2473 nmdc:mga0sz30_10494_c2 3300050516 Bacteria 2937
2474 nmdc:mga0sz30_5239_c1 3300050516 Bacteria 4743
2475 nmdc:mga0sz30_80_c1 3300050516 Bacteria 36573
2476 Ga0495601_0000001 3300053077 Bacteria 549454
2477 Ga0495601_0000436 3300053077 Bacteria 21835
2478 Ga0495601_0001331 3300053077 Bacteria 13569
2479 Ga0495601_0001359 3300053077 Bacteria 13454
2480 Ga0495601_0007011 3300053077 Bacteria 6603
2481 Ga0495601_0008518 3300053077 Bacteria 6055
2482 Ga0495601_0024745 3300053077 Bacteria 3697
2483 Ga0495601_0038526 3300053077 Bacteria 2990
2484 Ga0495601_0115923 3300053077 Bacteria 1737
2485 Ga0495601_0136045 3300053077 Bacteria 1602
2486 Ga0495612_0000003 3300053078 Bacteria 303629
2487 Ga0495612_0000238 3300053078 Bacteria 23053
2488 Ga0495612_0001573 3300053078 Bacteria 9409
2489 Ga0495612_0002394 3300053078 Bacteria 7733
2490 Ga0495612_0010542 3300053078 Bacteria 3736
2491 Ga0495612_0025146 3300053078 Bacteria 2391
2492 Ga0495612_0030780 3300053078 Bacteria 2162
2493 Ga0500635_0003829 3300053080 Bacteria 3814
2494 Ga0495655_0011370 3300053083 Bacteria 1787
2495 Ga0495595_0000795 3300053084 Bacteria 12010
2496 Ga0495595_0003290 3300053084 Bacteria 6418
2497 Ga0495595_0008795 3300053084 Bacteria 4159
2498 Ga0495595_0055169 3300053084 Bacteria 1849
2499 Ga0495595_0084094 3300053084 Bacteria 1520
2500 Ga0495595_0107725 3300053084 Bacteria 1349
2501 Ga0495619_0000004 3300053085 Bacteria 500068
2502 Ga0495619_0000063 3300053085 Bacteria 84834
2503 Ga0495619_0000309 3300053085 Bacteria 34322
2504 Ga0495619_0001951 3300053085 Bacteria 13751
2505 Ga0495619_0002041 3300053085 Bacteria 13423
2506 Ga0495619_0003766 3300053085 Bacteria 9762
2507 Ga0495619_0008111 3300053085 Bacteria 6648
2508 Ga0495619_0015161 3300053085 Bacteria 4871
2509 Ga0495619_0056935 3300053085 Bacteria 2593
2510 Ga0495619_0060005 3300053085 Bacteria 2527
2511 Ga0495619_0061790 3300053085 Bacteria 2493
2512 Ga0495619_0090750 3300053085 Bacteria 2068
2513 Ga0495619_0117223 3300053085 Bacteria 1823
2514 Ga0495619_0123609 3300053085 Bacteria 1775
2515 Ga0495619_0140692 3300053085 Bacteria 1661
2516 Ga0500643_000163 3300053087 Bacteria 66676
2517 Ga0500644_0000906 3300053088 Bacteria 9467
2518 Ga0500644_0061293 3300053088 Bacteria 1326
2519 Ga0500581_058542 3300053089 Bacteria 1954
2520 Ga0500651_0017521 3300053093 Bacteria 4420
2521 Ga0500651_0076262 3300053093 Bacteria 2082
2522 Ga0500566_0000224 3300053094 Bacteria 30350
2523 Ga0500566_0001842 3300053094 Bacteria 12474
2524 Ga0500566_0002615 3300053094 Bacteria 10724
2525 Ga0500640_022331 3300053095 Bacteria 2734
2526 Ga0500641_0002780 3300053096 Bacteria 6192
2527 Ga0500641_0024705 3300053096 Bacteria 2319
2528 Ga0500641_0028806 3300053096 Bacteria 2171
2529 Ga0500650_0016778 3300053098 Bacteria 3147
2530 Ga0500554_002504 3300053102 Bacteria 3624
2531 Ga0500554_005943 3300053102 Bacteria 2705
2532 Ga0500555_011139 3300053103 Bacteria 2582
2533 Ga0500556_0000012 3300053104 Bacteria 250391
2534 Ga0500557_000051 3300053105 Bacteria 51214
2535 Ga0500562_025691 3300053108 Bacteria 1542
2536 Ga0500572_001135 3300053111 Bacteria 7750
2537 Ga0500572_002711 3300053111 Bacteria 4189
2538 Ga0500592_001911 3300053116 Bacteria 3349
2539 Ga0500593_000272 3300053117 Bacteria 21177
2540 Ga0500595_000001 3300053119 Bacteria 1088438
2541 Ga0500595_002517 3300053119 Bacteria 9047
2542 Ga0500595_005235 3300053119 Bacteria 5684
2543 Ga0500595_006254 3300053119 Bacteria 5074
2544 Ga0500618_000232 3300053125 Bacteria 43742
2545 Ga0500618_001520 3300053125 Bacteria 10210
2546 Ga0500618_003481 3300053125 Bacteria 5376
2547 Ga0500642_0000055 3300053130 Bacteria 68809
2548 Ga0500642_0000117 3300053130 Bacteria 36211
2549 Ga0500642_0002359 3300053130 Bacteria 5526
2550 Ga0500652_000023 3300053131 Bacteria 116316
2551 Ga0500652_000373 3300053131 Bacteria 16097
2552 Ga0500658_0001179 3300053134 Bacteria 10646
2553 Ga0500559_0000250 3300053136 Bacteria 42675
2554 Ga0500559_0000268 3300053136 Bacteria 40472
2555 Ga0500561_0000071 3300053137 Bacteria 19971
2556 Ga0500568_0000005 3300053139 Bacteria 614296
2557 Ga0500568_0000066 3300053139 Bacteria 104826
2558 Ga0500568_0000980 3300053139 Bacteria 19644
2559 Ga0500568_0006313 3300053139 Bacteria 5967
2560 Ga0500573_0010889 3300053140 Bacteria 5081
2561 Ga0500573_0014460 3300053140 Bacteria 4467
2562 Ga0500577_0001415 3300053142 Bacteria 6134
2563 Ga0500589_013937 3300053147 Bacteria 3556
2564 Ga0500589_065591 3300053147 Bacteria 1655
2565 Ga0500590_000122 3300053148 Bacteria 21279
2566 Ga0500604_0000092 3300053151 Bacteria 28708
2567 Ga0500604_0010046 3300053151 Bacteria 2527
2568 Ga0500616_0000001 3300053153 Bacteria 1986011
2569 Ga0500616_0000035 3300053153 Bacteria 394242
2570 Ga0500616_0000038 3300053153 Bacteria 386801
2571 Ga0500616_0000441 3300053153 Bacteria 54819
2572 Ga0500616_0000989 3300053153 Bacteria 30709
2573 Ga0500616_0021195 3300053153 Bacteria 3648
2574 Ga0500616_0028372 3300053153 Bacteria 3084
2575 Ga0500616_0054873 3300053153 Bacteria 2085
2576 Ga0500616_0062546 3300053153 Bacteria 1922
2577 Ga0500616_0087467 3300053153 Bacteria 1551
2578 Ga0500622_0001833 3300053156 Bacteria 16093
2579 Ga0500634_0000017 3300053161 Bacteria 111983
2580 Ga0500634_0004414 3300053161 Bacteria 6495
2581 Ga0500638_001565 3300053162 Bacteria 7320
2582 Ga0500638_038767 3300053162 Bacteria 2313
2583 Ga0500636_0000025 3300053177 Bacteria 86697
2584 Ga0500636_0000330 3300053177 Bacteria 26259
2585 Ga0500636_0008037 3300053177 Bacteria 6104
2586 Ga0500636_0023913 3300053177 Bacteria 3612
2587 Ga0500637_0000029 3300053178 Bacteria 52437
2588 Ga0500637_0036351 3300053178 Bacteria 2764
2589 Ga0500649_027540 3300053722 Bacteria 2362
2590 Ga0500645_001608 3300053730 Bacteria 11202
2591 Ga0500596_001057 3300053735 Bacteria 5543
2592 Ga0500599_003111 3300053736 Bacteria 2016
2593 Ga0500601_005908 3300053737 Bacteria 1347
2594 Ga0501084_0001213 3300054114 Bacteria 20242
2595 Ga0501084_0011766 3300054114 Bacteria 7246
2596 Ga0501084_0025956 3300054114 Bacteria 4886
2597 Ga0501084_0052014 3300054114 Bacteria 3428
2598 Ga0501084_0127907 3300054114 Bacteria 2138
2599 Ga0501084_0202557 3300054114 Bacteria 1675
2600 Ga0501084_0308534 3300054114 Bacteria 1336
2601 Ga0500661_000146 3300055283 Bacteria 12054
2602 Ga0501082_0000510 3300060353 Bacteria 34491
2603 Ga0501082_0006956 3300060353 Bacteria 9774
2604 Ga0501082_0017584 3300060353 Bacteria 6159
2605 Ga0501082_0044780 3300060353 Bacteria 3816
2606 Ga0501082_0059691 3300060353 Bacteria 3286
2607 Ga0501082_0065679 3300060353 Bacteria 3125
2608 Ga0501082_0071431 3300060353 Bacteria 2989
2609 Ga0501082_0175306 3300060353 Bacteria 1864
2610 Ga0466962_0073500 3300061719 Bacteria 1634
2611 Ga0530510_0013057 3300061734 Bacteria 5842
2612 Ga0530510_0128959 3300061734 Bacteria 1860

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 8004695233 8004697305 342
2 iso_pu_bacteria 2878730984 2878731825 347
3 iso_pu_bacteria 2977898635 2977901329 368
4 iso_pu_bacteria 2856356410 2856358013 377
5 iso_pu_bacteria 2937868953 2937875218 377
6 3300021388 Ga0213875_10035814 Ga0213875_100358141 378
7 3300037853 Ga0436364_0707111 Ga0436364_0707111_966_2291 378
8 3300048914 Ga0496111_0025302 Ga0496111_0025302_883_2199 378
9 iso_pu_bacteria 2876377896 2876379181 378
10 3300029957 Ga0265324_10017887 Ga0265324_100178872 379
11 3300003775 Ga0055524_1006330 Ga0055524_10063308 380
12 3300048927 Ga0496124_0004778 Ga0496124_0004778_67_1212 380
13 3300048929 Ga0496126_0198058 Ga0496126_0198058_490_1635 380
14 3300050489 nmdc:mga03683_98196_c1 nmdc:mga03683_98196_c1_24_1169 380
15 3300050492 nmdc:mga0yw44_2725_c1 nmdc:mga0yw44_2725_c1_6423_7568 380
16 3300009093 Ga0105240_10072194 Ga0105240_100721942 381
17 3300010375 Ga0105239_10049300 Ga0105239_100493004 381
18 3300035121 Ga0373960_0019107 Ga0373960_0019107_562_1719 381
19 3300037471 Ga0395905_0417245 Ga0395905_0417245_23_1192 381
20 3300044684 Ga0466966_0084282 Ga0466966_0084282_799_1962 381
21 3300046460 Ga0495638_0058973 Ga0495638_0058973_1197_2363 381
22 3300046475 Ga0495639_0055393 Ga0495639_0055393_37_1200 381
23 3300046492 Ga0495585_0006974 Ga0495585_0006974_12_1157 381
24 3300047321 Ga0495676_0200205 Ga0495676_0200205_229_1377 381
25 3300048905 Ga0496102_0039332 Ga0496102_0039332_1499_2656 381
26 3300048908 Ga0496105_0272165 Ga0496105_0272165_195_1349 381
27 3300049575 Ga0501039_0029863 Ga0501039_0029863_3018_4175 381
28 3300049576 Ga0501040_0017414 Ga0501040_0017414_1657_2814 381
29 3300049580 Ga0501046_0042801 Ga0501046_0042801_292_1443 381
30 3300049743 Ga0501081_0082479 Ga0501081_0082479_32_1189 381
31 3300053089 Ga0500581_058542 Ga0500581_058542_767_1933 381
32 3300035171 Ga0373946_0096612 Ga0373946_0096612_126_1274 382
33 3300046475 Ga0495639_0042076 Ga0495639_0042076_868_2016 382
34 3300046690 Ga0495624_0095797 Ga0495624_0095797_640_1788 382
35 3300046557 Ga0495622_0064935 Ga0495622_0064935_17_1174 383
36 3300048927 Ga0496124_0214986 Ga0496124_0214986_46_1224 383
37 3300049578 Ga0501042_0110947 Ga0501042_0110947_762_1958 383
38 3300049579 Ga0501043_0207583 Ga0501043_0207583_300_1508 383
39 3300049742 Ga0501080_0313056 Ga0501080_0313056_10_1218 383
40 3300049743 Ga0501081_0252193 Ga0501081_0252193_19_1176 383
41 3300049823 Ga0501044_0291063 Ga0501044_0291063_333_1541 383
42 3300050507 nmdc:mga05p37_125558_c1 nmdc:mga05p37_125558_c1_970_2133 383
43 3300046648 Ga0495611_0092552 Ga0495611_0092552_77_1333 387
44 3300047322 Ga0495680_0093221 Ga0495680_0093221_20_1192 388
45 3300005843 Ga0068860_100096258 Ga0068860_1000962582 389
46 3300005844 Ga0068862_100044685 Ga0068862_1000446853 389
47 3300025904 Ga0207647_10067552 Ga0207647_100675522 389
48 3300025912 Ga0207707_10040737 Ga0207707_100407373 389
49 3300025932 Ga0207690_10085633 Ga0207690_100856332 389
50 3300025938 Ga0207704_10112604 Ga0207704_101126042 389
51 3300025944 Ga0207661_10091121 Ga0207661_100911212 389
52 3300028380 Ga0268265_10030071 Ga0268265_100300712 389
53 3300031241 Ga0265325_10016048 Ga0265325_100160483 389
54 3300035083 Ga0373926_0057784 Ga0373926_0057784_15_1202 389
55 3300035089 Ga0373944_0007598 Ga0373944_0007598_1712_2899 389
56 3300005440 Ga0070705_100034860 Ga0070705_1000348603 390
57 3300049822 Ga0501035_0010676 Ga0501035_0010676_1154_2407 390
58 iso_pu_bacteria 2916076590 2916080558 390
59 3300049568 Ga0501031_0039066 Ga0501031_0039066_1699_2874 391
60 3300049574 Ga0501038_0021411 Ga0501038_0021411_277_1452 391
61 3300053139 Ga0500568_0000066 Ga0500568_0000066_48247_49614 392
62 3300005434 Ga0070709_10000008 Ga0070709_1000000820 393
63 3300005439 Ga0070711_100034302 Ga0070711_1000343023 393
64 3300025906 Ga0207699_10000005 Ga0207699_10000005441 393
65 3300025916 Ga0207663_10046873 Ga0207663_100468733 393
66 3300035111 Ga0373923_0004799 Ga0373923_0004799_3039_4220 393
67 3300035170 Ga0373943_0001390 Ga0373943_0001390_312_1493 393
68 3300042876 Ga0451577_0000457 Ga0451577_0000457_63846_65033 393
69 3300044712 Ga0453684_0000005 Ga0453684_0000005_11418_12605 393
70 3300047315 Ga0495581_0015433 Ga0495581_0015433_2228_3409 393
71 3300048903 Ga0496100_0011928 Ga0496100_0011928_45_1226 393
72 3300048907 Ga0496104_0063578 Ga0496104_0063578_37_1218 393
73 3300048916 Ga0496113_0277964 Ga0496113_0277964_113_1294 393
74 3300005367 Ga0070667_100014994 Ga0070667_1000149942 394
75 3300005536 Ga0070697_100001409 Ga0070697_1000014099 394
76 3300025939 Ga0207665_10021238 Ga0207665_100212383 394
77 3300026142 Ga0207698_10209645 Ga0207698_102096451 394
78 iso_pu_bacteria 8019555841 8019562051 394
79 3300005548 Ga0070665_100044075 Ga0070665_1000440754 396
80 3300009147 Ga0114129_10040263 Ga0114129_100402636 396
81 3300028379 Ga0268266_10076560 Ga0268266_100765602 396
82 3300035691 Ga0373931_0006373 Ga0373931_0006373_1218_2414 396
83 3300048912 Ga0496109_0186100 Ga0496109_0186100_76_1272 396
84 3300048915 Ga0496112_0260257 Ga0496112_0260257_304_1500 396
85 3300049570 Ga0501033_0021230 Ga0501033_0021230_3035_4285 396
86 3300049579 Ga0501043_0065633 Ga0501043_0065633_814_2016 396
87 3300049581 Ga0501047_0001719 Ga0501047_0001719_9882_11084 396
88 3300049586 Ga0501070_0007368 Ga0501070_0007368_2320_3573 396
89 3300049822 Ga0501035_0003166 Ga0501035_0003166_3536_4789 396
90 3300049822 Ga0501035_0039257 Ga0501035_0039257_525_1727 396
91 3300049823 Ga0501044_0001031 Ga0501044_0001031_4127_5329 396
92 3300050507 nmdc:mga05p37_60233_c1 nmdc:mga05p37_60233_c1_1268_2470 396
93 3300053084 Ga0495595_0084094 Ga0495595_0084094_155_1381 396
94 3300028800 Ga0265338_10204405 Ga0265338_102044052 397
95 3300029957 Ga0265324_10000928 Ga0265324_1000092812 397
96 3300031241 Ga0265325_10006034 Ga0265325_100060348 397
97 3300031711 Ga0265314_10002666 Ga0265314_1000266614 397
98 3300037853 Ga0436364_0177909 Ga0436364_0177909_718_1980 397
99 3300045051 Ga0451576_0266888 Ga0451576_0266888_59_1258 397
100 3300049569 Ga0501032_0024318 Ga0501032_0024318_949_2202 397
101 3300049570 Ga0501033_0005482 Ga0501033_0005482_5400_6653 397
102 3300049573 Ga0501037_0000302 Ga0501037_0000302_24962_26215 397
103 3300049574 Ga0501038_0088438 Ga0501038_0088438_232_1485 397
104 3300049579 Ga0501043_0000006 Ga0501043_0000006_35020_36273 397
105 3300049585 Ga0501069_0000024 Ga0501069_0000024_83213_84466 397
106 3300049586 Ga0501070_0000093 Ga0501070_0000093_64013_65266 397
107 3300049587 Ga0501071_0014973 Ga0501071_0014973_1061_2314 397
108 3300049590 Ga0501074_0000216 Ga0501074_0000216_24962_26215 397
109 3300049742 Ga0501080_0003412 Ga0501080_0003412_8172_9425 397
110 3300049744 Ga0501083_0000541 Ga0501083_0000541_8078_9331 397
111 3300049822 Ga0501035_0000068 Ga0501035_0000068_115910_117163 397
112 3300049823 Ga0501044_0000096 Ga0501044_0000096_25067_26320 397
113 3300050507 nmdc:mga05p37_71742_c1 nmdc:mga05p37_71742_c1_610_1866 397
114 3300060353 Ga0501082_0175306 Ga0501082_0175306_147_1400 397
115 3300025929 Ga0207664_10035801 Ga0207664_100358013 398
116 3300031239 Ga0265328_10000282 Ga0265328_100002827 398
117 3300035172 Ga0373955_0064582 Ga0373955_0064582_776_1981 398
118 3300036242 Ga0310104_02843 Ga0310104_02843_23_1240 398
119 3300048910 Ga0496107_0229894 Ga0496107_0229894_128_1348 398
120 3300048920 Ga0496117_0027983 Ga0496117_0027983_20_1237 398
121 3300048927 Ga0496124_0111111 Ga0496124_0111111_38_1267 398
122 3300048929 Ga0496126_0287273 Ga0496126_0287273_121_1338 398
123 3300048929 Ga0496126_0304707 Ga0496126_0304707_22_1239 398
124 3300049568 Ga0501031_0002850 Ga0501031_0002850_2189_3409 398
125 3300049568 Ga0501031_0019447 Ga0501031_0019447_3182_4402 398
126 3300049568 Ga0501031_0138670 Ga0501031_0138670_13_1233 398
127 3300049569 Ga0501032_0030574 Ga0501032_0030574_1184_2404 398
128 3300049570 Ga0501033_0000469 Ga0501033_0000469_25824_27044 398
129 3300049572 Ga0501036_0069645 Ga0501036_0069645_929_2149 398
130 3300049573 Ga0501037_0004321 Ga0501037_0004321_139_1359 398
131 3300049574 Ga0501038_0005993 Ga0501038_0005993_2094_3314 398
132 3300049574 Ga0501038_0222942 Ga0501038_0222942_250_1470 398
133 3300049575 Ga0501039_0002320 Ga0501039_0002320_8686_9906 398
134 3300049575 Ga0501039_0063214 Ga0501039_0063214_820_2040 398
135 3300049579 Ga0501043_0002138 Ga0501043_0002138_4932_6152 398
136 3300049580 Ga0501046_0012094 Ga0501046_0012094_2539_3759 398
137 3300049741 Ga0501079_0021846 Ga0501079_0021846_3641_4852 398
138 3300049822 Ga0501035_0018388 Ga0501035_0018388_4415_5635 398
139 3300049822 Ga0501035_0332977 Ga0501035_0332977_38_1249 398
140 3300049823 Ga0501044_0004945 Ga0501044_0004945_3382_4602 398
141 3300053085 Ga0495619_0001951 Ga0495619_0001951_26_1231 398
142 3300053088 Ga0500644_0061293 Ga0500644_0061293_95_1315 398
143 3300053108 Ga0500562_025691 Ga0500562_025691_309_1523 398
144 3300021384 Ga0213876_10000566 Ga0213876_100005664 399
145 3300031239 Ga0265328_10025218 Ga0265328_100252182 399
146 3300039437 Ga0436365_1146135 Ga0436365_1146135_2651_3928 399
147 3300046543 Ga0495645_0030779 Ga0495645_0030779_1984_3201 399
148 3300053085 Ga0495619_0056935 Ga0495619_0056935_363_1673 399
149 3300053737 Ga0500601_005908 Ga0500601_005908_75_1289 399
150 3300061719 Ga0466962_0073500 Ga0466962_0073500_17_1216 399
151 3300009093 Ga0105240_10161045 Ga0105240_101610452 400
152 3300009093 Ga0105240_10216467 Ga0105240_102164671 400
153 3300009101 Ga0105247_10003104 Ga0105247_100031043 400
154 3300009176 Ga0105242_10000831 Ga0105242_100008318 400
155 3300010375 Ga0105239_10002407 Ga0105239_100024077 400
156 3300011119 Ga0105246_10000306 Ga0105246_100003066 400
157 3300013100 Ga0157373_10055120 Ga0157373_100551202 400
158 3300013102 Ga0157371_10013035 Ga0157371_100130353 400
159 3300035090 Ga0373949_0001957 Ga0373949_0001957_195_1397 400
160 3300035090 Ga0373949_0013353 Ga0373949_0013353_405_1607 400
161 3300035091 Ga0373951_0002271 Ga0373951_0002271_1826_3028 400
162 3300035092 Ga0373952_0001128 Ga0373952_0001128_2956_4158 400
163 3300035112 Ga0373932_0000364 Ga0373932_0000364_10929_12131 400
164 3300035112 Ga0373932_0045512 Ga0373932_0045512_53_1255 400
165 3300035114 Ga0373939_0000262 Ga0373939_0000262_11579_12781 400
166 3300035117 Ga0373953_0006564 Ga0373953_0006564_334_1536 400
167 3300035121 Ga0373960_0003528 Ga0373960_0003528_1633_2835 400
168 3300035172 Ga0373955_0010574 Ga0373955_0010574_1783_2985 400
169 3300035207 Ga0373942_0001281 Ga0373942_0001281_2223_3425 400
170 3300035241 Ga0373961_0022465 Ga0373961_0022465_204_1406 400
171 3300035242 Ga0373962_0001478 Ga0373962_0001478_3478_4680 400
172 3300035691 Ga0373931_0000182 Ga0373931_0000182_11588_12790 400
173 3300046458 Ga0495591_021370 Ga0495591_021370_492_1694 400
174 3300046462 Ga0495651_0000237 Ga0495651_0000237_39029_40231 400
175 3300046463 Ga0495653_0005473 Ga0495653_0005473_6046_7248 400
176 3300046477 Ga0495664_0009236 Ga0495664_0009236_99_1301 400
177 3300046491 Ga0495584_0027038 Ga0495584_0027038_21_1226 400
178 3300046501 Ga0495607_0005625 Ga0495607_0005625_1462_2664 400
179 3300046520 Ga0495637_0027801 Ga0495637_0027801_814_2016 400
180 3300046675 Ga0495657_0005203 Ga0495657_0005203_24_1226 400
181 3300047444 Ga0495675_0001085 Ga0495675_0001085_24_1226 400
182 3300048903 Ga0496100_0000249 Ga0496100_0000249_1895_3097 400
183 3300048904 Ga0496101_0000599 Ga0496101_0000599_8538_9740 400
184 3300048905 Ga0496102_0000433 Ga0496102_0000433_8832_10034 400
185 3300048906 Ga0496103_0000849 Ga0496103_0000849_12394_13596 400
186 3300048907 Ga0496104_0048911 Ga0496104_0048911_2315_3517 400
187 3300048908 Ga0496105_0156961 Ga0496105_0156961_615_1817 400
188 3300048909 Ga0496106_0003451 Ga0496106_0003451_3544_4746 400
189 3300048910 Ga0496107_0000078 Ga0496107_0000078_1957_3159 400
190 3300048912 Ga0496109_0000567 Ga0496109_0000567_20729_21931 400
191 3300048913 Ga0496110_0010645 Ga0496110_0010645_5115_6317 400
192 3300048914 Ga0496111_0075617 Ga0496111_0075617_958_2160 400
193 3300048916 Ga0496113_0011593 Ga0496113_0011593_1743_2945 400
194 3300048918 Ga0496115_0000437 Ga0496115_0000437_25983_27185 400
195 3300049571 Ga0501034_0241343 Ga0501034_0241343_13_1221 400
196 3300049589 Ga0501073_0131413 Ga0501073_0131413_508_1713 400
197 3300049741 Ga0501079_0120485 Ga0501079_0120485_809_2017 400
198 3300050494 nmdc:mga06z11_19399_c1 nmdc:mga06z11_19399_c1_853_2055 400
199 3300050511 nmdc:mga08y16_6764_c1 nmdc:mga08y16_6764_c1_1164_2366 400
200 3300050512 nmdc:mga0n895_1005_c1 nmdc:mga0n895_1005_c1_5119_6321 400
201 3300050515 nmdc:mga0a205_7042_c1 nmdc:mga0a205_7042_c1_8607_9809 400
202 3300053077 Ga0495601_0008518 Ga0495601_0008518_4830_6032 400
203 3300053077 Ga0495601_0024745 Ga0495601_0024745_2472_3674 400
204 3300053078 Ga0495612_0001573 Ga0495612_0001573_8184_9386 400
205 3300053085 Ga0495619_0008111 Ga0495619_0008111_24_1226 400
206 3300005344 Ga0070661_100051352 Ga0070661_1000513522 401
207 3300005543 Ga0070672_100210917 Ga0070672_1002109171 401
208 3300009545 Ga0105237_10186819 Ga0105237_101868192 401
209 3300025913 Ga0207695_10004482 Ga0207695_1000448217 401
210 3300025914 Ga0207671_10129952 Ga0207671_101299521 401
211 3300025938 Ga0207704_10097329 Ga0207704_100973292 401
212 3300025942 Ga0207689_10222689 Ga0207689_102226891 401
213 3300049823 Ga0501044_0117296 Ga0501044_0117296_792_2045 401
214 3300053093 Ga0500651_0076262 Ga0500651_0076262_21_1226 401
215 3300042139 Ga0450904_001213 Ga0450904_001213_2531_3757 402
216 3300044735 Ga0466968_0018315 Ga0466968_0018315_1295_2620 402
217 3300048911 Ga0496108_0028010 Ga0496108_0028010_3404_4612 402
218 3300049589 Ga0501073_0052052 Ga0501073_0052052_793_2064 402
219 3300049742 Ga0501080_0313078 Ga0501080_0313078_54_1325 402
220 3300006844 Ga0075428_100003846 Ga0075428_1000038465 403
221 3300006880 Ga0075429_100003394 Ga0075429_10000339412 403
222 3300027907 Ga0207428_10000847 Ga0207428_1000084712 403
223 3300031251 Ga0265327_10015122 Ga0265327_100151222 403
224 3300031344 Ga0265316_10016131 Ga0265316_100161316 403
225 3300046454 Ga0495592_0078958 Ga0495592_0078958_590_1807 403
226 3300046520 Ga0495637_0071812 Ga0495637_0071812_152_1369 403
227 3300046529 Ga0495652_0114031 Ga0495652_0114031_321_1538 403
228 3300046543 Ga0495645_0044736 Ga0495645_0044736_601_1818 403
229 3300048911 Ga0496108_0342193 Ga0496108_0342193_68_1285 403
230 3300050507 nmdc:mga05p37_427_c1 nmdc:mga05p37_427_c1_12583_13857 403
231 3300050508 nmdc:mga09592_2295_c1 nmdc:mga09592_2295_c1_10895_12169 403
232 3300050509 nmdc:mga0qj67_55452_c1 nmdc:mga0qj67_55452_c1_1844_3118 403
233 3300050510 nmdc:mga06r32_316_c1 nmdc:mga06r32_316_c1_15463_16737 403
234 3300050511 nmdc:mga08y16_90_c1 nmdc:mga08y16_90_c1_23219_24493 403
235 3300053077 Ga0495601_0001331 Ga0495601_0001331_4743_5960 403
236 3300053085 Ga0495619_0015161 Ga0495619_0015161_2132_3349 403
237 3300025292 Ga0209676_1006574 Ga0209676_10065745 404
238 3300025298 Ga0209050_1001334 Ga0209050_100133423 404
239 3300028379 Ga0268266_10088697 Ga0268266_100886973 404
240 3300031235 Ga0265330_10013072 Ga0265330_100130722 404
241 3300031239 Ga0265328_10001206 Ga0265328_100012067 404
242 3300046542 Ga0495597_0011889 Ga0495597_0011889_2063_3316 404
243 3300021377 Ga0213874_10008081 Ga0213874_100080811 405
244 3300037466 Ga0395898_0001221 Ga0395898_0001221_33641_34873 405
245 3300039438 Ga0436360_0422410 Ga0436360_0422410_647_1915 405
246 3300042436 Ga0439435_0003133 Ga0439435_0003133_1590_2867 405
247 3300042876 Ga0451577_0109070 Ga0451577_0109070_388_1635 405
248 3300044712 Ga0453684_0011680 Ga0453684_0011680_2807_4054 405
249 3300045051 Ga0451576_0001449 Ga0451576_0001449_27740_28987 405
250 3300047470 Ga0495681_0002823 Ga0495681_0002823_5834_7069 405
251 3300048916 Ga0496113_0128553 Ga0496113_0128553_287_1522 405
252 3300053151 Ga0500604_0000092 Ga0500604_0000092_14860_16086 405
253 iso_pu_bacteria 2643221554 2643787331 405
254 iso_pu_bacteria 2643221580 2643911778 405
255 iso_pu_bacteria 2643221591 2643965637 405
256 iso_pu_bacteria 2643221629 2644169451 405
257 iso_pu_bacteria 2643221662 2644350850 405
258 iso_pu_bacteria 2643221674 2644413146 405
259 iso_pu_bacteria 2932401849 2932406010 405
260 3300035089 Ga0373944_0001375 Ga0373944_0001375_3201_4424 406
261 3300035113 Ga0373936_0015159 Ga0373936_0015159_1591_2814 406
262 3300045051 Ga0451576_0030359 Ga0451576_0030359_1802_3049 406
263 3300046516 Ga0495628_0033397 Ga0495628_0033397_2910_4133 406
264 3300046525 Ga0495663_0023010 Ga0495663_0023010_285_1508 406
265 3300046529 Ga0495652_0032370 Ga0495652_0032370_496_1719 406
266 3300046557 Ga0495622_0008864 Ga0495622_0008864_2461_3684 406
267 3300046674 Ga0495588_0039713 Ga0495588_0039713_1026_2249 406
268 3300046809 Ga0495600_0037198 Ga0495600_0037198_950_2197 406
269 3300047446 Ga0495679_007638 Ga0495679_007638_2260_3483 406
270 3300049569 Ga0501032_0007205 Ga0501032_0007205_4971_6209 406
271 3300050512 nmdc:mga0n895_1829_c1 nmdc:mga0n895_1829_c1_11850_13088 406
272 3300050513 nmdc:mga0rr50_73151_c1 nmdc:mga0rr50_73151_c1_488_1726 406
273 3300053078 Ga0495612_0010542 Ga0495612_0010542_35_1267 406
274 3300053096 Ga0500641_0024705 Ga0500641_0024705_154_1386 406
275 3300053117 Ga0500593_000272 Ga0500593_000272_14218_15483 406
276 3300053139 Ga0500568_0000005 Ga0500568_0000005_183132_184397 406
277 3300053153 Ga0500616_0087467 Ga0500616_0087467_295_1527 406
278 iso_pu_bacteria 2509276021 2509389330 406
279 iso_pu_bacteria 2510065019 2510135329 406
280 iso_pu_bacteria 2510461069 2510839131 406
281 iso_pu_bacteria 2510461076 2510896779 406
282 iso_pu_bacteria 2510917022 2511133149 406
283 iso_pu_bacteria 2510917026 2511168872 406
284 iso_pu_bacteria 2510917028 2511184111 406
285 iso_pu_bacteria 2510917030 2511200635 406
286 iso_pu_bacteria 2511231027 2511388834 406
287 iso_pu_bacteria 2513237084 2513573597 406
288 iso_pu_bacteria 2513237085 2513578759 406
289 iso_pu_bacteria 2513237088 2513596909 406
290 iso_pu_bacteria 2513237093 2513630062 406
291 iso_pu_bacteria 2513237103 2513711429 406
292 iso_pu_bacteria 2513237138 2513865236 406
293 iso_pu_bacteria 2513237144 2513912685 406
294 iso_pu_bacteria 2513237146 2513928581 406
295 iso_pu_bacteria 2513237162 2514019491 406
296 iso_pu_bacteria 2515075009 2515114497 406
297 iso_pu_bacteria 2515154113 2515635490 406
298 iso_pu_bacteria 2515154116 2515657570 406
299 iso_pu_bacteria 2515154134 2515741681 406
300 iso_pu_bacteria 2516653077 2517038138 406
301 iso_pu_bacteria 2516653085 2517078416 406
302 iso_pu_bacteria 2517093000 2517097157 406
303 iso_pu_bacteria 2517287029 2517408454 406
304 iso_pu_bacteria 2519899620 2520376463 406
305 iso_pu_bacteria 2524023209 2524458672 406
306 iso_pu_bacteria 2529292951 2530647279 406
307 iso_pu_bacteria 2534681796 2535519114 406
308 iso_pu_bacteria 2537561587 2537873655 406
309 iso_pu_bacteria 2554235003 2554248887 406
310 iso_pu_bacteria 2558860242 2559295975 406
311 iso_pu_bacteria 2558860983 2561467158 406
312 iso_pu_bacteria 2582581294 2585201646 406
313 iso_pu_bacteria 2582581298 2585224012 406
314 iso_pu_bacteria 2582581299 2585228653 406
315 iso_pu_bacteria 2582581304 2585257264 406
316 iso_pu_bacteria 2582581307 2585271889 406
317 iso_pu_bacteria 2582581308 2585279747 406
318 iso_pu_bacteria 2582581867 2585399841 406
319 iso_pu_bacteria 2585427526 2585525953 406
320 iso_pu_bacteria 2585427527 2585531850 406
321 iso_pu_bacteria 2585427528 2585540861 406
322 iso_pu_bacteria 2585427529 2585549712 406
323 iso_pu_bacteria 2585427530 2585551203 406
324 iso_pu_bacteria 2585427531 2585563748 406
325 iso_pu_bacteria 2585427590 2585820929 406
326 iso_pu_bacteria 2585427593 2585839131 406
327 iso_pu_bacteria 2585427594 2585844978 406
328 iso_pu_bacteria 2585427608 2585897056 406
329 iso_pu_bacteria 2585427609 2585907087 406
330 iso_pu_bacteria 2585427633 2585997844 406
331 iso_pu_bacteria 2585427634 2586002433 406
332 iso_pu_bacteria 2585428125 2587982919 406
333 iso_pu_bacteria 2599185170 2599420068 406
334 iso_pu_bacteria 2599185210 2599603233 406
335 iso_pu_bacteria 2599185236 2599720391 406
336 iso_pu_bacteria 2600254933 2600373186 406
337 iso_pu_bacteria 2600255279 2601610862 406
338 iso_pu_bacteria 2600255308 2601747636 406
339 iso_pu_bacteria 2615840626 2616306537 406
340 iso_pu_bacteria 2615840698 2616551178 406
341 iso_pu_bacteria 2617270742 2617383963 406
342 iso_pu_bacteria 2643221558 2643813836 406
343 iso_pu_bacteria 2643221568 2643854934 406
344 iso_pu_bacteria 2643221582 2643921499 406
345 iso_pu_bacteria 2643221599 2644002523 406
346 iso_pu_bacteria 2643221634 2644194741 406
347 iso_pu_bacteria 2643221643 2644240420 406
348 iso_pu_bacteria 2643221693 2644521553 406
349 iso_pu_bacteria 2667528174 2671113300 406
350 iso_pu_bacteria 2718217882 2719183012 406
351 iso_pu_bacteria 2718217927 2719387756 406
352 iso_pu_bacteria 2718217997 2719667359 406
353 iso_pu_bacteria 2718218009 2719733729 406
354 iso_pu_bacteria 2718218199 2720493779 406
355 iso_pu_bacteria 2718218232 2720615235 406
356 iso_pu_bacteria 2718218233 2720622028 406
357 iso_pu_bacteria 2718218235 2720633378 406
358 iso_pu_bacteria 2718218269 2720777076 406
359 iso_pu_bacteria 2718218363 2721149124 406
360 iso_pu_bacteria 2718218365 2721160522 406
361 iso_pu_bacteria 2718218366 2721165937 406
362 iso_pu_bacteria 2718218423 2721401390 406
363 iso_pu_bacteria 2721755514 2722842107 406
364 iso_pu_bacteria 2721755556 2723028675 406
365 iso_pu_bacteria 2721755684 2723562288 406
366 iso_pu_bacteria 2721755685 2723568983 406
367 iso_pu_bacteria 2721755809 2724040204 406
368 iso_pu_bacteria 2721755810 2724046485 406
369 iso_pu_bacteria 2721755819 2724091683 406
370 iso_pu_bacteria 2721755822 2724106248 406
371 iso_pu_bacteria 2721755823 2724112054 406
372 iso_pu_bacteria 2724679232 2725945685 406
373 iso_pu_bacteria 2728369352 2730109611 406
374 iso_pu_bacteria 2728369365 2730166247 406
375 iso_pu_bacteria 2728369397 2730300154 406
376 iso_pu_bacteria 2738541293 2738801108 406
377 iso_pu_bacteria 2738541317 2738948929 406
378 iso_pu_bacteria 2738541333 2739038536 406
379 iso_pu_bacteria 2765235942 2766064179 406
380 iso_pu_bacteria 2775507049 2776915473 406
381 iso_pu_bacteria 2775507266 2778179093 406
382 iso_pu_bacteria 2791355256 2793295578 406
383 iso_pu_bacteria 2791355259 2793313289 406
384 iso_pu_bacteria 2791355260 2793320774 406
385 iso_pu_bacteria 2791355261 2793327366 406
386 iso_pu_bacteria 2791355262 2793332287 406
387 iso_pu_bacteria 2791355263 2793338897 406
388 iso_pu_bacteria 2791355264 2793346649 406
389 iso_pu_bacteria 2791355265 2793356178 406
390 iso_pu_bacteria 2791355266 2793359317 406
391 iso_pu_bacteria 2791355267 2793365978 406
392 iso_pu_bacteria 2802429605 2805926264 406
393 iso_pu_bacteria 2802429606 2805933990 406
394 iso_pu_bacteria 2802429633 2806049119 406
395 iso_pu_bacteria 2802429634 2806054307 406
396 iso_pu_bacteria 2802429635 2806060109 406
397 iso_pu_bacteria 2802429636 2806068723 406
398 iso_pu_bacteria 2802429637 2806076329 406
399 iso_pu_bacteria 2808606387 2808988200 406
400 iso_pu_bacteria 2818991439 2819560984 406
401 iso_pu_bacteria 2818991448 2819611686 406
402 iso_pu_bacteria 2818991453 2819638634 406
403 iso_pu_bacteria 2818991461 2819686986 406
404 iso_pu_bacteria 2838016132 2838018281 406
405 iso_pu_bacteria 2838022645 2838023959 406
406 iso_pu_bacteria 2838029111 2838031118 406
407 iso_pu_bacteria 2838035591 2838040276 406
408 iso_pu_bacteria 2838042994 2838046652 406
409 iso_pu_bacteria 2838048938 2838050859 406
410 iso_pu_bacteria 2838061910 2838062627 406
411 iso_pu_bacteria 2838068647 2838072175 406
412 iso_pu_bacteria 2838661181 2838667091 406
413 iso_pu_bacteria 2838668709 2838672213 406
414 iso_pu_bacteria 2838675328 2838678648 406
415 iso_pu_bacteria 2838680041 2838683805 406
416 iso_pu_bacteria 2838686498 2838690397 406
417 iso_pu_bacteria 2838694306 2838698333 406
418 iso_pu_bacteria 2838701080 2838704917 406
419 iso_pu_bacteria 2838707686 2838711448 406
420 iso_pu_bacteria 2838714209 2838718264 406
421 iso_pu_bacteria 2838719591 2838722944 406
422 iso_pu_bacteria 2838724970 2838728330 406
423 iso_pu_bacteria 2838729681 2838732155 406
424 iso_pu_bacteria 2838742623 2838745051 406
425 iso_pu_bacteria 2841846520 2841850500 406
426 iso_pu_bacteria 2841851746 2841856110 406
427 iso_pu_bacteria 2841859092 2841863248 406
428 iso_pu_bacteria 2841864319 2841867680 406
429 iso_pu_bacteria 2842077413 2842081249 406
430 iso_pu_bacteria 2842110456 2842117456 406
431 iso_pu_bacteria 2842118031 2842121974 406
432 iso_pu_bacteria 2842124991 2842128990 406
433 iso_pu_bacteria 2842130223 2842133540 406
434 iso_pu_bacteria 2842146304 2842148847 406
435 iso_pu_bacteria 2842152218 2842155548 406
436 iso_pu_bacteria 2842156927 2842161278 406
437 iso_pu_bacteria 2842163707 2842166786 406
438 iso_pu_bacteria 2842170452 2842174494 406
439 iso_pu_bacteria 2842175837 2842179154 406
440 iso_pu_bacteria 2842180545 2842184895 406
441 iso_pu_bacteria 2842187318 2842190688 406
442 iso_pu_bacteria 2842192696 2842194833 406
443 iso_pu_bacteria 2842198810 2842201312 406
444 iso_pu_bacteria 2842205361 2842207469 406
445 iso_pu_bacteria 2842211629 2842214988 406
446 iso_pu_bacteria 2842217011 2842221862 406
447 iso_pu_bacteria 2842224351 2842227709 406
448 iso_pu_bacteria 2842229732 2842232477 406
449 iso_pu_bacteria 2842237096 2842240988 406
450 iso_pu_bacteria 2842243621 2842246893 406
451 iso_pu_bacteria 2842250916 2842254598 406
452 iso_pu_bacteria 2842257432 2842261006 406
453 iso_pu_bacteria 2842264693 2842269894 406
454 iso_pu_bacteria 2842271015 2842274417 406
455 iso_pu_bacteria 2842278818 2842280820 406
456 iso_pu_bacteria 2842285085 2842288570 406
457 iso_pu_bacteria 2842291075 2842294906 406
458 iso_pu_bacteria 2842298080 2842300065 406
459 iso_pu_bacteria 2842304105 2842305741 406
460 iso_pu_bacteria 2842311132 2842311465 406
461 iso_pu_bacteria 2842317721 2842321160 406
462 iso_pu_bacteria 2842341865 2842346773 406
463 iso_pu_bacteria 2842357229 2842358976 406
464 iso_pu_bacteria 2842363717 2842366193 406
465 iso_pu_bacteria 2842370503 2842375076 406
466 iso_pu_bacteria 2842377471 2842381305 406
467 iso_pu_bacteria 2842384541 2842388375 406
468 iso_pu_bacteria 2842395702 2842395861 406
469 iso_pu_bacteria 2842402390 2842406084 406
470 iso_pu_bacteria 2842409023 2842412669 406
471 iso_pu_bacteria 2842415677 2842419452 406
472 iso_pu_bacteria 2842422224 2842425807 406
473 iso_pu_bacteria 2842428310 2842433779 406
474 iso_pu_bacteria 2842434925 2842440060 406
475 iso_pu_bacteria 2842441272 2842446737 406
476 iso_pu_bacteria 2842447887 2842448726 406
477 iso_pu_bacteria 2842462802 2842468190 406
478 iso_pu_bacteria 2842469257 2842474669 406
479 iso_pu_bacteria 2842475841 2842477850 406
480 iso_pu_bacteria 2842482326 2842485148 406
481 iso_pu_bacteria 2842489311 2842491213 406
482 iso_pu_bacteria 2842495871 2842498551 406
483 iso_pu_bacteria 2842502639 2842504278 406
484 iso_pu_bacteria 2842509118 2842511494 406
485 iso_pu_bacteria 2842515876 2842520015 406
486 iso_pu_bacteria 2842871566 2842874901 406
487 iso_pu_bacteria 2844454524 2844456903 406
488 iso_pu_bacteria 2852387548 2852391966 406
489 iso_pu_bacteria 2854896431 2854901666 406
490 iso_pu_bacteria 2854916844 2854920051 406
491 iso_pu_bacteria 2857516855 2857519663 406
492 iso_pu_bacteria 2891048133 2891048665 406
493 iso_pu_bacteria 2899792073 2899795345 406
494 iso_pu_bacteria 2899803654 2899807980 406
495 iso_pu_bacteria 2899845264 2899849325 406
496 iso_pu_bacteria 2913308742 2913313286 406
497 iso_pu_bacteria 2919100787 2919105477 406
498 iso_pu_bacteria 2919114240 2919118478 406
499 iso_pu_bacteria 2919171160 2919175720 406
500 iso_pu_bacteria 2919408235 2919411247 406
501 iso_pu_bacteria 2923556063 2923560622 406
502 iso_pu_bacteria 2926754445 2926755008 406
503 iso_pu_bacteria 2926760298 2926762170 406
504 iso_pu_bacteria 2929138655 2929141921 406
505 iso_pu_bacteria 2933006813 2933010603 406
506 iso_pu_bacteria 2933011516 2933015725 406
507 iso_pu_bacteria 2933016740 2933021829 406
508 iso_pu_bacteria 2933570622 2933572247 406
509 iso_pu_bacteria 2933586486 2933593522 406
510 iso_pu_bacteria 2933594066 2933597537 406
511 iso_pu_bacteria 2933599457 2933602972 406
512 iso_pu_bacteria 2935894831 2935898015 406
513 iso_pu_bacteria 2935901341 2935903542 406
514 iso_pu_bacteria 2936381700 2936381865 406
515 iso_pu_bacteria 2979089926 2979092560 406
516 iso_pu_bacteria 2979095461 2979100049 406
517 iso_pu_bacteria 2979100975 2979104531 406
518 iso_pu_bacteria 2984509177 2984513674 406
519 iso_pu_bacteria 2984518228 2984522747 406
520 iso_pu_bacteria 2984537506 2984542053 406
521 iso_pu_bacteria 2984587000 2984590884 406
522 iso_pu_bacteria 2984601300 2984601483 406
523 iso_pu_bacteria 2995392953 2995394246 406
524 iso_pu_bacteria 2996887358 2996890339 406
525 iso_pu_bacteria 2996893221 2996896082 406
526 iso_pu_bacteria 3005409236 3005415876 406
527 iso_pu_bacteria 3005416602 3005421437 406
528 iso_pu_bacteria 3005445848 3005449747 406
529 iso_pu_bacteria 3005452660 3005456003 406
530 iso_pu_bacteria 639633055 639650507 406
531 iso_pu_bacteria 650716007 650741191 406
532 iso_pu_bacteria 8003570095 8003573750 406
533 iso_pu_bacteria 8005258706 8005262522 406
534 iso_pu_bacteria 8005275841 8005282512 406
535 iso_pu_bacteria 8005282627 8005286698 406
536 iso_pu_bacteria 8005289223 8005295132 406
537 iso_pu_bacteria 8005307578 8005313792 406
538 iso_pu_bacteria 8005314921 8005319858 406
539 iso_pu_bacteria 8005321885 8005324866 406
540 iso_pu_bacteria 8005382845 8005387697 406
541 iso_pu_bacteria 8005395548 8005400728 406
542 iso_pu_bacteria 8005430974 8005431155 406
543 iso_pu_bacteria 8005460587 8005465188 406
544 iso_pu_bacteria 8005484373 8005490484 406
545 iso_pu_bacteria 8005497431 8005497741 406
546 iso_pu_bacteria 8005542996 8005546768 406
547 iso_pu_bacteria 8005556819 8005561254 406
548 iso_pu_bacteria 8005563573 8005565877 406
549 iso_pu_bacteria 8005570704 8005571926 406
550 iso_pu_bacteria 8005619151 8005623457 406
551 iso_pu_bacteria 8005626139 8005630962 406
552 iso_pu_bacteria 8005645114 8005647127 406
553 iso_pu_bacteria 8005658619 8005660919 406
554 iso_pu_bacteria 8005668836 8005669146 406
555 iso_pu_bacteria 8005688590 8005694292 406
556 iso_pu_bacteria 8005695170 8005695918 406
557 iso_pu_bacteria 8018127388 8018128963 406
558 iso_pu_bacteria 8018150411 8018153432 406
559 iso_pu_bacteria 8018163183 8018165007 406
560 iso_pu_bacteria 8018176218 8018181001 406
561 iso_pu_bacteria 8023680758 8023686635 406
562 iso_pu_bacteria 8024479707 8024484451 406
563 iso_pu_bacteria 8024486573 8024490928 406
564 iso_pu_bacteria 8024501048 8024502058 406
565 iso_pu_bacteria 8045864390 8045866740 406
566 iso_pu_bacteria 8046767195 8046767456 406
567 iso_pu_bacteria 8054460903 8054463764 406
568 iso_pu_bacteria 8055431914 8055432927 406
569 iso_pu_bacteria 8056375014 8056380489 406
570 iso_pu_bacteria 8056382006 8056383473 406
571 iso_pu_bacteria 8057575449 8057580299 406
572 iso_pu_bacteria 8057874678 8057879371 406
573 3300002773 JGI25152J39213_1000550 JGI25152J39213_100055010 407
574 3300002774 JGI25150J39212_1001193 JGI25150J39212_10011935 407
575 3300002987 JGI25159J45721_1001645 JGI25159J45721_10016454 407
576 3300002987 JGI25159J45721_1015273 JGI25159J45721_10152732 407
577 3300003215 JGI25153J46596_10008355 JGI25153J46596_100083552 407
578 3300003354 JGI25160J50197_1000586 JGI25160J50197_100058615 407
579 3300003374 JGI25161J50226_1002409 JGI25161J50226_10024093 407
580 3300003374 JGI25161J50226_1006982 JGI25161J50226_10069822 407
581 3300003771 Ga0055526_1002754 Ga0055526_10027549 407
582 3300003771 Ga0055526_1004369 Ga0055526_10043695 407
583 3300003773 Ga0055537_1000143 Ga0055537_100014320 407
584 3300003773 Ga0055537_1005109 Ga0055537_10051092 407
585 3300003775 Ga0055524_1006944 Ga0055524_10069444 407
586 3300003784 Ga0055534_1000226 Ga0055534_100022631 407
587 3300003784 Ga0055534_1002614 Ga0055534_10026141 407
588 3300003790 Ga0055528_1002580 Ga0055528_10025802 407
589 3300003790 Ga0055528_1002586 Ga0055528_10025864 407
590 3300004625 Ga0055543_1002954 Ga0055543_10029542 407
591 3300005262 Ga0065165_1010156 Ga0065165_10101562 407
592 3300005983 Ga0081540_1001109 Ga0081540_100110912 407
593 3300006195 Ga0075366_10021523 Ga0075366_100215232 407
594 3300009177 Ga0105248_10002898 Ga0105248_1000289814 407
595 3300014497 Ga0182008_10050169 Ga0182008_100501692 407
596 3300025208 Ga0209436_100074 Ga0209436_10007442 407
597 3300025208 Ga0209436_102742 Ga0209436_1027422 407
598 3300025245 Ga0207425_1000001 Ga0207425_10000011688 407
599 3300025245 Ga0207425_1000089 Ga0207425_10000899 407
600 3300025258 Ga0209129_1000001 Ga0209129_1000001865 407
601 3300025263 Ga0209565_1000009 Ga0209565_1000009137 407
602 3300025263 Ga0209565_1000311 Ga0209565_100031142 407
603 3300025263 Ga0209565_1005543 Ga0209565_10055432 407
604 3300025273 Ga0209673_1000019 Ga0209673_1000019245 407
605 3300025273 Ga0209673_1027002 Ga0209673_10270022 407
606 3300025284 Ga0209130_1000460 Ga0209130_100046043 407
607 3300025284 Ga0209130_1004145 Ga0209130_10041455 407
608 3300025291 Ga0209675_1000028 Ga0209675_1000028111 407
609 3300025295 Ga0209564_1000058 Ga0209564_1000058183 407
610 3300025295 Ga0209564_1006490 Ga0209564_10064904 407
611 3300025297 Ga0209758_1000116 Ga0209758_1000116126 407
612 3300025298 Ga0209050_1001086 Ga0209050_10010866 407
613 3300025299 Ga0209256_1000093 Ga0209256_1000093164 407
614 3300025299 Ga0209256_1000488 Ga0209256_100048843 407
615 3300025299 Ga0209256_1002578 Ga0209256_100257812 407
616 3300025303 Ga0209051_1012362 Ga0209051_10123624 407
617 3300025304 Ga0209257_1001369 Ga0209257_100136932 407
618 3300031251 Ga0265327_10027038 Ga0265327_100270382 407
619 3300035207 Ga0373942_0015922 Ga0373942_0015922_231_1466 407
620 3300035241 Ga0373961_0023688 Ga0373961_0023688_91_1326 407
621 3300035691 Ga0373931_0002195 Ga0373931_0002195_422_1657 407
622 3300044673 Ga0453683_0029063 Ga0453683_0029063_1520_2800 407
623 3300044712 Ga0453684_0000069 Ga0453684_0000069_11168_12421 407
624 3300044712 Ga0453684_0199049 Ga0453684_0199049_899_2152 407
625 3300045051 Ga0451576_0016224 Ga0451576_0016224_136_1389 407
626 3300045051 Ga0451576_0073785 Ga0451576_0073785_411_1664 407
627 3300045051 Ga0451576_0132950 Ga0451576_0132950_205_1458 407
628 3300046455 Ga0495603_0027172 Ga0495603_0027172_449_1690 407
629 3300046477 Ga0495664_0063331 Ga0495664_0063331_939_2180 407
630 3300046491 Ga0495584_0051421 Ga0495584_0051421_764_2005 407
631 3300046536 Ga0495587_0000314 Ga0495587_0000314_16922_18163 407
632 3300046559 Ga0495667_0025523 Ga0495667_0025523_24_1265 407
633 3300046689 Ga0495613_0067773 Ga0495613_0067773_581_1822 407
634 3300046809 Ga0495600_0021576 Ga0495600_0021576_697_1938 407
635 3300047322 Ga0495680_0040575 Ga0495680_0040575_1715_2956 407
636 3300047444 Ga0495675_0142347 Ga0495675_0142347_208_1464 407
637 3300048903 Ga0496100_0027384 Ga0496100_0027384_1148_2383 407
638 3300048904 Ga0496101_0001698 Ga0496101_0001698_10643_11878 407
639 3300048905 Ga0496102_0006852 Ga0496102_0006852_6600_7835 407
640 3300048906 Ga0496103_0021414 Ga0496103_0021414_2606_3847 407
641 3300048907 Ga0496104_0155751 Ga0496104_0155751_546_1781 407
642 3300048908 Ga0496105_0017159 Ga0496105_0017159_1780_3015 407
643 3300048911 Ga0496108_0055851 Ga0496108_0055851_1660_2895 407
644 3300048911 Ga0496108_0061998 Ga0496108_0061998_1569_2810 407
645 3300048913 Ga0496110_0003430 Ga0496110_0003430_2592_3827 407
646 3300048914 Ga0496111_0159886 Ga0496111_0159886_209_1444 407
647 3300048916 Ga0496113_0072224 Ga0496113_0072224_1062_2300 407
648 3300048916 Ga0496113_0244634 Ga0496113_0244634_80_1315 407
649 3300048917 Ga0496114_0030544 Ga0496114_0030544_679_1914 407
650 3300050493 nmdc:mga0k408_8464_c1 nmdc:mga0k408_8464_c1_816_2099 407
651 3300053078 Ga0495612_0002394 Ga0495612_0002394_2031_3272 407
652 3300053095 Ga0500640_022331 Ga0500640_022331_51_1316 407
653 3300053153 Ga0500616_0000038 Ga0500616_0000038_122790_124073 407
654 iso_pu_bacteria 2508501122 2509109623 407
655 iso_pu_bacteria 2509276019 2509378052 407
656 iso_pu_bacteria 2510065057 2510306756 407
657 iso_pu_bacteria 2511231052 2511498526 407
658 iso_pu_bacteria 2512047086 2512534676 407
659 iso_pu_bacteria 2512875026 2512973517 407
660 iso_pu_bacteria 2513237086 2513583688 407
661 iso_pu_bacteria 2513237089 2513601964 407
662 iso_pu_bacteria 2513237090 2513610302 407
663 iso_pu_bacteria 2513237091 2513615761 407
664 iso_pu_bacteria 2513237140 2513884943 407
665 iso_pu_bacteria 2513237143 2513905153 407
666 iso_pu_bacteria 2513237156 2513983419 407
667 iso_pu_bacteria 2513237159 2513998352 407
668 iso_pu_bacteria 2513237160 2514003436 407
669 iso_pu_bacteria 2515154107 2515611109 407
670 iso_pu_bacteria 2516143018 2516205590 407
671 iso_pu_bacteria 2516653046 2516894806 407
672 iso_pu_bacteria 2517487022 2517571479 407
673 iso_pu_bacteria 2524023207 2524450374 407
674 iso_pu_bacteria 2551306084 2551676660 407
675 iso_pu_bacteria 2551306084 2551680284 407
676 iso_pu_bacteria 2551306085 2551685114 407
677 iso_pu_bacteria 2551306087 2551703849 407
678 iso_pu_bacteria 2551306089 2551715351 407
679 iso_pu_bacteria 2551306090 2551717530 407
680 iso_pu_bacteria 2551306091 2551727407 407
681 iso_pu_bacteria 2558860100 2558867447 407
682 iso_pu_bacteria 2582581283 2585166657 407
683 iso_pu_bacteria 2582581866 2585396597 407
684 iso_pu_bacteria 2599185156 2599335183 407
685 iso_pu_bacteria 2599185352 2600193913 407
686 iso_pu_bacteria 2643221607 2644052285 407
687 iso_pu_bacteria 2643221618 2644110209 407
688 iso_pu_bacteria 2643221626 2644150485 407
689 iso_pu_bacteria 2643221636 2644201332 407
690 iso_pu_bacteria 2643221637 2644209516 407
691 iso_pu_bacteria 2643221655 2644313089 407
692 iso_pu_bacteria 2643221659 2644336637 407
693 iso_pu_bacteria 2643221686 2644484563 407
694 iso_pu_bacteria 2643221688 2644495024 407
695 iso_pu_bacteria 2643221698 2644546284 407
696 iso_pu_bacteria 2643221712 2644618819 407
697 iso_pu_bacteria 2643221718 2644653044 407
698 iso_pu_bacteria 2643221723 2644677036 407
699 iso_pu_bacteria 2657244999 2657682368 407
700 iso_pu_bacteria 2690316117 2692319905 407
701 iso_pu_bacteria 2751185821 2753458543 407
702 iso_pu_bacteria 2791355082 2792582283 407
703 iso_pu_bacteria 2791355091 2792621866 407
704 iso_pu_bacteria 2791355092 2792628876 407
705 iso_pu_bacteria 2791355094 2792639933 407
706 iso_pu_bacteria 2791355253 2793280932 407
707 iso_pu_bacteria 2802428858 2802717153 407
708 iso_pu_bacteria 2802428859 2802724858 407
709 iso_pu_bacteria 2802428860 2802729609 407
710 iso_pu_bacteria 2802428861 2802736955 407
711 iso_pu_bacteria 2802428862 2802743360 407
712 iso_pu_bacteria 2802428863 2802749514 407
713 iso_pu_bacteria 2802429268 2804753739 407
714 iso_pu_bacteria 2821123053 2821128780 407
715 iso_pu_bacteria 2837678835 2837680691 407
716 iso_pu_bacteria 2838074704 2838078125 407
717 iso_pu_bacteria 2838736955 2838741984 407
718 iso_pu_bacteria 2841840854 2841845887 407
719 iso_pu_bacteria 2842140634 2842145591 407
720 iso_pu_bacteria 2842521101 2842524621 407
721 iso_pu_bacteria 2842922631 2842926370 407
722 iso_pu_bacteria 2844163670 2844166301 407
723 iso_pu_bacteria 2847417321 2847420872 407
724 iso_pu_bacteria 2848992105 2848995701 407
725 iso_pu_bacteria 2850079185 2850082689 407
726 iso_pu_bacteria 2855825444 2855827437 407
727 iso_pu_bacteria 2855839649 2855842813 407
728 iso_pu_bacteria 2855872281 2855878236 407
729 iso_pu_bacteria 2857531043 2857534067 407
730 iso_pu_bacteria 2858800743 2858802151 407
731 iso_pu_bacteria 2891373044 2891377946 407
732 iso_pu_bacteria 2896384573 2896390152 407
733 iso_pu_bacteria 2913295892 2913300281 407
734 iso_pu_bacteria 2915980308 2915982363 407
735 iso_pu_bacteria 2915986958 2915988784 407
736 iso_pu_bacteria 2915993759 2915998315 407
737 iso_pu_bacteria 2916000859 2916003823 407
738 iso_pu_bacteria 2916007675 2916009041 407
739 iso_pu_bacteria 2916014648 2916018193 407
740 iso_pu_bacteria 2916021584 2916023869 407
741 iso_pu_bacteria 2916028427 2916031024 407
742 iso_pu_bacteria 2916035215 2916040436 407
743 iso_pu_bacteria 2916041962 2916045368 407
744 iso_pu_bacteria 2916048683 2916050704 407
745 iso_pu_bacteria 2916055098 2916056799 407
746 iso_pu_bacteria 2916061851 2916064950 407
747 iso_pu_bacteria 2920760137 2920760279 407
748 iso_pu_bacteria 2920822456 2920825992 407
749 iso_pu_bacteria 2921201388 2921207957 407
750 iso_pu_bacteria 2921208531 2921209867 407
751 iso_pu_bacteria 2921237296 2921239770 407
752 iso_pu_bacteria 2921244191 2921245452 407
753 iso_pu_bacteria 2921250672 2921252874 407
754 iso_pu_bacteria 2921257292 2921260191 407
755 iso_pu_bacteria 2921263974 2921266300 407
756 iso_pu_bacteria 2921282425 2921285334 407
757 iso_pu_bacteria 2921289301 2921295927 407
758 iso_pu_bacteria 2921296804 2921303858 407
759 iso_pu_bacteria 2924144063 2924144734 407
760 iso_pu_bacteria 2924150972 2924157599 407
761 iso_pu_bacteria 2924158325 2924158842 407
762 iso_pu_bacteria 2924165586 2924169905 407
763 iso_pu_bacteria 2924172951 2924174246 407
764 iso_pu_bacteria 2924179722 2924181895 407
765 iso_pu_bacteria 2924186466 2924187804 407
766 iso_pu_bacteria 2924193448 2924193546 407
767 iso_pu_bacteria 2924200457 2924201154 407
768 iso_pu_bacteria 2924207177 2924207729 407
769 iso_pu_bacteria 2924214083 2924214933 407
770 iso_pu_bacteria 2924221636 2924223479 407
771 iso_pu_bacteria 2924228884 2924234097 407
772 iso_pu_bacteria 2936996657 2936998905 407
773 iso_pu_bacteria 2937002841 2937006662 407
774 iso_pu_bacteria 2937009748 2937010300 407
775 iso_pu_bacteria 2937016420 2937017783 407
776 iso_pu_bacteria 2937023124 2937023239 407
777 iso_pu_bacteria 2937029754 2937031795 407
778 iso_pu_bacteria 2937036028 2937036273 407
779 iso_pu_bacteria 2937042894 2937048931 407
780 iso_pu_bacteria 2937049772 2937053401 407
781 iso_pu_bacteria 2937056579 2937059832 407
782 iso_pu_bacteria 2937063883 2937068169 407
783 iso_pu_bacteria 2937071275 2937075453 407
784 iso_pu_bacteria 2937078374 2937082110 407
785 iso_pu_bacteria 2937084907 2937090980 407
786 iso_pu_bacteria 2937091812 2937097118 407
787 iso_pu_bacteria 2937098957 2937103117 407
788 iso_pu_bacteria 2937106411 2937112579 407
789 iso_pu_bacteria 2937113482 2937114182 407
790 iso_pu_bacteria 2937119839 2937120182 407
791 iso_pu_bacteria 2937126314 2937128602 407
792 iso_pu_bacteria 2937843397 2937848584 407
793 iso_pu_bacteria 2941499720 2941501411 407
794 iso_pu_bacteria 2957375807 2957381764 407
795 iso_pu_bacteria 2957382221 2957384550 407
796 iso_pu_bacteria 2957388812 2957395256 407
797 iso_pu_bacteria 2957395598 2957398085 407
798 iso_pu_bacteria 2957402308 2957405172 407
799 iso_pu_bacteria 2957408893 2957411773 407
800 iso_pu_bacteria 2957415311 2957417530 407
801 iso_pu_bacteria 2957422303 2957422305 407
802 iso_pu_bacteria 2957430029 2957431976 407
803 iso_pu_bacteria 2957437181 2957441600 407
804 iso_pu_bacteria 2957443900 2957450344 407
805 iso_pu_bacteria 2957450854 2957454568 407
806 iso_pu_bacteria 2957457609 2957460939 407
807 iso_pu_bacteria 2957464669 2957465480 407
808 iso_pu_bacteria 2957471148 2957471351 407
809 iso_pu_bacteria 2957478035 2957479407 407
810 iso_pu_bacteria 2957484790 2957486347 407
811 iso_pu_bacteria 2957491536 2957494496 407
812 iso_pu_bacteria 2957498199 2957504990 407
813 iso_pu_bacteria 2957505466 2957512260 407
814 iso_pu_bacteria 2960584000 2960584891 407
815 iso_pu_bacteria 2960591022 2960595973 407
816 iso_pu_bacteria 2960597568 2960597958 407
817 iso_pu_bacteria 2960603979 2960606572 407
818 iso_pu_bacteria 2960610863 2960613355 407
819 iso_pu_bacteria 2960617483 2960618355 407
820 iso_pu_bacteria 2960624210 2960629414 407
821 iso_pu_bacteria 2960631154 2960633749 407
822 iso_pu_bacteria 2960637947 2960643742 407
823 iso_pu_bacteria 2960645483 2960647520 407
824 iso_pu_bacteria 2960652885 2960654652 407
825 iso_pu_bacteria 2960660292 2960666882 407
826 iso_pu_bacteria 2960667422 2960673229 407
827 iso_pu_bacteria 2960674078 2960674942 407
828 iso_pu_bacteria 2960680706 2960682406 407
829 iso_pu_bacteria 2960687367 2960693267 407
830 iso_pu_bacteria 2960693952 2960698168 407
831 iso_pu_bacteria 2964607997 2964612464 407
832 iso_pu_bacteria 2964615318 2964617028 407
833 iso_pu_bacteria 2964621998 2964624441 407
834 iso_pu_bacteria 2964628898 2964629474 407
835 iso_pu_bacteria 2964636051 2964641559 407
836 iso_pu_bacteria 2964643177 2964643670 407
837 iso_pu_bacteria 2964649959 2964655272 407
838 iso_pu_bacteria 2964656573 2964659640 407
839 iso_pu_bacteria 2964663802 2964669340 407
840 iso_pu_bacteria 2964670856 2964675408 407
841 iso_pu_bacteria 2964678106 2964679160 407
842 iso_pu_bacteria 2964685014 2964687167 407
843 iso_pu_bacteria 2964691889 2964695082 407
844 iso_pu_bacteria 2964698721 2964702482 407
845 iso_pu_bacteria 2964705432 2964705965 407
846 iso_pu_bacteria 2964712639 2964712721 407
847 iso_pu_bacteria 2964719344 2964719519 407
848 iso_pu_bacteria 2967664464 2967664801 407
849 iso_pu_bacteria 2967671571 2967672300 407
850 iso_pu_bacteria 2967678726 2967681187 407
851 iso_pu_bacteria 2967686174 2967690184 407
852 iso_pu_bacteria 2967693043 2967699339 407
853 iso_pu_bacteria 2967699805 2967700898 407
854 iso_pu_bacteria 2967706974 2967713255 407
855 iso_pu_bacteria 2967714385 2967719028 407
856 iso_pu_bacteria 2967721400 2967723853 407
857 iso_pu_bacteria 2967728569 2967730888 407
858 iso_pu_bacteria 2967735183 2967738403 407
859 iso_pu_bacteria 2967742019 2967748585 407
860 iso_pu_bacteria 2967748971 2967753998 407
861 iso_pu_bacteria 2967755722 2967757476 407
862 iso_pu_bacteria 2967762386 2967767865 407
863 iso_pu_bacteria 2967769361 2967769842 407
864 iso_pu_bacteria 2967775926 2967781014 407
865 iso_pu_bacteria 2970019648 2970021928 407
866 iso_pu_bacteria 2970026789 2970028748 407
867 iso_pu_bacteria 2970033650 2970036638 407
868 iso_pu_bacteria 2970040964 2970044958 407
869 iso_pu_bacteria 2970047711 2970051145 407
870 iso_pu_bacteria 2970054988 2970058897 407
871 iso_pu_bacteria 2970061556 2970068443 407
872 iso_pu_bacteria 2970068827 2970070299 407
873 iso_pu_bacteria 2970076120 2970076780 407
874 iso_pu_bacteria 2970082768 2970084034 407
875 iso_pu_bacteria 2970088815 2970092804 407
876 iso_pu_bacteria 2970095765 2970099897 407
877 iso_pu_bacteria 2970102677 2970106979 407
878 iso_pu_bacteria 2970109326 2970111123 407
879 iso_pu_bacteria 2970116247 2970116878 407
880 iso_pu_bacteria 2970122695 2970124575 407
881 iso_pu_bacteria 2970129317 2970133582 407
882 iso_pu_bacteria 2970136068 2970142258 407
883 iso_pu_bacteria 2970143518 2970143538 407
884 iso_pu_bacteria 2970149975 2970151690 407
885 iso_pu_bacteria 2970156795 2970158720 407
886 iso_pu_bacteria 2970164137 2970170815 407
887 iso_pu_bacteria 2970170962 2970176102 407
888 iso_pu_bacteria 2970177841 2970181276 407
889 iso_pu_bacteria 2970184632 2970185504 407
890 iso_pu_bacteria 2970191845 2970197975 407
891 iso_pu_bacteria 2977516862 2977519764 407
892 iso_pu_bacteria 2977523885 2977525163 407
893 iso_pu_bacteria 2977530762 2977535019 407
894 iso_pu_bacteria 2977537788 2977544531 407
895 iso_pu_bacteria 2977544691 2977550563 407
896 iso_pu_bacteria 2977551784 2977558072 407
897 iso_pu_bacteria 2977558990 2977561030 407
898 iso_pu_bacteria 2977565890 2977571250 407
899 iso_pu_bacteria 2977572785 2977573773 407
900 iso_pu_bacteria 2977579622 2977582974 407
901 iso_pu_bacteria 2989349275 2989354879 407
902 iso_pu_bacteria 2989771324 2989771597 407
903 iso_pu_bacteria 3003930520 3003930964 407
904 iso_pu_bacteria 643692032 643827463 407
905 iso_pu_bacteria 648276728 648737249 407
906 iso_pu_bacteria 8002392321 8002394722 407
907 iso_pu_bacteria 8003992118 8003995393 407
908 iso_pu_bacteria 8003999396 8004003144 407
909 iso_pu_bacteria 8049293176 8049296338 407
910 3300001979 JGI24740J21852_10000317 JGI24740J21852_1000031714 408
911 3300002704 JGI25155J39150_1000004 JGI25155J39150_1000004179 408
912 3300002705 JGI25156J39149_1000015 JGI25156J39149_100001595 408
913 3300002737 JGI25162J39368_1000199 JGI25162J39368_100019914 408
914 3300002737 JGI25162J39368_1000207 JGI25162J39368_100020751 408
915 3300002738 JGI25154J39366_1000026 JGI25154J39366_1000026107 408
916 3300002739 JGI25158J39367_1000004 JGI25158J39367_100000432 408
917 3300002741 JGI25157J39369_1000005 JGI25157J39369_100000584 408
918 3300002773 JGI25152J39213_1000815 JGI25152J39213_10008157 408
919 3300002773 JGI25152J39213_1001458 JGI25152J39213_100145810 408
920 3300002773 JGI25152J39213_1005316 JGI25152J39213_10053163 408
921 3300002774 JGI25150J39212_1000171 JGI25150J39212_100017134 408
922 3300002774 JGI25150J39212_1000433 JGI25150J39212_100043321 408
923 3300002987 JGI25159J45721_1001077 JGI25159J45721_100107715 408
924 3300003187 JGI25151J46595_10000034 JGI25151J46595_1000003434 408
925 3300003187 JGI25151J46595_10004445 JGI25151J46595_100044452 408
926 3300003187 JGI25151J46595_10005968 JGI25151J46595_100059683 408
927 3300003187 JGI25151J46595_10025448 JGI25151J46595_100254482 408
928 3300003214 JGI25165J46597_1000307 JGI25165J46597_100030735 408
929 3300003214 JGI25165J46597_1002547 JGI25165J46597_10025474 408
930 3300003215 JGI25153J46596_10003425 JGI25153J46596_100034257 408
931 3300003215 JGI25153J46596_10005782 JGI25153J46596_100057822 408
932 3300003215 JGI25153J46596_10012088 JGI25153J46596_100120882 408
933 3300003354 JGI25160J50197_1000109 JGI25160J50197_10001092 408
934 3300003354 JGI25160J50197_1000493 JGI25160J50197_100049310 408
935 3300003374 JGI25161J50226_1000011 JGI25161J50226_10000112 408
936 3300003374 JGI25161J50226_1000038 JGI25161J50226_1000038108 408
937 3300003374 JGI25161J50226_1002572 JGI25161J50226_10025723 408
938 3300003578 Ga0006562J51391_1019599 Ga0006562J51391_10195992 408
939 3300003771 Ga0055526_1000361 Ga0055526_10003616 408
940 3300003771 Ga0055526_1004469 Ga0055526_10044692 408
941 3300003775 Ga0055524_1002424 Ga0055524_10024246 408
942 3300003775 Ga0055524_1012395 Ga0055524_10123953 408
943 3300003790 Ga0055528_1000543 Ga0055528_100054314 408
944 3300003790 Ga0055528_1003048 Ga0055528_10030489 408
945 3300003790 Ga0055528_1003134 Ga0055528_10031342 408
946 3300003790 Ga0055528_1005705 Ga0055528_10057055 408
947 3300003790 Ga0055528_1020707 Ga0055528_10207072 408
948 3300003792 Ga0055540_1000945 Ga0055540_10009459 408
949 3300003792 Ga0055540_1016785 Ga0055540_10167852 408
950 3300003794 Ga0055531_10003856 Ga0055531_100038565 408
951 3300003856 Ga0058692_1001723 Ga0058692_10017233 408
952 3300003856 Ga0058692_1001864 Ga0058692_10018644 408
953 3300004625 Ga0055543_1000071 Ga0055543_100007188 408
954 3300004625 Ga0055543_1000106 Ga0055543_100010615 408
955 3300005262 Ga0065165_1000135 Ga0065165_10001352 408
956 3300005262 Ga0065165_1002898 Ga0065165_10028984 408
957 3300005331 Ga0070670_100000061 Ga0070670_10000006175 408
958 3300005347 Ga0070668_100027231 Ga0070668_1000272312 408
959 3300005435 Ga0070714_100082383 Ga0070714_1000823832 408
960 3300005548 Ga0070665_100000961 Ga0070665_10000096120 408
961 3300005548 Ga0070665_100006101 Ga0070665_1000061012 408
962 3300005578 Ga0068854_100149097 Ga0068854_1001490972 408
963 3300005981 Ga0081538_10003840 Ga0081538_1000384015 408
964 3300006038 Ga0075365_10001556 Ga0075365_100015564 408
965 3300006038 Ga0075365_10005164 Ga0075365_100051645 408
966 3300006051 Ga0075364_10000198 Ga0075364_100001987 408
967 3300006051 Ga0075364_10058898 Ga0075364_100588982 408
968 3300006051 Ga0075364_10148742 Ga0075364_101487421 408
969 3300006177 Ga0075362_10046844 Ga0075362_100468442 408
970 3300006178 Ga0075367_10002178 Ga0075367_100021788 408
971 3300006178 Ga0075367_10019918 Ga0075367_100199182 408
972 3300006178 Ga0075367_10026314 Ga0075367_100263143 408
973 3300006195 Ga0075366_10002009 Ga0075366_100020093 408
974 3300006353 Ga0075370_10069008 Ga0075370_100690082 408
975 3300006948 Ga0099826_10000120 Ga0099826_100001206 408
976 3300006948 Ga0099826_10015703 Ga0099826_100157032 408
977 3300009011 Ga0105251_10021244 Ga0105251_100212443 408
978 3300009093 Ga0105240_10000013 Ga0105240_10000013412 408
979 3300009148 Ga0105243_10007195 Ga0105243_1000719510 408
980 3300009177 Ga0105248_10152568 Ga0105248_101525682 408
981 3300009545 Ga0105237_10000949 Ga0105237_1000094929 408
982 3300009765 Ga0123341_1000021 Ga0123341_100002160 408
983 3300009766 Ga0123342_1009449 Ga0123342_10094497 408
984 3300009766 Ga0123342_1020489 Ga0123342_10204893 408
985 3300010375 Ga0105239_10010104 Ga0105239_1001010411 408
986 3300013100 Ga0157373_10004518 Ga0157373_1000451810 408
987 3300013102 Ga0157371_10000108 Ga0157371_10000108103 408
988 3300013102 Ga0157371_10006295 Ga0157371_100062956 408
989 3300013104 Ga0157370_10000324 Ga0157370_1000032429 408
990 3300013104 Ga0157370_10003808 Ga0157370_100038082 408
991 3300013297 Ga0157378_10143035 Ga0157378_101430352 408
992 3300014497 Ga0182008_10008431 Ga0182008_100084316 408
993 3300014968 Ga0157379_10222843 Ga0157379_102228431 408
994 3300015262 Ga0182007_10004002 Ga0182007_100040022 408
995 3300015265 Ga0182005_1004548 Ga0182005_10045484 408
996 3300025206 Ga0209435_100009 Ga0209435_10000981 408
997 3300025207 Ga0209760_101544 Ga0209760_1015442 408
998 3300025208 Ga0209436_100045 Ga0209436_10004556 408
999 3300025230 Ga0209563_102386 Ga0209563_1023862 408
1000 3300025233 Ga0209437_100182 Ga0209437_10018243 408
1001 3300025233 Ga0209437_100204 Ga0209437_10020440 408
1002 3300025245 Ga0207425_1000035 Ga0207425_100003557 408
1003 3300025245 Ga0207425_1005085 Ga0207425_10050853 408
1004 3300025246 Ga0209646_1000018 Ga0209646_100001881 408
1005 3300025250 Ga0209026_1000043 Ga0209026_100004381 408
1006 3300025256 Ga0209759_1000007 Ga0209759_100000781 408
1007 3300025258 Ga0209129_1000029 Ga0209129_100002957 408
1008 3300025258 Ga0209129_1000050 Ga0209129_1000050206 408
1009 3300025258 Ga0209129_1000565 Ga0209129_10005658 408
1010 3300025258 Ga0209129_1000823 Ga0209129_10008239 408
1011 3300025258 Ga0209129_1000925 Ga0209129_100092515 408
1012 3300025258 Ga0209129_1003167 Ga0209129_10031675 408
1013 3300025258 Ga0209129_1003665 Ga0209129_10036652 408
1014 3300025261 Ga0209233_1000231 Ga0209233_100023172 408
1015 3300025273 Ga0209673_1000033 Ga0209673_1000033157 408
1016 3300025273 Ga0209673_1000050 Ga0209673_1000050100 408
1017 3300025273 Ga0209673_1000052 Ga0209673_1000052236 408
1018 3300025273 Ga0209673_1001744 Ga0209673_100174416 408
1019 3300025273 Ga0209673_1001945 Ga0209673_100194511 408
1020 3300025273 Ga0209673_1002003 Ga0209673_10020039 408
1021 3300025273 Ga0209673_1004219 Ga0209673_10042195 408
1022 3300025273 Ga0209673_1005234 Ga0209673_10052346 408
1023 3300025284 Ga0209130_1000009 Ga0209130_1000009177 408
1024 3300025284 Ga0209130_1000058 Ga0209130_1000058187 408
1025 3300025284 Ga0209130_1010105 Ga0209130_10101052 408
1026 3300025294 Ga0209025_1000132 Ga0209025_1000132149 408
1027 3300025294 Ga0209025_1000487 Ga0209025_100048776 408
1028 3300025294 Ga0209025_1001158 Ga0209025_100115825 408
1029 3300025294 Ga0209025_1003440 Ga0209025_100344016 408
1030 3300025294 Ga0209025_1004756 Ga0209025_100475615 408
1031 3300025294 Ga0209025_1005664 Ga0209025_10056648 408
1032 3300025294 Ga0209025_1007555 Ga0209025_10075554 408
1033 3300025294 Ga0209025_1007819 Ga0209025_10078195 408
1034 3300025295 Ga0209564_1000236 Ga0209564_100023634 408
1035 3300025295 Ga0209564_1000795 Ga0209564_100079524 408
1036 3300025295 Ga0209564_1002373 Ga0209564_10023739 408
1037 3300025295 Ga0209564_1007526 Ga0209564_10075266 408
1038 3300025295 Ga0209564_1016597 Ga0209564_10165973 408
1039 3300025297 Ga0209758_1000255 Ga0209758_100025546 408
1040 3300025297 Ga0209758_1000337 Ga0209758_100033767 408
1041 3300025297 Ga0209758_1001072 Ga0209758_10010727 408
1042 3300025297 Ga0209758_1001193 Ga0209758_10011937 408
1043 3300025297 Ga0209758_1001212 Ga0209758_10012128 408
1044 3300025297 Ga0209758_1002254 Ga0209758_10022549 408
1045 3300025297 Ga0209758_1002939 Ga0209758_10029392 408
1046 3300025299 Ga0209256_1000250 Ga0209256_100025045 408
1047 3300025299 Ga0209256_1000279 Ga0209256_100027943 408
1048 3300025299 Ga0209256_1000563 Ga0209256_100056312 408
1049 3300025299 Ga0209256_1000847 Ga0209256_100084717 408
1050 3300025299 Ga0209256_1002849 Ga0209256_10028499 408
1051 3300025299 Ga0209256_1011433 Ga0209256_10114332 408
1052 3300025302 Ga0207426_1000041 Ga0207426_1000041115 408
1053 3300025302 Ga0207426_1000070 Ga0207426_1000070268 408
1054 3300025302 Ga0207426_1000131 Ga0207426_1000131187 408
1055 3300025302 Ga0207426_1000798 Ga0207426_100079813 408
1056 3300025303 Ga0209051_1000118 Ga0209051_1000118124 408
1057 3300025303 Ga0209051_1000818 Ga0209051_10008182 408
1058 3300025303 Ga0209051_1001035 Ga0209051_10010352 408
1059 3300025303 Ga0209051_1002026 Ga0209051_100202611 408
1060 3300025303 Ga0209051_1003381 Ga0209051_10033818 408
1061 3300025303 Ga0209051_1031934 Ga0209051_10319342 408
1062 3300025304 Ga0209257_1001682 Ga0209257_10016827 408
1063 3300025304 Ga0209257_1002038 Ga0209257_10020389 408
1064 3300025304 Ga0209257_1008647 Ga0209257_10086473 408
1065 3300025913 Ga0207695_10000044 Ga0207695_10000044369 408
1066 3300025914 Ga0207671_10000043 Ga0207671_10000043119 408
1067 3300025925 Ga0207650_10001296 Ga0207650_1000129613 408
1068 3300025929 Ga0207664_10070924 Ga0207664_100709242 408
1069 3300025931 Ga0207644_10033579 Ga0207644_100335792 408
1070 3300025935 Ga0207709_10020341 Ga0207709_100203413 408
1071 3300025941 Ga0207711_10114779 Ga0207711_101147792 408
1072 3300025972 Ga0207668_10121336 Ga0207668_101213362 408
1073 3300027312 Ga0209371_1000037 Ga0209371_1000037166 408
1074 3300027312 Ga0209371_1000686 Ga0209371_100068617 408
1075 3300027312 Ga0209371_1011883 Ga0209371_10118832 408
1076 3300027666 Ga0209282_1020473 Ga0209282_10204732 408
1077 3300027866 Ga0209813_10002400 Ga0209813_100024003 408
1078 3300028379 Ga0268266_10004472 Ga0268266_100044724 408
1079 3300028794 Ga0307515_10009143 Ga0307515_100091437 408
1080 3300028794 Ga0307515_10026153 Ga0307515_100261539 408
1081 3300028794 Ga0307515_10126691 Ga0307515_101266912 408
1082 3300030500 Ga0268256_1000039 Ga0268256_1000039142 408
1083 3300030500 Ga0268256_1002437 Ga0268256_10024372 408
1084 3300030500 Ga0268256_1012217 Ga0268256_10122172 408
1085 3300030744 Ga0316181_1283596 Ga0316181_12835964 408
1086 3300031456 Ga0307513_10022564 Ga0307513_100225643 408
1087 3300031456 Ga0307513_10136816 Ga0307513_101368163 408
1088 3300031456 Ga0307513_10159766 Ga0307513_101597662 408
1089 3300031731 Ga0307405_10000319 Ga0307405_1000031914 408
1090 3300031852 Ga0307410_10158348 Ga0307410_101583482 408
1091 3300031901 Ga0307406_10005642 Ga0307406_100056424 408
1092 3300031911 Ga0307412_10003405 Ga0307412_1000340510 408
1093 3300032133 Ga0316583_10001744 Ga0316583_100017447 408
1094 3300035114 Ga0373939_0041662 Ga0373939_0041662_24_1262 408
1095 3300035695 Ga0373927_0003318 Ga0373927_0003318_5655_6908 408
1096 3300036647 Ga0316582_0031383 Ga0316582_0031383_875_2161 408
1097 3300036712 Ga0316584_0070324 Ga0316584_0070324_199_1485 408
1098 3300037068 Ga0373925_0001364 Ga0373925_0001364_597_1850 408
1099 3300037471 Ga0395905_0001780 Ga0395905_0001780_4083_5336 408
1100 3300041501 Ga0451845_0530672 Ga0451845_0530672_129_1379 408
1101 3300041507 Ga0451851_0818185 Ga0451851_0818185_16_1266 408
1102 3300042005 Ga0439448_0001298 Ga0439448_0001298_2856_4130 408
1103 3300044673 Ga0453683_0016829 Ga0453683_0016829_2956_4218 408
1104 3300044683 Ga0466965_0021541 Ga0466965_0021541_576_1814 408
1105 3300046460 Ga0495638_0001230 Ga0495638_0001230_7363_8613 408
1106 3300046460 Ga0495638_0031248 Ga0495638_0031248_1443_2696 408
1107 3300046462 Ga0495651_0056832 Ga0495651_0056832_543_1826 408
1108 3300046474 Ga0495605_0011002 Ga0495605_0011002_2702_3952 408
1109 3300046476 Ga0495662_0004884 Ga0495662_0004884_4052_5335 408
1110 3300046492 Ga0495585_0007162 Ga0495585_0007162_2467_3717 408
1111 3300046492 Ga0495585_0038672 Ga0495585_0038672_1163_2413 408
1112 3300046506 Ga0495583_0008791 Ga0495583_0008791_544_1869 408
1113 3300046512 Ga0495610_0000530 Ga0495610_0000530_4026_5279 408
1114 3300046518 Ga0495631_0005295 Ga0495631_0005295_4199_5449 408
1115 3300046518 Ga0495631_0062505 Ga0495631_0062505_224_1474 408
1116 3300046519 Ga0495632_0005390 Ga0495632_0005390_3523_4776 408
1117 3300046519 Ga0495632_0023573 Ga0495632_0023573_619_1869 408
1118 3300046522 Ga0495643_0049524 Ga0495643_0049524_771_2021 408
1119 3300046524 Ga0495648_0017029 Ga0495648_0017029_3650_4900 408
1120 3300046558 Ga0495633_0018493 Ga0495633_0018493_1618_2868 408
1121 3300046558 Ga0495633_0038118 Ga0495633_0038118_108_1358 408
1122 3300046648 Ga0495611_0029517 Ga0495611_0029517_918_2168 408
1123 3300046660 Ga0495625_0016626 Ga0495625_0016626_3417_4667 408
1124 3300046660 Ga0495625_0047456 Ga0495625_0047456_434_1684 408
1125 3300046675 Ga0495657_0070709 Ga0495657_0070709_734_2017 408
1126 3300046692 Ga0495671_0055100 Ga0495671_0055100_236_1486 408
1127 3300046809 Ga0495600_0041246 Ga0495600_0041246_963_2246 408
1128 3300047317 Ga0495604_0013564 Ga0495604_0013564_1627_2910 408
1129 3300047320 Ga0495672_0034520 Ga0495672_0034520_195_1445 408
1130 3300047443 Ga0495687_029152 Ga0495687_029152_1289_2539 408
1131 3300047472 Ga0495686_0003490 Ga0495686_0003490_3013_4266 408
1132 3300047472 Ga0495686_0147368 Ga0495686_0147368_117_1367 408
1133 3300048905 Ga0496102_0311711 Ga0496102_0311711_98_1372 408
1134 3300048913 Ga0496110_0213022 Ga0496110_0213022_443_1726 408
1135 3300048914 Ga0496111_0001190 Ga0496111_0001190_10127_11377 408
1136 3300048919 Ga0496116_0000057 Ga0496116_0000057_199492_200775 408
1137 3300048919 Ga0496116_0002318 Ga0496116_0002318_17144_18397 408
1138 3300048919 Ga0496116_0015322 Ga0496116_0015322_3500_4828 408
1139 3300048919 Ga0496116_0022830 Ga0496116_0022830_976_2226 408
1140 3300048919 Ga0496116_0066889 Ga0496116_0066889_30_1283 408
1141 3300048920 Ga0496117_0000031 Ga0496117_0000031_190957_192279 408
1142 3300048920 Ga0496117_0003614 Ga0496117_0003614_7701_9098 408
1143 3300048920 Ga0496117_0088586 Ga0496117_0088586_129_1367 408
1144 3300048921 Ga0496118_0000899 Ga0496118_0000899_40492_41814 408
1145 3300048921 Ga0496118_0004165 Ga0496118_0004165_8718_10115 408
1146 3300048921 Ga0496118_0005042 Ga0496118_0005042_3090_4340 408
1147 3300048921 Ga0496118_0009394 Ga0496118_0009394_3340_4668 408
1148 3300048922 Ga0496119_0007259 Ga0496119_0007259_89_1339 408
1149 3300048923 Ga0496120_0000337 Ga0496120_0000337_40170_41492 408
1150 3300048924 Ga0496121_0000034 Ga0496121_0000034_149417_150667 408
1151 3300048924 Ga0496121_0000435 Ga0496121_0000435_2463_3713 408
1152 3300048924 Ga0496121_0003229 Ga0496121_0003229_14303_15604 408
1153 3300048924 Ga0496121_0017251 Ga0496121_0017251_2127_3374 408
1154 3300048924 Ga0496121_0017810 Ga0496121_0017810_3490_4743 408
1155 3300048925 Ga0496122_0000023 Ga0496122_0000023_190957_192279 408
1156 3300048925 Ga0496122_0000074 Ga0496122_0000074_113389_114792 408
1157 3300048925 Ga0496122_0009256 Ga0496122_0009256_885_2135 408
1158 3300048925 Ga0496122_0012716 Ga0496122_0012716_1779_3032 408
1159 3300048925 Ga0496122_0022157 Ga0496122_0022157_4367_5617 408
1160 3300048925 Ga0496122_0089191 Ga0496122_0089191_126_1376 408
1161 3300048925 Ga0496122_0143320 Ga0496122_0143320_29_1279 408
1162 3300048926 Ga0496123_0000027 Ga0496123_0000027_188757_190079 408
1163 3300048926 Ga0496123_0000062 Ga0496123_0000062_113371_114774 408
1164 3300048926 Ga0496123_0003477 Ga0496123_0003477_12874_14127 408
1165 3300048926 Ga0496123_0055394 Ga0496123_0055394_99_1346 408
1166 3300048927 Ga0496124_0000174 Ga0496124_0000174_39140_40390 408
1167 3300048927 Ga0496124_0009391 Ga0496124_0009391_3477_4805 408
1168 3300048927 Ga0496124_0203961 Ga0496124_0203961_88_1335 408
1169 3300048928 Ga0496125_0000030 Ga0496125_0000030_223835_225085 408
1170 3300048928 Ga0496125_0020756 Ga0496125_0020756_116_1369 408
1171 3300048928 Ga0496125_0039635 Ga0496125_0039635_2581_3831 408
1172 3300048929 Ga0496126_0064232 Ga0496126_0064232_465_1715 408
1173 3300049569 Ga0501032_0013894 Ga0501032_0013894_2753_3982 408
1174 3300049570 Ga0501033_0005793 Ga0501033_0005793_8212_9507 408
1175 3300049571 Ga0501034_0001253 Ga0501034_0001253_5239_6468 408
1176 3300049571 Ga0501034_0003747 Ga0501034_0003747_8031_9278 408
1177 3300049571 Ga0501034_0054795 Ga0501034_0054795_101_1330 408
1178 3300049571 Ga0501034_0054907 Ga0501034_0054907_432_1685 408
1179 3300049571 Ga0501034_0057340 Ga0501034_0057340_101_1330 408
1180 3300049572 Ga0501036_0008929 Ga0501036_0008929_2779_4008 408
1181 3300049574 Ga0501038_0132981 Ga0501038_0132981_340_1569 408
1182 3300049579 Ga0501043_0024078 Ga0501043_0024078_101_1330 408
1183 3300049580 Ga0501046_0010020 Ga0501046_0010020_2663_3892 408
1184 3300049581 Ga0501047_0000384 Ga0501047_0000384_2684_3913 408
1185 3300049581 Ga0501047_0153725 Ga0501047_0153725_203_1477 408
1186 3300049582 Ga0501048_0000074 Ga0501048_0000074_22920_24149 408
1187 3300049586 Ga0501070_0020486 Ga0501070_0020486_2962_4236 408
1188 3300049586 Ga0501070_0020720 Ga0501070_0020720_1746_2975 408
1189 3300049589 Ga0501073_0121374 Ga0501073_0121374_100_1329 408
1190 3300049590 Ga0501074_0015582 Ga0501074_0015582_2536_3765 408
1191 3300049742 Ga0501080_0001148 Ga0501080_0001148_17841_19070 408
1192 3300049742 Ga0501080_0039828 Ga0501080_0039828_2167_3420 408
1193 3300049744 Ga0501083_0087690 Ga0501083_0087690_502_1749 408
1194 3300049776 Ga0501280_001879 Ga0501280_001879_15_1280 408
1195 3300049822 Ga0501035_0043458 Ga0501035_0043458_1834_3108 408
1196 3300049823 Ga0501044_0049618 Ga0501044_0049618_101_1330 408
1197 3300049823 Ga0501044_0333709 Ga0501044_0333709_109_1338 408
1198 3300050491 nmdc:mga00v17_10_c2 nmdc:mga00v17_10_c2_101129_102379 408
1199 3300050491 nmdc:mga00v17_32480_c1 nmdc:mga00v17_32480_c1_1516_2838 408
1200 3300050491 nmdc:mga00v17_99588_c1 nmdc:mga00v17_99588_c1_235_1488 408
1201 3300050493 nmdc:mga0k408_30291_c1 nmdc:mga0k408_30291_c1_1670_2992 408
1202 3300050494 nmdc:mga06z11_6158_c1 nmdc:mga06z11_6158_c1_3077_4399 408
1203 3300050516 nmdc:mga0sz30_5239_c1 nmdc:mga0sz30_5239_c1_3137_4459 408
1204 3300050516 nmdc:mga0sz30_80_c1 nmdc:mga0sz30_80_c1_26659_27981 408
1205 3300053125 Ga0500618_001520 Ga0500618_001520_3092_4342 408
1206 3300053134 Ga0500658_0001179 Ga0500658_0001179_7793_9043 408
1207 3300053137 Ga0500561_0000071 Ga0500561_0000071_7001_8323 408
1208 3300053139 Ga0500568_0000980 Ga0500568_0000980_15488_16738 408
1209 3300053139 Ga0500568_0006313 Ga0500568_0006313_3969_5216 408
1210 3300053148 Ga0500590_000122 Ga0500590_000122_16934_18217 408
1211 3300053153 Ga0500616_0000441 Ga0500616_0000441_50248_51498 408
1212 3300053153 Ga0500616_0000989 Ga0500616_0000989_24165_25415 408
1213 3300053153 Ga0500616_0062546 Ga0500616_0062546_112_1362 408
1214 3300053161 Ga0500634_0004414 Ga0500634_0004414_4249_5499 408
1215 3300053177 Ga0500636_0000025 Ga0500636_0000025_76858_78108 408
1216 iso_pu_bacteria 2508501050 2508734181 408
1217 iso_pu_bacteria 2508501114 2509079116 408
1218 iso_pu_bacteria 2509276033 2509446279 408
1219 iso_pu_bacteria 2515154114 2515647173 408
1220 iso_pu_bacteria 2534681786 2535485839 408
1221 iso_pu_bacteria 2545555834 2545674855 408
1222 iso_pu_bacteria 2582581315 2585326714 408
1223 iso_pu_bacteria 2582581316 2585333875 408
1224 iso_pu_bacteria 2643221547 2643758992 408
1225 iso_pu_bacteria 2643221651 2644290745 408
1226 iso_pu_bacteria 2643221653 2644299887 408
1227 iso_pu_bacteria 2643221719 2644658114 408
1228 iso_pu_bacteria 2643221733 2644728598 408
1229 iso_pu_bacteria 2643221734 2644736987 408
1230 iso_pu_bacteria 2643221736 2644744179 408
1231 iso_pu_bacteria 2667528175 2671123557 408
1232 iso_pu_bacteria 2767802442 2770198771 408
1233 iso_pu_bacteria 2773857925 2774869254 408
1234 iso_pu_bacteria 2775506901 2776257909 408
1235 iso_pu_bacteria 2818991272 2819244670 408
1236 iso_pu_bacteria 2818991467 2819719874 408
1237 iso_pu_bacteria 2835312727 2835317383 408
1238 iso_pu_bacteria 2839993093 2839993156 408
1239 iso_pu_bacteria 2841760612 2841765416 408
1240 iso_pu_bacteria 2841911363 2841914643 408
1241 iso_pu_bacteria 2841917233 2841920192 408
1242 iso_pu_bacteria 2844104063 2844107026 408
1243 iso_pu_bacteria 2844315083 2844321900 408
1244 iso_pu_bacteria 2851182111 2851186009 408
1245 iso_pu_bacteria 2851246043 2851249066 408
1246 iso_pu_bacteria 2882456835 2882457370 408
1247 iso_pu_bacteria 2894232714 2894238451 408
1248 iso_pu_bacteria 2903727486 2903727552 408
1249 iso_pu_bacteria 2906602504 2906602958 408
1250 iso_pu_bacteria 2917699015 2917704222 408
1251 iso_pu_bacteria 2919166419 2919170565 408
1252 iso_pu_bacteria 2928521798 2928522972 408
1253 iso_pu_bacteria 2935959822 2935962356 408
1254 iso_pu_bacteria 2936367885 2936369969 408
1255 iso_pu_bacteria 2936375103 2936379155 408
1256 iso_pu_bacteria 2954011201 2954013662 408
1257 iso_pu_bacteria 2978969890 2978972632 408
1258 iso_pu_bacteria 2989776772 2989780072 408
1259 iso_pu_bacteria 641522639 641645185 408
1260 iso_pu_bacteria 643348564 643602988 408
1261 iso_pu_bacteria 8005246636 8005249216 408
1262 iso_pu_bacteria 8005301065 8005306009 408
1263 iso_pu_bacteria 8005376324 8005381489 408
1264 iso_pu_bacteria 8005682033 8005687056 408
1265 iso_pu_bacteria 8055225921 8055227049 408
1266 iso_pu_bacteria 8056967851 8056970991 408
1267 3300001989 JGI24739J22299_10021252 JGI24739J22299_100212524 409
1268 3300001990 JGI24737J22298_10017133 JGI24737J22298_100171334 409
1269 3300001991 JGI24743J22301_10010100 JGI24743J22301_100101001 409
1270 3300002739 JGI25158J39367_1004769 JGI25158J39367_10047691 409
1271 3300002987 JGI25159J45721_1000017 JGI25159J45721_100001740 409
1272 3300003354 JGI25160J50197_1000027 JGI25160J50197_1000027142 409
1273 3300003374 JGI25161J50226_1000160 JGI25161J50226_100016019 409
1274 3300003771 Ga0055526_1009807 Ga0055526_10098072 409
1275 3300003775 Ga0055524_1000782 Ga0055524_100078214 409
1276 3300003781 Ga0055536_1000711 Ga0055536_10007117 409
1277 3300003791 Ga0055530_10005385 Ga0055530_100053856 409
1278 3300003794 Ga0055531_10012212 Ga0055531_100122123 409
1279 3300004625 Ga0055543_1000307 Ga0055543_10003079 409
1280 3300005262 Ga0065165_1000122 Ga0065165_100012240 409
1281 3300005262 Ga0065165_1005783 Ga0065165_10057838 409
1282 3300005327 Ga0070658_10025059 Ga0070658_100250592 409
1283 3300005329 Ga0070683_100209871 Ga0070683_1002098712 409
1284 3300005330 Ga0070690_100002180 Ga0070690_10000218012 409
1285 3300005331 Ga0070670_100004993 Ga0070670_10000499313 409
1286 3300005334 Ga0068869_100159483 Ga0068869_1001594831 409
1287 3300005335 Ga0070666_10026117 Ga0070666_100261176 409
1288 3300005336 Ga0070680_100006931 Ga0070680_1000069313 409
1289 3300005337 Ga0070682_100018545 Ga0070682_1000185455 409
1290 3300005339 Ga0070660_100008772 Ga0070660_1000087728 409
1291 3300005339 Ga0070660_100025451 Ga0070660_1000254514 409
1292 3300005340 Ga0070689_100005891 Ga0070689_1000058913 409
1293 3300005341 Ga0070691_10009340 Ga0070691_100093403 409
1294 3300005341 Ga0070691_10060814 Ga0070691_100608142 409
1295 3300005341 Ga0070691_10077573 Ga0070691_100775732 409
1296 3300005343 Ga0070687_100013352 Ga0070687_1000133523 409
1297 3300005344 Ga0070661_100048736 Ga0070661_1000487364 409
1298 3300005347 Ga0070668_100114249 Ga0070668_1001142491 409
1299 3300005353 Ga0070669_100033079 Ga0070669_1000330794 409
1300 3300005354 Ga0070675_100067254 Ga0070675_1000672541 409
1301 3300005355 Ga0070671_100015298 Ga0070671_1000152987 409
1302 3300005356 Ga0070674_100002874 Ga0070674_1000028746 409
1303 3300005356 Ga0070674_100033570 Ga0070674_1000335702 409
1304 3300005364 Ga0070673_100016081 Ga0070673_1000160817 409
1305 3300005365 Ga0070688_100009682 Ga0070688_1000096823 409
1306 3300005366 Ga0070659_100007211 Ga0070659_1000072114 409
1307 3300005366 Ga0070659_100019746 Ga0070659_1000197462 409
1308 3300005367 Ga0070667_100001663 Ga0070667_10000166310 409
1309 3300005434 Ga0070709_10001813 Ga0070709_100018135 409
1310 3300005435 Ga0070714_100021478 Ga0070714_1000214785 409
1311 3300005437 Ga0070710_10006112 Ga0070710_100061123 409
1312 3300005439 Ga0070711_100002026 Ga0070711_10000202610 409
1313 3300005440 Ga0070705_100003053 Ga0070705_10000305310 409
1314 3300005441 Ga0070700_100023748 Ga0070700_1000237484 409
1315 3300005441 Ga0070700_100052907 Ga0070700_1000529073 409
1316 3300005444 Ga0070694_100010080 Ga0070694_1000100804 409
1317 3300005455 Ga0070663_100071295 Ga0070663_1000712952 409
1318 3300005456 Ga0070678_100004826 Ga0070678_1000048263 409
1319 3300005457 Ga0070662_100013628 Ga0070662_1000136282 409
1320 3300005467 Ga0070706_100254940 Ga0070706_1002549401 409
1321 3300005530 Ga0070679_100010661 Ga0070679_10001066110 409
1322 3300005536 Ga0070697_100017478 Ga0070697_1000174786 409
1323 3300005539 Ga0068853_100004757 Ga0068853_1000047578 409
1324 3300005539 Ga0068853_100007846 Ga0068853_1000078461 409
1325 3300005539 Ga0068853_100041320 Ga0068853_1000413203 409
1326 3300005543 Ga0070672_100003513 Ga0070672_10000351313 409
1327 3300005544 Ga0070686_100005106 Ga0070686_1000051064 409
1328 3300005546 Ga0070696_100005176 Ga0070696_1000051764 409
1329 3300005547 Ga0070693_100001155 Ga0070693_1000011559 409
1330 3300005548 Ga0070665_100083903 Ga0070665_1000839034 409
1331 3300005549 Ga0070704_100020612 Ga0070704_1000206126 409
1332 3300005563 Ga0068855_100045338 Ga0068855_1000453384 409
1333 3300005563 Ga0068855_100087048 Ga0068855_1000870484 409
1334 3300005563 Ga0068855_100164178 Ga0068855_1001641784 409
1335 3300005564 Ga0070664_100014548 Ga0070664_1000145483 409
1336 3300005577 Ga0068857_100003061 Ga0068857_1000030614 409
1337 3300005578 Ga0068854_100000311 Ga0068854_10000031138 409
1338 3300005614 Ga0068856_100001380 Ga0068856_10000138030 409
1339 3300005615 Ga0070702_100055083 Ga0070702_1000550832 409
1340 3300005616 Ga0068852_100042687 Ga0068852_1000426873 409
1341 3300005617 Ga0068859_100028027 Ga0068859_1000280276 409
1342 3300005618 Ga0068864_100018414 Ga0068864_1000184148 409
1343 3300005719 Ga0068861_100000580 Ga0068861_10000058027 409
1344 3300005719 Ga0068861_100004999 Ga0068861_10000499911 409
1345 3300005719 Ga0068861_100056550 Ga0068861_1000565505 409
1346 3300005841 Ga0068863_100077621 Ga0068863_1000776213 409
1347 3300005842 Ga0068858_100004902 Ga0068858_10000490213 409
1348 3300005842 Ga0068858_100151890 Ga0068858_1001518902 409
1349 3300005843 Ga0068860_100015025 Ga0068860_1000150253 409
1350 3300005844 Ga0068862_100056403 Ga0068862_1000564033 409
1351 3300005937 Ga0081455_10005384 Ga0081455_100053848 409
1352 3300005937 Ga0081455_10013086 Ga0081455_1001308610 409
1353 3300006173 Ga0070716_100010038 Ga0070716_1000100383 409
1354 3300006175 Ga0070712_100004674 Ga0070712_1000046742 409
1355 3300006175 Ga0070712_100010515 Ga0070712_1000105157 409
1356 3300006844 Ga0075428_100158985 Ga0075428_1001589852 409
1357 3300006844 Ga0075428_100173899 Ga0075428_1001738993 409
1358 3300006844 Ga0075428_100215198 Ga0075428_1002151982 409
1359 3300006847 Ga0075431_100088143 Ga0075431_1000881434 409
1360 3300006847 Ga0075431_100125030 Ga0075431_1001250303 409
1361 3300006852 Ga0075433_10053810 Ga0075433_100538103 409
1362 3300006852 Ga0075433_10071256 Ga0075433_100712563 409
1363 3300006880 Ga0075429_100004003 Ga0075429_10000400316 409
1364 3300006881 Ga0068865_100054473 Ga0068865_1000544732 409
1365 3300006914 Ga0075436_100003587 Ga0075436_10000358712 409
1366 3300006931 Ga0097620_100028028 Ga0097620_1000280284 409
1367 3300006946 Ga0079104_1000103 Ga0079104_100010328 409
1368 3300006946 Ga0079104_1004556 Ga0079104_10045564 409
1369 3300007076 Ga0075435_100007644 Ga0075435_1000076441 409
1370 3300009011 Ga0105251_10021318 Ga0105251_100213184 409
1371 3300009093 Ga0105240_10048419 Ga0105240_100484192 409
1372 3300009098 Ga0105245_10061403 Ga0105245_100614034 409
1373 3300009101 Ga0105247_10002622 Ga0105247_100026225 409
1374 3300009101 Ga0105247_10007807 Ga0105247_100078077 409
1375 3300009101 Ga0105247_10025413 Ga0105247_100254133 409
1376 3300009147 Ga0114129_10106624 Ga0114129_101066243 409
1377 3300009176 Ga0105242_10010754 Ga0105242_100107549 409
1378 3300009177 Ga0105248_10018295 Ga0105248_1001829510 409
1379 3300009177 Ga0105248_10249474 Ga0105248_102494743 409
1380 3300009545 Ga0105237_10000878 Ga0105237_1000087832 409
1381 3300009551 Ga0105238_10041496 Ga0105238_100414964 409
1382 3300013102 Ga0157371_10047188 Ga0157371_100471883 409
1383 3300013105 Ga0157369_10014310 Ga0157369_1001431011 409
1384 3300013249 Ga0171463_1004 Ga0171463_1004252 409
1385 3300013296 Ga0157374_10003330 Ga0157374_100033302 409
1386 3300013297 Ga0157378_10107027 Ga0157378_101070273 409
1387 3300013297 Ga0157378_10107962 Ga0157378_101079624 409
1388 3300013297 Ga0157378_10308482 Ga0157378_103084821 409
1389 3300013306 Ga0163162_10002380 Ga0163162_100023806 409
1390 3300013307 Ga0157372_10014204 Ga0157372_1001420410 409
1391 3300013308 Ga0157375_10009498 Ga0157375_100094985 409
1392 3300013308 Ga0157375_10051570 Ga0157375_100515704 409
1393 3300014325 Ga0163163_10060151 Ga0163163_100601515 409
1394 3300014326 Ga0157380_10005442 Ga0157380_1000544211 409
1395 3300014745 Ga0157377_10007280 Ga0157377_100072804 409
1396 3300014968 Ga0157379_10007524 Ga0157379_1000752411 409
1397 3300014968 Ga0157379_10062781 Ga0157379_100627813 409
1398 3300014969 Ga0157376_10013905 Ga0157376_100139054 409
1399 3300014969 Ga0157376_10230164 Ga0157376_102301642 409
1400 3300015690 Ga0183363_1088 Ga0183363_10885 409
1401 3300017792 Ga0163161_10002298 Ga0163161_100022984 409
1402 3300021320 Ga0214544_1000079 Ga0214544_100007974 409
1403 3300021321 Ga0214542_1000064 Ga0214542_100006479 409
1404 3300021321 Ga0214542_1014779 Ga0214542_10147796 409
1405 3300021327 Ga0214543_1000015 Ga0214543_1000015129 409
1406 3300021327 Ga0214543_1000063 Ga0214543_100006333 409
1407 3300022739 Ga0228711_1000004 Ga0228711_1000004164 409
1408 3300022740 Ga0228710_1000002 Ga0228710_1000002113 409
1409 3300025261 Ga0209233_1001118 Ga0209233_10011189 409
1410 3300025284 Ga0209130_1000027 Ga0209130_1000027277 409
1411 3300025292 Ga0209676_1000956 Ga0209676_100095614 409
1412 3300025294 Ga0209025_1000003 Ga0209025_1000003610 409
1413 3300025294 Ga0209025_1000042 Ga0209025_1000042255 409
1414 3300025294 Ga0209025_1000591 Ga0209025_100059141 409
1415 3300025295 Ga0209564_1000193 Ga0209564_100019313 409
1416 3300025298 Ga0209050_1001220 Ga0209050_100122015 409
1417 3300025299 Ga0209256_1001067 Ga0209256_100106711 409
1418 3300025302 Ga0207426_1000072 Ga0207426_100007239 409
1419 3300025303 Ga0209051_1001484 Ga0209051_100148410 409
1420 3300025304 Ga0209257_1001382 Ga0209257_10013827 409
1421 3300025898 Ga0207692_10023265 Ga0207692_100232653 409
1422 3300025900 Ga0207710_10019327 Ga0207710_100193273 409
1423 3300025901 Ga0207688_10017612 Ga0207688_100176124 409
1424 3300025903 Ga0207680_10069953 Ga0207680_100699531 409
1425 3300025904 Ga0207647_10033366 Ga0207647_100333663 409
1426 3300025907 Ga0207645_10001769 Ga0207645_1000176922 409
1427 3300025909 Ga0207705_10000988 Ga0207705_1000098819 409
1428 3300025914 Ga0207671_10032725 Ga0207671_100327255 409
1429 3300025915 Ga0207693_10001597 Ga0207693_1000159711 409
1430 3300025915 Ga0207693_10001757 Ga0207693_1000175716 409
1431 3300025915 Ga0207693_10103321 Ga0207693_101033211 409
1432 3300025916 Ga0207663_10044706 Ga0207663_100447063 409
1433 3300025916 Ga0207663_10095463 Ga0207663_100954632 409
1434 3300025918 Ga0207662_10024803 Ga0207662_100248033 409
1435 3300025919 Ga0207657_10000522 Ga0207657_100005224 409
1436 3300025919 Ga0207657_10004263 Ga0207657_1000426318 409
1437 3300025919 Ga0207657_10006481 Ga0207657_100064817 409
1438 3300025923 Ga0207681_10009656 Ga0207681_100096566 409
1439 3300025924 Ga0207694_10082719 Ga0207694_100827192 409
1440 3300025925 Ga0207650_10130471 Ga0207650_101304712 409
1441 3300025926 Ga0207659_10014032 Ga0207659_100140325 409
1442 3300025927 Ga0207687_10044574 Ga0207687_100445744 409
1443 3300025929 Ga0207664_10071859 Ga0207664_100718592 409
1444 3300025931 Ga0207644_10109092 Ga0207644_101090922 409
1445 3300025932 Ga0207690_10049856 Ga0207690_100498565 409
1446 3300025933 Ga0207706_10000545 Ga0207706_100005456 409
1447 3300025934 Ga0207686_10023814 Ga0207686_100238143 409
1448 3300025936 Ga0207670_10046309 Ga0207670_100463093 409
1449 3300025937 Ga0207669_10042345 Ga0207669_100423453 409
1450 3300025938 Ga0207704_10022815 Ga0207704_100228153 409
1451 3300025939 Ga0207665_10013838 Ga0207665_100138386 409
1452 3300025940 Ga0207691_10000674 Ga0207691_1000067438 409
1453 3300025941 Ga0207711_10122306 Ga0207711_101223062 409
1454 3300025942 Ga0207689_10040799 Ga0207689_100407994 409
1455 3300025944 Ga0207661_10103672 Ga0207661_101036722 409
1456 3300025945 Ga0207679_10131539 Ga0207679_101315393 409
1457 3300025949 Ga0207667_10068592 Ga0207667_100685924 409
1458 3300025949 Ga0207667_10183129 Ga0207667_101831293 409
1459 3300025960 Ga0207651_10062435 Ga0207651_100624353 409
1460 3300025961 Ga0207712_10045246 Ga0207712_100452464 409
1461 3300025972 Ga0207668_10033225 Ga0207668_100332254 409
1462 3300025981 Ga0207640_10064224 Ga0207640_100642243 409
1463 3300025986 Ga0207658_10045732 Ga0207658_100457323 409
1464 3300026023 Ga0207677_10100915 Ga0207677_101009151 409
1465 3300026035 Ga0207703_10061361 Ga0207703_100613613 409
1466 3300026041 Ga0207639_10010574 Ga0207639_100105741 409
1467 3300026067 Ga0207678_10005223 Ga0207678_1000522311 409
1468 3300026075 Ga0207708_10000369 Ga0207708_1000036944 409
1469 3300026075 Ga0207708_10175768 Ga0207708_101757682 409
1470 3300026078 Ga0207702_10114222 Ga0207702_101142223 409
1471 3300026088 Ga0207641_10072336 Ga0207641_100723363 409
1472 3300026089 Ga0207648_10066392 Ga0207648_100663924 409
1473 3300026095 Ga0207676_10025512 Ga0207676_100255124 409
1474 3300026116 Ga0207674_10003979 Ga0207674_100039794 409
1475 3300026118 Ga0207675_100063904 Ga0207675_1000639044 409
1476 3300026118 Ga0207675_100115042 Ga0207675_1001150424 409
1477 3300026121 Ga0207683_10008593 Ga0207683_100085934 409
1478 3300026121 Ga0207683_10010296 Ga0207683_100102963 409
1479 3300026121 Ga0207683_10057258 Ga0207683_100572583 409
1480 3300026142 Ga0207698_10025383 Ga0207698_100253834 409
1481 3300027111 Ga0209281_1000030 Ga0209281_1000030147 409
1482 3300027111 Ga0209281_1000144 Ga0209281_100014498 409
1483 3300027111 Ga0209281_1000362 Ga0209281_100036227 409
1484 3300027666 Ga0209282_1000004 Ga0209282_1000004147 409
1485 3300027907 Ga0207428_10006016 Ga0207428_1000601613 409
1486 3300028379 Ga0268266_10116675 Ga0268266_101166752 409
1487 3300028381 Ga0268264_10159519 Ga0268264_101595191 409
1488 3300028794 Ga0307515_10003252 Ga0307515_1000325216 409
1489 3300028794 Ga0307515_10007398 Ga0307515_1000739811 409
1490 3300031456 Ga0307513_10001043 Ga0307513_1000104338 409
1491 3300031595 Ga0265313_10000062 Ga0265313_1000006281 409
1492 3300031852 Ga0307410_10259058 Ga0307410_102590581 409
1493 3300031911 Ga0307412_10071752 Ga0307412_100717523 409
1494 3300031967 Ga0315914_1000001 Ga0315914_1000001236 409
1495 3300032004 Ga0307414_10005179 Ga0307414_100051797 409
1496 3300033430 Ga0315913_1000004 Ga0315913_100000464 409
1497 3300033464 Ga0315915_1000002 Ga0315915_1000002148 409
1498 3300034820 Ga0373959_0005521 Ga0373959_0005521_513_1757 409
1499 3300035115 Ga0373941_0003953 Ga0373941_0003953_1013_2257 409
1500 3300035242 Ga0373962_0007935 Ga0373962_0007935_1206_2450 409
1501 3300035691 Ga0373931_0019966 Ga0373931_0019966_1699_2943 409
1502 3300035695 Ga0373927_0012386 Ga0373927_0012386_459_1703 409
1503 3300036647 Ga0316582_0084872 Ga0316582_0084872_138_1409 409
1504 3300037068 Ga0373925_0005204 Ga0373925_0005204_1653_2897 409
1505 3300037418 Ga0395900_0000404 Ga0395900_0000404_11578_12855 409
1506 3300037418 Ga0395900_0005078 Ga0395900_0005078_2658_3902 409
1507 3300037418 Ga0395900_0028835 Ga0395900_0028835_1588_2880 409
1508 3300037471 Ga0395905_0002795 Ga0395905_0002795_3972_5216 409
1509 3300038443 Ga0395901_0007034 Ga0395901_0007034_6155_7447 409
1510 3300039062 Ga0400483_165206 Ga0400483_165206_2713_3957 409
1511 3300039450 Ga0436363_0311986 Ga0436363_0311986_279_1538 409
1512 3300041406 Ga0439439_0019889 Ga0439439_0019889_302_1555 409
1513 3300041413 Ga0439465_0018843 Ga0439465_0018843_386_1627 409
1514 3300042145 Ga0450906_005481 Ga0450906_005481_1073_2326 409
1515 3300046455 Ga0495603_0000026 Ga0495603_0000026_39427_40671 409
1516 3300046459 Ga0495629_0001467 Ga0495629_0001467_8961_10205 409
1517 3300046461 Ga0495641_0006743 Ga0495641_0006743_122_1366 409
1518 3300046472 Ga0495580_0002524 Ga0495580_0002524_1848_3092 409
1519 3300046473 Ga0495582_0000385 Ga0495582_0000385_18420_19664 409
1520 3300046475 Ga0495639_0000233 Ga0495639_0000233_11652_12896 409
1521 3300046499 Ga0495594_0000255 Ga0495594_0000255_20666_21910 409
1522 3300046526 Ga0495666_0062568 Ga0495666_0062568_449_1693 409
1523 3300046530 Ga0495654_0001982 Ga0495654_0001982_7254_8507 409
1524 3300046531 Ga0495665_0004399 Ga0495665_0004399_1999_3243 409
1525 3300046557 Ga0495622_0000481 Ga0495622_0000481_7394_8638 409
1526 3300046642 Ga0495634_0013214 Ga0495634_0013214_4464_5708 409
1527 3300046674 Ga0495588_0018029 Ga0495588_0018029_905_2149 409
1528 3300046681 Ga0495647_0004330 Ga0495647_0004330_1325_2569 409
1529 3300046683 Ga0495658_0004563 Ga0495658_0004563_1545_2789 409
1530 3300046689 Ga0495613_0000386 Ga0495613_0000386_15081_16325 409
1531 3300046690 Ga0495624_0046742 Ga0495624_0046742_1373_2617 409
1532 3300047315 Ga0495581_0000121 Ga0495581_0000121_29276_30520 409
1533 3300047321 Ga0495676_0007864 Ga0495676_0007864_909_2153 409
1534 3300047322 Ga0495680_0016476 Ga0495680_0016476_642_1886 409
1535 3300047445 Ga0495677_0009375 Ga0495677_0009375_183_1439 409
1536 3300047673 Ga0495593_0000434 Ga0495593_0000434_11203_12447 409
1537 3300048089 Ga0495614_0008914 Ga0495614_0008914_2206_3450 409
1538 3300048903 Ga0496100_0034966 Ga0496100_0034966_699_1943 409
1539 3300048903 Ga0496100_0040740 Ga0496100_0040740_1296_2540 409
1540 3300048904 Ga0496101_0007434 Ga0496101_0007434_956_2200 409
1541 3300048904 Ga0496101_0109991 Ga0496101_0109991_572_1816 409
1542 3300048904 Ga0496101_0128557 Ga0496101_0128557_282_1526 409
1543 3300048905 Ga0496102_0011364 Ga0496102_0011364_69_1313 409
1544 3300048905 Ga0496102_0073655 Ga0496102_0073655_797_2041 409
1545 3300048906 Ga0496103_0019786 Ga0496103_0019786_1803_3047 409
1546 3300048907 Ga0496104_0122319 Ga0496104_0122319_911_2155 409
1547 3300048908 Ga0496105_0032869 Ga0496105_0032869_1909_3153 409
1548 3300048908 Ga0496105_0034406 Ga0496105_0034406_978_2222 409
1549 3300048908 Ga0496105_0042410 Ga0496105_0042410_1097_2341 409
1550 3300048909 Ga0496106_0003291 Ga0496106_0003291_7304_8548 409
1551 3300048910 Ga0496107_0011933 Ga0496107_0011933_2914_4164 409
1552 3300048910 Ga0496107_0017121 Ga0496107_0017121_419_1663 409
1553 3300048910 Ga0496107_0043107 Ga0496107_0043107_1448_2692 409
1554 3300048911 Ga0496108_0094442 Ga0496108_0094442_621_1865 409
1555 3300048912 Ga0496109_0050473 Ga0496109_0050473_2218_3462 409
1556 3300048912 Ga0496109_0108637 Ga0496109_0108637_83_1327 409
1557 3300048912 Ga0496109_0139271 Ga0496109_0139271_344_1588 409
1558 3300048913 Ga0496110_0094998 Ga0496110_0094998_681_1925 409
1559 3300048915 Ga0496112_0049874 Ga0496112_0049874_399_1643 409
1560 3300048915 Ga0496112_0100146 Ga0496112_0100146_602_1846 409
1561 3300048915 Ga0496112_0146057 Ga0496112_0146057_344_1588 409
1562 3300048916 Ga0496113_0058744 Ga0496113_0058744_396_1640 409
1563 3300048917 Ga0496114_0002231 Ga0496114_0002231_3371_4615 409
1564 3300048917 Ga0496114_0020390 Ga0496114_0020390_708_1958 409
1565 3300048917 Ga0496114_0196767 Ga0496114_0196767_49_1293 409
1566 3300048918 Ga0496115_0000541 Ga0496115_0000541_4794_6038 409
1567 3300048918 Ga0496115_0085978 Ga0496115_0085978_344_1588 409
1568 3300048918 Ga0496115_0155249 Ga0496115_0155249_548_1792 409
1569 3300048920 Ga0496117_0008139 Ga0496117_0008139_816_2069 409
1570 3300048924 Ga0496121_0002503 Ga0496121_0002503_24806_26104 409
1571 3300048924 Ga0496121_0008351 Ga0496121_0008351_2114_3367 409
1572 3300048925 Ga0496122_0001772 Ga0496122_0001772_13137_14390 409
1573 3300048926 Ga0496123_0001756 Ga0496123_0001756_13063_14316 409
1574 3300048927 Ga0496124_0002790 Ga0496124_0002790_13091_14344 409
1575 3300048927 Ga0496124_0014268 Ga0496124_0014268_1906_3159 409
1576 3300048928 Ga0496125_0006845 Ga0496125_0006845_9693_10946 409
1577 3300048928 Ga0496125_0167215 Ga0496125_0167215_163_1404 409
1578 3300048929 Ga0496126_0000892 Ga0496126_0000892_31625_32878 409
1579 3300048929 Ga0496126_0003241 Ga0496126_0003241_2314_3612 409
1580 3300048929 Ga0496126_0030387 Ga0496126_0030387_3399_4652 409
1581 3300048929 Ga0496126_0166147 Ga0496126_0166147_106_1347 409
1582 3300049571 Ga0501034_0087240 Ga0501034_0087240_78_1310 409
1583 3300049572 Ga0501036_0049500 Ga0501036_0049500_240_1484 409
1584 3300049572 Ga0501036_0249791 Ga0501036_0249791_220_1461 409
1585 3300049573 Ga0501037_0125283 Ga0501037_0125283_121_1365 409
1586 3300049575 Ga0501039_0026740 Ga0501039_0026740_2850_4094 409
1587 3300049576 Ga0501040_0010829 Ga0501040_0010829_23_1267 409
1588 3300049576 Ga0501040_0013750 Ga0501040_0013750_2532_3776 409
1589 3300049576 Ga0501040_0040136 Ga0501040_0040136_510_1754 409
1590 3300049576 Ga0501040_0046525 Ga0501040_0046525_1297_2538 409
1591 3300049578 Ga0501042_0015506 Ga0501042_0015506_918_2162 409
1592 3300049578 Ga0501042_0040774 Ga0501042_0040774_347_1618 409
1593 3300049580 Ga0501046_0064386 Ga0501046_0064386_996_2288 409
1594 3300049580 Ga0501046_0110298 Ga0501046_0110298_810_2054 409
1595 3300049581 Ga0501047_0020399 Ga0501047_0020399_2518_3750 409
1596 3300049585 Ga0501069_0021941 Ga0501069_0021941_1489_2721 409
1597 3300049586 Ga0501070_0005902 Ga0501070_0005902_4673_5905 409
1598 3300049586 Ga0501070_0010222 Ga0501070_0010222_5973_7205 409
1599 3300049587 Ga0501071_0025240 Ga0501071_0025240_2696_3940 409
1600 3300049587 Ga0501071_0231709 Ga0501071_0231709_41_1285 409
1601 3300049588 Ga0501072_0041802 Ga0501072_0041802_1167_2411 409
1602 3300049588 Ga0501072_0071385 Ga0501072_0071385_487_1719 409
1603 3300049588 Ga0501072_0274845 Ga0501072_0274845_76_1317 409
1604 3300049589 Ga0501073_0036453 Ga0501073_0036453_694_1926 409
1605 3300049590 Ga0501074_0015532 Ga0501074_0015532_3171_4403 409
1606 3300049590 Ga0501074_0042994 Ga0501074_0042994_1308_2552 409
1607 3300049591 Ga0501075_0006476 Ga0501075_0006476_6114_7358 409
1608 3300049591 Ga0501075_0063401 Ga0501075_0063401_1111_2355 409
1609 3300049592 Ga0501076_0073178 Ga0501076_0073178_1486_2730 409
1610 3300049593 Ga0501077_0006840 Ga0501077_0006840_2868_4112 409
1611 3300049741 Ga0501079_0024563 Ga0501079_0024563_659_1903 409
1612 3300049741 Ga0501079_0047913 Ga0501079_0047913_550_1794 409
1613 3300049741 Ga0501079_0122955 Ga0501079_0122955_749_1993 409
1614 3300049742 Ga0501080_0048906 Ga0501080_0048906_1578_2822 409
1615 3300049743 Ga0501081_0034274 Ga0501081_0034274_1638_2882 409
1616 3300049743 Ga0501081_0075766 Ga0501081_0075766_41_1312 409
1617 3300049822 Ga0501035_0078741 Ga0501035_0078741_496_1740 409
1618 3300049823 Ga0501044_0037292 Ga0501044_0037292_739_1980 409
1619 3300049823 Ga0501044_0176070 Ga0501044_0176070_169_1461 409
1620 3300049824 Ga0501045_0034657 Ga0501045_0034657_1874_3118 409
1621 3300049824 Ga0501045_0044669 Ga0501045_0044669_1811_3055 409
1622 3300049824 Ga0501045_0124502 Ga0501045_0124502_245_1489 409
1623 3300049824 Ga0501045_0139827 Ga0501045_0139827_438_1682 409
1624 3300050507 nmdc:mga05p37_91996_c1 nmdc:mga05p37_91996_c1_1295_2539 409
1625 3300050509 nmdc:mga0qj67_209269_c1 nmdc:mga0qj67_209269_c1_308_1552 409
1626 3300050510 nmdc:mga06r32_107250_c1 nmdc:mga06r32_107250_c1_977_2221 409
1627 3300050510 nmdc:mga06r32_181519_c1 nmdc:mga06r32_181519_c1_567_1817 409
1628 3300050510 nmdc:mga06r32_192073_c1 nmdc:mga06r32_192073_c1_706_1950 409
1629 3300050513 nmdc:mga0rr50_23086_c1 nmdc:mga0rr50_23086_c1_2046_3290 409
1630 3300050515 nmdc:mga0a205_47157_c1 nmdc:mga0a205_47157_c1_1163_2407 409
1631 3300053077 Ga0495601_0136045 Ga0495601_0136045_142_1404 409
1632 3300053083 Ga0495655_0011370 Ga0495655_0011370_180_1424 409
1633 3300053085 Ga0495619_0002041 Ga0495619_0002041_9997_11241 409
1634 3300053085 Ga0495619_0061790 Ga0495619_0061790_1124_2386 409
1635 3300053094 Ga0500566_0002615 Ga0500566_0002615_4209_5492 409
1636 3300053125 Ga0500618_000232 Ga0500618_000232_40817_42070 409
1637 3300053140 Ga0500573_0010889 Ga0500573_0010889_605_1861 409
1638 3300053161 Ga0500634_0000017 Ga0500634_0000017_56225_57469 409
1639 3300054114 Ga0501084_0011766 Ga0501084_0011766_2057_3301 409
1640 3300054114 Ga0501084_0052014 Ga0501084_0052014_333_1577 409
1641 3300054114 Ga0501084_0202557 Ga0501084_0202557_339_1583 409
1642 3300054114 Ga0501084_0308534 Ga0501084_0308534_41_1282 409
1643 3300060353 Ga0501082_0044780 Ga0501082_0044780_1296_2540 409
1644 3300060353 Ga0501082_0065679 Ga0501082_0065679_113_1357 409
1645 3300060353 Ga0501082_0071431 Ga0501082_0071431_1644_2888 409
1646 3300061734 Ga0530510_0013057 Ga0530510_0013057_129_1373 409
1647 iso_pu_bacteria 2507262055 2507504922 409
1648 iso_pu_bacteria 2508501009 2508546270 409
1649 iso_pu_bacteria 2508501042 2508695202 409
1650 iso_pu_bacteria 2508501128 2509150099 409
1651 iso_pu_bacteria 2511231028 2511395261 409
1652 iso_pu_bacteria 2513237092 2513623387 409
1653 iso_pu_bacteria 2513237094 2513639628 409
1654 iso_pu_bacteria 2513237095 2513647886 409
1655 iso_pu_bacteria 2513237096 2513661796 409
1656 iso_pu_bacteria 2513237098 2513678428 409
1657 iso_pu_bacteria 2513237101 2513694079 409
1658 iso_pu_bacteria 2513237102 2513699669 409
1659 iso_pu_bacteria 2513237104 2513718770 409
1660 iso_pu_bacteria 2513237137 2513863005 409
1661 iso_pu_bacteria 2513237139 2513873833 409
1662 iso_pu_bacteria 2513237141 2513890362 409
1663 iso_pu_bacteria 2513237145 2513922858 409
1664 iso_pu_bacteria 2513237161 2514012803 409
1665 iso_pu_bacteria 2515154112 2515625785 409
1666 iso_pu_bacteria 2517093001 2517102307 409
1667 iso_pu_bacteria 2517572143 2517888496 409
1668 iso_pu_bacteria 2524023205 2524435808 409
1669 iso_pu_bacteria 2524023210 2524467170 409
1670 iso_pu_bacteria 2524023228 2524535201 409
1671 iso_pu_bacteria 2528768022 2528851973 409
1672 iso_pu_bacteria 2602042107 2603857852 409
1673 iso_pu_bacteria 2617270735 2617351784 409
1674 iso_pu_bacteria 2617270741 2617374041 409
1675 iso_pu_bacteria 2643221557 2643808007 409
1676 iso_pu_bacteria 2643221594 2643978190 409
1677 iso_pu_bacteria 2643221610 2644068804 409
1678 iso_pu_bacteria 2643221621 2644121023 409
1679 iso_pu_bacteria 2643221668 2644379441 409
1680 iso_pu_bacteria 2643221675 2644419874 409
1681 iso_pu_bacteria 2643221680 2644453231 409
1682 iso_pu_bacteria 2643221726 2644688741 409
1683 iso_pu_bacteria 2721755755 2723849375 409
1684 iso_pu_bacteria 2728368998 2728751998 409
1685 iso_pu_bacteria 2744054633 2745079105 409
1686 iso_pu_bacteria 2791355196 2793063035 409
1687 iso_pu_bacteria 2791355197 2793067319 409
1688 iso_pu_bacteria 2791355199 2793077064 409
1689 iso_pu_bacteria 2802429603 2805915916 409
1690 iso_pu_bacteria 2816332527 2818237357 409
1691 iso_pu_bacteria 2824600985 2824602651 409
1692 iso_pu_bacteria 2824609381 2824617082 409
1693 iso_pu_bacteria 2824617872 2824621032 409
1694 iso_pu_bacteria 2824626560 2824630039 409
1695 iso_pu_bacteria 2824635225 2824642230 409
1696 iso_pu_bacteria 2824644064 2824650280 409
1697 iso_pu_bacteria 2824653114 2824660693 409
1698 iso_pu_bacteria 2824661429 2824669607 409
1699 iso_pu_bacteria 2824671348 2824677988 409
1700 iso_pu_bacteria 2824679649 2824686054 409
1701 iso_pu_bacteria 2824687955 2824694296 409
1702 iso_pu_bacteria 2824696289 2824703347 409
1703 iso_pu_bacteria 2824704595 2824712384 409
1704 iso_pu_bacteria 2824714736 2824721291 409
1705 iso_pu_bacteria 2824723954 2824730324 409
1706 iso_pu_bacteria 2824732956 2824737608 409
1707 iso_pu_bacteria 2824746037 2824752733 409
1708 iso_pu_bacteria 2824753945 2824757041 409
1709 iso_pu_bacteria 2824763712 2824768377 409
1710 iso_pu_bacteria 2824773399 2824774859 409
1711 iso_pu_bacteria 2838122688 2838124200 409
1712 iso_pu_bacteria 2841941048 2841944546 409
1713 iso_pu_bacteria 2841949485 2841951684 409
1714 iso_pu_bacteria 2841957949 2841964826 409
1715 iso_pu_bacteria 2841966195 2841969324 409
1716 iso_pu_bacteria 2841974524 2841980279 409
1717 iso_pu_bacteria 2841983080 2841985529 409
1718 iso_pu_bacteria 2842038055 2842043801 409
1719 iso_pu_bacteria 2842045827 2842052209 409
1720 iso_pu_bacteria 2842698319 2842699659 409
1721 iso_pu_bacteria 2847930680 2847931394 409
1722 iso_pu_bacteria 2847939898 2847941837 409
1723 iso_pu_bacteria 2849076700 2849082752 409
1724 iso_pu_bacteria 2855730933 2855734324 409
1725 iso_pu_bacteria 2855767633 2855769914 409
1726 iso_pu_bacteria 2857509624 2857511645 409
1727 iso_pu_bacteria 2857524615 2857527226 409
1728 iso_pu_bacteria 2857537821 2857539601 409
1729 iso_pu_bacteria 2857576091 2857580329 409
1730 iso_pu_bacteria 2858950400 2858953084 409
1731 iso_pu_bacteria 2874590934 2874596919 409
1732 iso_pu_bacteria 2874604998 2874608392 409
1733 iso_pu_bacteria 2874612657 2874619035 409
1734 iso_pu_bacteria 2874620515 2874624493 409
1735 iso_pu_bacteria 2874628541 2874629143 409
1736 iso_pu_bacteria 2874645413 2874648723 409
1737 iso_pu_bacteria 2876761206 2876768975 409
1738 iso_pu_bacteria 2876771140 2876777383 409
1739 iso_pu_bacteria 2876808645 2876815917 409
1740 iso_pu_bacteria 2876818435 2876825465 409
1741 iso_pu_bacteria 2879074833 2879077714 409
1742 iso_pu_bacteria 2879083081 2879087569 409
1743 iso_pu_bacteria 2879099564 2879107305 409
1744 iso_pu_bacteria 2879110137 2879112839 409
1745 iso_pu_bacteria 2879127579 2879131407 409
1746 iso_pu_bacteria 2879142872 2879144367 409
1747 iso_pu_bacteria 2881364244 2881370927 409
1748 iso_pu_bacteria 2881665667 2881665772 409
1749 iso_pu_bacteria 2885366525 2885371325 409
1750 iso_pu_bacteria 2885374607 2885378758 409
1751 iso_pu_bacteria 2885409591 2885411830 409
1752 iso_pu_bacteria 2888378607 2888379886 409
1753 iso_pu_bacteria 2888388044 2888390961 409
1754 iso_pu_bacteria 2888419890 2888420694 409
1755 iso_pu_bacteria 2889033259 2889035835 409
1756 iso_pu_bacteria 2891088606 2891092456 409
1757 iso_pu_bacteria 2893066018 2893067999 409
1758 iso_pu_bacteria 2903748898 2903756769 409
1759 iso_pu_bacteria 2903768456 2903770605 409
1760 iso_pu_bacteria 2904666416 2904672168 409
1761 iso_pu_bacteria 2904699407 2904708014 409
1762 iso_pu_bacteria 2904711408 2904716256 409
1763 iso_pu_bacteria 2906610324 2906614135 409
1764 iso_pu_bacteria 2906626472 2906632258 409
1765 iso_pu_bacteria 2906635258 2906639298 409
1766 iso_pu_bacteria 2906643746 2906650726 409
1767 iso_pu_bacteria 2906660503 2906668393 409
1768 iso_pu_bacteria 2908739725 2908747034 409
1769 iso_pu_bacteria 2908756301 2908764734 409
1770 iso_pu_bacteria 2908775508 2908776518 409
1771 iso_pu_bacteria 2919073203 2919078341 409
1772 iso_pu_bacteria 2922361189 2922364315 409
1773 iso_pu_bacteria 2922368715 2922378575 409
1774 iso_pu_bacteria 2922386360 2922389014 409
1775 iso_pu_bacteria 2922393267 2922396650 409
1776 iso_pu_bacteria 2922425934 2922425964 409
1777 iso_pu_bacteria 2929615660 2929623815 409
1778 iso_pu_bacteria 2929624759 2929629046 409
1779 iso_pu_bacteria 2932784394 2932786427 409
1780 iso_pu_bacteria 2932794094 2932794611 409
1781 iso_pu_bacteria 2932801729 2932806892 409
1782 iso_pu_bacteria 2932809354 2932812499 409
1783 iso_pu_bacteria 2932818245 2932822861 409
1784 iso_pu_bacteria 2932828146 2932829664 409
1785 iso_pu_bacteria 2933577622 2933585664 409
1786 iso_pu_bacteria 2935608549 2935614882 409
1787 iso_pu_bacteria 2935616580 2935618183 409
1788 iso_pu_bacteria 2935630451 2935636674 409
1789 iso_pu_bacteria 2935638405 2935641420 409
1790 iso_pu_bacteria 2935648319 2935652913 409
1791 iso_pu_bacteria 2935656913 2935661496 409
1792 iso_pu_bacteria 2935665750 2935669522 409
1793 iso_pu_bacteria 2935675223 2935677880 409
1794 iso_pu_bacteria 2935684952 2935689671 409
1795 iso_pu_bacteria 2935694250 2935698209 409
1796 iso_pu_bacteria 2935703347 2935707347 409
1797 iso_pu_bacteria 2935713505 2935717191 409
1798 iso_pu_bacteria 2935722832 2935729975 409
1799 iso_pu_bacteria 2935732158 2935738606 409
1800 iso_pu_bacteria 2935741537 2935749146 409
1801 iso_pu_bacteria 2935750917 2935757025 409
1802 iso_pu_bacteria 2935760218 2935764364 409
1803 iso_pu_bacteria 2935769743 2935772701 409
1804 iso_pu_bacteria 2935777560 2935778163 409
1805 iso_pu_bacteria 2935785616 2935787390 409
1806 iso_pu_bacteria 2935793552 2935795822 409
1807 iso_pu_bacteria 2935801545 2935804274 409
1808 iso_pu_bacteria 2935810662 2935815357 409
1809 iso_pu_bacteria 2935819856 2935826078 409
1810 iso_pu_bacteria 2935827899 2935831151 409
1811 iso_pu_bacteria 2935837841 2935841760 409
1812 iso_pu_bacteria 2935847175 2935851697 409
1813 iso_pu_bacteria 2935855204 2935856318 409
1814 iso_pu_bacteria 2935864058 2935866350 409
1815 iso_pu_bacteria 2935873716 2935874656 409
1816 iso_pu_bacteria 2935883170 2935890307 409
1817 iso_pu_bacteria 2935908558 2935910281 409
1818 iso_pu_bacteria 2935916978 2935918433 409
1819 iso_pu_bacteria 2935926038 2935927808 409
1820 iso_pu_bacteria 2935934488 2935936320 409
1821 iso_pu_bacteria 2935942939 2935944127 409
1822 iso_pu_bacteria 2935951376 2935952564 409
1823 iso_pu_bacteria 2935967501 2935969404 409
1824 iso_pu_bacteria 2935975950 2935977828 409
1825 iso_pu_bacteria 2935984226 2935984863 409
1826 iso_pu_bacteria 2935992306 2935994116 409
1827 iso_pu_bacteria 2936002035 2936004873 409
1828 iso_pu_bacteria 2936011229 2936015775 409
1829 iso_pu_bacteria 2936019824 2936024409 409
1830 iso_pu_bacteria 2936028420 2936031704 409
1831 iso_pu_bacteria 2936037263 2936045012 409
1832 iso_pu_bacteria 2936046547 2936051526 409
1833 iso_pu_bacteria 2936055302 2936056034 409
1834 iso_pu_bacteria 2940556831 2940562939 409
1835 iso_pu_bacteria 2941507105 2941513310 409
1836 iso_pu_bacteria 2941515067 2941521273 409
1837 iso_pu_bacteria 2941523033 2941529015 409
1838 iso_pu_bacteria 2941531003 2941532418 409
1839 iso_pu_bacteria 2941538514 2941543833 409
1840 iso_pu_bacteria 3003665799 3003671930 409
1841 iso_pu_bacteria 3005474847 3005483584 409
1842 iso_pu_bacteria 3005483717 3005487355 409
1843 iso_pu_bacteria 3005506211 3005509464 409
1844 iso_pu_bacteria 3005587118 3005589513 409
1845 iso_pu_bacteria 3005594810 3005602237 409
1846 iso_pu_bacteria 3005710791 3005718003 409
1847 iso_pu_bacteria 3005718088 3005725023 409
1848 iso_pu_bacteria 8002060224 8002061043 409
1849 iso_pu_bacteria 8006926726 8006932740 409
1850 iso_pu_bacteria 8006933436 8006936666 409
1851 iso_pu_bacteria 8006964411 8006970248 409
1852 iso_pu_bacteria 8006973647 8006976636 409
1853 iso_pu_bacteria 8006984368 8006992414 409
1854 iso_pu_bacteria 8006994254 8007000001 409
1855 iso_pu_bacteria 8016511872 8016518537 409
1856 iso_pu_bacteria 8016522445 8016526514 409
1857 iso_pu_bacteria 8016530956 8016531595 409
1858 iso_pu_bacteria 8016539877 8016544801 409
1859 iso_pu_bacteria 8016548790 8016557280 409
1860 iso_pu_bacteria 8016557553 8016565630 409
1861 iso_pu_bacteria 8016566248 8016569858 409
1862 iso_pu_bacteria 8016595262 8016603240 409
1863 iso_pu_bacteria 8016603502 8016606168 409
1864 iso_pu_bacteria 8016613128 8016618044 409
1865 iso_pu_bacteria 8016622563 8016623527 409
1866 iso_pu_bacteria 8016630954 8016636005 409
1867 iso_pu_bacteria 8017057580 8017058126 409
1868 iso_pu_bacteria 8019538911 8019540104 409
1869 iso_pu_bacteria 8019547302 8019550548 409
1870 iso_pu_bacteria 8019576017 8019577603 409
1871 iso_pu_bacteria 8019586578 8019595700 409
1872 iso_pu_bacteria 8019597564 8019606063 409
1873 iso_pu_bacteria 8019608314 8019612467 409
1874 iso_pu_bacteria 8019629233 8019630466 409
1875 iso_pu_bacteria 8019668869 8019677068 409
1876 iso_pu_bacteria 8019678201 8019678914 409
1877 iso_pu_bacteria 8019687851 8019696618 409
1878 iso_pu_bacteria 8054558443 8054561625 409
1879 iso_pu_bacteria 8055742211 8055751086 409
1880 iso_pu_bacteria 8056673599 8056678649 409
1881 iso_pu_bacteria 8056681323 8056682999 409
1882 iso_pu_bacteria 8056689827 8056693931 409
1883 3300003187 JGI25151J46595_10000039 JGI25151J46595_100000399 410
1884 3300003187 JGI25151J46595_10000350 JGI25151J46595_1000035013 410
1885 3300003756 Ga0055533_1000006 Ga0055533_100000660 410
1886 3300003759 Ga0055525_1000677 Ga0055525_100067710 410
1887 3300003771 Ga0055526_1000090 Ga0055526_100009031 410
1888 3300003771 Ga0055526_1001895 Ga0055526_10018951 410
1889 3300003775 Ga0055524_1000104 Ga0055524_100010422 410
1890 3300005262 Ga0065165_1000014 Ga0065165_100001419 410
1891 3300005328 Ga0070676_10024392 Ga0070676_100243922 410
1892 3300005334 Ga0068869_100229192 Ga0068869_1002291921 410
1893 3300005366 Ga0070659_100011030 Ga0070659_1000110303 410
1894 3300005435 Ga0070714_100009803 Ga0070714_1000098037 410
1895 3300005436 Ga0070713_100080567 Ga0070713_1000805672 410
1896 3300005439 Ga0070711_100001385 Ga0070711_1000013856 410
1897 3300005456 Ga0070678_100120982 Ga0070678_1001209822 410
1898 3300005458 Ga0070681_10063269 Ga0070681_100632692 410
1899 3300005539 Ga0068853_100002155 Ga0068853_1000021553 410
1900 3300005564 Ga0070664_100164935 Ga0070664_1001649352 410
1901 3300005577 Ga0068857_100090980 Ga0068857_1000909803 410
1902 3300005843 Ga0068860_100001139 Ga0068860_10000113926 410
1903 3300006028 Ga0070717_10009219 Ga0070717_100092197 410
1904 3300006028 Ga0070717_10165725 Ga0070717_101657252 410
1905 3300006163 Ga0070715_10003544 Ga0070715_100035446 410
1906 3300006173 Ga0070716_100024144 Ga0070716_1000241442 410
1907 3300009176 Ga0105242_10051464 Ga0105242_100514643 410
1908 3300013102 Ga0157371_10100220 Ga0157371_101002202 410
1909 3300013104 Ga0157370_10007741 Ga0157370_100077419 410
1910 3300013250 Ga0171462_1008 Ga0171462_1008141 410
1911 3300013307 Ga0157372_10031292 Ga0157372_100312924 410
1912 3300013307 Ga0157372_10212034 Ga0157372_102120342 410
1913 3300021384 Ga0213876_10102757 Ga0213876_101027572 410
1914 3300025226 Ga0209674_100003 Ga0209674_1000031276 410
1915 3300025230 Ga0209563_100010 Ga0209563_1000101004 410
1916 3300025253 Ga0209677_100274 Ga0209677_1002746 410
1917 3300025284 Ga0209130_1000024 Ga0209130_1000024254 410
1918 3300025291 Ga0209675_1000452 Ga0209675_10004527 410
1919 3300025292 Ga0209676_1013494 Ga0209676_10134942 410
1920 3300025294 Ga0209025_1000008 Ga0209025_1000008214 410
1921 3300025294 Ga0209025_1001580 Ga0209025_10015807 410
1922 3300025294 Ga0209025_1020735 Ga0209025_10207352 410
1923 3300025294 Ga0209025_1037646 Ga0209025_10376462 410
1924 3300025295 Ga0209564_1000015 Ga0209564_1000015269 410
1925 3300025295 Ga0209564_1000043 Ga0209564_1000043287 410
1926 3300025299 Ga0209256_1000062 Ga0209256_1000062199 410
1927 3300025299 Ga0209256_1000374 Ga0209256_100037431 410
1928 3300025302 Ga0207426_1014914 Ga0207426_10149142 410
1929 3300025893 Ga0207682_10047215 Ga0207682_100472151 410
1930 3300025898 Ga0207692_10001635 Ga0207692_100016359 410
1931 3300025898 Ga0207692_10004470 Ga0207692_100044703 410
1932 3300025900 Ga0207710_10017122 Ga0207710_100171222 410
1933 3300025906 Ga0207699_10012376 Ga0207699_100123764 410
1934 3300025911 Ga0207654_10036360 Ga0207654_100363603 410
1935 3300025912 Ga0207707_10016386 Ga0207707_100163866 410
1936 3300025915 Ga0207693_10006006 Ga0207693_100060068 410
1937 3300025915 Ga0207693_10026745 Ga0207693_100267453 410
1938 3300025916 Ga0207663_10000181 Ga0207663_1000018118 410
1939 3300025916 Ga0207663_10014178 Ga0207663_100141782 410
1940 3300025929 Ga0207664_10091550 Ga0207664_100915502 410
1941 3300025939 Ga0207665_10011230 Ga0207665_100112306 410
1942 3300025941 Ga0207711_10021859 Ga0207711_100218594 410
1943 3300025941 Ga0207711_10149557 Ga0207711_101495572 410
1944 3300025949 Ga0207667_10290324 Ga0207667_102903242 410
1945 3300026035 Ga0207703_10337259 Ga0207703_103372591 410
1946 3300026041 Ga0207639_10122374 Ga0207639_101223743 410
1947 3300026067 Ga0207678_10052917 Ga0207678_100529173 410
1948 3300026121 Ga0207683_10083289 Ga0207683_100832892 410
1949 3300028381 Ga0268264_10000050 Ga0268264_10000050197 410
1950 3300030521 Ga0307511_10061899 Ga0307511_100618992 410
1951 3300031239 Ga0265328_10002032 Ga0265328_100020325 410
1952 3300031239 Ga0265328_10005546 Ga0265328_100055462 410
1953 3300031250 Ga0265331_10000061 Ga0265331_1000006116 410
1954 3300031251 Ga0265327_10030185 Ga0265327_100301851 410
1955 3300031507 Ga0307509_10014275 Ga0307509_100142755 410
1956 3300031665 Ga0316575_10007938 Ga0316575_100079385 410
1957 3300031711 Ga0265314_10119362 Ga0265314_101193621 410
1958 3300031730 Ga0307516_10025488 Ga0307516_100254881 410
1959 3300031995 Ga0307409_100238779 Ga0307409_1002387792 410
1960 3300032004 Ga0307414_10204856 Ga0307414_102048561 410
1961 3300033179 Ga0307507_10026668 Ga0307507_100266686 410
1962 3300034819 Ga0373958_0000933 Ga0373958_0000933_2103_3338 410
1963 3300035092 Ga0373952_0004273 Ga0373952_0004273_366_1637 410
1964 3300035115 Ga0373941_0000914 Ga0373941_0000914_3221_4456 410
1965 3300035116 Ga0373945_0018457 Ga0373945_0018457_898_2133 410
1966 3300035695 Ga0373927_0036139 Ga0373927_0036139_335_1570 410
1967 3300035725 Ga0373947_0140676 Ga0373947_0140676_176_1492 410
1968 3300037312 Ga0395899_0000028 Ga0395899_0000028_246218_247489 410
1969 3300039437 Ga0436365_0414414 Ga0436365_0414414_10891_12126 410
1970 3300046459 Ga0495629_0044110 Ga0495629_0044110_819_2111 410
1971 3300046461 Ga0495641_0005110 Ga0495641_0005110_3861_5096 410
1972 3300046472 Ga0495580_0047427 Ga0495580_0047427_938_2173 410
1973 3300046507 Ga0495606_0035648 Ga0495606_0035648_885_2156 410
1974 3300046511 Ga0495608_0124634 Ga0495608_0124634_191_1450 410
1975 3300046522 Ga0495643_0080428 Ga0495643_0080428_269_1564 410
1976 3300046531 Ga0495665_0015137 Ga0495665_0015137_1555_2790 410
1977 3300046533 Ga0495640_0078013 Ga0495640_0078013_852_2129 410
1978 3300046558 Ga0495633_0063273 Ga0495633_0063273_228_1499 410
1979 3300046674 Ga0495588_0016615 Ga0495588_0016615_2171_3406 410
1980 3300046681 Ga0495647_0003355 Ga0495647_0003355_2243_3478 410
1981 3300046691 Ga0495670_0073465 Ga0495670_0073465_114_1400 410
1982 3300046692 Ga0495671_0055615 Ga0495671_0055615_331_1605 410
1983 3300047319 Ga0495674_0005253 Ga0495674_0005253_5421_6656 410
1984 3300047320 Ga0495672_0088634 Ga0495672_0088634_152_1423 410
1985 3300047321 Ga0495676_0127912 Ga0495676_0127912_589_1824 410
1986 3300047469 Ga0495673_0040145 Ga0495673_0040145_518_1789 410
1987 3300047472 Ga0495686_0002420 Ga0495686_0002420_3563_4852 410
1988 3300047673 Ga0495593_0001424 Ga0495593_0001424_9587_10822 410
1989 3300047673 Ga0495593_0089574 Ga0495593_0089574_47_1327 410
1990 3300048091 Ga0495626_0033198 Ga0495626_0033198_960_2231 410
1991 3300048903 Ga0496100_0003697 Ga0496100_0003697_1183_2430 410
1992 3300048903 Ga0496100_0166284 Ga0496100_0166284_45_1325 410
1993 3300048904 Ga0496101_0002247 Ga0496101_0002247_4726_5973 410
1994 3300048905 Ga0496102_0028773 Ga0496102_0028773_1001_2248 410
1995 3300048907 Ga0496104_0042931 Ga0496104_0042931_2841_4088 410
1996 3300048908 Ga0496105_0021111 Ga0496105_0021111_36_1283 410
1997 3300048909 Ga0496106_0008474 Ga0496106_0008474_2463_3710 410
1998 3300048909 Ga0496106_0009134 Ga0496106_0009134_3733_5010 410
1999 3300048910 Ga0496107_0012977 Ga0496107_0012977_3938_5173 410
2000 3300048911 Ga0496108_0001178 Ga0496108_0001178_18945_20192 410
2001 3300048911 Ga0496108_0004093 Ga0496108_0004093_9479_10795 410
2002 3300048911 Ga0496108_0005723 Ga0496108_0005723_3004_4251 410
2003 3300048912 Ga0496109_0039192 Ga0496109_0039192_2360_3607 410
2004 3300048913 Ga0496110_0004642 Ga0496110_0004642_5387_6634 410
2005 3300048914 Ga0496111_0004667 Ga0496111_0004667_2593_3840 410
2006 3300048915 Ga0496112_0022734 Ga0496112_0022734_1910_3157 410
2007 3300048915 Ga0496112_0034816 Ga0496112_0034816_73_1389 410
2008 3300048916 Ga0496113_0051264 Ga0496113_0051264_632_1879 410
2009 3300048916 Ga0496113_0137141 Ga0496113_0137141_279_1559 410
2010 3300048920 Ga0496117_0020411 Ga0496117_0020411_871_2145 410
2011 3300048920 Ga0496117_0023711 Ga0496117_0023711_2066_3343 410
2012 3300048921 Ga0496118_0011865 Ga0496118_0011865_5691_6968 410
2013 3300048922 Ga0496119_0116419 Ga0496119_0116419_185_1462 410
2014 3300048924 Ga0496121_0000453 Ga0496121_0000453_418_1695 410
2015 3300048924 Ga0496121_0023721 Ga0496121_0023721_4004_5308 410
2016 3300048925 Ga0496122_0005603 Ga0496122_0005603_3637_4908 410
2017 3300048926 Ga0496123_0024129 Ga0496123_0024129_1275_2546 410
2018 3300048926 Ga0496123_0047485 Ga0496123_0047485_95_1369 410
2019 3300048927 Ga0496124_0000155 Ga0496124_0000155_35276_36580 410
2020 3300048929 Ga0496126_0004111 Ga0496126_0004111_49_1326 410
2021 3300048929 Ga0496126_0031901 Ga0496126_0031901_1776_3050 410
2022 3300049569 Ga0501032_0016542 Ga0501032_0016542_1226_2461 410
2023 3300049571 Ga0501034_0078547 Ga0501034_0078547_602_1837 410
2024 3300049572 Ga0501036_0020295 Ga0501036_0020295_2080_3315 410
2025 3300049572 Ga0501036_0215937 Ga0501036_0215937_33_1337 410
2026 3300049573 Ga0501037_0006349 Ga0501037_0006349_4190_5425 410
2027 3300049574 Ga0501038_0069287 Ga0501038_0069287_1001_2272 410
2028 3300049579 Ga0501043_0077835 Ga0501043_0077835_878_2149 410
2029 3300049579 Ga0501043_0077912 Ga0501043_0077912_1308_2585 410
2030 3300049581 Ga0501047_0026599 Ga0501047_0026599_3472_4707 410
2031 3300049582 Ga0501048_0094486 Ga0501048_0094486_160_1395 410
2032 3300049586 Ga0501070_0014212 Ga0501070_0014212_2608_3843 410
2033 3300049589 Ga0501073_0070142 Ga0501073_0070142_64_1299 410
2034 3300049589 Ga0501073_0167387 Ga0501073_0167387_38_1300 410
2035 3300049590 Ga0501074_0061089 Ga0501074_0061089_553_1788 410
2036 3300049592 Ga0501076_0010040 Ga0501076_0010040_2908_4179 410
2037 3300049671 Ga0501238_003209 Ga0501238_003209_657_1922 410
2038 3300049742 Ga0501080_0042992 Ga0501080_0042992_783_2018 410
2039 3300049743 Ga0501081_0050347 Ga0501081_0050347_714_1985 410
2040 3300049744 Ga0501083_0088417 Ga0501083_0088417_101_1336 410
2041 3300049822 Ga0501035_0000371 Ga0501035_0000371_1775_3010 410
2042 3300049822 Ga0501035_0035358 Ga0501035_0035358_1262_2497 410
2043 3300049823 Ga0501044_0023347 Ga0501044_0023347_4085_5356 410
2044 3300049823 Ga0501044_0224194 Ga0501044_0224194_554_1789 410
2045 3300050507 nmdc:mga05p37_10559_c1 nmdc:mga05p37_10559_c1_2003_3250 410
2046 3300053140 Ga0500573_0014460 Ga0500573_0014460_2261_3538 410
2047 3300053178 Ga0500637_0036351 Ga0500637_0036351_132_1409 410
2048 3300053735 Ga0500596_001057 Ga0500596_001057_1512_2789 410
2049 3300060353 Ga0501082_0017584 Ga0501082_0017584_4133_5404 410
2050 iso_pu_bacteria 2513237087 2513590594 410
2051 iso_pu_bacteria 2738541281 2738745576 410
2052 iso_pu_bacteria 2738543032 2739354806 410
2053 iso_pu_bacteria 2757320392 2757572694 410
2054 iso_pu_bacteria 2765235802 2765468069 410
2055 iso_pu_bacteria 2828305725 2828308691 410
2056 iso_pu_bacteria 2829745981 2829746521 410
2057 iso_pu_bacteria 2854911287 2854913044 410
2058 iso_pu_bacteria 2861691609 2861691725 410
2059 iso_pu_bacteria 2902405164 2902405626 410
2060 iso_pu_bacteria 2904578770 2904580192 410
2061 iso_pu_bacteria 2909042592 2909046822 410
2062 iso_pu_bacteria 2919119836 2919120135 410
2063 iso_pu_bacteria 2919450847 2919452238 410
2064 iso_pu_bacteria 8001845381 8001845914 410
2065 3300001979 JGI24740J21852_10001515 JGI24740J21852_100015151 411
2066 3300001989 JGI24739J22299_10014257 JGI24739J22299_100142572 411
2067 3300001990 JGI24737J22298_10020559 JGI24737J22298_100205592 411
2068 3300003203 JGI25406J46586_10000037 JGI25406J46586_1000003750 411
2069 3300003215 JGI25153J46596_10019745 JGI25153J46596_100197452 411
2070 3300003578 Ga0006562J51391_1017287 Ga0006562J51391_10172871 411
2071 3300003794 Ga0055531_10029233 Ga0055531_100292332 411
2072 3300004625 Ga0055543_1001699 Ga0055543_10016998 411
2073 3300005327 Ga0070658_10099819 Ga0070658_100998191 411
2074 3300005330 Ga0070690_100031212 Ga0070690_1000312121 411
2075 3300005336 Ga0070680_100016861 Ga0070680_1000168614 411
2076 3300005338 Ga0068868_100007459 Ga0068868_1000074596 411
2077 3300005339 Ga0070660_100026571 Ga0070660_1000265713 411
2078 3300005341 Ga0070691_10076519 Ga0070691_100765191 411
2079 3300005347 Ga0070668_100165771 Ga0070668_1001657711 411
2080 3300005356 Ga0070674_100104402 Ga0070674_1001044023 411
2081 3300005364 Ga0070673_100147539 Ga0070673_1001475391 411
2082 3300005365 Ga0070688_100017211 Ga0070688_1000172113 411
2083 3300005366 Ga0070659_100059306 Ga0070659_1000593062 411
2084 3300005434 Ga0070709_10001411 Ga0070709_100014113 411
2085 3300005434 Ga0070709_10005023 Ga0070709_100050236 411
2086 3300005435 Ga0070714_100021907 Ga0070714_1000219072 411
2087 3300005436 Ga0070713_100012693 Ga0070713_1000126932 411
2088 3300005437 Ga0070710_10000787 Ga0070710_100007876 411
2089 3300005437 Ga0070710_10028328 Ga0070710_100283282 411
2090 3300005438 Ga0070701_10100428 Ga0070701_101004281 411
2091 3300005439 Ga0070711_100004812 Ga0070711_1000048128 411
2092 3300005439 Ga0070711_100017221 Ga0070711_1000172213 411
2093 3300005439 Ga0070711_100019865 Ga0070711_1000198653 411
2094 3300005440 Ga0070705_100012761 Ga0070705_1000127612 411
2095 3300005455 Ga0070663_100013319 Ga0070663_1000133193 411
2096 3300005455 Ga0070663_100015859 Ga0070663_1000158595 411
2097 3300005455 Ga0070663_100019686 Ga0070663_1000196863 411
2098 3300005455 Ga0070663_100092346 Ga0070663_1000923461 411
2099 3300005455 Ga0070663_100130358 Ga0070663_1001303581 411
2100 3300005456 Ga0070678_100105108 Ga0070678_1001051081 411
2101 3300005458 Ga0070681_10011156 Ga0070681_100111563 411
2102 3300005471 Ga0070698_100009726 Ga0070698_1000097266 411
2103 3300005530 Ga0070679_100002856 Ga0070679_1000028567 411
2104 3300005530 Ga0070679_100033033 Ga0070679_1000330337 411
2105 3300005535 Ga0070684_100083030 Ga0070684_1000830302 411
2106 3300005539 Ga0068853_100037287 Ga0068853_1000372873 411
2107 3300005539 Ga0068853_100063484 Ga0068853_1000634842 411
2108 3300005548 Ga0070665_100022659 Ga0070665_1000226593 411
2109 3300005548 Ga0070665_100242115 Ga0070665_1002421152 411
2110 3300005563 Ga0068855_100027849 Ga0068855_10002784910 411
2111 3300005563 Ga0068855_100029470 Ga0068855_1000294706 411
2112 3300005563 Ga0068855_100030375 Ga0068855_1000303754 411
2113 3300005563 Ga0068855_100040067 Ga0068855_1000400676 411
2114 3300005563 Ga0068855_100187217 Ga0068855_1001872172 411
2115 3300005564 Ga0070664_100158941 Ga0070664_1001589412 411
2116 3300005577 Ga0068857_100004888 Ga0068857_1000048886 411
2117 3300005577 Ga0068857_100010388 Ga0068857_1000103889 411
2118 3300005578 Ga0068854_100091552 Ga0068854_1000915522 411
2119 3300005614 Ga0068856_100000013 Ga0068856_100000013128 411
2120 3300005614 Ga0068856_100039704 Ga0068856_1000397042 411
2121 3300005616 Ga0068852_100014464 Ga0068852_1000144642 411
2122 3300005616 Ga0068852_100077518 Ga0068852_1000775183 411
2123 3300005617 Ga0068859_100030696 Ga0068859_1000306963 411
2124 3300005617 Ga0068859_100084982 Ga0068859_1000849822 411
2125 3300005618 Ga0068864_100087925 Ga0068864_1000879252 411
2126 3300005618 Ga0068864_100103785 Ga0068864_1001037852 411
2127 3300005718 Ga0068866_10011469 Ga0068866_100114692 411
2128 3300005834 Ga0068851_10022202 Ga0068851_100222022 411
2129 3300005841 Ga0068863_100224470 Ga0068863_1002244701 411
2130 3300005937 Ga0081455_10001309 Ga0081455_100013093 411
2131 3300005937 Ga0081455_10028767 Ga0081455_100287674 411
2132 3300005937 Ga0081455_10030645 Ga0081455_100306452 411
2133 3300005981 Ga0081538_10002248 Ga0081538_1000224814 411
2134 3300005981 Ga0081538_10015217 Ga0081538_100152174 411
2135 3300005983 Ga0081540_1007725 Ga0081540_10077257 411
2136 3300005983 Ga0081540_1030603 Ga0081540_10306032 411
2137 3300005983 Ga0081540_1033713 Ga0081540_10337132 411
2138 3300005983 Ga0081540_1041288 Ga0081540_10412882 411
2139 3300005985 Ga0081539_10000129 Ga0081539_10000129105 411
2140 3300005985 Ga0081539_10002840 Ga0081539_1000284013 411
2141 3300005985 Ga0081539_10055480 Ga0081539_100554802 411
2142 3300006028 Ga0070717_10011634 Ga0070717_100116341 411
2143 3300006028 Ga0070717_10020456 Ga0070717_100204566 411
2144 3300006038 Ga0075365_10056876 Ga0075365_100568762 411
2145 3300006042 Ga0075368_10005011 Ga0075368_100050113 411
2146 3300006048 Ga0075363_100000348 Ga0075363_10000034812 411
2147 3300006051 Ga0075364_10005491 Ga0075364_100054912 411
2148 3300006178 Ga0075367_10074102 Ga0075367_100741021 411
2149 3300006186 Ga0075369_10014661 Ga0075369_100146613 411
2150 3300006881 Ga0068865_100052101 Ga0068865_1000521012 411
2151 3300006931 Ga0097620_100030694 Ga0097620_1000306943 411
2152 3300006931 Ga0097620_100084988 Ga0097620_1000849883 411
2153 3300006941 Ga0099825_1021428 Ga0099825_10214282 411
2154 3300006942 Ga0099824_1012461 Ga0099824_10124613 411
2155 3300006942 Ga0099824_1013833 Ga0099824_10138333 411
2156 3300006943 Ga0099822_1000008 Ga0099822_100000844 411
2157 3300007076 Ga0075435_100014990 Ga0075435_1000149905 411
2158 3300007788 Ga0099795_10011850 Ga0099795_100118502 411
2159 3300009093 Ga0105240_10013956 Ga0105240_100139566 411
2160 3300009093 Ga0105240_10016913 Ga0105240_100169137 411
2161 3300009093 Ga0105240_10021261 Ga0105240_100212616 411
2162 3300009093 Ga0105240_10027723 Ga0105240_100277232 411
2163 3300009174 Ga0105241_10000950 Ga0105241_1000095017 411
2164 3300009174 Ga0105241_10099264 Ga0105241_100992642 411
2165 3300009545 Ga0105237_10006980 Ga0105237_100069809 411
2166 3300009545 Ga0105237_10035995 Ga0105237_100359952 411
2167 3300009551 Ga0105238_10001968 Ga0105238_1000196815 411
2168 3300009551 Ga0105238_10003568 Ga0105238_100035687 411
2169 3300009551 Ga0105238_10047244 Ga0105238_100472441 411
2170 3300009553 Ga0105249_10125158 Ga0105249_101251582 411
2171 3300009553 Ga0105249_10146245 Ga0105249_101462453 411
2172 3300010375 Ga0105239_10002945 Ga0105239_100029457 411
2173 3300010375 Ga0105239_10005003 Ga0105239_1000500311 411
2174 3300011119 Ga0105246_10019357 Ga0105246_100193572 411
2175 3300013105 Ga0157369_10008988 Ga0157369_1000898811 411
2176 3300013105 Ga0157369_10029380 Ga0157369_100293804 411
2177 3300013296 Ga0157374_10048783 Ga0157374_100487832 411
2178 3300013306 Ga0163162_10012633 Ga0163162_100126335 411
2179 3300013308 Ga0157375_10006749 Ga0157375_100067492 411
2180 3300014325 Ga0163163_10055138 Ga0163163_100551381 411
2181 3300014969 Ga0157376_10001823 Ga0157376_1000182314 411
2182 3300021320 Ga0214544_1000003 Ga0214544_100000347 411
2183 3300021321 Ga0214542_1000003 Ga0214542_100000337 411
2184 3300021324 Ga0214545_1000004 Ga0214545_100000450 411
2185 3300021327 Ga0214543_1000007 Ga0214543_1000007366 411
2186 3300021384 Ga0213876_10000882 Ga0213876_100008824 411
2187 3300021388 Ga0213875_10000036 Ga0213875_1000003675 411
2188 3300025230 Ga0209563_105564 Ga0209563_1055641 411
2189 3300025245 Ga0207425_1009843 Ga0207425_10098432 411
2190 3300025253 Ga0209677_100611 Ga0209677_10061111 411
2191 3300025253 Ga0209677_102993 Ga0209677_1029932 411
2192 3300025254 Ga0209148_1000334 Ga0209148_100033410 411
2193 3300025261 Ga0209233_1007161 Ga0209233_10071612 411
2194 3300025272 Ga0209455_1000787 Ga0209455_100078716 411
2195 3300025272 Ga0209455_1003869 Ga0209455_10038692 411
2196 3300025272 Ga0209455_1005215 Ga0209455_10052154 411
2197 3300025295 Ga0209564_1001506 Ga0209564_100150614 411
2198 3300025297 Ga0209758_1000015 Ga0209758_100001594 411
2199 3300025297 Ga0209758_1004072 Ga0209758_10040724 411
2200 3300025297 Ga0209758_1004594 Ga0209758_10045942 411
2201 3300025297 Ga0209758_1007787 Ga0209758_10077872 411
2202 3300025297 Ga0209758_1014598 Ga0209758_10145984 411
2203 3300025297 Ga0209758_1017770 Ga0209758_10177704 411
2204 3300025297 Ga0209758_1022699 Ga0209758_10226993 411
2205 3300025302 Ga0207426_1000201 Ga0207426_100020177 411
2206 3300025302 Ga0207426_1001330 Ga0207426_10013306 411
2207 3300025302 Ga0207426_1013438 Ga0207426_10134382 411
2208 3300025321 Ga0207656_10001876 Ga0207656_100018765 411
2209 3300025321 Ga0207656_10011344 Ga0207656_100113443 411
2210 3300025893 Ga0207682_10001050 Ga0207682_100010502 411
2211 3300025898 Ga0207692_10005805 Ga0207692_100058052 411
2212 3300025901 Ga0207688_10019774 Ga0207688_100197743 411
2213 3300025901 Ga0207688_10024469 Ga0207688_100244694 411
2214 3300025906 Ga0207699_10001412 Ga0207699_1000141210 411
2215 3300025906 Ga0207699_10112318 Ga0207699_101123182 411
2216 3300025909 Ga0207705_10030993 Ga0207705_100309932 411
2217 3300025911 Ga0207654_10000221 Ga0207654_1000022122 411
2218 3300025912 Ga0207707_10001049 Ga0207707_100010497 411
2219 3300025912 Ga0207707_10001381 Ga0207707_1000138112 411
2220 3300025913 Ga0207695_10000065 Ga0207695_10000065248 411
2221 3300025913 Ga0207695_10001260 Ga0207695_1000126024 411
2222 3300025913 Ga0207695_10037557 Ga0207695_100375572 411
2223 3300025913 Ga0207695_10196479 Ga0207695_101964792 411
2224 3300025914 Ga0207671_10023237 Ga0207671_100232373 411
2225 3300025916 Ga0207663_10006068 Ga0207663_100060682 411
2226 3300025916 Ga0207663_10025098 Ga0207663_100250982 411
2227 3300025917 Ga0207660_10002412 Ga0207660_100024128 411
2228 3300025917 Ga0207660_10099090 Ga0207660_100990901 411
2229 3300025919 Ga0207657_10004432 Ga0207657_100044327 411
2230 3300025919 Ga0207657_10029869 Ga0207657_100298694 411
2231 3300025921 Ga0207652_10011982 Ga0207652_100119823 411
2232 3300025921 Ga0207652_10012842 Ga0207652_100128424 411
2233 3300025921 Ga0207652_10053276 Ga0207652_100532762 411
2234 3300025924 Ga0207694_10000256 Ga0207694_1000025616 411
2235 3300025928 Ga0207700_10018161 Ga0207700_100181612 411
2236 3300025929 Ga0207664_10009878 Ga0207664_100098782 411
2237 3300025929 Ga0207664_10153590 Ga0207664_101535902 411
2238 3300025931 Ga0207644_10047549 Ga0207644_100475492 411
2239 3300025932 Ga0207690_10040988 Ga0207690_100409882 411
2240 3300025932 Ga0207690_10089898 Ga0207690_100898982 411
2241 3300025937 Ga0207669_10031362 Ga0207669_100313623 411
2242 3300025938 Ga0207704_10013224 Ga0207704_100132244 411
2243 3300025941 Ga0207711_10088256 Ga0207711_100882562 411
2244 3300025942 Ga0207689_10013235 Ga0207689_100132358 411
2245 3300025944 Ga0207661_10003004 Ga0207661_100030048 411
2246 3300025945 Ga0207679_10137794 Ga0207679_101377942 411
2247 3300025949 Ga0207667_10008231 Ga0207667_100082318 411
2248 3300025949 Ga0207667_10011663 Ga0207667_100116635 411
2249 3300025949 Ga0207667_10019628 Ga0207667_100196282 411
2250 3300025981 Ga0207640_10028827 Ga0207640_100288274 411
2251 3300026041 Ga0207639_10001359 Ga0207639_1000135913 411
2252 3300026041 Ga0207639_10007341 Ga0207639_100073416 411
2253 3300026041 Ga0207639_10021364 Ga0207639_100213642 411
2254 3300026041 Ga0207639_10073866 Ga0207639_100738662 411
2255 3300026067 Ga0207678_10028664 Ga0207678_100286642 411
2256 3300026067 Ga0207678_10043516 Ga0207678_100435163 411
2257 3300026067 Ga0207678_10161380 Ga0207678_101613802 411
2258 3300026078 Ga0207702_10000090 Ga0207702_1000009046 411
2259 3300026078 Ga0207702_10000453 Ga0207702_1000045313 411
2260 3300026078 Ga0207702_10010553 Ga0207702_100105535 411
2261 3300026078 Ga0207702_10065644 Ga0207702_100656442 411
2262 3300026088 Ga0207641_10132018 Ga0207641_101320182 411
2263 3300026088 Ga0207641_10324759 Ga0207641_103247591 411
2264 3300026089 Ga0207648_10034904 Ga0207648_100349046 411
2265 3300026116 Ga0207674_10007138 Ga0207674_1000713814 411
2266 3300026116 Ga0207674_10007679 Ga0207674_1000767910 411
2267 3300026116 Ga0207674_10050250 Ga0207674_100502504 411
2268 3300026116 Ga0207674_10170923 Ga0207674_101709232 411
2269 3300026121 Ga0207683_10004947 Ga0207683_100049475 411
2270 3300026142 Ga0207698_10161442 Ga0207698_101614421 411
2271 3300027296 Ga0209389_1000051 Ga0209389_100005176 411
2272 3300027296 Ga0209389_1000064 Ga0209389_100006452 411
2273 3300027357 Ga0209589_1000012 Ga0209589_1000012131 411
2274 3300027357 Ga0209589_1000013 Ga0209589_100001375 411
2275 3300027357 Ga0209589_1000026 Ga0209589_100002664 411
2276 3300027361 Ga0209489_100013 Ga0209489_100013132 411
2277 3300027361 Ga0209489_100046 Ga0209489_10004664 411
2278 3300027361 Ga0209489_102226 Ga0209489_10222618 411
2279 3300027363 Ga0209700_100014 Ga0209700_100014175 411
2280 3300027363 Ga0209700_100047 Ga0209700_10004764 411
2281 3300027671 Ga0209588_1024492 Ga0209588_10244922 411
2282 3300028379 Ga0268266_10003225 Ga0268266_100032253 411
2283 3300028379 Ga0268266_10004165 Ga0268266_1000416514 411
2284 3300028379 Ga0268266_10028142 Ga0268266_100281422 411
2285 3300028379 Ga0268266_10066370 Ga0268266_100663703 411
2286 3300028379 Ga0268266_10113831 Ga0268266_101138312 411
2287 3300028379 Ga0268266_10360369 Ga0268266_103603691 411
2288 3300028573 Ga0265334_10024268 Ga0265334_100242682 411
2289 3300028653 Ga0265323_10007422 Ga0265323_100074222 411
2290 3300028666 Ga0265336_10000355 Ga0265336_100003554 411
2291 3300028786 Ga0307517_10002340 Ga0307517_1000234019 411
2292 3300028794 Ga0307515_10016062 Ga0307515_100160624 411
2293 3300028800 Ga0265338_10000256 Ga0265338_1000025683 411
2294 3300028800 Ga0265338_10019026 Ga0265338_100190269 411
2295 3300029957 Ga0265324_10006036 Ga0265324_100060362 411
2296 3300031235 Ga0265330_10017374 Ga0265330_100173744 411
2297 3300031239 Ga0265328_10000684 Ga0265328_1000068415 411
2298 3300031240 Ga0265320_10101125 Ga0265320_101011251 411
2299 3300031242 Ga0265329_10006611 Ga0265329_100066114 411
2300 3300031247 Ga0265340_10018523 Ga0265340_100185234 411
2301 3300031249 Ga0265339_10000068 Ga0265339_1000006872 411
2302 3300031249 Ga0265339_10001455 Ga0265339_100014558 411
2303 3300031249 Ga0265339_10042357 Ga0265339_100423572 411
2304 3300031250 Ga0265331_10012049 Ga0265331_100120494 411
2305 3300031251 Ga0265327_10033929 Ga0265327_100339292 411
2306 3300031548 Ga0307408_100055235 Ga0307408_1000552352 411
2307 3300031595 Ga0265313_10000020 Ga0265313_100000205 411
2308 3300031595 Ga0265313_10009591 Ga0265313_100095916 411
2309 3300031616 Ga0307508_10000199 Ga0307508_1000019943 411
2310 3300031616 Ga0307508_10020920 Ga0307508_100209206 411
2311 3300031711 Ga0265314_10002042 Ga0265314_100020424 411
2312 3300031711 Ga0265314_10008333 Ga0265314_100083334 411
2313 3300031711 Ga0265314_10040218 Ga0265314_100402182 411
2314 3300031711 Ga0265314_10113701 Ga0265314_101137011 411
2315 3300031712 Ga0265342_10058454 Ga0265342_100584542 411
2316 3300031730 Ga0307516_10148264 Ga0307516_101482642 411
2317 3300032126 Ga0307415_100231521 Ga0307415_1002315211 411
2318 3300033180 Ga0307510_10013982 Ga0307510_100139823 411
2319 3300033180 Ga0307510_10130356 Ga0307510_101303562 411
2320 3300033442 Ga0315911_1000019 Ga0315911_100001938 411
2321 3300035084 Ga0373928_0002599 Ga0373928_0002599_206_1456 411
2322 3300035086 Ga0373934_0056216 Ga0373934_0056216_127_1443 411
2323 3300035111 Ga0373923_0009517 Ga0373923_0009517_311_1603 411
2324 3300035112 Ga0373932_0033283 Ga0373932_0033283_14_1300 411
2325 3300035113 Ga0373936_0006238 Ga0373936_0006238_3040_4332 411
2326 3300035113 Ga0373936_0010212 Ga0373936_0010212_1748_3037 411
2327 3300035115 Ga0373941_0003796 Ga0373941_0003796_1788_3038 411
2328 3300035116 Ga0373945_0021338 Ga0373945_0021338_80_1369 411
2329 3300035118 Ga0373954_0051934 Ga0373954_0051934_280_1569 411
2330 3300035172 Ga0373955_0027625 Ga0373955_0027625_1495_2775 411
2331 3300035172 Ga0373955_0095774 Ga0373955_0095774_385_1665 411
2332 3300035242 Ga0373962_0000973 Ga0373962_0000973_38_1276 411
2333 3300035691 Ga0373931_0000619 Ga0373931_0000619_785_2098 411
2334 3300035692 Ga0373935_0072671 Ga0373935_0072671_595_1875 411
2335 3300035695 Ga0373927_0008391 Ga0373927_0008391_2269_3546 411
2336 3300035695 Ga0373927_0009076 Ga0373927_0009076_816_2108 411
2337 3300035695 Ga0373927_0014795 Ga0373927_0014795_3870_5147 411
2338 3300035724 Ga0373933_0000173 Ga0373933_0000173_4590_5876 411
2339 3300035724 Ga0373933_0003738 Ga0373933_0003738_6977_8254 411
2340 3300035724 Ga0373933_0024387 Ga0373933_0024387_1017_2306 411
2341 3300035724 Ga0373933_0043832 Ga0373933_0043832_337_1629 411
2342 3300035725 Ga0373947_0000761 Ga0373947_0000761_14618_15910 411
2343 3300035725 Ga0373947_0006054 Ga0373947_0006054_63_1352 411
2344 3300035725 Ga0373947_0020231 Ga0373947_0020231_807_2084 411
2345 3300036401 Ga0373937_0065228 Ga0373937_0065228_734_2023 411
2346 3300037068 Ga0373925_0008156 Ga0373925_0008156_3448_4740 411
2347 3300037068 Ga0373925_0035545 Ga0373925_0035545_1786_3075 411
2348 3300037068 Ga0373925_0069228 Ga0373925_0069228_242_1519 411
2349 3300037418 Ga0395900_0019840 Ga0395900_0019840_1618_2907 411
2350 3300037418 Ga0395900_0268640 Ga0395900_0268640_83_1372 411
2351 3300037466 Ga0395898_0186306 Ga0395898_0186306_148_1431 411
2352 3300037471 Ga0395905_0024591 Ga0395905_0024591_1446_2729 411
2353 3300037853 Ga0436364_0245439 Ga0436364_0245439_18183_19439 411
2354 3300037853 Ga0436364_0839632 Ga0436364_0839632_17_1429 411
2355 3300038443 Ga0395901_0121596 Ga0395901_0121596_112_1401 411
2356 3300039437 Ga0436365_0330576 Ga0436365_0330576_292_1548 411
2357 3300039437 Ga0436365_0441549 Ga0436365_0441549_1502_2776 411
2358 3300039437 Ga0436365_0994189 Ga0436365_0994189_93_1343 411
2359 3300039437 Ga0436365_1822426 Ga0436365_1822426_10069_11352 411
2360 3300039450 Ga0436363_0310436 Ga0436363_0310436_5218_6510 411
2361 3300039450 Ga0436363_0466725 Ga0436363_0466725_507_1757 411
2362 3300039450 Ga0436363_0910224 Ga0436363_0910224_1636_2946 411
2363 3300039453 Ga0436362_0511152 Ga0436362_0511152_58_1341 411
2364 3300042157 Ga0439458_0017551 Ga0439458_0017551_229_1515 411
2365 3300044658 Ga0466972_0000059 Ga0466972_0000059_11259_12542 411
2366 3300044658 Ga0466972_0006116 Ga0466972_0006116_1349_2632 411
2367 3300044683 Ga0466965_0040806 Ga0466965_0040806_951_2234 411
2368 3300044684 Ga0466966_0047162 Ga0466966_0047162_841_2115 411
2369 3300044693 Ga0466961_0000019 Ga0466961_0000019_63735_65018 411
2370 3300044694 Ga0466963_0097280 Ga0466963_0097280_416_1699 411
2371 3300044735 Ga0466968_0058531 Ga0466968_0058531_235_1518 411
2372 3300044842 Ga0466957_0047073 Ga0466957_0047073_356_1648 411
2373 3300044901 Ga0466960_0036700 Ga0466960_0036700_931_2214 411
2374 3300045049 Ga0466959_0099473 Ga0466959_0099473_369_1643 411
2375 3300045976 Ga0466967_0044462 Ga0466967_0044462_1474_2766 411
2376 3300045976 Ga0466967_0073350 Ga0466967_0073350_964_2253 411
2377 3300045976 Ga0466967_0118079 Ga0466967_0118079_492_1790 411
2378 3300046454 Ga0495592_0015083 Ga0495592_0015083_4374_5651 411
2379 3300046454 Ga0495592_0048804 Ga0495592_0048804_1200_2483 411
2380 3300046455 Ga0495603_0000068 Ga0495603_0000068_40424_41716 411
2381 3300046455 Ga0495603_0000736 Ga0495603_0000736_3683_4969 411
2382 3300046455 Ga0495603_0023660 Ga0495603_0023660_885_2162 411
2383 3300046455 Ga0495603_0057691 Ga0495603_0057691_752_2044 411
2384 3300046455 Ga0495603_0069177 Ga0495603_0069177_560_1843 411
2385 3300046455 Ga0495603_0080546 Ga0495603_0080546_509_1798 411
2386 3300046458 Ga0495591_000596 Ga0495591_000596_13416_14708 411
2387 3300046459 Ga0495629_0004611 Ga0495629_0004611_7243_8526 411
2388 3300046459 Ga0495629_0009583 Ga0495629_0009583_4558_5850 411
2389 3300046460 Ga0495638_0005696 Ga0495638_0005696_2763_4049 411
2390 3300046461 Ga0495641_0008803 Ga0495641_0008803_2662_3954 411
2391 3300046462 Ga0495651_0005160 Ga0495651_0005160_1071_2357 411
2392 3300046462 Ga0495651_0023239 Ga0495651_0023239_111_1394 411
2393 3300046463 Ga0495653_0003759 Ga0495653_0003759_4392_5669 411
2394 3300046463 Ga0495653_0015717 Ga0495653_0015717_1663_2946 411
2395 3300046463 Ga0495653_0043872 Ga0495653_0043872_1786_3066 411
2396 3300046472 Ga0495580_0011805 Ga0495580_0011805_2547_3839 411
2397 3300046472 Ga0495580_0070690 Ga0495580_0070690_183_1472 411
2398 3300046473 Ga0495582_0000679 Ga0495582_0000679_12857_14149 411
2399 3300046473 Ga0495582_0037338 Ga0495582_0037338_57_1346 411
2400 3300046475 Ga0495639_0000161 Ga0495639_0000161_4372_5664 411
2401 3300046476 Ga0495662_0002657 Ga0495662_0002657_4860_6152 411
2402 3300046477 Ga0495664_0017860 Ga0495664_0017860_896_2188 411
2403 3300046477 Ga0495664_0044447 Ga0495664_0044447_1332_2612 411
2404 3300046477 Ga0495664_0105692 Ga0495664_0105692_304_1587 411
2405 3300046491 Ga0495584_0004151 Ga0495584_0004151_2651_3943 411
2406 3300046492 Ga0495585_0036945 Ga0495585_0036945_677_1963 411
2407 3300046492 Ga0495585_0041580 Ga0495585_0041580_74_1366 411
2408 3300046499 Ga0495594_0002249 Ga0495594_0002249_6402_7652 411
2409 3300046501 Ga0495607_0002872 Ga0495607_0002872_1971_3263 411
2410 3300046507 Ga0495606_0013420 Ga0495606_0013420_5034_6326 411
2411 3300046507 Ga0495606_0035855 Ga0495606_0035855_1823_3106 411
2412 3300046507 Ga0495606_0093185 Ga0495606_0093185_132_1415 411
2413 3300046511 Ga0495608_0001255 Ga0495608_0001255_16628_17935 411
2414 3300046511 Ga0495608_0013731 Ga0495608_0013731_922_2202 411
2415 3300046511 Ga0495608_0101568 Ga0495608_0101568_383_1633 411
2416 3300046512 Ga0495610_0001267 Ga0495610_0001267_8064_9356 411
2417 3300046516 Ga0495628_0015875 Ga0495628_0015875_2374_3654 411
2418 3300046516 Ga0495628_0107627 Ga0495628_0107627_159_1442 411
2419 3300046517 Ga0495630_0008279 Ga0495630_0008279_2278_3567 411
2420 3300046517 Ga0495630_0017710 Ga0495630_0017710_2618_3910 411
2421 3300046517 Ga0495630_0122282 Ga0495630_0122282_53_1303 411
2422 3300046518 Ga0495631_0027980 Ga0495631_0027980_311_1594 411
2423 3300046520 Ga0495637_0000004 Ga0495637_0000004_275187_276479 411
2424 3300046522 Ga0495643_0023035 Ga0495643_0023035_801_2084 411
2425 3300046524 Ga0495648_0000382 Ga0495648_0000382_36011_37303 411
2426 3300046524 Ga0495648_0002308 Ga0495648_0002308_9265_10554 411
2427 3300046524 Ga0495648_0013844 Ga0495648_0013844_3685_4968 411
2428 3300046525 Ga0495663_0031713 Ga0495663_0031713_259_1545 411
2429 3300046526 Ga0495666_0030379 Ga0495666_0030379_1309_2601 411
2430 3300046529 Ga0495652_0011158 Ga0495652_0011158_1285_2568 411
2431 3300046529 Ga0495652_0024608 Ga0495652_0024608_1844_3127 411
2432 3300046531 Ga0495665_0002175 Ga0495665_0002175_5895_7187 411
2433 3300046533 Ga0495640_0003966 Ga0495640_0003966_1468_2760 411
2434 3300046533 Ga0495640_0016407 Ga0495640_0016407_912_2189 411
2435 3300046533 Ga0495640_0023451 Ga0495640_0023451_2724_4007 411
2436 3300046533 Ga0495640_0040413 Ga0495640_0040413_792_2072 411
2437 3300046533 Ga0495640_0087467 Ga0495640_0087467_642_1892 411
2438 3300046536 Ga0495587_0030897 Ga0495587_0030897_520_1797 411
2439 3300046538 Ga0495609_0051638 Ga0495609_0051638_330_1616 411
2440 3300046539 Ga0495621_0009389 Ga0495621_0009389_774_2027 411
2441 3300046542 Ga0495597_0023795 Ga0495597_0023795_241_1524 411
2442 3300046543 Ga0495645_0055053 Ga0495645_0055053_1236_2525 411
2443 3300046543 Ga0495645_0058653 Ga0495645_0058653_1187_2467 411
2444 3300046557 Ga0495622_0003266 Ga0495622_0003266_2614_3906 411
2445 3300046557 Ga0495622_0013013 Ga0495622_0013013_297_1583 411
2446 3300046557 Ga0495622_0041972 Ga0495622_0041972_364_1647 411
2447 3300046616 Ga0495668_0008589 Ga0495668_0008589_4568_5854 411
2448 3300046616 Ga0495668_0086649 Ga0495668_0086649_369_1634 411
2449 3300046642 Ga0495634_0010485 Ga0495634_0010485_965_2257 411
2450 3300046642 Ga0495634_0021617 Ga0495634_0021617_2816_4093 411
2451 3300046642 Ga0495634_0066382 Ga0495634_0066382_930_2180 411
2452 3300046663 Ga0495635_0000722 Ga0495635_0000722_12109_13386 411
2453 3300046663 Ga0495635_0001197 Ga0495635_0001197_11428_12720 411
2454 3300046674 Ga0495588_0009402 Ga0495588_0009402_2823_4115 411
2455 3300046674 Ga0495588_0115870 Ga0495588_0115870_38_1321 411
2456 3300046675 Ga0495657_0005123 Ga0495657_0005123_9106_10383 411
2457 3300046675 Ga0495657_0006519 Ga0495657_0006519_1672_2955 411
2458 3300046675 Ga0495657_0036037 Ga0495657_0036037_1988_3271 411
2459 3300046678 Ga0495599_0001956 Ga0495599_0001956_4142_5419 411
2460 3300046678 Ga0495599_0027883 Ga0495599_0027883_1073_2353 411
2461 3300046679 Ga0495623_0015704 Ga0495623_0015704_3562_4845 411
2462 3300046679 Ga0495623_0024957 Ga0495623_0024957_373_1653 411
2463 3300046681 Ga0495647_0006295 Ga0495647_0006295_1219_2511 411
2464 3300046681 Ga0495647_0028614 Ga0495647_0028614_63_1349 411
2465 3300046683 Ga0495658_0000229 Ga0495658_0000229_5127_6377 411
2466 3300046683 Ga0495658_0001094 Ga0495658_0001094_4538_5830 411
2467 3300046683 Ga0495658_0008841 Ga0495658_0008841_3675_4964 411
2468 3300046684 Ga0495669_0043990 Ga0495669_0043990_88_1374 411
2469 3300046689 Ga0495613_0007259 Ga0495613_0007259_415_1692 411
2470 3300046689 Ga0495613_0008404 Ga0495613_0008404_3933_5183 411
2471 3300046689 Ga0495613_0017342 Ga0495613_0017342_2291_3574 411
2472 3300046690 Ga0495624_0001906 Ga0495624_0001906_10077_11369 411
2473 3300046690 Ga0495624_0042986 Ga0495624_0042986_610_1899 411
2474 3300046690 Ga0495624_0079178 Ga0495624_0079178_322_1599 411
2475 3300046692 Ga0495671_0031197 Ga0495671_0031197_1068_2351 411
2476 3300046692 Ga0495671_0044218 Ga0495671_0044218_678_1964 411
2477 3300046809 Ga0495600_0007908 Ga0495600_0007908_930_2207 411
2478 3300046809 Ga0495600_0031165 Ga0495600_0031165_1410_2693 411
2479 3300046810 Ga0495660_0022496 Ga0495660_0022496_1349_2632 411
2480 3300046810 Ga0495660_0080201 Ga0495660_0080201_264_1547 411
2481 3300047315 Ga0495581_0005283 Ga0495581_0005283_2100_3392 411
2482 3300047319 Ga0495674_0018268 Ga0495674_0018268_940_2217 411
2483 3300047319 Ga0495674_0052639 Ga0495674_0052639_1901_3190 411
2484 3300047320 Ga0495672_0015658 Ga0495672_0015658_2280_3563 411
2485 3300047320 Ga0495672_0052337 Ga0495672_0052337_668_1945 411
2486 3300047321 Ga0495676_0051409 Ga0495676_0051409_1384_2676 411
2487 3300047321 Ga0495676_0125008 Ga0495676_0125008_362_1639 411
2488 3300047322 Ga0495680_0006090 Ga0495680_0006090_5120_6403 411
2489 3300047322 Ga0495680_0018505 Ga0495680_0018505_4369_5646 411
2490 3300047323 Ga0495683_0000248 Ga0495683_0000248_22231_23523 411
2491 3300047443 Ga0495687_005553 Ga0495687_005553_6283_7566 411
2492 3300047444 Ga0495675_0011969 Ga0495675_0011969_1803_3083 411
2493 3300047447 Ga0495685_030260 Ga0495685_030260_340_1593 411
2494 3300047471 Ga0495684_0000803 Ga0495684_0000803_6539_7816 411
2495 3300047471 Ga0495684_0012024 Ga0495684_0012024_2426_3709 411
2496 3300047471 Ga0495684_0096102 Ga0495684_0096102_230_1522 411
2497 3300047472 Ga0495686_0021146 Ga0495686_0021146_1607_2890 411
2498 3300047472 Ga0495686_0036677 Ga0495686_0036677_1237_2523 411
2499 3300047472 Ga0495686_0061046 Ga0495686_0061046_103_1389 411
2500 3300047673 Ga0495593_0000763 Ga0495593_0000763_12845_14137 411
2501 3300047673 Ga0495593_0098761 Ga0495593_0098761_206_1486 411
2502 3300048088 Ga0495602_0018448 Ga0495602_0018448_1126_2409 411
2503 3300048088 Ga0495602_0050209 Ga0495602_0050209_707_1990 411
2504 3300048088 Ga0495602_0079676 Ga0495602_0079676_1212_2492 411
2505 3300048091 Ga0495626_0000085 Ga0495626_0000085_53009_54301 411
2506 3300048091 Ga0495626_0075245 Ga0495626_0075245_14_1306 411
2507 3300048903 Ga0496100_0022664 Ga0496100_0022664_979_2262 411
2508 3300048903 Ga0496100_0141206 Ga0496100_0141206_438_1688 411
2509 3300048904 Ga0496101_0043411 Ga0496101_0043411_122_1405 411
2510 3300048904 Ga0496101_0140038 Ga0496101_0140038_250_1548 411
2511 3300048905 Ga0496102_0001207 Ga0496102_0001207_15131_16414 411
2512 3300048905 Ga0496102_0041696 Ga0496102_0041696_1097_2380 411
2513 3300048905 Ga0496102_0138854 Ga0496102_0138854_205_1491 411
2514 3300048906 Ga0496103_0052115 Ga0496103_0052115_996_2279 411
2515 3300048907 Ga0496104_0000352 Ga0496104_0000352_18978_20276 411
2516 3300048907 Ga0496104_0002052 Ga0496104_0002052_8106_9389 411
2517 3300048907 Ga0496104_0014004 Ga0496104_0014004_1514_2797 411
2518 3300048907 Ga0496104_0018509 Ga0496104_0018509_3298_4596 411
2519 3300048907 Ga0496104_0029954 Ga0496104_0029954_3035_4333 411
2520 3300048907 Ga0496104_0046825 Ga0496104_0046825_2725_4008 411
2521 3300048907 Ga0496104_0077323 Ga0496104_0077323_1695_2945 411
2522 3300048907 Ga0496104_0087001 Ga0496104_0087001_1549_2835 411
2523 3300048907 Ga0496104_0097204 Ga0496104_0097204_1250_2533 411
2524 3300048908 Ga0496105_0007594 Ga0496105_0007594_6439_7722 411
2525 3300048908 Ga0496105_0012656 Ga0496105_0012656_5143_6426 411
2526 3300048908 Ga0496105_0061549 Ga0496105_0061549_1277_2575 411
2527 3300048908 Ga0496105_0080673 Ga0496105_0080673_1360_2673 411
2528 3300048908 Ga0496105_0102493 Ga0496105_0102493_477_1775 411
2529 3300048909 Ga0496106_0001807 Ga0496106_0001807_9527_10819 411
2530 3300048909 Ga0496106_0013977 Ga0496106_0013977_3987_5285 411
2531 3300048909 Ga0496106_0074745 Ga0496106_0074745_723_2006 411
2532 3300048910 Ga0496107_0021779 Ga0496107_0021779_1787_3070 411
2533 3300048910 Ga0496107_0091251 Ga0496107_0091251_666_1949 411
2534 3300048911 Ga0496108_0001039 Ga0496108_0001039_5235_6527 411
2535 3300048911 Ga0496108_0013891 Ga0496108_0013891_4608_5906 411
2536 3300048911 Ga0496108_0027851 Ga0496108_0027851_1642_2928 411
2537 3300048911 Ga0496108_0047343 Ga0496108_0047343_1137_2420 411
2538 3300048912 Ga0496109_0005690 Ga0496109_0005690_444_1727 411
2539 3300048912 Ga0496109_0025359 Ga0496109_0025359_2639_3937 411
2540 3300048913 Ga0496110_0007215 Ga0496110_0007215_6049_7341 411
2541 3300048913 Ga0496110_0043177 Ga0496110_0043177_1918_3201 411
2542 3300048913 Ga0496110_0043511 Ga0496110_0043511_1429_2742 411
2543 3300048913 Ga0496110_0045002 Ga0496110_0045002_1074_2372 411
2544 3300048913 Ga0496110_0101204 Ga0496110_0101204_57_1334 411
2545 3300048914 Ga0496111_0009069 Ga0496111_0009069_1643_2926 411
2546 3300048914 Ga0496111_0069931 Ga0496111_0069931_1104_2342 411
2547 3300048915 Ga0496112_0000015 Ga0496112_0000015_13534_14826 411
2548 3300048915 Ga0496112_0002924 Ga0496112_0002924_6673_7956 411
2549 3300048915 Ga0496112_0012837 Ga0496112_0012837_5626_6939 411
2550 3300048915 Ga0496112_0023921 Ga0496112_0023921_2240_3538 411
2551 3300048915 Ga0496112_0037020 Ga0496112_0037020_1928_3220 411
2552 3300048915 Ga0496112_0158369 Ga0496112_0158369_904_2181 411
2553 3300048916 Ga0496113_0005719 Ga0496113_0005719_5060_6343 411
2554 3300048916 Ga0496113_0104622 Ga0496113_0104622_198_1484 411
2555 3300048917 Ga0496114_0002873 Ga0496114_0002873_1134_2417 411
2556 3300048917 Ga0496114_0190488 Ga0496114_0190488_243_1532 411
2557 3300048918 Ga0496115_0001012 Ga0496115_0001012_7607_8890 411
2558 3300048918 Ga0496115_0007765 Ga0496115_0007765_150_1424 411
2559 3300048918 Ga0496115_0121284 Ga0496115_0121284_83_1360 411
2560 3300048918 Ga0496115_0266918 Ga0496115_0266918_14_1273 411
2561 3300048920 Ga0496117_0014441 Ga0496117_0014441_5471_6763 411
2562 3300048921 Ga0496118_0013833 Ga0496118_0013833_83_1375 411
2563 3300048921 Ga0496118_0064361 Ga0496118_0064361_206_1489 411
2564 3300048922 Ga0496119_0000483 Ga0496119_0000483_31970_33268 411
2565 3300048922 Ga0496119_0019218 Ga0496119_0019218_1825_3108 411
2566 3300048923 Ga0496120_0021409 Ga0496120_0021409_2590_3873 411
2567 3300048923 Ga0496120_0086695 Ga0496120_0086695_271_1554 411
2568 3300048924 Ga0496121_0005291 Ga0496121_0005291_9733_11025 411
2569 3300048924 Ga0496121_0010238 Ga0496121_0010238_1937_3220 411
2570 3300048924 Ga0496121_0022569 Ga0496121_0022569_4623_5912 411
2571 3300048925 Ga0496122_0026121 Ga0496122_0026121_3308_4591 411
2572 3300048925 Ga0496122_0130036 Ga0496122_0130036_53_1369 411
2573 3300048926 Ga0496123_0023676 Ga0496123_0023676_2506_3789 411
2574 3300048928 Ga0496125_0004399 Ga0496125_0004399_14376_15659 411
2575 3300048928 Ga0496125_0034144 Ga0496125_0034144_2268_3551 411
2576 3300048929 Ga0496126_0010756 Ga0496126_0010756_2018_3301 411
2577 3300048929 Ga0496126_0016310 Ga0496126_0016310_1348_2637 411
2578 3300048929 Ga0496126_0040027 Ga0496126_0040027_2659_3945 411
2579 3300048929 Ga0496126_0044458 Ga0496126_0044458_149_1432 411
2580 3300048929 Ga0496126_0061667 Ga0496126_0061667_1842_3137 411
2581 3300048929 Ga0496126_0067841 Ga0496126_0067841_60_1352 411
2582 3300048929 Ga0496126_0079093 Ga0496126_0079093_223_1512 411
2583 3300048929 Ga0496126_0105376 Ga0496126_0105376_417_1700 411
2584 3300048929 Ga0496126_0108834 Ga0496126_0108834_385_1674 411
2585 3300048929 Ga0496126_0121679 Ga0496126_0121679_914_2230 411
2586 3300049459 Ga0495678_000439 Ga0495678_000439_29170_30462 411
2587 3300049568 Ga0501031_0000598 Ga0501031_0000598_13482_14765 411
2588 3300049568 Ga0501031_0092239 Ga0501031_0092239_129_1424 411
2589 3300049569 Ga0501032_0000150 Ga0501032_0000150_25756_27039 411
2590 3300049569 Ga0501032_0053013 Ga0501032_0053013_640_1959 411
2591 3300049569 Ga0501032_0133515 Ga0501032_0133515_26_1318 411
2592 3300049570 Ga0501033_0000075 Ga0501033_0000075_552_1835 411
2593 3300049570 Ga0501033_0015297 Ga0501033_0015297_2919_4169 411
2594 3300049570 Ga0501033_0042182 Ga0501033_0042182_1519_2805 411
2595 3300049570 Ga0501033_0050348 Ga0501033_0050348_26_1318 411
2596 3300049570 Ga0501033_0062452 Ga0501033_0062452_615_1901 411
2597 3300049570 Ga0501033_0171390 Ga0501033_0171390_249_1544 411
2598 3300049571 Ga0501034_0000113 Ga0501034_0000113_33275_34558 411
2599 3300049571 Ga0501034_0090948 Ga0501034_0090948_124_1419 411
2600 3300049571 Ga0501034_0380588 Ga0501034_0380588_34_1320 411
2601 3300049572 Ga0501036_0000059 Ga0501036_0000059_1593_2876 411
2602 3300049572 Ga0501036_0040701 Ga0501036_0040701_2613_3905 411
2603 3300049572 Ga0501036_0060519 Ga0501036_0060519_741_2027 411
2604 3300049572 Ga0501036_0134891 Ga0501036_0134891_493_1788 411
2605 3300049573 Ga0501037_0002854 Ga0501037_0002854_6765_8048 411
2606 3300049573 Ga0501037_0082799 Ga0501037_0082799_819_2111 411
2607 3300049574 Ga0501038_0000580 Ga0501038_0000580_8484_9767 411
2608 3300049574 Ga0501038_0012461 Ga0501038_0012461_162_1454 411
2609 3300049574 Ga0501038_0080561 Ga0501038_0080561_604_1896 411
2610 3300049574 Ga0501038_0193283 Ga0501038_0193283_26_1318 411
2611 3300049575 Ga0501039_0000067 Ga0501039_0000067_54798_56081 411
2612 3300049575 Ga0501039_0201549 Ga0501039_0201549_88_1380 411
2613 3300049576 Ga0501040_0149937 Ga0501040_0149937_150_1433 411
2614 3300049578 Ga0501042_0028811 Ga0501042_0028811_1176_2468 411
2615 3300049578 Ga0501042_0045522 Ga0501042_0045522_444_1727 411
2616 3300049579 Ga0501043_0000017 Ga0501043_0000017_62555_63838 411
2617 3300049579 Ga0501043_0211370 Ga0501043_0211370_184_1470 411
2618 3300049580 Ga0501046_0000838 Ga0501046_0000838_25821_27104 411
2619 3300049580 Ga0501046_0043027 Ga0501046_0043027_2132_3424 411
2620 3300049581 Ga0501047_0000181 Ga0501047_0000181_32675_33958 411
2621 3300049581 Ga0501047_0003718 Ga0501047_0003718_9163_10452 411
2622 3300049582 Ga0501048_0000071 Ga0501048_0000071_47699_48982 411
2623 3300049582 Ga0501048_0029448 Ga0501048_0029448_1821_3113 411
2624 3300049583 Ga0501067_0000196 Ga0501067_0000196_5142_6425 411
2625 3300049583 Ga0501067_0020429 Ga0501067_0020429_733_2025 411
2626 3300049584 Ga0501068_0000210 Ga0501068_0000210_8194_9477 411
2627 3300049584 Ga0501068_0077121 Ga0501068_0077121_351_1643 411
2628 3300049584 Ga0501068_0111971 Ga0501068_0111971_126_1421 411
2629 3300049585 Ga0501069_0008631 Ga0501069_0008631_2521_3804 411
2630 3300049585 Ga0501069_0025052 Ga0501069_0025052_1631_2926 411
2631 3300049586 Ga0501070_0002397 Ga0501070_0002397_10570_11853 411
2632 3300049586 Ga0501070_0003457 Ga0501070_0003457_6092_7381 411
2633 3300049586 Ga0501070_0053253 Ga0501070_0053253_130_1422 411
2634 3300049586 Ga0501070_0146274 Ga0501070_0146274_163_1458 411
2635 3300049586 Ga0501070_0268234 Ga0501070_0268234_20_1312 411
2636 3300049587 Ga0501071_0069793 Ga0501071_0069793_1227_2519 411
2637 3300049587 Ga0501071_0074257 Ga0501071_0074257_664_1959 411
2638 3300049588 Ga0501072_0000275 Ga0501072_0000275_28327_29610 411
2639 3300049588 Ga0501072_0082328 Ga0501072_0082328_1104_2423 411
2640 3300049589 Ga0501073_0000054 Ga0501073_0000054_52817_54100 411
2641 3300049590 Ga0501074_0000073 Ga0501074_0000073_13948_15231 411
2642 3300049590 Ga0501074_0001376 Ga0501074_0001376_12402_13694 411
2643 3300049590 Ga0501074_0047669 Ga0501074_0047669_1466_2761 411
2644 3300049591 Ga0501075_0148363 Ga0501075_0148363_85_1377 411
2645 3300049593 Ga0501077_0107859 Ga0501077_0107859_446_1738 411
2646 3300049741 Ga0501079_0136163 Ga0501079_0136163_283_1575 411
2647 3300049742 Ga0501080_0000146 Ga0501080_0000146_37904_39187 411
2648 3300049742 Ga0501080_0099518 Ga0501080_0099518_1027_2316 411
2649 3300049742 Ga0501080_0199432 Ga0501080_0199432_272_1591 411
2650 3300049744 Ga0501083_0136610 Ga0501083_0136610_141_1433 411
2651 3300049822 Ga0501035_0000490 Ga0501035_0000490_18446_19729 411
2652 3300049822 Ga0501035_0030849 Ga0501035_0030849_1166_2458 411
2653 3300049822 Ga0501035_0104108 Ga0501035_0104108_574_1860 411
2654 3300049823 Ga0501044_0000387 Ga0501044_0000387_39499_40782 411
2655 3300049823 Ga0501044_0034204 Ga0501044_0034204_577_1863 411
2656 3300049823 Ga0501044_0037446 Ga0501044_0037446_328_1617 411
2657 3300049824 Ga0501045_0004468 Ga0501045_0004468_906_2189 411
2658 3300049824 Ga0501045_0011682 Ga0501045_0011682_311_1603 411
2659 3300050489 nmdc:mga03683_13882_c1 nmdc:mga03683_13882_c1_861_2138 411
2660 3300050490 nmdc:mga03n38_9629_c1 nmdc:mga03n38_9629_c1_1082_2365 411
2661 3300050491 nmdc:mga00v17_3261_c1 nmdc:mga00v17_3261_c1_484_1785 411
2662 3300050492 nmdc:mga0yw44_123974_c1 nmdc:mga0yw44_123974_c1_168_1451 411
2663 3300050492 nmdc:mga0yw44_126820_c1 nmdc:mga0yw44_126820_c1_311_1597 411
2664 3300050492 nmdc:mga0yw44_7017_c1 nmdc:mga0yw44_7017_c1_1515_2801 411
2665 3300050494 nmdc:mga06z11_2960_c1 nmdc:mga06z11_2960_c1_2167_3444 411
2666 3300050494 nmdc:mga06z11_45125_c1 nmdc:mga06z11_45125_c1_154_1440 411
2667 3300050496 nmdc:mga07m45_67920_c1 nmdc:mga07m45_67920_c1_722_2008 411
2668 3300050515 nmdc:mga0a205_245107_c1 nmdc:mga0a205_245107_c1_309_1592 411
2669 3300050516 nmdc:mga0sz30_10494_c2 nmdc:mga0sz30_10494_c2_773_2056 411
2670 3300053077 Ga0495601_0038526 Ga0495601_0038526_1397_2677 411
2671 3300053078 Ga0495612_0025146 Ga0495612_0025146_270_1550 411
2672 3300053080 Ga0500635_0003829 Ga0500635_0003829_297_1589 411
2673 3300053085 Ga0495619_0117223 Ga0495619_0117223_371_1657 411
2674 3300053085 Ga0495619_0140692 Ga0495619_0140692_179_1459 411
2675 3300053087 Ga0500643_000163 Ga0500643_000163_52210_53493 411
2676 3300053088 Ga0500644_0000906 Ga0500644_0000906_1163_2398 411
2677 3300053093 Ga0500651_0017521 Ga0500651_0017521_140_1432 411
2678 3300053094 Ga0500566_0000224 Ga0500566_0000224_18413_19696 411
2679 3300053094 Ga0500566_0001842 Ga0500566_0001842_8495_9778 411
2680 3300053096 Ga0500641_0002780 Ga0500641_0002780_1608_2891 411
2681 3300053096 Ga0500641_0028806 Ga0500641_0028806_269_1555 411
2682 3300053098 Ga0500650_0016778 Ga0500650_0016778_1114_2397 411
2683 3300053102 Ga0500554_002504 Ga0500554_002504_948_2234 411
2684 3300053102 Ga0500554_005943 Ga0500554_005943_838_2130 411
2685 3300053103 Ga0500555_011139 Ga0500555_011139_666_1949 411
2686 3300053104 Ga0500556_0000012 Ga0500556_0000012_191961_193244 411
2687 3300053105 Ga0500557_000051 Ga0500557_000051_17872_19155 411
2688 3300053111 Ga0500572_001135 Ga0500572_001135_5736_7022 411
2689 3300053111 Ga0500572_002711 Ga0500572_002711_1728_3017 411
2690 3300053116 Ga0500592_001911 Ga0500592_001911_297_1580 411
2691 3300053119 Ga0500595_000001 Ga0500595_000001_1068127_1069383 411
2692 3300053119 Ga0500595_002517 Ga0500595_002517_6276_7562 411
2693 3300053119 Ga0500595_005235 Ga0500595_005235_653_1945 411
2694 3300053119 Ga0500595_006254 Ga0500595_006254_1539_2825 411
2695 3300053125 Ga0500618_003481 Ga0500618_003481_564_1847 411
2696 3300053130 Ga0500642_0000055 Ga0500642_0000055_36968_38251 411
2697 3300053130 Ga0500642_0000117 Ga0500642_0000117_16360_17643 411
2698 3300053130 Ga0500642_0002359 Ga0500642_0002359_2274_3566 411
2699 3300053131 Ga0500652_000373 Ga0500652_000373_6344_7627 411
2700 3300053136 Ga0500559_0000250 Ga0500559_0000250_13959_15245 411
2701 3300053136 Ga0500559_0000268 Ga0500559_0000268_19703_20986 411
2702 3300053142 Ga0500577_0001415 Ga0500577_0001415_2342_3631 411
2703 3300053147 Ga0500589_013937 Ga0500589_013937_1477_2763 411
2704 3300053147 Ga0500589_065591 Ga0500589_065591_327_1610 411
2705 3300053151 Ga0500604_0010046 Ga0500604_0010046_832_2115 411
2706 3300053153 Ga0500616_0000001 Ga0500616_0000001_921011_922246 411
2707 3300053153 Ga0500616_0000035 Ga0500616_0000035_189949_191232 411
2708 3300053153 Ga0500616_0054873 Ga0500616_0054873_445_1680 411
2709 3300053156 Ga0500622_0001833 Ga0500622_0001833_1732_3015 411
2710 3300053162 Ga0500638_001565 Ga0500638_001565_3832_5118 411
2711 3300053162 Ga0500638_038767 Ga0500638_038767_547_1830 411
2712 3300053177 Ga0500636_0000330 Ga0500636_0000330_5291_6574 411
2713 3300053177 Ga0500636_0008037 Ga0500636_0008037_3681_4964 411
2714 3300053177 Ga0500636_0023913 Ga0500636_0023913_1355_2647 411
2715 3300053178 Ga0500637_0000029 Ga0500637_0000029_23847_25133 411
2716 3300053722 Ga0500649_027540 Ga0500649_027540_602_1885 411
2717 3300053730 Ga0500645_001608 Ga0500645_001608_3435_4670 411
2718 3300053736 Ga0500599_003111 Ga0500599_003111_713_1996 411
2719 3300054114 Ga0501084_0001213 Ga0501084_0001213_14196_15479 411
2720 3300055283 Ga0500661_000146 Ga0500661_000146_3378_4664 411
2721 3300060353 Ga0501082_0006956 Ga0501082_0006956_950_2233 411
2722 3300060353 Ga0501082_0059691 Ga0501082_0059691_1673_2965 411
2723 iso_pu_bacteria 2751185800 2753360237 411
2724 iso_pu_bacteria 2758568016 2758642556 411
2725 iso_pu_bacteria 2889306138 2889310033 411
2726 iso_pu_bacteria 2928125067 2928129604 411
2727 3300005328 Ga0070676_10123609 Ga0070676_101236091 412
2728 3300005331 Ga0070670_100012349 Ga0070670_1000123497 412
2729 3300005340 Ga0070689_100033578 Ga0070689_1000335783 412
2730 3300005340 Ga0070689_100104347 Ga0070689_1001043472 412
2731 3300005340 Ga0070689_100153105 Ga0070689_1001531051 412
2732 3300005343 Ga0070687_100006064 Ga0070687_1000060644 412
2733 3300005354 Ga0070675_100234284 Ga0070675_1002342841 412
2734 3300005356 Ga0070674_100092501 Ga0070674_1000925012 412
2735 3300005364 Ga0070673_100273055 Ga0070673_1002730551 412
2736 3300005365 Ga0070688_100004421 Ga0070688_1000044218 412
2737 3300005365 Ga0070688_100066334 Ga0070688_1000663341 412
2738 3300005366 Ga0070659_100036270 Ga0070659_1000362704 412
2739 3300005367 Ga0070667_100033624 Ga0070667_1000336244 412
2740 3300005435 Ga0070714_100110299 Ga0070714_1001102992 412
2741 3300005436 Ga0070713_100005168 Ga0070713_1000051687 412
2742 3300005436 Ga0070713_100083304 Ga0070713_1000833042 412
2743 3300005441 Ga0070700_100016266 Ga0070700_1000162663 412
2744 3300005445 Ga0070708_100031035 Ga0070708_1000310355 412
2745 3300005457 Ga0070662_100243701 Ga0070662_1002437011 412
2746 3300005458 Ga0070681_10030392 Ga0070681_100303924 412
2747 3300005466 Ga0070685_10006291 Ga0070685_100062914 412
2748 3300005518 Ga0070699_100109575 Ga0070699_1001095753 412
2749 3300005530 Ga0070679_100158535 Ga0070679_1001585352 412
2750 3300005530 Ga0070679_100207363 Ga0070679_1002073632 412
2751 3300005547 Ga0070693_100099171 Ga0070693_1000991711 412
2752 3300005564 Ga0070664_100177561 Ga0070664_1001775611 412
2753 3300005615 Ga0070702_100045405 Ga0070702_1000454052 412
2754 3300005617 Ga0068859_100112114 Ga0068859_1001121142 412
2755 3300005618 Ga0068864_100238949 Ga0068864_1002389491 412
2756 3300005718 Ga0068866_10068565 Ga0068866_100685651 412
2757 3300005719 Ga0068861_100032768 Ga0068861_1000327681 412
2758 3300005834 Ga0068851_10038908 Ga0068851_100389082 412
2759 3300005840 Ga0068870_10035153 Ga0068870_100351533 412
2760 3300005841 Ga0068863_100022927 Ga0068863_1000229273 412
2761 3300005843 Ga0068860_100052879 Ga0068860_1000528792 412
2762 3300005937 Ga0081455_10001108 Ga0081455_1000110821 412
2763 3300005937 Ga0081455_10012343 Ga0081455_1001234310 412
2764 3300005937 Ga0081455_10037372 Ga0081455_100373723 412
2765 3300005937 Ga0081455_10069942 Ga0081455_100699423 412
2766 3300005983 Ga0081540_1008051 Ga0081540_10080513 412
2767 3300005983 Ga0081540_1042547 Ga0081540_10425473 412
2768 3300006028 Ga0070717_10297275 Ga0070717_102972751 412
2769 3300006038 Ga0075365_10004337 Ga0075365_100043378 412
2770 3300006038 Ga0075365_10175711 Ga0075365_101757112 412
2771 3300006048 Ga0075363_100114436 Ga0075363_1001144361 412
2772 3300006163 Ga0070715_10078485 Ga0070715_100784851 412
2773 3300006175 Ga0070712_100001745 Ga0070712_1000017456 412
2774 3300006178 Ga0075367_10011888 Ga0075367_100118885 412
2775 3300006178 Ga0075367_10015553 Ga0075367_100155533 412
2776 3300006195 Ga0075366_10010703 Ga0075366_100107033 412
2777 3300006844 Ga0075428_100161345 Ga0075428_1001613452 412
2778 3300006846 Ga0075430_100000163 Ga0075430_10000016343 412
2779 3300006871 Ga0075434_100022014 Ga0075434_1000220142 412
2780 3300006871 Ga0075434_100024327 Ga0075434_1000243271 412
2781 3300006871 Ga0075434_100039048 Ga0075434_1000390483 412
2782 3300006871 Ga0075434_100040777 Ga0075434_1000407774 412
2783 3300006931 Ga0097620_100112111 Ga0097620_1001121112 412
2784 3300007076 Ga0075435_100019992 Ga0075435_1000199924 412
2785 3300007265 Ga0099794_10010756 Ga0099794_100107564 412
2786 3300007265 Ga0099794_10022333 Ga0099794_100223331 412
2787 3300007788 Ga0099795_10000833 Ga0099795_100008336 412
2788 3300009094 Ga0111539_10057903 Ga0111539_100579032 412
2789 3300009094 Ga0111539_10159696 Ga0111539_101596962 412
2790 3300009147 Ga0114129_10003018 Ga0114129_100030183 412
2791 3300009148 Ga0105243_10064941 Ga0105243_100649411 412
2792 3300010159 Ga0099796_10015517 Ga0099796_100155174 412
2793 3300013296 Ga0157374_10223538 Ga0157374_102235381 412
2794 3300013306 Ga0163162_10284854 Ga0163162_102848543 412
2795 3300021377 Ga0213874_10011993 Ga0213874_100119932 412
2796 3300021388 Ga0213875_10018859 Ga0213875_100188593 412
2797 3300025297 Ga0209758_1003339 Ga0209758_10033396 412
2798 3300025321 Ga0207656_10034179 Ga0207656_100341792 412
2799 3300025901 Ga0207688_10001807 Ga0207688_100018072 412
2800 3300025903 Ga0207680_10046288 Ga0207680_100462882 412
2801 3300025905 Ga0207685_10001890 Ga0207685_100018903 412
2802 3300025905 Ga0207685_10021800 Ga0207685_100218001 412
2803 3300025907 Ga0207645_10097113 Ga0207645_100971132 412
2804 3300025908 Ga0207643_10006932 Ga0207643_100069321 412
2805 3300025912 Ga0207707_10043837 Ga0207707_100438373 412
2806 3300025915 Ga0207693_10002389 Ga0207693_1000238915 412
2807 3300025915 Ga0207693_10004047 Ga0207693_1000404711 412
2808 3300025915 Ga0207693_10006151 Ga0207693_100061515 412
2809 3300025918 Ga0207662_10018022 Ga0207662_100180223 412
2810 3300025919 Ga0207657_10084964 Ga0207657_100849642 412
2811 3300025920 Ga0207649_10027301 Ga0207649_100273013 412
2812 3300025923 Ga0207681_10092740 Ga0207681_100927402 412
2813 3300025925 Ga0207650_10061739 Ga0207650_100617392 412
2814 3300025926 Ga0207659_10247041 Ga0207659_102470411 412
2815 3300025927 Ga0207687_10128977 Ga0207687_101289771 412
2816 3300025928 Ga0207700_10013652 Ga0207700_100136523 412
2817 3300025931 Ga0207644_10047954 Ga0207644_100479543 412
2818 3300025933 Ga0207706_10099499 Ga0207706_100994993 412
2819 3300025936 Ga0207670_10001838 Ga0207670_1000183810 412
2820 3300025936 Ga0207670_10198741 Ga0207670_101987411 412
2821 3300025940 Ga0207691_10023057 Ga0207691_100230574 412
2822 3300025942 Ga0207689_10034313 Ga0207689_100343134 412
2823 3300025961 Ga0207712_10204016 Ga0207712_102040161 412
2824 3300026023 Ga0207677_10056707 Ga0207677_100567072 412
2825 3300026067 Ga0207678_10026652 Ga0207678_100266524 412
2826 3300026075 Ga0207708_10018519 Ga0207708_100185192 412
2827 3300026088 Ga0207641_10239973 Ga0207641_102399732 412
2828 3300026089 Ga0207648_10011963 Ga0207648_100119635 412
2829 3300026095 Ga0207676_10146632 Ga0207676_101466322 412
2830 3300026095 Ga0207676_10303120 Ga0207676_103031202 412
2831 3300026118 Ga0207675_100048218 Ga0207675_1000482181 412
2832 3300028381 Ga0268264_10020186 Ga0268264_100201863 412
2833 3300031249 Ga0265339_10081348 Ga0265339_100813481 412
2834 3300031595 Ga0265313_10001715 Ga0265313_1000171516 412
2835 3300031595 Ga0265313_10020357 Ga0265313_100203574 412
2836 3300031616 Ga0307508_10052241 Ga0307508_100522412 412
2837 3300035116 Ga0373945_0008561 Ga0373945_0008561_384_1637 412
2838 3300035116 Ga0373945_0049866 Ga0373945_0049866_258_1511 412
2839 3300035170 Ga0373943_0000193 Ga0373943_0000193_6364_7662 412
2840 3300035171 Ga0373946_0003060 Ga0373946_0003060_2774_4072 412
2841 3300035172 Ga0373955_0091788 Ga0373955_0091788_443_1696 412
2842 3300035241 Ga0373961_0004127 Ga0373961_0004127_1125_2387 412
2843 3300035410 Ga0373924_0021352 Ga0373924_0021352_499_1758 412
2844 3300035692 Ga0373935_0011008 Ga0373935_0011008_1618_2916 412
2845 3300035692 Ga0373935_0093570 Ga0373935_0093570_479_1732 412
2846 3300035692 Ga0373935_0185454 Ga0373935_0185454_152_1405 412
2847 3300035695 Ga0373927_0003709 Ga0373927_0003709_2774_4072 412
2848 3300035695 Ga0373927_0037323 Ga0373927_0037323_1754_3022 412
2849 3300035695 Ga0373927_0106518 Ga0373927_0106518_100_1353 412
2850 3300035724 Ga0373933_0114124 Ga0373933_0114124_325_1578 412
2851 3300035725 Ga0373947_0000076 Ga0373947_0000076_30297_31595 412
2852 3300035725 Ga0373947_0127385 Ga0373947_0127385_116_1405 412
2853 3300036401 Ga0373937_0001940 Ga0373937_0001940_8611_9864 412
2854 3300037068 Ga0373925_0005607 Ga0373925_0005607_3164_4462 412
2855 3300037466 Ga0395898_0233200 Ga0395898_0233200_114_1367 412
2856 3300037853 Ga0436364_0249156 Ga0436364_0249156_5065_6396 412
2857 3300039437 Ga0436365_0800699 Ga0436365_0800699_1993_3324 412
2858 3300039437 Ga0436365_1213591 Ga0436365_1213591_129_1382 412
2859 3300039447 Ga0436361_0641333 Ga0436361_0641333_808_2061 412
2860 3300039453 Ga0436362_1277031 Ga0436362_1277031_883_2214 412
2861 3300041408 Ga0439453_0002197 Ga0439453_0002197_1311_2564 412
2862 3300044735 Ga0466968_0045456 Ga0466968_0045456_103_1353 412
2863 3300046455 Ga0495603_0034454 Ga0495603_0034454_193_1446 412
2864 3300046459 Ga0495629_0020215 Ga0495629_0020215_3127_4380 412
2865 3300046459 Ga0495629_0190849 Ga0495629_0190849_57_1310 412
2866 3300046461 Ga0495641_0010843 Ga0495641_0010843_2399_3652 412
2867 3300046463 Ga0495653_0130924 Ga0495653_0130924_427_1668 412
2868 3300046472 Ga0495580_0148683 Ga0495580_0148683_119_1417 412
2869 3300046514 Ga0495618_0098373 Ga0495618_0098373_46_1299 412
2870 3300046517 Ga0495630_0024068 Ga0495630_0024068_616_1905 412
2871 3300046518 Ga0495631_0048290 Ga0495631_0048290_304_1557 412
2872 3300046526 Ga0495666_0008457 Ga0495666_0008457_100_1398 412
2873 3300046529 Ga0495652_0039570 Ga0495652_0039570_2439_3728 412
2874 3300046531 Ga0495665_0089653 Ga0495665_0089653_171_1424 412
2875 3300046533 Ga0495640_0033195 Ga0495640_0033195_36_1289 412
2876 3300046533 Ga0495640_0043960 Ga0495640_0043960_551_1804 412
2877 3300046543 Ga0495645_0097767 Ga0495645_0097767_21_1310 412
2878 3300046559 Ga0495667_0017614 Ga0495667_0017614_2785_4026 412
2879 3300046642 Ga0495634_0012404 Ga0495634_0012404_2803_4101 412
2880 3300046663 Ga0495635_0025607 Ga0495635_0025607_895_2136 412
2881 3300046689 Ga0495613_0055986 Ga0495613_0055986_477_1730 412
2882 3300046809 Ga0495600_0055342 Ga0495600_0055342_508_1749 412
2883 3300047315 Ga0495581_0029748 Ga0495581_0029748_40_1338 412
2884 3300047319 Ga0495674_0132557 Ga0495674_0132557_790_2043 412
2885 3300047321 Ga0495676_0027874 Ga0495676_0027874_457_1710 412
2886 3300047322 Ga0495680_0047821 Ga0495680_0047821_728_1969 412
2887 3300047471 Ga0495684_0035297 Ga0495684_0035297_555_1853 412
2888 3300047673 Ga0495593_0062052 Ga0495593_0062052_168_1457 412
2889 3300048903 Ga0496100_0011981 Ga0496100_0011981_380_1636 412
2890 3300048903 Ga0496100_0158338 Ga0496100_0158338_176_1429 412
2891 3300048904 Ga0496101_0026708 Ga0496101_0026708_2436_3689 412
2892 3300048904 Ga0496101_0062367 Ga0496101_0062367_641_1894 412
2893 3300048904 Ga0496101_0119052 Ga0496101_0119052_612_1865 412
2894 3300048905 Ga0496102_0126553 Ga0496102_0126553_859_2112 412
2895 3300048906 Ga0496103_0037523 Ga0496103_0037523_780_2033 412
2896 3300048906 Ga0496103_0058356 Ga0496103_0058356_161_1414 412
2897 3300048907 Ga0496104_0000900 Ga0496104_0000900_6313_7566 412
2898 3300048907 Ga0496104_0004221 Ga0496104_0004221_1746_2999 412
2899 3300048907 Ga0496104_0019479 Ga0496104_0019479_163_1416 412
2900 3300048907 Ga0496104_0073044 Ga0496104_0073044_1560_2813 412
2901 3300048908 Ga0496105_0000363 Ga0496105_0000363_23209_24462 412
2902 3300048908 Ga0496105_0024665 Ga0496105_0024665_772_2025 412
2903 3300048908 Ga0496105_0030126 Ga0496105_0030126_201_1454 412
2904 3300048908 Ga0496105_0163028 Ga0496105_0163028_462_1715 412
2905 3300048910 Ga0496107_0003003 Ga0496107_0003003_8161_9414 412
2906 3300048910 Ga0496107_0132191 Ga0496107_0132191_16_1326 412
2907 3300048911 Ga0496108_0000256 Ga0496108_0000256_19782_21035 412
2908 3300048911 Ga0496108_0006129 Ga0496108_0006129_3590_4843 412
2909 3300048912 Ga0496109_0000730 Ga0496109_0000730_4219_5472 412
2910 3300048913 Ga0496110_0022510 Ga0496110_0022510_1247_2500 412
2911 3300048913 Ga0496110_0037247 Ga0496110_0037247_996_2249 412
2912 3300048913 Ga0496110_0121857 Ga0496110_0121857_460_1713 412
2913 3300048914 Ga0496111_0017583 Ga0496111_0017583_128_1381 412
2914 3300048915 Ga0496112_0003013 Ga0496112_0003013_2854_4107 412
2915 3300048916 Ga0496113_0001666 Ga0496113_0001666_2870_4123 412
2916 3300048917 Ga0496114_0104570 Ga0496114_0104570_254_1507 412
2917 3300048918 Ga0496115_0076799 Ga0496115_0076799_819_2093 412
2918 3300048918 Ga0496115_0123878 Ga0496115_0123878_627_1880 412
2919 3300048918 Ga0496115_0231510 Ga0496115_0231510_48_1301 412
2920 3300048924 Ga0496121_0170934 Ga0496121_0170934_226_1497 412
2921 3300048925 Ga0496122_0081963 Ga0496122_0081963_229_1524 412
2922 3300048928 Ga0496125_0000398 Ga0496125_0000398_61672_62967 412
2923 3300048928 Ga0496125_0009727 Ga0496125_0009727_5094_6389 412
2924 3300048929 Ga0496126_0056292 Ga0496126_0056292_51_1346 412
2925 3300049569 Ga0501032_0007475 Ga0501032_0007475_4010_5263 412
2926 3300049571 Ga0501034_0230011 Ga0501034_0230011_461_1702 412
2927 3300049572 Ga0501036_0229654 Ga0501036_0229654_27_1268 412
2928 3300049573 Ga0501037_0026515 Ga0501037_0026515_311_1564 412
2929 3300049573 Ga0501037_0157358 Ga0501037_0157358_188_1501 412
2930 3300049574 Ga0501038_0001565 Ga0501038_0001565_19621_20874 412
2931 3300049575 Ga0501039_0007921 Ga0501039_0007921_4390_5643 412
2932 3300049578 Ga0501042_0099527 Ga0501042_0099527_233_1486 412
2933 3300049579 Ga0501043_0119756 Ga0501043_0119756_41_1354 412
2934 3300049580 Ga0501046_0017926 Ga0501046_0017926_1509_2762 412
2935 3300049582 Ga0501048_0019318 Ga0501048_0019318_2640_3893 412
2936 3300049583 Ga0501067_0012549 Ga0501067_0012549_2470_3723 412
2937 3300049587 Ga0501071_0009884 Ga0501071_0009884_342_1595 412
2938 3300049590 Ga0501074_0018888 Ga0501074_0018888_614_1867 412
2939 3300049741 Ga0501079_0100373 Ga0501079_0100373_138_1391 412
2940 3300049742 Ga0501080_0020553 Ga0501080_0020553_1722_2975 412
2941 3300049744 Ga0501083_0000817 Ga0501083_0000817_7447_8700 412
2942 3300049822 Ga0501035_0009505 Ga0501035_0009505_4116_5429 412
2943 3300049823 Ga0501044_0000509 Ga0501044_0000509_24822_26075 412
2944 3300049823 Ga0501044_0043184 Ga0501044_0043184_1106_2359 412
2945 3300049824 Ga0501045_0109722 Ga0501045_0109722_318_1571 412
2946 3300050491 nmdc:mga00v17_145631_c1 nmdc:mga00v17_145631_c1_237_1505 412
2947 3300050492 nmdc:mga0yw44_154622_c1 nmdc:mga0yw44_154622_c1_170_1423 412
2948 3300050492 nmdc:mga0yw44_35449_c1 nmdc:mga0yw44_35449_c1_451_1704 412
2949 3300050493 nmdc:mga0k408_7846_c1 nmdc:mga0k408_7846_c1_2661_3914 412
2950 3300050494 nmdc:mga06z11_6093_c1 nmdc:mga06z11_6093_c1_3257_4558 412
2951 3300050507 nmdc:mga05p37_101291_c1 nmdc:mga05p37_101291_c1_665_1918 412
2952 3300050507 nmdc:mga05p37_4601_c1 nmdc:mga05p37_4601_c1_10175_11416 412
2953 3300050509 nmdc:mga0qj67_128_c1 nmdc:mga0qj67_128_c1_37264_38517 412
2954 3300050510 nmdc:mga06r32_44334_c1 nmdc:mga06r32_44334_c1_482_1735 412
2955 3300050511 nmdc:mga08y16_31396_c1 nmdc:mga08y16_31396_c1_2837_4090 412
2956 3300050511 nmdc:mga08y16_66128_c1 nmdc:mga08y16_66128_c1_1919_3175 412
2957 3300050512 nmdc:mga0n895_47257_c1 nmdc:mga0n895_47257_c1_1906_3159 412
2958 3300050512 nmdc:mga0n895_47479_c1 nmdc:mga0n895_47479_c1_2642_3895 412
2959 3300050515 nmdc:mga0a205_9319_c2 nmdc:mga0a205_9319_c2_62_1315 412
2960 3300053077 Ga0495601_0000436 Ga0495601_0000436_18888_20129 412
2961 3300053077 Ga0495601_0115923 Ga0495601_0115923_398_1651 412
2962 3300053084 Ga0495595_0008795 Ga0495595_0008795_1357_2598 412
2963 3300053084 Ga0495595_0107725 Ga0495595_0107725_10_1263 412
2964 3300053085 Ga0495619_0000063 Ga0495619_0000063_22257_23498 412
2965 3300053085 Ga0495619_0090750 Ga0495619_0090750_691_1989 412
2966 3300053131 Ga0500652_000023 Ga0500652_000023_65550_66818 412
2967 3300054114 Ga0501084_0025956 Ga0501084_0025956_813_2066 412
2968 3300061734 Ga0530510_0128959 Ga0530510_0128959_546_1799 412
2969 iso_pu_bacteria 2739367655 2739613002 412
2970 iso_pu_bacteria 2887375801 2887378571 412
2971 iso_pu_bacteria 8056875544 8056878301 412
2972 3300003203 JGI25406J46586_10028126 JGI25406J46586_100281261 413
2973 3300005327 Ga0070658_10215013 Ga0070658_102150131 413
2974 3300005328 Ga0070676_10046326 Ga0070676_100463263 413
2975 3300005340 Ga0070689_100086468 Ga0070689_1000864682 413
2976 3300005353 Ga0070669_100179938 Ga0070669_1001799381 413
2977 3300005436 Ga0070713_100152730 Ga0070713_1001527302 413
2978 3300005458 Ga0070681_10078430 Ga0070681_100784303 413
2979 3300005530 Ga0070679_100036379 Ga0070679_1000363793 413
2980 3300005535 Ga0070684_100075729 Ga0070684_1000757292 413
2981 3300005563 Ga0068855_100028788 Ga0068855_1000287881 413
2982 3300005983 Ga0081540_1000453 Ga0081540_100045345 413
2983 3300005985 Ga0081539_10000522 Ga0081539_100005228 413
2984 3300006028 Ga0070717_10314831 Ga0070717_103148311 413
2985 3300006048 Ga0075363_100016408 Ga0075363_1000164084 413
2986 3300006195 Ga0075366_10069535 Ga0075366_100695353 413
2987 3300006846 Ga0075430_100157645 Ga0075430_1001576452 413
2988 3300006914 Ga0075436_100053073 Ga0075436_1000530733 413
2989 3300007076 Ga0075435_100180971 Ga0075435_1001809712 413
2990 3300009553 Ga0105249_10248664 Ga0105249_102486641 413
2991 3300013102 Ga0157371_10055016 Ga0157371_100550162 413
2992 3300013307 Ga0157372_10102896 Ga0157372_101028963 413
2993 3300020070 Ga0206356_11609129 Ga0206356_116091291 413
2994 3300025909 Ga0207705_10063858 Ga0207705_100638582 413
2995 3300025909 Ga0207705_10139317 Ga0207705_101393171 413
2996 3300025912 Ga0207707_10204605 Ga0207707_102046051 413
2997 3300025915 Ga0207693_10097226 Ga0207693_100972262 413
2998 3300025916 Ga0207663_10192919 Ga0207663_101929191 413
2999 3300025921 Ga0207652_10074485 Ga0207652_100744852 413
3000 3300025925 Ga0207650_10005632 Ga0207650_100056328 413
3001 3300025932 Ga0207690_10048542 Ga0207690_100485422 413
3002 3300025936 Ga0207670_10024411 Ga0207670_100244112 413
3003 3300025949 Ga0207667_10019161 Ga0207667_100191617 413
3004 3300025949 Ga0207667_10145332 Ga0207667_101453322 413
3005 3300027512 Ga0209179_1001531 Ga0209179_10015313 413
3006 3300028800 Ga0265338_10100418 Ga0265338_101004182 413
3007 3300028800 Ga0265338_10110723 Ga0265338_101107232 413
3008 3300031238 Ga0265332_10000616 Ga0265332_100006163 413
3009 3300031241 Ga0265325_10031982 Ga0265325_100319822 413
3010 3300031241 Ga0265325_10068660 Ga0265325_100686601 413
3011 3300031247 Ga0265340_10001157 Ga0265340_1000115714 413
3012 3300031249 Ga0265339_10001689 Ga0265339_1000168919 413
3013 3300031595 Ga0265313_10005225 Ga0265313_1000522511 413
3014 3300031712 Ga0265342_10000082 Ga0265342_1000008287 413
3015 3300031712 Ga0265342_10000139 Ga0265342_1000013975 413
3016 3300031712 Ga0265342_10028648 Ga0265342_100286482 413
3017 3300032133 Ga0316583_10001130 Ga0316583_1000113010 413
3018 3300035113 Ga0373936_0000685 Ga0373936_0000685_7562_8818 413
3019 3300035118 Ga0373954_0004003 Ga0373954_0004003_3231_4487 413
3020 3300035118 Ga0373954_0025295 Ga0373954_0025295_254_1537 413
3021 3300035118 Ga0373954_0062050 Ga0373954_0062050_461_1717 413
3022 3300035119 Ga0373956_0027504 Ga0373956_0027504_905_2161 413
3023 3300035120 Ga0373957_0002081 Ga0373957_0002081_2179_3435 413
3024 3300035170 Ga0373943_0009002 Ga0373943_0009002_1708_2964 413
3025 3300035170 Ga0373943_0015415 Ga0373943_0015415_1018_2274 413
3026 3300035171 Ga0373946_0003391 Ga0373946_0003391_3462_4718 413
3027 3300035172 Ga0373955_0020387 Ga0373955_0020387_431_1714 413
3028 3300035172 Ga0373955_0074746 Ga0373955_0074746_482_1738 413
3029 3300035410 Ga0373924_0000735 Ga0373924_0000735_1177_2433 413
3030 3300035410 Ga0373924_0001157 Ga0373924_0001157_4483_5739 413
3031 3300035692 Ga0373935_0000514 Ga0373935_0000514_4840_6096 413
3032 3300035695 Ga0373927_0003594 Ga0373927_0003594_8442_9698 413
3033 3300035695 Ga0373927_0026965 Ga0373927_0026965_1305_2561 413
3034 3300035724 Ga0373933_0000565 Ga0373933_0000565_17201_18457 413
3035 3300035724 Ga0373933_0010982 Ga0373933_0010982_3214_4470 413
3036 3300035724 Ga0373933_0022257 Ga0373933_0022257_289_1572 413
3037 3300035724 Ga0373933_0108205 Ga0373933_0108205_231_1487 413
3038 3300035725 Ga0373947_0003322 Ga0373947_0003322_6584_7840 413
3039 3300036401 Ga0373937_0000005 Ga0373937_0000005_120644_121900 413
3040 3300036401 Ga0373937_0006584 Ga0373937_0006584_6103_7359 413
3041 3300036401 Ga0373937_0186133 Ga0373937_0186133_316_1572 413
3042 3300037068 Ga0373925_0000007 Ga0373925_0000007_78293_79549 413
3043 3300037068 Ga0373925_0120937 Ga0373925_0120937_508_1764 413
3044 3300037312 Ga0395899_0002676 Ga0395899_0002676_13015_14259 413
3045 3300037312 Ga0395899_0048268 Ga0395899_0048268_1714_2961 413
3046 3300037418 Ga0395900_0019554 Ga0395900_0019554_3671_4918 413
3047 3300037418 Ga0395900_0019750 Ga0395900_0019750_3660_4907 413
3048 3300037418 Ga0395900_0026868 Ga0395900_0026868_2065_3309 413
3049 3300037418 Ga0395900_0105359 Ga0395900_0105359_722_1969 413
3050 3300037466 Ga0395898_0023811 Ga0395898_0023811_3207_4454 413
3051 3300037466 Ga0395898_0104048 Ga0395898_0104048_808_2055 413
3052 3300038443 Ga0395901_0026762 Ga0395901_0026762_2883_4130 413
3053 3300038443 Ga0395901_0038318 Ga0395901_0038318_162_1409 413
3054 3300039437 Ga0436365_0479730 Ga0436365_0479730_801_2051 413
3055 3300039437 Ga0436365_1845112 Ga0436365_1845112_429_1688 413
3056 3300044684 Ga0466966_0099309 Ga0466966_0099309_499_1746 413
3057 3300044694 Ga0466963_0004164 Ga0466963_0004164_1608_2855 413
3058 3300044842 Ga0466957_0102611 Ga0466957_0102611_17_1264 413
3059 3300045976 Ga0466967_0012157 Ga0466967_0012157_987_2234 413
3060 3300046454 Ga0495592_0000165 Ga0495592_0000165_22163_23419 413
3061 3300046459 Ga0495629_0001993 Ga0495629_0001993_7965_9221 413
3062 3300046459 Ga0495629_0004630 Ga0495629_0004630_3649_4905 413
3063 3300046460 Ga0495638_0111246 Ga0495638_0111246_218_1474 413
3064 3300046462 Ga0495651_0000136 Ga0495651_0000136_18003_19259 413
3065 3300046462 Ga0495651_0000836 Ga0495651_0000836_12886_14142 413
3066 3300046462 Ga0495651_0138808 Ga0495651_0138808_435_1691 413
3067 3300046463 Ga0495653_0000103 Ga0495653_0000103_46358_47614 413
3068 3300046463 Ga0495653_0001743 Ga0495653_0001743_10331_11587 413
3069 3300046473 Ga0495582_0095002 Ga0495582_0095002_329_1585 413
3070 3300046475 Ga0495639_0013398 Ga0495639_0013398_2128_3384 413
3071 3300046476 Ga0495662_0006646 Ga0495662_0006646_2980_4236 413
3072 3300046477 Ga0495664_0000003 Ga0495664_0000003_480012_481268 413
3073 3300046491 Ga0495584_0005330 Ga0495584_0005330_1134_2390 413
3074 3300046511 Ga0495608_0000072 Ga0495608_0000072_61657_62913 413
3075 3300046511 Ga0495608_0000282 Ga0495608_0000282_30346_31602 413
3076 3300046514 Ga0495618_0000019 Ga0495618_0000019_45179_46435 413
3077 3300046514 Ga0495618_0007700 Ga0495618_0007700_4219_5475 413
3078 3300046516 Ga0495628_0000080 Ga0495628_0000080_22055_23311 413
3079 3300046516 Ga0495628_0057951 Ga0495628_0057951_1079_2335 413
3080 3300046517 Ga0495630_0038629 Ga0495630_0038629_711_1967 413
3081 3300046529 Ga0495652_0000006 Ga0495652_0000006_237485_238741 413
3082 3300046529 Ga0495652_0005586 Ga0495652_0005586_3301_4557 413
3083 3300046529 Ga0495652_0039885 Ga0495652_0039885_1304_2560 413
3084 3300046531 Ga0495665_0024507 Ga0495665_0024507_658_1914 413
3085 3300046533 Ga0495640_0000002 Ga0495640_0000002_424226_425482 413
3086 3300046533 Ga0495640_0001369 Ga0495640_0001369_13243_14499 413
3087 3300046536 Ga0495587_0000001 Ga0495587_0000001_496682_497938 413
3088 3300046536 Ga0495587_0001140 Ga0495587_0001140_2861_4117 413
3089 3300046536 Ga0495587_0010772 Ga0495587_0010772_207_1490 413
3090 3300046536 Ga0495587_0052418 Ga0495587_0052418_824_2080 413
3091 3300046543 Ga0495645_0000284 Ga0495645_0000284_21909_23165 413
3092 3300046559 Ga0495667_0000021 Ga0495667_0000021_101159_102415 413
3093 3300046559 Ga0495667_0000392 Ga0495667_0000392_17410_18666 413
3094 3300046559 Ga0495667_0013071 Ga0495667_0013071_4168_5451 413
3095 3300046559 Ga0495667_0107560 Ga0495667_0107560_228_1484 413
3096 3300046642 Ga0495634_0000396 Ga0495634_0000396_2716_3972 413
3097 3300046642 Ga0495634_0008801 Ga0495634_0008801_5830_7086 413
3098 3300046642 Ga0495634_0114137 Ga0495634_0114137_102_1358 413
3099 3300046663 Ga0495635_0000001 Ga0495635_0000001_482493_483749 413
3100 3300046663 Ga0495635_0001645 Ga0495635_0001645_4751_6007 413
3101 3300046675 Ga0495657_0000088 Ga0495657_0000088_19477_20733 413
3102 3300046675 Ga0495657_0002613 Ga0495657_0002613_10659_11915 413
3103 3300046675 Ga0495657_0045394 Ga0495657_0045394_329_1612 413
3104 3300046678 Ga0495599_0000025 Ga0495599_0000025_96960_98216 413
3105 3300046678 Ga0495599_0002003 Ga0495599_0002003_2376_3632 413
3106 3300046679 Ga0495623_0000058 Ga0495623_0000058_42531_43787 413
3107 3300046679 Ga0495623_0001489 Ga0495623_0001489_10005_11261 413
3108 3300046679 Ga0495623_0039940 Ga0495623_0039940_1413_2669 413
3109 3300046680 Ga0495646_0000003 Ga0495646_0000003_60481_61737 413
3110 3300046689 Ga0495613_0059035 Ga0495613_0059035_1501_2757 413
3111 3300046809 Ga0495600_0000042 Ga0495600_0000042_59638_60894 413
3112 3300046809 Ga0495600_0045335 Ga0495600_0045335_808_2091 413
3113 3300047315 Ga0495581_0117941 Ga0495581_0117941_199_1455 413
3114 3300047317 Ga0495604_0000008 Ga0495604_0000008_22096_23352 413
3115 3300047317 Ga0495604_0000168 Ga0495604_0000168_3663_4919 413
3116 3300047317 Ga0495604_0091587 Ga0495604_0091587_518_1774 413
3117 3300047319 Ga0495674_0000028 Ga0495674_0000028_101287_102543 413
3118 3300047319 Ga0495674_0000573 Ga0495674_0000573_6743_7999 413
3119 3300047322 Ga0495680_0000285 Ga0495680_0000285_17329_18585 413
3120 3300047322 Ga0495680_0000711 Ga0495680_0000711_13981_15237 413
3121 3300047322 Ga0495680_0044275 Ga0495680_0044275_1336_2619 413
3122 3300047322 Ga0495680_0088775 Ga0495680_0088775_316_1572 413
3123 3300047444 Ga0495675_0000511 Ga0495675_0000511_1800_3056 413
3124 3300047444 Ga0495675_0070146 Ga0495675_0070146_159_1415 413
3125 3300047471 Ga0495684_0000002 Ga0495684_0000002_22154_23410 413
3126 3300047471 Ga0495684_0026256 Ga0495684_0026256_1843_3099 413
3127 3300047471 Ga0495684_0179447 Ga0495684_0179447_80_1336 413
3128 3300047673 Ga0495593_0000379 Ga0495593_0000379_2367_3623 413
3129 3300047673 Ga0495593_0093930 Ga0495593_0093930_250_1506 413
3130 3300048088 Ga0495602_0000468 Ga0495602_0000468_22161_23417 413
3131 3300048088 Ga0495602_0002627 Ga0495602_0002627_5668_6924 413
3132 3300048088 Ga0495602_0057794 Ga0495602_0057794_885_2168 413
3133 3300048088 Ga0495602_0086241 Ga0495602_0086241_1134_2390 413
3134 3300048915 Ga0496112_0013962 Ga0496112_0013962_4457_5713 413
3135 3300048929 Ga0496126_0027644 Ga0496126_0027644_781_2052 413
3136 3300049571 Ga0501034_0024599 Ga0501034_0024599_4530_5774 413
3137 3300049581 Ga0501047_0047642 Ga0501047_0047642_2521_3768 413
3138 3300049586 Ga0501070_0084335 Ga0501070_0084335_1281_2618 413
3139 3300049588 Ga0501072_0039495 Ga0501072_0039495_188_1462 413
3140 3300049591 Ga0501075_0174953 Ga0501075_0174953_327_1601 413
3141 3300049592 Ga0501076_0007396 Ga0501076_0007396_926_2200 413
3142 3300049741 Ga0501079_0007319 Ga0501079_0007319_1849_3123 413
3143 3300049741 Ga0501079_0177867 Ga0501079_0177867_155_1411 413
3144 3300049744 Ga0501083_0021039 Ga0501083_0021039_1271_2521 413
3145 3300049822 Ga0501035_0188105 Ga0501035_0188105_99_1367 413
3146 3300049823 Ga0501044_0002617 Ga0501044_0002617_6945_8282 413
3147 3300049823 Ga0501044_0057886 Ga0501044_0057886_162_1499 413
3148 3300050493 nmdc:mga0k408_13090_c1 nmdc:mga0k408_13090_c1_326_1585 413
3149 3300050493 nmdc:mga0k408_30488_c1 nmdc:mga0k408_30488_c1_888_2147 413
3150 3300050496 nmdc:mga07m45_72804_c1 nmdc:mga07m45_72804_c1_474_1733 413
3151 3300050508 nmdc:mga09592_163393_c1 nmdc:mga09592_163393_c1_94_1350 413
3152 3300050509 nmdc:mga0qj67_28496_c1 nmdc:mga0qj67_28496_c1_443_1699 413
3153 3300050510 nmdc:mga06r32_140977_c1 nmdc:mga06r32_140977_c1_454_1710 413
3154 3300050512 nmdc:mga0n895_55742_c1 nmdc:mga0n895_55742_c1_295_1551 413
3155 3300050514 nmdc:mga08x19_55560_c1 nmdc:mga08x19_55560_c1_1029_2297 413
3156 3300053077 Ga0495601_0000001 Ga0495601_0000001_61654_62910 413
3157 3300053077 Ga0495601_0007011 Ga0495601_0007011_1474_2730 413
3158 3300053078 Ga0495612_0000003 Ga0495612_0000003_280195_281451 413
3159 3300053078 Ga0495612_0030780 Ga0495612_0030780_82_1365 413
3160 3300053084 Ga0495595_0003290 Ga0495595_0003290_528_1784 413
3161 3300053085 Ga0495619_0000004 Ga0495619_0000004_61685_62941 413
3162 3300053085 Ga0495619_0000309 Ga0495619_0000309_18530_19786 413
3163 3300053085 Ga0495619_0060005 Ga0495619_0060005_836_2092 413
3164 3300053153 Ga0500616_0021195 Ga0500616_0021195_37_1311 413
3165 3300053153 Ga0500616_0028372 Ga0500616_0028372_1540_2811 413
3166 3300060353 Ga0501082_0000510 Ga0501082_0000510_15810_17069 413
3167 3300005983 Ga0081540_1027256 Ga0081540_10272562 414
3168 3300006914 Ga0075436_100200088 Ga0075436_1002000881 414
3169 3300031241 Ga0265325_10000162 Ga0265325_1000016228 414
3170 3300031595 Ga0265313_10013976 Ga0265313_100139763 414
3171 3300035172 Ga0373955_0023840 Ga0373955_0023840_1250_2497 414
3172 3300036401 Ga0373937_0090634 Ga0373937_0090634_296_1543 414
3173 3300046454 Ga0495592_0000595 Ga0495592_0000595_21764_23011 414
3174 3300046462 Ga0495651_0003936 Ga0495651_0003936_7338_8585 414
3175 3300046463 Ga0495653_0016165 Ga0495653_0016165_4685_5932 414
3176 3300046472 Ga0495580_0160798 Ga0495580_0160798_119_1423 414
3177 3300046516 Ga0495628_0004979 Ga0495628_0004979_10208_11455 414
3178 3300046535 Ga0495586_0064927 Ga0495586_0064927_429_1733 414
3179 3300046543 Ga0495645_0013793 Ga0495645_0013793_3470_4717 414
3180 3300046559 Ga0495667_0003673 Ga0495667_0003673_3869_5116 414
3181 3300046663 Ga0495635_0035758 Ga0495635_0035758_582_1829 414
3182 3300046675 Ga0495657_0020196 Ga0495657_0020196_608_1855 414
3183 3300046678 Ga0495599_0001552 Ga0495599_0001552_6906_8153 414
3184 3300046679 Ga0495623_0033995 Ga0495623_0033995_587_1891 414
3185 3300047317 Ga0495604_0177352 Ga0495604_0177352_162_1445 414
3186 3300047319 Ga0495674_0064963 Ga0495674_0064963_789_2036 414
3187 3300047322 Ga0495680_0023560 Ga0495680_0023560_2108_3355 414
3188 3300048088 Ga0495602_0005586 Ga0495602_0005586_6114_7361 414
3189 3300048907 Ga0496104_0000311 Ga0496104_0000311_5368_6615 414
3190 3300048908 Ga0496105_0004311 Ga0496105_0004311_2941_4188 414
3191 3300053077 Ga0495601_0001359 Ga0495601_0001359_8753_10000 414
3192 3300053078 Ga0495612_0000238 Ga0495612_0000238_1311_2558 414
3193 3300053084 Ga0495595_0000795 Ga0495595_0000795_1062_2309 414
3194 3300053085 Ga0495619_0003766 Ga0495619_0003766_536_1783 414
3195 3300053085 Ga0495619_0123609 Ga0495619_0123609_221_1504 414
3196 iso_pu_bacteria 2884298095 2884301559 414
3197 3300039450 Ga0436363_1497563 Ga0436363_1497563_773_2074 415
3198 3300005344 Ga0070661_100192612 Ga0070661_1001926121 416
3199 3300006852 Ga0075433_10079168 Ga0075433_100791683 416
3200 3300012508 Ga0157315_1000261 Ga0157315_10002613 416
3201 3300025907 Ga0207645_10032413 Ga0207645_100324133 416
3202 3300025986 Ga0207658_10158921 Ga0207658_101589212 416
3203 3300035115 Ga0373941_0010185 Ga0373941_0010185_690_1961 416
3204 3300046473 Ga0495582_0000793 Ga0495582_0000793_8022_9293 416
3205 3300048913 Ga0496110_0074619 Ga0496110_0074619_580_1851 416
3206 3300049571 Ga0501034_0114283 Ga0501034_0114283_636_1916 416
3207 3300005333 Ga0070677_10018292 Ga0070677_100182922 417
3208 3300005340 Ga0070689_100132734 Ga0070689_1001327341 417
3209 3300005343 Ga0070687_100087824 Ga0070687_1000878241 417
3210 3300005435 Ga0070714_100003683 Ga0070714_1000036838 417
3211 3300005441 Ga0070700_100044425 Ga0070700_1000444252 417
3212 3300005444 Ga0070694_100097543 Ga0070694_1000975432 417
3213 3300005445 Ga0070708_100284460 Ga0070708_1002844601 417
3214 3300005468 Ga0070707_100037010 Ga0070707_1000370104 417
3215 3300006058 Ga0075432_10000446 Ga0075432_100004465 417
3216 3300013105 Ga0157369_10235695 Ga0157369_102356952 417
3217 3300025899 Ga0207642_10012285 Ga0207642_100122852 417
3218 3300025918 Ga0207662_10023389 Ga0207662_100233893 417
3219 3300025918 Ga0207662_10075522 Ga0207662_100755222 417
3220 3300025928 Ga0207700_10000499 Ga0207700_1000049910 417
3221 3300025929 Ga0207664_10014099 Ga0207664_100140996 417
3222 3300025939 Ga0207665_10000578 Ga0207665_1000057812 417
3223 3300026118 Ga0207675_100176893 Ga0207675_1001768931 417
3224 3300031711 Ga0265314_10005463 Ga0265314_100054632 417
3225 3300034817 Ga0373948_0001630 Ga0373948_0001630_1315_2601 417
3226 3300035089 Ga0373944_0011824 Ga0373944_0011824_400_1686 417
3227 3300035092 Ga0373952_0007790 Ga0373952_0007790_652_1938 417
3228 3300035121 Ga0373960_0004964 Ga0373960_0004964_949_2223 417
3229 3300035725 Ga0373947_0001894 Ga0373947_0001894_8904_10190 417
3230 3300046452 Ga0495617_004305 Ga0495617_004305_730_2004 417
3231 3300046691 Ga0495670_0000125 Ga0495670_0000125_29963_31237 417
3232 3300048907 Ga0496104_0014512 Ga0496104_0014512_1487_2761 417
3233 3300048917 Ga0496114_0108460 Ga0496114_0108460_674_1960 417
3234 3300048929 Ga0496126_0151904 Ga0496126_0151904_472_1746 417
3235 3300050513 nmdc:mga0rr50_5482_c1 nmdc:mga0rr50_5482_c1_2122_3396 417
3236 3300053084 Ga0495595_0055169 Ga0495595_0055169_11_1297 417
3237 3300035724 Ga0373933_0094322 Ga0373933_0094322_494_1771 418
3238 2209111006 2214939646 2214003028 419
3239 3300000041 ARcpr5oldR_c000422 ARcpr5oldR_0004226 419
3240 3300000042 ARSoilYngRDRAFT_c00290 ARSoilYngRDRAFT_002903 419
3241 3300000044 ARSoilOldRDRAFT_c000309 ARSoilOldRDRAFT_0003093 419
3242 3300000652 ARCol0yngRDRAFT_1000109 ARCol0yngRDRAFT_10001094 419
3243 3300001977 JGI24746J21847_1000682 JGI24746J21847_10006822 419
3244 3300001978 JGI24747J21853_1000356 JGI24747J21853_10003562 419
3245 3300001989 JGI24739J22299_10000366 JGI24739J22299_100003666 419
3246 3300001990 JGI24737J22298_10020002 JGI24737J22298_100200022 419
3247 3300002070 JGI24750J21931_1000233 JGI24750J21931_10002333 419
3248 3300002073 JGI24745J21846_1000067 JGI24745J21846_10000673 419
3249 3300002075 JGI24738J21930_10000230 JGI24738J21930_1000023010 419
3250 3300002126 JGI24035J26624_1004197 JGI24035J26624_10041971 419
3251 3300002155 JGI24033J26618_1000616 JGI24033J26618_10006162 419
3252 3300005289 Ga0065704_10090546 Ga0065704_100905462 419
3253 3300005290 Ga0065712_10068383 Ga0065712_100683831 419
3254 3300005290 Ga0065712_10086212 Ga0065712_100862122 419
3255 3300005293 Ga0065715_10000448 Ga0065715_100004484 419
3256 3300005293 Ga0065715_10016705 Ga0065715_100167052 419
3257 3300005328 Ga0070676_10000318 Ga0070676_100003187 419
3258 3300005329 Ga0070683_100000075 Ga0070683_1000000754 419
3259 3300005330 Ga0070690_100027937 Ga0070690_1000279372 419
3260 3300005330 Ga0070690_100032811 Ga0070690_1000328111 419
3261 3300005331 Ga0070670_100034700 Ga0070670_1000347004 419
3262 3300005334 Ga0068869_100000395 Ga0068869_1000003952 419
3263 3300005335 Ga0070666_10009311 Ga0070666_100093114 419
3264 3300005336 Ga0070680_100001357 Ga0070680_1000013575 419
3265 3300005336 Ga0070680_100173223 Ga0070680_1001732232 419
3266 3300005337 Ga0070682_100000144 Ga0070682_10000014439 419
3267 3300005338 Ga0068868_100011607 Ga0068868_1000116072 419
3268 3300005339 Ga0070660_100001798 Ga0070660_1000017984 419
3269 3300005340 Ga0070689_100000388 Ga0070689_1000003884 419
3270 3300005341 Ga0070691_10000600 Ga0070691_100006007 419
3271 3300005341 Ga0070691_10019727 Ga0070691_100197272 419
3272 3300005341 Ga0070691_10087360 Ga0070691_100873601 419
3273 3300005343 Ga0070687_100000016 Ga0070687_10000001637 419
3274 3300005344 Ga0070661_100000249 Ga0070661_10000024937 419
3275 3300005345 Ga0070692_10003282 Ga0070692_100032824 419
3276 3300005347 Ga0070668_100001568 Ga0070668_1000015683 419
3277 3300005347 Ga0070668_100032024 Ga0070668_1000320244 419
3278 3300005353 Ga0070669_100000145 Ga0070669_1000001453 419
3279 3300005353 Ga0070669_100242768 Ga0070669_1002427681 419
3280 3300005354 Ga0070675_100000081 Ga0070675_10000008137 419
3281 3300005354 Ga0070675_100109969 Ga0070675_1001099691 419
3282 3300005355 Ga0070671_100000144 Ga0070671_10000014418 419
3283 3300005356 Ga0070674_100000102 Ga0070674_1000001029 419
3284 3300005356 Ga0070674_100098257 Ga0070674_1000982571 419
3285 3300005364 Ga0070673_100000068 Ga0070673_10000006826 419
3286 3300005365 Ga0070688_100001094 Ga0070688_1000010941 419
3287 3300005365 Ga0070688_100001524 Ga0070688_1000015244 419
3288 3300005366 Ga0070659_100000144 Ga0070659_10000014437 419
3289 3300005366 Ga0070659_100040574 Ga0070659_1000405742 419
3290 3300005367 Ga0070667_100002536 Ga0070667_1000025361 419
3291 3300005438 Ga0070701_10001040 Ga0070701_100010406 419
3292 3300005440 Ga0070705_100000222 Ga0070705_1000002227 419
3293 3300005441 Ga0070700_100000100 Ga0070700_10000010037 419
3294 3300005441 Ga0070700_100045417 Ga0070700_1000454172 419
3295 3300005444 Ga0070694_100000041 Ga0070694_10000004149 419
3296 3300005444 Ga0070694_100012093 Ga0070694_1000120934 419
3297 3300005445 Ga0070708_100016844 Ga0070708_1000168442 419
3298 3300005455 Ga0070663_100000071 Ga0070663_10000007137 419
3299 3300005455 Ga0070663_100222150 Ga0070663_1002221501 419
3300 3300005456 Ga0070678_100000093 Ga0070678_10000009322 419
3301 3300005457 Ga0070662_100005696 Ga0070662_1000056962 419
3302 3300005457 Ga0070662_100008556 Ga0070662_1000085564 419
3303 3300005458 Ga0070681_10000485 Ga0070681_1000048516 419
3304 3300005458 Ga0070681_10025654 Ga0070681_100256542 419
3305 3300005459 Ga0068867_100021542 Ga0068867_1000215421 419
3306 3300005459 Ga0068867_100028591 Ga0068867_1000285913 419
3307 3300005459 Ga0068867_100180076 Ga0068867_1001800761 419
3308 3300005466 Ga0070685_10000918 Ga0070685_1000091810 419
3309 3300005530 Ga0070679_100053137 Ga0070679_1000531372 419
3310 3300005535 Ga0070684_100000099 Ga0070684_1000000999 419
3311 3300005535 Ga0070684_100128477 Ga0070684_1001284773 419
3312 3300005539 Ga0068853_100044558 Ga0068853_1000445583 419
3313 3300005539 Ga0068853_100099222 Ga0068853_1000992221 419
3314 3300005543 Ga0070672_100000035 Ga0070672_10000003544 419
3315 3300005543 Ga0070672_100018387 Ga0070672_1000183874 419
3316 3300005544 Ga0070686_100000086 Ga0070686_10000008638 419
3317 3300005544 Ga0070686_100038021 Ga0070686_1000380213 419
3318 3300005545 Ga0070695_100000036 Ga0070695_10000003637 419
3319 3300005545 Ga0070695_100013150 Ga0070695_1000131501 419
3320 3300005545 Ga0070695_100017309 Ga0070695_1000173092 419
3321 3300005546 Ga0070696_100033284 Ga0070696_1000332842 419
3322 3300005547 Ga0070693_100075999 Ga0070693_1000759992 419
3323 3300005549 Ga0070704_100000280 Ga0070704_10000028019 419
3324 3300005549 Ga0070704_100011293 Ga0070704_1000112933 419
3325 3300005549 Ga0070704_100099989 Ga0070704_1000999892 419
3326 3300005564 Ga0070664_100000480 Ga0070664_1000004807 419
3327 3300005577 Ga0068857_100001341 Ga0068857_1000013417 419
3328 3300005578 Ga0068854_100003846 Ga0068854_1000038464 419
3329 3300005578 Ga0068854_100240471 Ga0068854_1002404711 419
3330 3300005614 Ga0068856_100002467 Ga0068856_1000024678 419
3331 3300005614 Ga0068856_100235098 Ga0068856_1002350983 419
3332 3300005615 Ga0070702_100010139 Ga0070702_1000101394 419
3333 3300005616 Ga0068852_100000344 Ga0068852_1000003443 419
3334 3300005617 Ga0068859_100005828 Ga0068859_1000058287 419
3335 3300005617 Ga0068859_100020601 Ga0068859_1000206014 419
3336 3300005618 Ga0068864_100005269 Ga0068864_1000052691 419
3337 3300005718 Ga0068866_10000550 Ga0068866_100005502 419
3338 3300005719 Ga0068861_100003527 Ga0068861_1000035271 419
3339 3300005840 Ga0068870_10000439 Ga0068870_100004391 419
3340 3300005841 Ga0068863_100001408 Ga0068863_1000014087 419
3341 3300005842 Ga0068858_100025484 Ga0068858_1000254842 419
3342 3300005842 Ga0068858_100055890 Ga0068858_1000558902 419
3343 3300005842 Ga0068858_100062517 Ga0068858_1000625171 419
3344 3300005843 Ga0068860_100002680 Ga0068860_1000026809 419
3345 3300005844 Ga0068862_100003661 Ga0068862_10000366110 419
3346 3300005937 Ga0081455_10000007 Ga0081455_10000007164 419
3347 3300006178 Ga0075367_10045594 Ga0075367_100455942 419
3348 3300006237 Ga0097621_100000047 Ga0097621_1000000474 419
3349 3300006358 Ga0068871_100000651 Ga0068871_10000065110 419
3350 3300006852 Ga0075433_10001479 Ga0075433_100014792 419
3351 3300006852 Ga0075433_10139267 Ga0075433_101392671 419
3352 3300006871 Ga0075434_100000362 Ga0075434_10000036229 419
3353 3300006881 Ga0068865_100000233 Ga0068865_10000023327 419
3354 3300006881 Ga0068865_100099864 Ga0068865_1000998643 419
3355 3300006931 Ga0097620_100005828 Ga0097620_1000058287 419
3356 3300006931 Ga0097620_100020600 Ga0097620_1000206002 419
3357 3300009094 Ga0111539_10000185 Ga0111539_100001856 419
3358 3300009094 Ga0111539_10002902 Ga0111539_1000290219 419
3359 3300009094 Ga0111539_10127816 Ga0111539_101278162 419
3360 3300009098 Ga0105245_10000213 Ga0105245_1000021350 419
3361 3300009101 Ga0105247_10046261 Ga0105247_100462613 419
3362 3300009148 Ga0105243_10000175 Ga0105243_100001758 419
3363 3300009148 Ga0105243_10007988 Ga0105243_100079882 419
3364 3300009174 Ga0105241_10006537 Ga0105241_100065373 419
3365 3300009177 Ga0105248_10003421 Ga0105248_100034214 419
3366 3300009177 Ga0105248_10010753 Ga0105248_100107535 419
3367 3300009545 Ga0105237_10012841 Ga0105237_100128412 419
3368 3300009553 Ga0105249_10000200 Ga0105249_100002003 419
3369 3300009553 Ga0105249_10041909 Ga0105249_100419093 419
3370 3300010375 Ga0105239_10090150 Ga0105239_100901501 419
3371 3300011119 Ga0105246_10045760 Ga0105246_100457602 419
3372 3300013104 Ga0157370_10117475 Ga0157370_101174751 419
3373 3300013296 Ga0157374_10002304 Ga0157374_100023043 419
3374 3300013297 Ga0157378_10000717 Ga0157378_1000071714 419
3375 3300013306 Ga0163162_10006589 Ga0163162_100065892 419
3376 3300013308 Ga0157375_10000355 Ga0157375_1000035533 419
3377 3300014325 Ga0163163_10004739 Ga0163163_100047397 419
3378 3300014326 Ga0157380_10000166 Ga0157380_1000016630 419
3379 3300014745 Ga0157377_10000207 Ga0157377_1000020716 419
3380 3300014968 Ga0157379_10000036 Ga0157379_1000003654 419
3381 3300014968 Ga0157379_10038245 Ga0157379_100382452 419
3382 3300014969 Ga0157376_10000062 Ga0157376_100000628 419
3383 3300017792 Ga0163161_10001670 Ga0163161_100016703 419
3384 3300025271 Ga0207666_1000029 Ga0207666_10000296 419
3385 3300025290 Ga0207673_1000274 Ga0207673_10002743 419
3386 3300025315 Ga0207697_10000208 Ga0207697_1000020816 419
3387 3300025315 Ga0207697_10008476 Ga0207697_100084762 419
3388 3300025885 Ga0207653_10026121 Ga0207653_100261212 419
3389 3300025893 Ga0207682_10000004 Ga0207682_1000000489 419
3390 3300025899 Ga0207642_10000631 Ga0207642_100006316 419
3391 3300025901 Ga0207688_10000155 Ga0207688_1000015513 419
3392 3300025903 Ga0207680_10000818 Ga0207680_100008182 419
3393 3300025904 Ga0207647_10000681 Ga0207647_100006817 419
3394 3300025907 Ga0207645_10000061 Ga0207645_1000006158 419
3395 3300025908 Ga0207643_10000012 Ga0207643_10000012117 419
3396 3300025911 Ga0207654_10001023 Ga0207654_100010235 419
3397 3300025912 Ga0207707_10000405 Ga0207707_100004056 419
3398 3300025914 Ga0207671_10051369 Ga0207671_100513692 419
3399 3300025917 Ga0207660_10000008 Ga0207660_100000083 419
3400 3300025917 Ga0207660_10167846 Ga0207660_101678462 419
3401 3300025918 Ga0207662_10000196 Ga0207662_100001966 419
3402 3300025919 Ga0207657_10001135 Ga0207657_100011356 419
3403 3300025919 Ga0207657_10029853 Ga0207657_100298532 419
3404 3300025920 Ga0207649_10000491 Ga0207649_1000049112 419
3405 3300025923 Ga0207681_10001185 Ga0207681_100011854 419
3406 3300025923 Ga0207681_10012775 Ga0207681_100127755 419
3407 3300025925 Ga0207650_10006337 Ga0207650_100063373 419
3408 3300025926 Ga0207659_10000023 Ga0207659_100000233 419
3409 3300025926 Ga0207659_10230241 Ga0207659_102302411 419
3410 3300025927 Ga0207687_10001111 Ga0207687_1000111110 419
3411 3300025931 Ga0207644_10000286 Ga0207644_1000028619 419
3412 3300025932 Ga0207690_10000105 Ga0207690_100001059 419
3413 3300025933 Ga0207706_10001378 Ga0207706_1000137813 419
3414 3300025933 Ga0207706_10001736 Ga0207706_1000173615 419
3415 3300025934 Ga0207686_10004085 Ga0207686_100040853 419
3416 3300025935 Ga0207709_10000264 Ga0207709_1000026414 419
3417 3300025935 Ga0207709_10030477 Ga0207709_100304773 419
3418 3300025936 Ga0207670_10000108 Ga0207670_1000010850 419
3419 3300025937 Ga0207669_10000515 Ga0207669_100005153 419
3420 3300025938 Ga0207704_10000535 Ga0207704_100005353 419
3421 3300025940 Ga0207691_10000986 Ga0207691_1000098613 419
3422 3300025942 Ga0207689_10000008 Ga0207689_10000008103 419
3423 3300025944 Ga0207661_10000053 Ga0207661_100000533 419
3424 3300025945 Ga0207679_10000053 Ga0207679_1000005392 419
3425 3300025945 Ga0207679_10141456 Ga0207679_101414562 419
3426 3300025960 Ga0207651_10000052 Ga0207651_1000005239 419
3427 3300025961 Ga0207712_10000317 Ga0207712_100003177 419
3428 3300025972 Ga0207668_10000638 Ga0207668_100006387 419
3429 3300025981 Ga0207640_10000232 Ga0207640_1000023229 419
3430 3300025981 Ga0207640_10029317 Ga0207640_100293172 419
3431 3300025986 Ga0207658_10001329 Ga0207658_100013293 419
3432 3300026023 Ga0207677_10004039 Ga0207677_100040393 419
3433 3300026035 Ga0207703_10004297 Ga0207703_100042977 419
3434 3300026035 Ga0207703_10032924 Ga0207703_100329242 419
3435 3300026041 Ga0207639_10000704 Ga0207639_100007047 419
3436 3300026067 Ga0207678_10000830 Ga0207678_1000083013 419
3437 3300026067 Ga0207678_10017070 Ga0207678_100170703 419
3438 3300026075 Ga0207708_10000581 Ga0207708_100005816 419
3439 3300026075 Ga0207708_10000940 Ga0207708_100009404 419
3440 3300026078 Ga0207702_10000297 Ga0207702_1000029741 419
3441 3300026078 Ga0207702_10234868 Ga0207702_102348681 419
3442 3300026088 Ga0207641_10001618 Ga0207641_100016187 419
3443 3300026089 Ga0207648_10001259 Ga0207648_1000125913 419
3444 3300026089 Ga0207648_10020540 Ga0207648_100205404 419
3445 3300026089 Ga0207648_10154258 Ga0207648_101542581 419
3446 3300026095 Ga0207676_10000182 Ga0207676_1000018231 419
3447 3300026116 Ga0207674_10001329 Ga0207674_1000132916 419
3448 3300026118 Ga0207675_100000924 Ga0207675_1000009248 419
3449 3300026121 Ga0207683_10000006 Ga0207683_100000066 419
3450 3300026142 Ga0207698_10000669 Ga0207698_100006694 419
3451 3300027682 Ga0209971_1004456 Ga0209971_10044562 419
3452 3300027717 Ga0209998_10000772 Ga0209998_100007724 419
3453 3300027717 Ga0209998_10001021 Ga0209998_100010213 419
3454 3300027907 Ga0207428_10000112 Ga0207428_1000011293 419
3455 3300027907 Ga0207428_10015144 Ga0207428_100151443 419
3456 3300028380 Ga0268265_10000257 Ga0268265_100002573 419
3457 3300028381 Ga0268264_10000579 Ga0268264_100005791 419
3458 3300034816 Ga0373930_0000855 Ga0373930_0000855_1145_2404 419
3459 3300034817 Ga0373948_0000427 Ga0373948_0000427_3258_4517 419
3460 3300034818 Ga0373950_0000407 Ga0373950_0000407_3253_4512 419
3461 3300034820 Ga0373959_0001537 Ga0373959_0001537_1371_2630 419
3462 3300034957 Ga0373938_0000284 Ga0373938_0000284_5404_6663 419
3463 3300035084 Ga0373928_0000447 Ga0373928_0000447_4380_5639 419
3464 3300035085 Ga0373929_0000896 Ga0373929_0000896_4166_5425 419
3465 3300035091 Ga0373951_0000431 Ga0373951_0000431_4031_5290 419
3466 3300035092 Ga0373952_0003885 Ga0373952_0003885_1226_2485 419
3467 3300035114 Ga0373939_0001568 Ga0373939_0001568_1050_2309 419
3468 3300035115 Ga0373941_0007351 Ga0373941_0007351_637_1896 419
3469 3300035120 Ga0373957_0000707 Ga0373957_0000707_3504_4784 419
3470 3300035207 Ga0373942_0001043 Ga0373942_0001043_5510_6769 419
3471 3300035241 Ga0373961_0001729 Ga0373961_0001729_1966_3225 419
3472 3300035691 Ga0373931_0003796 Ga0373931_0003796_1723_2982 419
3473 3300042439 Ga0439464_0009999 Ga0439464_0009999_702_1964 419
3474 3300042876 Ga0451577_0115420 Ga0451577_0115420_583_1842 419
3475 3300045051 Ga0451576_0018100 Ga0451576_0018100_3569_4828 419
3476 3300048907 Ga0496104_0142135 Ga0496104_0142135_248_1510 419
3477 3300048909 Ga0496106_0169976 Ga0496106_0169976_177_1436 419
3478 3300048910 Ga0496107_0104427 Ga0496107_0104427_128_1387 419
3479 3300048912 Ga0496109_0001475 Ga0496109_0001475_15873_17135 419
3480 3300048914 Ga0496111_0004420 Ga0496111_0004420_5086_6348 419
3481 3300048916 Ga0496113_0003159 Ga0496113_0003159_5435_6697 419
3482 3300048917 Ga0496114_0001673 Ga0496114_0001673_10062_11321 419
3483 3300049592 Ga0501076_0168614 Ga0501076_0168614_407_1669 419
3484 3300049593 Ga0501077_0049506 Ga0501077_0049506_642_1904 419
3485 3300050511 nmdc:mga08y16_119924_c1 nmdc:mga08y16_119924_c1_455_1714 419
3486 3300050511 nmdc:mga08y16_133508_c1 nmdc:mga08y16_133508_c1_99_1361 419
3487 3300050513 nmdc:mga0rr50_13503_c1 nmdc:mga0rr50_13503_c1_3949_5211 419
3488 3300054114 Ga0501084_0127907 Ga0501084_0127907_109_1371 419

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04551

GcpE

GcpE protein

31

408

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4s3a-assembly1.cif.gz_A ispg in complex with intermediate i 0.9531 7 400
4g9p-assembly1.cif.gz_A structure of the gcpe-mecpp (ispg) complex from thermus thermophilus 0.9512 6 404
4g9p-assembly1.cif.gz_A structure of the gcpe-mecpp (ispg) complex from thermus thermophilus 0.9353 6 404
4s3a-assembly1.cif.gz_A ispg in complex with intermediate i 0.9324 7 400
4mwa-assembly3.cif.gz_D 1.85 angstrom crystal structure of gcpe protein from bacillus anthracis 0.9024 4 287
ID Description Score Start End Superfamily
4s23A01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Dihydropteroate synthase-like 0.9767 5 286 3.20.20.20
4s23A01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Dihydropteroate synthase-like 0.9567 5 286 3.20.20.20
3noyC01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Dihydropteroate synthase-like 0.9163 5 286 3.20.20.20
3noyC01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Dihydropteroate synthase-like 0.9094 5 286 3.20.20.20
4s23B02 Alpha Beta;2-Layer Sandwich;Sulfite Reductase Hemoprotein; domain 1;Sulfite Reductase Hemoprotein, domain 1 0.9046 288 404 3.30.413.10
ID Description Score Start End GO Terms
AF-A0A526YU46-F1-model_v4 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (EC 1.17.7.1) 0.9929 53 141 GO:0016114
GO:0019288
GO:0046429
AF-A0A6L7MCN3-F1-model_v4 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (EC 1.17.7.1) 0.9918 6 145 GO:0016114
GO:0019288
GO:0046429
AF-A0A2V8E579-F1-model_v4 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (EC 1.17.7.1) 0.9917 6 114 GO:0016114
GO:0019288
GO:0046429
AF-A0A259N1B5-F1-model_v4 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 0.9915 41 199 GO:0016114
GO:0019288
GO:0046429
AF-T1AUY0-F1-model_v4 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, bacterial-type 0.9899 5 225 GO:0016114
GO:0019288
GO:0046429

Feature Viewer

pLDDT pTM Quality
88.57 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map