F497340

General Info

Members Datasets Scaffolds Average Seq Length
3560 1470 7118 388

Family's Representative Sequence

Representative Sequence 3300005549|Ga0070704_100002708|Ga0070704_1000027088
Length 425
Sequence MPPGYFSNLFYGLSKASLAVALGSAYIPCISHTGAFMTACIVGLAHTPFGKLDTESVESLIIRVTKEALADAGIEAADVDEIVLGHFNAGFSAQDFTAALVLQADPAFRFKPATRVENACATGSAAVHQGIKAIVSKSARIVLVVGVEQMTTTPSAEIGKNLLKASYLPEDGSIEGGFAGVFGKIAGLYFQRYGDQSDALAKIAAKNHKNGVGNPYAQMRKDFGYEFCRTESEKNPRVAGPLKRTDCSLVSDGAAAIVLTDVETAMKLDKPAIAFRGIAHAQDFLPMSKRDILKFEGCSEAWGRALKQAGIDLYDLSFVETHDCFTVAELIEYEAMGLAKPGQGARVIHDGIVEKTGKLPVNPSGGLKAKGHPIGATGVSMHALTTMQLRGEAGDMQIKDARLGGIFNMGGAAVANYVSILERLR

Samples

Sample ID Description Type Environment
1 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
4 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
5 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
6 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
7 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
8 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
9 3300001430 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 Metagenome Rhizosphere
10 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
11 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
12 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
13 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
14 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
15 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
16 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
17 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
18 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
19 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
20 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
21 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
22 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
23 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
24 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
25 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
27 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
28 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
29 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
30 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
31 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
32 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
33 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
34 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
35 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
36 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
37 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
38 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
39 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
40 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
41 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
42 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
43 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
44 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
46 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
47 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
48 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
49 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
50 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
51 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
52 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
53 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
54 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
55 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
56 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
57 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
58 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
59 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
60 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
61 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
62 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
63 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
64 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
65 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
66 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
67 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
68 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
69 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
70 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
71 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
72 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
73 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
74 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
75 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
76 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
77 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
78 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
79 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
80 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
81 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
82 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
83 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
84 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
85 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
86 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
87 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
88 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
89 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
90 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
91 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
92 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
93 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
94 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
95 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
96 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
97 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
98 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
99 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
100 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
101 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
102 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
103 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
104 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
105 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
106 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
107 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
108 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
109 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
110 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
111 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
112 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
113 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
114 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
115 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
116 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
117 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
118 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
119 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
120 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
121 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
122 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
123 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
124 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
125 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
126 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
127 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
128 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
129 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
130 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
131 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
132 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
133 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
134 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
135 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
136 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
137 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
138 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
139 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
140 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
141 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
142 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
143 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
144 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
145 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
146 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
147 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
148 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
149 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
150 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
151 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
152 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
153 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
154 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
155 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
156 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
157 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
158 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
159 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
160 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
161 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
162 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
163 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
164 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
165 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
166 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
167 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
168 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
169 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
170 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
171 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
172 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
173 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
174 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
175 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
176 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
177 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
178 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
179 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
180 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
181 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
182 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
183 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
184 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
185 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
186 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
187 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
188 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
189 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
190 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
191 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
192 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
193 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
194 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
195 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
196 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
197 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
198 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
199 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
200 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
201 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
202 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
203 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
204 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
205 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
206 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
207 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
208 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
209 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
210 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
211 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
212 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
213 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
214 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
215 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
216 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
217 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
218 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
219 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
220 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
221 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
222 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
223 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
224 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
225 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
227 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
228 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
229 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
230 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
231 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
232 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
233 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
234 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
235 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
236 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
237 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
238 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
239 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
296 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
297 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
298 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
301 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
302 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
303 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
304 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
305 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
306 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
308 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
309 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
310 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
311 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
312 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
313 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
314 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
315 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
316 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
317 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
318 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
319 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
320 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
321 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
322 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
323 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
324 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
326 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
327 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
328 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
329 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
330 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
331 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
332 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
333 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
334 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
335 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
336 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
337 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
338 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
339 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
340 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
341 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
342 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
343 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
344 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
345 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
346 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
347 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
348 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
349 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
350 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
351 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
352 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
353 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
354 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
355 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
356 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
357 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
358 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
359 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
360 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
361 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
362 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
363 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
364 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
365 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
366 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
367 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
368 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
369 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
370 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
371 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
372 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
373 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
374 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
375 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
376 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
377 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
378 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
379 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
380 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
381 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
382 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
383 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
384 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
385 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
386 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
387 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
388 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
389 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
390 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
391 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
392 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
393 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
394 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
395 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
396 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
397 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
398 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
399 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
400 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
401 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
402 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
403 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
404 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
405 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
406 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
407 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
408 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
409 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
410 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
411 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
412 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
413 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
414 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
415 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
416 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
417 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
418 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
419 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
420 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
421 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
422 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
423 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
424 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
425 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
426 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
427 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
428 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
429 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
430 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
431 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
432 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
433 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
434 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
435 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
436 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
437 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
438 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
439 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
440 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
441 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
442 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
443 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
444 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
445 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
446 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
447 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
448 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
449 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
450 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
451 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
452 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
453 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
454 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
455 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
456 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
457 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
458 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
459 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
460 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
461 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
462 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
463 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
464 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
465 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
466 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
467 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
468 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
469 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
470 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
471 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
472 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
473 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
474 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
475 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
476 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
477 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
478 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
479 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
480 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
481 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
482 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
483 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
484 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
485 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
486 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
487 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
488 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
489 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
490 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
491 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
492 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
493 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
494 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
495 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
496 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
497 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
498 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
499 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
500 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
501 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
502 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
503 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
504 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
505 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
506 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
507 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
508 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
509 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
510 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
511 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
512 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
513 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
514 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
515 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
516 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
517 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
518 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
519 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
520 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
521 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
522 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
523 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
524 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
525 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
526 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
527 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
528 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
529 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
530 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
531 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
532 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
533 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
534 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
535 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
536 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
537 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
538 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
539 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
540 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
541 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
542 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
543 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
544 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
545 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
546 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
547 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
548 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
549 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
550 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
551 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
552 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
553 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
554 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
555 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
556 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
557 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
558 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
559 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
560 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
561 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
562 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
563 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
564 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
565 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
566 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
567 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
568 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
569 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
570 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
571 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
572 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
573 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
574 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
575 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
576 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
577 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
578 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
579 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
580 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
581 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
582 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
583 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
584 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
585 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
586 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
587 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
588 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
589 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
590 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
591 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
592 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
593 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
594 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
595 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
596 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
597 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
598 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
599 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
600 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
601 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
602 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
603 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
604 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
605 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
606 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
607 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
608 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
609 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
610 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
611 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
612 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
613 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
614 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
615 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
616 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
617 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
618 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
619 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
620 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
621 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
622 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
623 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
624 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
625 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
626 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
627 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
628 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
629 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
630 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
631 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
632 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
633 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
634 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
635 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
636 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
637 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
638 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
639 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
640 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
641 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
642 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
643 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
644 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
645 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
646 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
647 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
648 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
649 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
650 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
651 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
652 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
653 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
654 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
655 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
656 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
657 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
658 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
659 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
660 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
661 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
662 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
663 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
664 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
665 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
666 2508501050 Microvirga lupini Lut6 Isolate Nodule
667 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
668 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
669 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
670 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
671 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
672 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
673 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
674 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
675 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
676 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
677 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
678 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
679 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
680 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
681 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
682 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
683 2512875024
684 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
685 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
686 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
687 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
688 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
689 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
690 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
691 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
692 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
693 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
694 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
695 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
696 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
697 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
698 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
699 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
700 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
701 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
702 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
703 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
704 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
705 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
706 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
707 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
708 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
709 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
710 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
711 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
712 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
713 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
714 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
715 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
716 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
717 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
718 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
719 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
720 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
721 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
722 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
723 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
724 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
725 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
726 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
727 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
728 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
729 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
730 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
731 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
732 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
733 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
734 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
735 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
736 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
737 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
738 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
739 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
740 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
741 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
742 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
743 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
744 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
745 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
746 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
747 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
748 2643221558 Rhizobium sp. Root149 Isolate Unclassified
749 2643221561 Nocardioides sp. Root151 Isolate Unclassified
750 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
751 2643221570 Acidovorax sp. Root568 Isolate Unclassified
752 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
753 2643221596 Acidovorax sp. Root70 Isolate Unclassified
754 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
755 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
756 2643221651 Afipia sp. Root123D2 Isolate Unclassified
757 2643221652 Acidovorax sp. Root402 Isolate Unclassified
758 2643221658 Variovorax sp. Root411 Isolate Unclassified
759 2643221693 Rhizobium sp. Root491 Isolate Unclassified
760 2643221696 Nocardioides sp. Root140 Isolate Unclassified
761 2643221733 Bosea sp. Root381 Isolate Unclassified
762 2643221734 Bosea sp. Root670 Isolate Unclassified
763 2643221736 Bosea sp. Root483D1 Isolate Unclassified
764 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
765 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
766 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
767 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
768 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
769 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
770 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
771 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
772 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
773 2738543024 Aminobacter sp. AP02 Isolate Unclassified
774 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
775 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
776 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
777 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
778 2773857925 Microvirga vignae BR3299 Isolate Unclassified
779 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
780 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
781 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
782 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
783 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
784 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
785 2791355199
786 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
787 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
788 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
789 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
790 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
791 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
792 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
793 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
794 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
795 2818991467 Bosea vestrisii 3192 Isolate Unclassified
796 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
797 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
798 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
799 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
800 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
801 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
802 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
803 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
804 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
805 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
806 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
807 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
808 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
809 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
810 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
811 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
812 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
813 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
814 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
815 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
816 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
817 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
818 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
819 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
820 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
821 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
822 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
823 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
824 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
825 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
826 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
827 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
828 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
829 2841760612 Bosea sp. Tri-49 Isolate Nodule
830 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
831 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
832 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
833 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
834 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
835 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
836 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
837 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
838 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
839 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
840 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
841 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
842 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
843 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
844 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
845 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
846 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
847 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
848 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
849 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
850 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
851 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
852 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
853 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
854 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
855 2844104063 Bosea sp. Tri-39 Isolate Nodule
856 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
857 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
858 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
859 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
860 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
861 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
862 2851182111 Bosea sp. Tri-44 Isolate Nodule
863 2851246043 Bosea sp. Tri-54 Isolate Nodule
864 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
865 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
866 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
867 2855730933 Achromobacter sp. HZ28 Isolate Nodule
868 2855767633 Achromobacter sp. HZ34 Isolate Nodule
869 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
870 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
871 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
872 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
873 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
874 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
875 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
876 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
877 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
878 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
879 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
880 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
881 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
882 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
883 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
884 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
885 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
886 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
887 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
888 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
889 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
890 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
891 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
892 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
893 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
894 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
895 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
896 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
897 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
898 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
899 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
900 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
901 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
902 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
903 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
904 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
905 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
906 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
907 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
908 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
909 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
910 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
911 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
912 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
913 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
914 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
915 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
916 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
917 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
918 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
919 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
920 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
921 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
922 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
923 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
924 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
925 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
926 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
927 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
928 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
929 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
930 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
931 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
932 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
933 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
934 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
935 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
936 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
937 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
938 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
939 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
940 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
941 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
942 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
943 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
944 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
945 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
946 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
947 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
948 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
949 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
950 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
951 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
952 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
953 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
954 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
955 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
956 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
957 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
958 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
959 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
960 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
961 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
962 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
963 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
964 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
965 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
966 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
967 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
968 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
969 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
970 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
971 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
972 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
973 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
974 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
975 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
976 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
977 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
978 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
979 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
980 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
981 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
982 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
983 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
984 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
985 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
986 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
987 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
988 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
989 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
990 2899259804 Paracoccus aeridis JC501 Isolate Rhizosphere
991 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
992 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
993 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
994 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
995 2902330777 Methylobacterium sp. 2A Isolate Unclassified
996 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
997 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
998 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
999 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
1000 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
1001 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
1002 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
1003 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
1004 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
1005 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
1006 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
1007 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
1008 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
1009 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
1010 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
1011 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
1012 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
1013 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
1014 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
1015 2904699407
1016 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
1017 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
1018 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
1019 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
1020 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
1021 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
1022 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
1023 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
1024 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
1025 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
1026 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
1027 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
1028 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
1029 2906610324
1030 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
1031 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
1032 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
1033 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
1034 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
1035 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
1036 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
1037 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
1038 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
1039 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
1040 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
1041 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
1042 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
1043 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
1044 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
1045 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
1046 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
1047 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
1048 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
1049 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
1050 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
1051 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
1052 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
1053 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
1054 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
1055 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
1056 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
1057 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
1058 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
1059 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
1060 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
1061 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
1062 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
1063 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
1064 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
1065 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
1066 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
1067 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
1068 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
1069 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
1070 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
1071 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
1072 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
1073 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
1074 2922368715
1075 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
1076 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
1077 2922425934
1078 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
1079 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
1080 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
1081 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
1082 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
1083 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
1084 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
1085 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
1086 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
1087 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
1088 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
1089 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
1090 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
1091 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
1092 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
1093 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
1094 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
1095 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
1096 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
1097 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
1098 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
1099 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
1100 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
1101 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
1102 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
1103 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
1104 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
1105 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
1106 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
1107 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
1108 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
1109 2929520902 Variovorax beijingensis 502 Isolate Unclassified
1110 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
1111 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
1112 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
1113 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
1114 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
1115 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
1116 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
1117 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
1118 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
1119 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
1120 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
1121 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
1122 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
1123 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
1124 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
1125 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
1126 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
1127 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
1128 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
1129 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
1130 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
1131 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
1132 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
1133 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
1134 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
1135 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
1136 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
1137 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
1138 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
1139 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
1140 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
1141 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
1142 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
1143 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
1144 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
1145 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
1146 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
1147 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
1148 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
1149 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
1150 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
1151 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
1152 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
1153 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
1154 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
1155 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
1156 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
1157 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
1158 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
1159 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
1160 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
1161 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
1162 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
1163 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
1164 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
1165 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
1166 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
1167 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
1168 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
1169 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
1170 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
1171 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
1172 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
1173 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
1174 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
1175 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
1176 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
1177 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
1178 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
1179 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
1180 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
1181 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
1182 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
1183 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
1184 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
1185 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
1186 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
1187 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
1188 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
1189 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
1190 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
1191 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
1192 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
1193 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
1194 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
1195 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
1196 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
1197 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
1198 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
1199 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
1200 2941479691
1201 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
1202 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
1203 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
1204 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
1205 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
1206 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
1207 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
1208 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
1209 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
1210 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
1211 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
1212 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
1213 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
1214 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
1215 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
1216 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
1217 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
1218 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
1219 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
1220 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
1221 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
1222 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
1223 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
1224 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
1225 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
1226 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
1227 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
1228 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
1229 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
1230 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
1231 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
1232 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
1233 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
1234 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
1235 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
1236 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
1237 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
1238 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
1239 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
1240 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
1241 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
1242 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
1243 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
1244 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
1245 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
1246 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
1247 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
1248 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
1249 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
1250 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
1251 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
1252 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
1253 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
1254 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
1255 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
1256 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
1257 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
1258 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
1259 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
1260 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
1261 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
1262 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
1263 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
1264 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
1265 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
1266 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
1267 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
1268 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
1269 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
1270 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
1271 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
1272 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
1273 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
1274 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
1275 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
1276 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
1277 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
1278 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
1279 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
1280 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
1281 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
1282 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
1283 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
1284 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
1285 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
1286 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
1287 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
1288 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
1289 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
1290 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
1291 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
1292 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
1293 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
1294 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
1295 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
1296 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
1297 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
1298 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
1299 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
1300 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
1301 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
1302 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
1303 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
1304 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
1305 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
1306 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
1307 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
1308 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
1309 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
1310 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
1311 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
1312 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
1313 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
1314 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
1315 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
1316 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
1317 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
1318 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
1319 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
1320 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
1321 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
1322 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
1323 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
1324 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
1325 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
1326 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
1327 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
1328 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
1329 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
1330 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
1331 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
1332 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
1333 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
1334 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
1335 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
1336 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
1337 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
1338 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
1339 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
1340 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
1341 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
1342 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
1343 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
1344 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
1345 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
1346 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
1347 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
1348 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
1349 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
1350 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
1351 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
1352 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
1353 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
1354 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
1355 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
1356 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
1357 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
1358 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
1359 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
1360 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
1361 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
1362 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
1363 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
1364 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
1365 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
1366 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
1367 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
1368 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
1369 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
1370 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
1371 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
1372 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
1373 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
1374 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
1375 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
1376 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
1377 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
1378 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
1379 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
1380 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
1381 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
1382 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
1383 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
1384 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
1385 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
1386 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
1387 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
1388 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
1389 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
1390 3004167301 Mesorhizobium loti 582 Isolate Unclassified
1391 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
1392 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
1393 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
1394 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
1395 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
1396 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
1397 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
1398 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
1399 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
1400 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
1401 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
1402 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
1403 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
1404 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
1405 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
1406 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
1407 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
1408 641522639 Methylobacterium sp. 4-46 Isolate Nodule
1409 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
1410 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
1411 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
1412 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
1413 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
1414 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
1415 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
1416 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
1417 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
1418 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
1419 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
1420 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
1421 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
1422 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
1423 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
1424 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
1425 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
1426 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
1427 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
1428 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
1429 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
1430 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
1431 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
1432 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
1433 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
1434 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
1435 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
1436 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
1437 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
1438 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
1439 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
1440 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
1441 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
1442 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
1443 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
1444 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
1445 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
1446 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
1447 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
1448 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
1449 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
1450 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
1451 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
1452 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
1453 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
1454 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
1455 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
1456 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
1457 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
1458 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
1459 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
1460 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
1461 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule
1462 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
1463 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
1464 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
1465 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
1466 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
1467 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
1468 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
1469 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule
1470 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 76.85
Metatranscriptomes 0.17
Isolates 22.98

Biome Distribution

Category Percentage (%)
Aerial Root 0.08
Bulb 0
Endosphere 6.35
Nodule 17.56
Rhizoplane 5.48
Rhizosphere 61.18
Stem 0
Stem Tuber 0
Unclassified 0.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070704_100002708 3300005549 Bacteria 10020
2 2214544919 2209111006 Bacteria 20284
3 ARcpr5oldR_c000002 3300000041 Bacteria 79314
4 ARSoilYngRDRAFT_c00003 3300000042 Bacteria 43678
5 ARcpr5yngRDRAFT_c000036 3300000043 Bacteria 21264
6 ARSoilOldRDRAFT_c000002 3300000044 Bacteria 66650
7 ARCol0oldRDRAFT_c00314 3300000045 Bacteria 4672
8 ARCol0yngRDRAFT_1000005 3300000652 Bacteria 47205
9 JGI24032J14994_100147 3300001430 Bacteria 3367
10 JGI24746J21847_1000131 3300001977 Bacteria 9137
11 JGI24739J22299_10007211 3300001989 Bacteria 4180
12 JGI24739J22299_10026188 3300001989 Bacteria 2048
13 JGI24737J22298_10003920 3300001990 Bacteria 5214
14 JGI24737J22298_10011733 3300001990 Bacteria 2866
15 JGI24750J21931_1000047 3300002070 Bacteria 16414
16 JGI24748J21848_1000620 3300002074 Bacteria 3809
17 JGI24748J21848_1004239 3300002074 Bacteria 1644
18 JGI24738J21930_10000265 3300002075 Bacteria 14234
19 JGI24749J21850_1002322 3300002076 Bacteria 2675
20 JGI24035J26624_1000154 3300002126 Bacteria 6182
21 JGI24034J26672_10000826 3300002239 Bacteria 4018
22 JGI24742J22300_10000044 3300002244 Bacteria 18297
23 JGI24742J22300_10001628 3300002244 Bacteria 3568
24 JGI24751J29686_10011524 3300002459 Bacteria 1823
25 JGI25156J39149_1002014 3300002705 Bacteria 7769
26 JGI25156J39149_1004416 3300002705 Bacteria 4285
27 JGI25157J39369_1001113 3300002741 Bacteria 11952
28 JGI25157J39369_1002073 3300002741 Bacteria 5718
29 JGI25159J45721_1003796 3300002987 Bacteria 5205
30 JGI25151J46595_10000036 3300003187 Bacteria 188770
31 JGI25151J46595_10000209 3300003187 Bacteria 71715
32 JGI25151J46595_10000244 3300003187 Bacteria 63724
33 JGI25151J46595_10004420 3300003187 Bacteria 7443
34 JGI25406J46586_10000093 3300003203 Bacteria 41100
35 JGI25406J46586_10000412 3300003203 Bacteria 19629
36 JGI25406J46586_10000504 3300003203 Bacteria 18270
37 JGI25406J46586_10000565 3300003203 Bacteria 17468
38 JGI25406J46586_10002895 3300003203 Bacteria 8093
39 JGI25165J46597_1000016 3300003214 Bacteria 377866
40 JGI25153J46596_10000462 3300003215 Bacteria 25965
41 JGI25153J46596_10000860 3300003215 Bacteria 18503
42 JGI25153J46596_10002078 3300003215 Bacteria 11772
43 JGI25153J46596_10005256 3300003215 Bacteria 6807
44 JGI25160J50197_1001585 3300003354 Bacteria 11209
45 JGI25160J50197_1005731 3300003354 Bacteria 5126
46 Ga0006562J51391_1082408 3300003578 Bacteria 2384
47 Ga0006562J51391_1082410 3300003578 Bacteria 1520
48 JGI25404J52841_10001115 3300003659 Bacteria 4531
49 JGI25404J52841_10005561 3300003659 Bacteria 2604
50 Ga0055539_1000125 3300003752 Bacteria 81835
51 Ga0055533_1000132 3300003756 Bacteria 81835
52 Ga0055532_1001641 3300003758 Bacteria 5866
53 Ga0055525_1000171 3300003759 Bacteria 81835
54 Ga0055529_1002195 3300003763 Bacteria 4034
55 Ga0055526_1000017 3300003771 Bacteria 210613
56 Ga0055526_1000391 3300003771 Bacteria 35449
57 Ga0055524_1000014 3300003775 Bacteria 259417
58 Ga0055524_1001064 3300003775 Bacteria 16909
59 Ga0055524_1028695 3300003775 Bacteria 1661
60 Ga0055536_1015634 3300003781 Bacteria 2583
61 Ga0055530_10000614 3300003791 Bacteria 30953
62 Ga0055530_10024263 3300003791 Bacteria 1724
63 Ga0055540_1000014 3300003792 Bacteria 234171
64 Ga0055540_1008590 3300003792 Bacteria 3661
65 Ga0055531_10007927 3300003794 Bacteria 5696
66 Ga0055531_10011219 3300003794 Bacteria 4352
67 Ga0055541_1000083 3300003841 Bacteria 81835
68 Ga0058692_1001859 3300003856 Bacteria 7413
69 JGI25405J52794_10001403 3300003911 Bacteria 3950
70 Ga0065165_1000048 3300005262 Bacteria 196539
71 Ga0065165_1000231 3300005262 Bacteria 97237
72 Ga0065165_1010260 3300005262 Bacteria 4074
73 Ga0065165_1014736 3300005262 Bacteria 3020
74 Ga0065165_1026652 3300005262 Bacteria 1898
75 Ga0065717_1002078 3300005276 Bacteria 3085
76 Ga0065704_10074116 3300005289 Bacteria 6514
77 Ga0065704_10101877 3300005289 Bacteria 2223
78 Ga0065712_10037077 3300005290 Bacteria 1279
79 Ga0065712_10081299 3300005290 Bacteria 3019
80 Ga0065712_10105846 3300005290 Bacteria 1930
81 Ga0065715_10000449 3300005293 Bacteria 15495
82 Ga0065715_10164600 3300005293 Bacteria 1598
83 Ga0070658_10033732 3300005327 Bacteria 4119
84 Ga0070676_10000308 3300005328 Bacteria 22069
85 Ga0070683_100004737 3300005329 Bacteria 11254
86 Ga0070683_100031574 3300005329 Bacteria 4818
87 Ga0070683_100054561 3300005329 Bacteria 3705
88 Ga0070683_100160548 3300005329 Bacteria 2133
89 Ga0070683_100166639 3300005329 Bacteria 2091
90 Ga0070683_100222817 3300005329 Bacteria 1792
91 Ga0070690_100002356 3300005330 Bacteria 10159
92 Ga0070690_100009282 3300005330 Bacteria 5693
93 Ga0070690_100134039 3300005330 Bacteria 1675
94 Ga0070670_100003132 3300005331 Bacteria 13685
95 Ga0070670_100003645 3300005331 Bacteria 12827
96 Ga0070670_100013025 3300005331 Bacteria 7124
97 Ga0070670_100054159 3300005331 Bacteria 3443
98 Ga0070670_100350918 3300005331 Bacteria 1296
99 Ga0070677_10000203 3300005333 Bacteria 20576
100 Ga0070677_10093224 3300005333 Bacteria 1314
101 Ga0068869_100000290 3300005334 Bacteria 26728
102 Ga0068869_100118106 3300005334 Bacteria 2025
103 Ga0068869_100178225 3300005334 Bacteria 1665
104 Ga0068869_100239011 3300005334 Bacteria 1446
105 Ga0070666_10033208 3300005335 Bacteria 3413
106 Ga0070666_10068460 3300005335 Bacteria 2412
107 Ga0070680_100006358 3300005336 Bacteria 8972
108 Ga0070680_100006548 3300005336 Bacteria 8859
109 Ga0070680_100007952 3300005336 Bacteria 8093
110 Ga0070680_100040562 3300005336 Bacteria 3770
111 Ga0070680_100096638 3300005336 Bacteria 2449
112 Ga0070680_100107144 3300005336 Bacteria 2324
113 Ga0070680_100135402 3300005336 Bacteria 2063
114 Ga0070680_100170904 3300005336 Bacteria 1829
115 Ga0070682_100000982 3300005337 Bacteria 16537
116 Ga0070682_100001061 3300005337 Bacteria 15845
117 Ga0070682_100038624 3300005337 Bacteria 2929
118 Ga0070682_100066366 3300005337 Bacteria 2295
119 Ga0068868_100000505 3300005338 Bacteria 26049
120 Ga0070660_100000419 3300005339 Bacteria 28331
121 Ga0070660_100002532 3300005339 Bacteria 12526
122 Ga0070660_100016441 3300005339 Bacteria 5369
123 Ga0070660_100039991 3300005339 Bacteria 3566
124 Ga0070660_100042109 3300005339 Bacteria 3484
125 Ga0070660_100216086 3300005339 Bacteria 1557
126 Ga0070689_100000567 3300005340 Bacteria 22207
127 Ga0070689_100000784 3300005340 Bacteria 19512
128 Ga0070689_100006577 3300005340 Bacteria 8062
129 Ga0070689_100010941 3300005340 Bacteria 6484
130 Ga0070689_100017607 3300005340 Bacteria 5251
131 Ga0070689_100019683 3300005340 Bacteria 4993
132 Ga0070689_100024286 3300005340 Bacteria 4545
133 Ga0070691_10001059 3300005341 Bacteria 11357
134 Ga0070691_10016994 3300005341 Bacteria 3346
135 Ga0070691_10080215 3300005341 Bacteria 1597
136 Ga0070687_100000145 3300005343 Bacteria 24820
137 Ga0070687_100001424 3300005343 Bacteria 8402
138 Ga0070661_100004369 3300005344 Bacteria 9747
139 Ga0070661_100015609 3300005344 Bacteria 5362
140 Ga0070661_100063942 3300005344 Bacteria 2703
141 Ga0070661_100067273 3300005344 Bacteria 2633
142 Ga0070661_100102307 3300005344 Bacteria 2132
143 Ga0070661_100151584 3300005344 Bacteria 1752
144 Ga0070692_10000927 3300005345 Bacteria 9932
145 Ga0070668_100003304 3300005347 Bacteria 11899
146 Ga0070668_100044604 3300005347 Bacteria 3401
147 Ga0070668_100049906 3300005347 Bacteria 3220
148 Ga0070668_100071617 3300005347 Bacteria 2701
149 Ga0070668_100090516 3300005347 Bacteria 2411
150 Ga0070668_100353361 3300005347 Bacteria 1244
151 Ga0070669_100003579 3300005353 Bacteria 11213
152 Ga0070669_100026298 3300005353 Bacteria 4186
153 Ga0070669_100118893 3300005353 Bacteria 2013
154 Ga0070669_100170420 3300005353 Bacteria 1697
155 Ga0070675_100000977 3300005354 Bacteria 20445
156 Ga0070675_100006235 3300005354 Bacteria 9148
157 Ga0070675_100047289 3300005354 Bacteria 3526
158 Ga0070675_100053971 3300005354 Bacteria 3306
159 Ga0070671_100000457 3300005355 Bacteria 28429
160 Ga0070671_100005484 3300005355 Bacteria 10122
161 Ga0070671_100013863 3300005355 Bacteria 6503
162 Ga0070671_100024576 3300005355 Bacteria 4934
163 Ga0070671_100056174 3300005355 Bacteria 3275
164 Ga0070671_100102405 3300005355 Bacteria 2403
165 Ga0070671_100162562 3300005355 Bacteria 1887
166 Ga0070674_100003924 3300005356 Bacteria 8424
167 Ga0070674_100005104 3300005356 Bacteria 7550
168 Ga0070674_100010581 3300005356 Bacteria 5583
169 Ga0070674_100023685 3300005356 Bacteria 3977
170 Ga0070673_100002173 3300005364 Bacteria 11883
171 Ga0070673_100002183 3300005364 Bacteria 11836
172 Ga0070673_100091785 3300005364 Bacteria 2483
173 Ga0070673_100095685 3300005364 Bacteria 2436
174 Ga0070688_100000956 3300005365 Bacteria 14425
175 Ga0070688_100008606 3300005365 Bacteria 5551
176 Ga0070688_100036208 3300005365 Bacteria 3000
177 Ga0070688_100061090 3300005365 Bacteria 2381
178 Ga0070688_100071389 3300005365 Bacteria 2223
179 Ga0070659_100001451 3300005366 Bacteria 17085
180 Ga0070659_100016138 3300005366 Bacteria 5604
181 Ga0070659_100049630 3300005366 Bacteria 3300
182 Ga0070659_100059384 3300005366 Bacteria 3020
183 Ga0070659_100233404 3300005366 Bacteria 1520
184 Ga0070667_100156522 3300005367 Bacteria 2004
185 Ga0070703_10011030 3300005406 Bacteria 2551
186 Ga0070709_10004491 3300005434 Bacteria 7528
187 Ga0070709_10011326 3300005434 Bacteria 4967
188 Ga0070709_10022469 3300005434 Bacteria 3690
189 Ga0070709_10030529 3300005434 Bacteria 3235
190 Ga0070714_100005442 3300005435 Bacteria 9720
191 Ga0070714_100011031 3300005435 Bacteria 7157
192 Ga0070714_100016605 3300005435 Bacteria 5948
193 Ga0070714_100016855 3300005435 Bacteria 5909
194 Ga0070714_100019021 3300005435 Bacteria 5589
195 Ga0070714_100036484 3300005435 Bacteria 4123
196 Ga0070714_100042403 3300005435 Bacteria 3844
197 Ga0070714_100083816 3300005435 Bacteria 2781
198 Ga0070714_100194327 3300005435 Bacteria 1853
199 Ga0070714_100196379 3300005435 Bacteria 1844
200 Ga0070713_100000834 3300005436 Bacteria 19697
201 Ga0070713_100008105 3300005436 Bacteria 7430
202 Ga0070713_100015475 3300005436 Bacteria 5707
203 Ga0070713_100051872 3300005436 Bacteria 3395
204 Ga0070713_100092085 3300005436 Bacteria 2609
205 Ga0070713_100095586 3300005436 Bacteria 2563
206 Ga0070710_10000567 3300005437 Bacteria 17537
207 Ga0070710_10009242 3300005437 Bacteria 4817
208 Ga0070710_10019974 3300005437 Bacteria 3470
209 Ga0070710_10027323 3300005437 Bacteria 3042
210 Ga0070701_10000773 3300005438 Bacteria 11424
211 Ga0070701_10052031 3300005438 Bacteria 2126
212 Ga0070711_100000801 3300005439 Bacteria 16448
213 Ga0070711_100006558 3300005439 Bacteria 7021
214 Ga0070711_100019620 3300005439 Bacteria 4340
215 Ga0070711_100067921 3300005439 Bacteria 2503
216 Ga0070711_100073752 3300005439 Bacteria 2412
217 Ga0070711_100146969 3300005439 Bacteria 1774
218 Ga0070705_100012088 3300005440 Bacteria 4377
219 Ga0070705_100114972 3300005440 Bacteria 1727
220 Ga0070700_100002595 3300005441 Bacteria 9237
221 Ga0070700_100005406 3300005441 Bacteria 6762
222 Ga0070700_100015662 3300005441 Bacteria 4304
223 Ga0070694_100005038 3300005444 Bacteria 7972
224 Ga0070694_100019262 3300005444 Bacteria 4339
225 Ga0070708_100016537 3300005445 Bacteria 6125
226 Ga0070663_100007329 3300005455 Bacteria 6707
227 Ga0070663_100013311 3300005455 Bacteria 5240
228 Ga0070663_100016126 3300005455 Bacteria 4841
229 Ga0070663_100018939 3300005455 Bacteria 4525
230 Ga0070663_100020358 3300005455 Bacteria 4392
231 Ga0070663_100080041 3300005455 Bacteria 2399
232 Ga0070663_100081341 3300005455 Bacteria 2381
233 Ga0070663_100236714 3300005455 Bacteria 1440
234 Ga0070678_100000204 3300005456 Bacteria 26272
235 Ga0070678_100006849 3300005456 Bacteria 6717
236 Ga0070678_100016075 3300005456 Bacteria 4774
237 Ga0070678_100019584 3300005456 Bacteria 4418
238 Ga0070678_100026143 3300005456 Bacteria 3941
239 Ga0070678_100062074 3300005456 Bacteria 2757
240 Ga0070678_100064897 3300005456 Bacteria 2708
241 Ga0070678_100069888 3300005456 Bacteria 2623
242 Ga0070678_100071249 3300005456 Bacteria 2602
243 Ga0070662_100051612 3300005457 Bacteria 2970
244 Ga0070662_100077295 3300005457 Bacteria 2470
245 Ga0070662_100124476 3300005457 Bacteria 1979
246 Ga0070681_10001622 3300005458 Bacteria 20041
247 Ga0070681_10004974 3300005458 Bacteria 12787
248 Ga0070681_10016579 3300005458 Bacteria 7356
249 Ga0070681_10018673 3300005458 Bacteria 6935
250 Ga0070681_10034683 3300005458 Bacteria 5067
251 Ga0070681_10062985 3300005458 Bacteria 3681
252 Ga0070681_10064861 3300005458 Bacteria 3622
253 Ga0070681_10106074 3300005458 Bacteria 2751
254 Ga0070681_10301768 3300005458 Bacteria 1511
255 Ga0068867_100016017 3300005459 Bacteria 5322
256 Ga0068867_100021279 3300005459 Bacteria 4628
257 Ga0068867_100024746 3300005459 Bacteria 4303
258 Ga0068867_100068926 3300005459 Bacteria 2641
259 Ga0068867_100095594 3300005459 Bacteria 2261
260 Ga0068867_100183297 3300005459 Bacteria 1666
261 Ga0070685_10017792 3300005466 Bacteria 3811
262 Ga0070685_10023595 3300005466 Bacteria 3370
263 Ga0070685_10057794 3300005466 Bacteria 2258
264 Ga0070706_100096722 3300005467 Bacteria 2741
265 Ga0070707_100064794 3300005468 Bacteria 3509
266 Ga0070707_100108628 3300005468 Bacteria 2691
267 Ga0070707_100190933 3300005468 Bacteria 1997
268 Ga0070699_100004210 3300005518 Bacteria 12728
269 Ga0070679_100003230 3300005530 Bacteria 14890
270 Ga0070679_100004369 3300005530 Bacteria 13060
271 Ga0070679_100006042 3300005530 Bacteria 11261
272 Ga0070679_100020708 3300005530 Bacteria 6417
273 Ga0070679_100066542 3300005530 Bacteria 3591
274 Ga0070679_100296983 3300005530 Bacteria 1566
275 Ga0070679_100437708 3300005530 Bacteria 1252
276 Ga0070684_100006387 3300005535 Bacteria 9116
277 Ga0070684_100017723 3300005535 Bacteria 5852
278 Ga0070684_100069493 3300005535 Bacteria 3097
279 Ga0070684_100138162 3300005535 Bacteria 2202
280 Ga0070684_100221590 3300005535 Bacteria 1726
281 Ga0070697_100003792 3300005536 Bacteria 11607
282 Ga0070697_100219633 3300005536 Bacteria 1620
283 Ga0068853_100000504 3300005539 Bacteria 26665
284 Ga0068853_100006640 3300005539 Bacteria 9216
285 Ga0068853_100014714 3300005539 Bacteria 6418
286 Ga0068853_100018347 3300005539 Bacteria 5790
287 Ga0068853_100028677 3300005539 Bacteria 4684
288 Ga0068853_100112169 3300005539 Bacteria 2423
289 Ga0070672_100000343 3300005543 Bacteria 26805
290 Ga0070672_100014311 3300005543 Bacteria 5622
291 Ga0070672_100014711 3300005543 Bacteria 5551
292 Ga0070686_100000862 3300005544 Bacteria 17619
293 Ga0070686_100003330 3300005544 Bacteria 8806
294 Ga0070686_100015191 3300005544 Bacteria 4452
295 Ga0070695_100000693 3300005545 Bacteria 18006
296 Ga0070695_100003899 3300005545 Bacteria 8707
297 Ga0070695_100017273 3300005545 Bacteria 4374
298 Ga0070695_100036710 3300005545 Bacteria 3085
299 Ga0070696_100008114 3300005546 Bacteria 7020
300 Ga0070696_100116741 3300005546 Bacteria 1928
301 Ga0070693_100008248 3300005547 Bacteria 5123
302 Ga0070693_100008941 3300005547 Bacteria 4968
303 Ga0070693_100124478 3300005547 Bacteria 1603
304 Ga0070665_100021753 3300005548 Bacteria 6448
305 Ga0070665_100032166 3300005548 Bacteria 5279
306 Ga0070665_100087707 3300005548 Bacteria 3117
307 Ga0070665_100095749 3300005548 Bacteria 2974
308 Ga0070665_100193878 3300005548 Bacteria 2032
309 Ga0070665_100292379 3300005548 Bacteria 1631
310 Ga0070704_100000799 3300005549 Bacteria 15589
311 Ga0070704_100002929 3300005549 Bacteria 9697
312 Ga0070704_100024943 3300005549 Bacteria 3930
313 Ga0068855_100012892 3300005563 Bacteria 10087
314 Ga0068855_100016222 3300005563 Bacteria 8958
315 Ga0068855_100019843 3300005563 Bacteria 8075
316 Ga0068855_100040429 3300005563 Bacteria 5534
317 Ga0068855_100040447 3300005563 Bacteria 5533
318 Ga0068855_100096594 3300005563 Bacteria 3403
319 Ga0068855_100146506 3300005563 Bacteria 2687
320 Ga0068855_100155994 3300005563 Bacteria 2594
321 Ga0068855_100326594 3300005563 Bacteria 1694
322 Ga0068855_100363645 3300005563 Bacteria 1592
323 Ga0070664_100022786 3300005564 Bacteria 5166
324 Ga0070664_100094573 3300005564 Bacteria 2591
325 Ga0068857_100000979 3300005577 Bacteria 21865
326 Ga0068857_100100623 3300005577 Bacteria 2593
327 Ga0068857_100139657 3300005577 Bacteria 2189
328 Ga0068857_100341286 3300005577 Bacteria 1386
329 Ga0068854_100000702 3300005578 Bacteria 19795
330 Ga0068854_100056438 3300005578 Bacteria 2830
331 Ga0068856_100000020 3300005614 Bacteria 146775
332 Ga0068856_100010469 3300005614 Bacteria 9003
333 Ga0068856_100021168 3300005614 Bacteria 6317
334 Ga0068856_100039666 3300005614 Bacteria 4623
335 Ga0068856_100276730 3300005614 Bacteria 1695
336 Ga0068856_100291136 3300005614 Bacteria 1650
337 Ga0070702_100001050 3300005615 Bacteria 11000
338 Ga0068852_100001019 3300005616 Bacteria 18512
339 Ga0068852_100002168 3300005616 Bacteria 13456
340 Ga0068852_100002288 3300005616 Bacteria 13173
341 Ga0068852_100038925 3300005616 Bacteria 4000
342 Ga0068852_100046632 3300005616 Bacteria 3693
343 Ga0068852_100052790 3300005616 Bacteria 3495
344 Ga0068852_100059057 3300005616 Bacteria 3325
345 Ga0068852_100093147 3300005616 Bacteria 2700
346 Ga0068852_100383865 3300005616 Bacteria 1378
347 Ga0068859_100045113 3300005617 Bacteria 4429
348 Ga0068859_100067415 3300005617 Bacteria 3613
349 Ga0068859_100231421 3300005617 Bacteria 1936
350 Ga0068864_100004079 3300005618 Bacteria 11994
351 Ga0068864_100241508 3300005618 Bacteria 1674
352 Ga0068866_10002039 3300005718 Bacteria 8408
353 Ga0068861_100005424 3300005719 Bacteria 8634
354 Ga0068861_100011655 3300005719 Bacteria 6117
355 Ga0068861_100124311 3300005719 Bacteria 2085
356 Ga0068861_100303730 3300005719 Bacteria 1383
357 Ga0068851_10001344 3300005834 Bacteria 10741
358 Ga0068851_10007440 3300005834 Bacteria 5028
359 Ga0068851_10071673 3300005834 Bacteria 1794
360 Ga0068870_10000442 3300005840 Bacteria 15715
361 Ga0068863_100022454 3300005841 Bacteria 6026
362 Ga0068858_100000657 3300005842 Bacteria 36147
363 Ga0068858_100024985 3300005842 Bacteria 5560
364 Ga0068858_100025080 3300005842 Bacteria 5549
365 Ga0068858_100051225 3300005842 Bacteria 3820
366 Ga0068858_100152855 3300005842 Bacteria 2170
367 Ga0068858_100258627 3300005842 Bacteria 1654
368 Ga0068860_100000633 3300005843 Bacteria 41450
369 Ga0068860_100012235 3300005843 Bacteria 8456
370 Ga0068860_100029184 3300005843 Bacteria 5306
371 Ga0068860_100140686 3300005843 Bacteria 2319
372 Ga0068862_100002115 3300005844 Bacteria 17901
373 Ga0068862_100084095 3300005844 Bacteria 2764
374 Ga0068862_100123886 3300005844 Bacteria 2281
375 Ga0068862_100154356 3300005844 Bacteria 2045
376 Ga0081455_10000012 3300005937 Bacteria 201668
377 Ga0081455_10000678 3300005937 Bacteria 44138
378 Ga0081455_10001814 3300005937 Bacteria 25739
379 Ga0081455_10005602 3300005937 Bacteria 13727
380 Ga0081455_10008012 3300005937 Bacteria 11039
381 Ga0081455_10011296 3300005937 Bacteria 8984
382 Ga0081455_10044146 3300005937 Bacteria 3892
383 Ga0081455_10056922 3300005937 Bacteria 3317
384 Ga0081455_10067121 3300005937 Bacteria 2991
385 Ga0081455_10071109 3300005937 Bacteria 2885
386 Ga0081455_10240205 3300005937 Bacteria 1332
387 Ga0081538_10005596 3300005981 Bacteria 11277
388 Ga0081538_10011536 3300005981 Bacteria 7152
389 Ga0081538_10053242 3300005981 Bacteria 2408
390 Ga0081538_10059528 3300005981 Bacteria 2205
391 Ga0081540_1000019 3300005983 Bacteria 163281
392 Ga0081540_1000933 3300005983 Bacteria 26285
393 Ga0081540_1001603 3300005983 Bacteria 19287
394 Ga0081540_1001730 3300005983 Bacteria 18408
395 Ga0081540_1002812 3300005983 Bacteria 14092
396 Ga0081540_1004950 3300005983 Bacteria 10015
397 Ga0081540_1011886 3300005983 Bacteria 5779
398 Ga0081540_1024213 3300005983 Bacteria 3528
399 Ga0081540_1027590 3300005983 Bacteria 3212
400 Ga0081540_1047883 3300005983 Bacteria 2146
401 Ga0081539_10000059 3300005985 Bacteria 254888
402 Ga0081539_10000140 3300005985 Bacteria 166746
403 Ga0081539_10000862 3300005985 Bacteria 58119
404 Ga0081539_10002946 3300005985 Bacteria 22393
405 Ga0081539_10003950 3300005985 Bacteria 17174
406 Ga0081539_10008084 3300005985 Bacteria 9306
407 Ga0081539_10041228 3300005985 Bacteria 2700
408 Ga0081539_10044663 3300005985 Bacteria 2556
409 Ga0070717_10000720 3300006028 Bacteria 21477
410 Ga0070717_10002391 3300006028 Bacteria 13228
411 Ga0070717_10004566 3300006028 Bacteria 10020
412 Ga0070717_10012075 3300006028 Bacteria 6581
413 Ga0070717_10101140 3300006028 Bacteria 2448
414 Ga0070717_10121488 3300006028 Bacteria 2238
415 Ga0070717_10124748 3300006028 Bacteria 2210
416 Ga0070717_10126620 3300006028 Bacteria 2193
417 Ga0070717_10175268 3300006028 Bacteria 1867
418 Ga0075365_10019560 3300006038 Bacteria 4182
419 Ga0075365_10093037 3300006038 Bacteria 2056
420 Ga0075368_10014679 3300006042 Bacteria 2898
421 Ga0075368_10024855 3300006042 Bacteria 2296
422 Ga0075368_10037252 3300006042 Bacteria 1902
423 Ga0075363_100025038 3300006048 Bacteria 3039
424 Ga0075363_100087500 3300006048 Bacteria 1711
425 Ga0075364_10004310 3300006051 Bacteria 8166
426 Ga0075364_10066064 3300006051 Bacteria 2375
427 Ga0075432_10002045 3300006058 Bacteria 6716
428 Ga0075432_10011462 3300006058 Bacteria 3011
429 Ga0070715_10002602 3300006163 Bacteria 5578
430 Ga0070715_10012885 3300006163 Bacteria 3057
431 Ga0070716_100003115 3300006173 Bacteria 7747
432 Ga0070716_100004945 3300006173 Bacteria 6414
433 Ga0070712_100000405 3300006175 Bacteria 24580
434 Ga0070712_100006221 3300006175 Bacteria 7388
435 Ga0070712_100084821 3300006175 Bacteria 2304
436 Ga0070712_100096644 3300006175 Bacteria 2175
437 Ga0075362_10010694 3300006177 Bacteria 3591
438 Ga0075362_10026595 3300006177 Bacteria 2473
439 Ga0075362_10065967 3300006177 Bacteria 1644
440 Ga0075367_10000606 3300006178 Bacteria 13778
441 Ga0075367_10027570 3300006178 Bacteria 3233
442 Ga0075367_10031335 3300006178 Bacteria 3053
443 Ga0075369_10005848 3300006186 Bacteria 4623
444 Ga0075427_10000374 3300006194 Bacteria 4961
445 Ga0075366_10052684 3300006195 Bacteria 2417
446 Ga0075366_10064748 3300006195 Bacteria 2174
447 Ga0097621_100000568 3300006237 Bacteria 25929
448 Ga0097621_100031502 3300006237 Bacteria 4209
449 Ga0097621_100122529 3300006237 Bacteria 2207
450 Ga0097621_100159633 3300006237 Bacteria 1937
451 Ga0097621_100252451 3300006237 Bacteria 1545
452 Ga0075370_10015666 3300006353 Bacteria 4064
453 Ga0075370_10022235 3300006353 Bacteria 3480
454 Ga0068871_100000203 3300006358 Bacteria 41063
455 Ga0068871_100034225 3300006358 Bacteria 4030
456 Ga0075428_100001488 3300006844 Bacteria 25069
457 Ga0075428_100001638 3300006844 Bacteria 23879
458 Ga0075428_100001971 3300006844 Bacteria 22113
459 Ga0075428_100007729 3300006844 Bacteria 11915
460 Ga0075428_100045691 3300006844 Bacteria 4812
461 Ga0075430_100000132 3300006846 Bacteria 47593
462 Ga0075430_100000251 3300006846 Bacteria 37229
463 Ga0075430_100024107 3300006846 Bacteria 5180
464 Ga0075430_100072799 3300006846 Bacteria 2881
465 Ga0075430_100102368 3300006846 Bacteria 2391
466 Ga0075431_100000504 3300006847 Bacteria 32639
467 Ga0075431_100001119 3300006847 Bacteria 24014
468 Ga0075431_100006760 3300006847 Bacteria 11391
469 Ga0075431_100017432 3300006847 Bacteria 7297
470 Ga0075431_100050893 3300006847 Bacteria 4271
471 Ga0075431_100099529 3300006847 Bacteria 3000
472 Ga0075431_100115251 3300006847 Bacteria 2774
473 Ga0075431_100236707 3300006847 Bacteria 1858
474 Ga0075431_100269808 3300006847 Bacteria 1725
475 Ga0075433_10000152 3300006852 Bacteria 37183
476 Ga0075433_10038769 3300006852 Bacteria 4116
477 Ga0075433_10053555 3300006852 Bacteria 3519
478 Ga0075434_100003370 3300006871 Bacteria 14305
479 Ga0075434_100022796 3300006871 Bacteria 6097
480 Ga0075434_100025594 3300006871 Bacteria 5773
481 Ga0075434_100036086 3300006871 Bacteria 4889
482 Ga0075434_100044526 3300006871 Bacteria 4402
483 Ga0075434_100133060 3300006871 Bacteria 2506
484 Ga0075434_100176158 3300006871 Bacteria 2159
485 Ga0075434_100270499 3300006871 Bacteria 1719
486 Ga0075429_100000459 3300006880 Bacteria 30370
487 Ga0075429_100000855 3300006880 Bacteria 23955
488 Ga0075429_100002649 3300006880 Bacteria 15053
489 Ga0075429_100029010 3300006880 Bacteria 4804
490 Ga0075429_100105058 3300006880 Bacteria 2467
491 Ga0075429_100292969 3300006880 Bacteria 1425
492 Ga0068865_100000155 3300006881 Bacteria 37357
493 Ga0068865_100024484 3300006881 Bacteria 3961
494 Ga0068865_100103481 3300006881 Bacteria 2088
495 Ga0068865_100130394 3300006881 Bacteria 1883
496 Ga0075436_100003747 3300006914 Bacteria 10419
497 Ga0075436_100013840 3300006914 Bacteria 5525
498 Ga0097620_100045113 3300006931 Bacteria 4429
499 Ga0097620_100067407 3300006931 Bacteria 3613
500 Ga0097620_100068299 3300006931 Bacteria 3589
501 Ga0097620_100231398 3300006931 Bacteria 1936
502 Ga0099825_1023236 3300006941 Bacteria 3840
503 Ga0099824_1011525 3300006942 Bacteria 9966
504 Ga0099824_1016950 3300006942 Bacteria 6464
505 Ga0099822_1002297 3300006943 Bacteria 23658
506 Ga0079104_1000013 3300006946 Bacteria 349477
507 Ga0079104_1004572 3300006946 Bacteria 5849
508 Ga0079104_1015986 3300006946 Bacteria 2207
509 Ga0075435_100008956 3300007076 Bacteria 7216
510 Ga0075435_100008983 3300007076 Bacteria 7207
511 Ga0075435_100020212 3300007076 Bacteria 5097
512 Ga0075435_100089012 3300007076 Bacteria 2545
513 Ga0075435_100128461 3300007076 Bacteria 2120
514 Ga0105251_10013625 3300009011 Bacteria 4541
515 Ga0105244_10022126 3300009036 Bacteria 3502
516 Ga0105240_10009843 3300009093 Bacteria 13490
517 Ga0105240_10011032 3300009093 Bacteria 12637
518 Ga0105240_10038752 3300009093 Bacteria 6110
519 Ga0105240_10070355 3300009093 Bacteria 4328
520 Ga0105240_10117923 3300009093 Bacteria 3199
521 Ga0105240_10132741 3300009093 Bacteria 2985
522 Ga0105240_10335532 3300009093 Bacteria 1719
523 Ga0111539_10000114 3300009094 Bacteria 88757
524 Ga0111539_10000367 3300009094 Bacteria 55719
525 Ga0111539_10000673 3300009094 Bacteria 44168
526 Ga0111539_10002196 3300009094 Bacteria 26061
527 Ga0111539_10005040 3300009094 Bacteria 17161
528 Ga0111539_10010049 3300009094 Bacteria 11929
529 Ga0111539_10025425 3300009094 Bacteria 7259
530 Ga0111539_10036276 3300009094 Bacteria 5964
531 Ga0111539_10058399 3300009094 Bacteria 4577
532 Ga0111539_10097831 3300009094 Bacteria 3447
533 Ga0111539_10108668 3300009094 Bacteria 3255
534 Ga0111539_10122343 3300009094 Bacteria 3050
535 Ga0111539_10172350 3300009094 Bacteria 2528
536 Ga0105245_10001558 3300009098 Bacteria 20810
537 Ga0105245_10043604 3300009098 Bacteria 4001
538 Ga0105245_10124344 3300009098 Bacteria 2413
539 Ga0105245_10316628 3300009098 Bacteria 1536
540 Ga0105247_10012387 3300009101 Bacteria 5120
541 Ga0105247_10152833 3300009101 Bacteria 1522
542 Ga0114129_10000593 3300009147 Bacteria 44778
543 Ga0114129_10007730 3300009147 Bacteria 15296
544 Ga0114129_10012376 3300009147 Bacteria 12146
545 Ga0114129_10016320 3300009147 Bacteria 10571
546 Ga0114129_10022324 3300009147 Bacteria 8983
547 Ga0114129_10037856 3300009147 Bacteria 6808
548 Ga0114129_10081687 3300009147 Bacteria 4492
549 Ga0114129_10126328 3300009147 Bacteria 3516
550 Ga0114129_10379780 3300009147 Bacteria 1866
551 Ga0114129_10530940 3300009147 Bacteria 1533
552 Ga0105243_10000960 3300009148 Bacteria 26967
553 Ga0105243_10016776 3300009148 Bacteria 5536
554 Ga0105243_10019267 3300009148 Bacteria 5173
555 Ga0105241_10001324 3300009174 Bacteria 18806
556 Ga0105241_10002167 3300009174 Bacteria 14788
557 Ga0105241_10002458 3300009174 Bacteria 13919
558 Ga0105241_10034550 3300009174 Bacteria 3799
559 Ga0105241_10108268 3300009174 Bacteria 2221
560 Ga0105241_10237971 3300009174 Bacteria 1538
561 Ga0105242_10001412 3300009176 Bacteria 18927
562 Ga0105242_10134459 3300009176 Bacteria 2138
563 Ga0105242_10329696 3300009176 Bacteria 1403
564 Ga0105248_10001378 3300009177 Bacteria 27081
565 Ga0105248_10004213 3300009177 Bacteria 15908
566 Ga0105248_10009339 3300009177 Bacteria 10798
567 Ga0105248_10038312 3300009177 Bacteria 5364
568 Ga0105248_10048628 3300009177 Bacteria 4758
569 Ga0105248_10124692 3300009177 Bacteria 2906
570 Ga0105248_10130378 3300009177 Bacteria 2836
571 Ga0105248_10326079 3300009177 Bacteria 1730
572 Ga0105248_10631395 3300009177 Bacteria 1208
573 Ga0105237_10007091 3300009545 Bacteria 12319
574 Ga0105237_10010293 3300009545 Bacteria 9963
575 Ga0105237_10034611 3300009545 Bacteria 5114
576 Ga0105237_10043126 3300009545 Bacteria 4546
577 Ga0105237_10052821 3300009545 Bacteria 4078
578 Ga0105237_10053424 3300009545 Bacteria 4052
579 Ga0105237_10080663 3300009545 Bacteria 3244
580 Ga0105237_10085649 3300009545 Bacteria 3141
581 Ga0105237_10368426 3300009545 Bacteria 1441
582 Ga0105238_10000006 3300009551 Bacteria 346249
583 Ga0105238_10025766 3300009551 Bacteria 5997
584 Ga0105238_10038823 3300009551 Bacteria 4835
585 Ga0105238_10075539 3300009551 Bacteria 3361
586 Ga0105238_10092943 3300009551 Bacteria 3004
587 Ga0105249_10000925 3300009553 Bacteria 25945
588 Ga0105249_10000930 3300009553 Bacteria 25901
589 Ga0105249_10008708 3300009553 Bacteria 8847
590 Ga0105249_10212680 3300009553 Bacteria 1898
591 Ga0099796_10009432 3300010159 Bacteria 2642
592 Ga0105239_10003131 3300010375 Bacteria 20532
593 Ga0105239_10009354 3300010375 Bacteria 11062
594 Ga0105239_10010180 3300010375 Bacteria 10534
595 Ga0105239_10033065 3300010375 Bacteria 5681
596 Ga0105239_10033364 3300010375 Bacteria 5654
597 Ga0105239_10053228 3300010375 Bacteria 4440
598 Ga0105239_10089057 3300010375 Bacteria 3403
599 Ga0105239_10097520 3300010375 Bacteria 3249
600 Ga0105239_10118722 3300010375 Bacteria 2935
601 Ga0105239_10122398 3300010375 Bacteria 2890
602 Ga0105239_10123931 3300010375 Bacteria 2871
603 Ga0105239_10163330 3300010375 Bacteria 2489
604 Ga0105239_10178685 3300010375 Bacteria 2374
605 Ga0105239_10281271 3300010375 Bacteria 1873
606 Ga0105239_10447064 3300010375 Bacteria 1466
607 Ga0105246_10029413 3300011119 Bacteria 3618
608 Ga0105246_10036496 3300011119 Bacteria 3293
609 Ga0105246_10049577 3300011119 Bacteria 2876
610 Ga0105246_10077053 3300011119 Bacteria 2364
611 Ga0105246_10179703 3300011119 Bacteria 1628
612 Ga0157342_1000469 3300012507 Bacteria 2468
613 Ga0157326_1003442 3300012513 Bacteria 1665
614 Ga0157373_10011335 3300013100 Bacteria 6555
615 Ga0157373_10011392 3300013100 Bacteria 6539
616 Ga0157373_10020149 3300013100 Bacteria 4851
617 Ga0157373_10058571 3300013100 Bacteria 2731
618 Ga0157373_10139478 3300013100 Bacteria 1705
619 Ga0157371_10000268 3300013102 Bacteria 70868
620 Ga0157371_10002137 3300013102 Bacteria 19248
621 Ga0157371_10004410 3300013102 Bacteria 12300
622 Ga0157370_10006303 3300013104 Bacteria 13111
623 Ga0157370_10009085 3300013104 Bacteria 10660
624 Ga0157370_10013966 3300013104 Bacteria 8247
625 Ga0157370_10031648 3300013104 Bacteria 5173
626 Ga0157370_10056849 3300013104 Bacteria 3723
627 Ga0157370_10159190 3300013104 Bacteria 2101
628 Ga0157369_10018324 3300013105 Bacteria 7851
629 Ga0157369_10058415 3300013105 Bacteria 4161
630 Ga0157369_10082850 3300013105 Bacteria 3432
631 Ga0157369_10391079 3300013105 Bacteria 1443
632 Ga0171462_1007 3300013250 Bacteria 417698
633 Ga0157374_10006983 3300013296 Bacteria 9610
634 Ga0157374_10081595 3300013296 Bacteria 3069
635 Ga0157374_10185883 3300013296 Bacteria 2031
636 Ga0157378_10006990 3300013297 Bacteria 9847
637 Ga0157378_10013694 3300013297 Bacteria 7094
638 Ga0157378_10056690 3300013297 Bacteria 3492
639 Ga0163162_10002587 3300013306 Bacteria 17132
640 Ga0163162_10007934 3300013306 Bacteria 10351
641 Ga0163162_10062058 3300013306 Bacteria 3777
642 Ga0163162_10068389 3300013306 Bacteria 3603
643 Ga0163162_10171987 3300013306 Bacteria 2291
644 Ga0157372_10038427 3300013307 Bacteria 5282
645 Ga0157372_10053251 3300013307 Bacteria 4509
646 Ga0157372_10068346 3300013307 Bacteria 3994
647 Ga0157372_10236564 3300013307 Bacteria 2118
648 Ga0157372_10274136 3300013307 Bacteria 1961
649 Ga0157372_10309064 3300013307 Bacteria 1840
650 Ga0157375_10000697 3300013308 Bacteria 29707
651 Ga0157375_10006290 3300013308 Bacteria 10341
652 Ga0157375_10019881 3300013308 Bacteria 6122
653 Ga0157375_10042254 3300013308 Bacteria 4411
654 Ga0157375_10153889 3300013308 Bacteria 2437
655 Ga0157375_10157330 3300013308 Bacteria 2412
656 Ga0163163_10002553 3300014325 Bacteria 15424
657 Ga0163163_10020492 3300014325 Bacteria 6227
658 Ga0163163_10022591 3300014325 Bacteria 5961
659 Ga0163163_10036664 3300014325 Bacteria 4765
660 Ga0163163_10073045 3300014325 Bacteria 3420
661 Ga0157380_10002235 3300014326 Bacteria 13019
662 Ga0157380_10022132 3300014326 Bacteria 4779
663 Ga0182008_10022719 3300014497 Bacteria 3211
664 Ga0157377_10000454 3300014745 Bacteria 17664
665 Ga0157377_10018242 3300014745 Bacteria 3645
666 Ga0157379_10000539 3300014968 Bacteria 30568
667 Ga0157379_10087747 3300014968 Bacteria 2789
668 Ga0157379_10221421 3300014968 Bacteria 1715
669 Ga0157376_10001949 3300014969 Bacteria 13795
670 Ga0157376_10023925 3300014969 Bacteria 4790
671 Ga0157376_10048612 3300014969 Bacteria 3509
672 Ga0157376_10114658 3300014969 Bacteria 2378
673 Ga0182006_1023156 3300015261 Bacteria 2574
674 Ga0182006_1026458 3300015261 Bacteria 2375
675 Ga0182006_1039122 3300015261 Bacteria 1873
676 Ga0163161_10001235 3300017792 Bacteria 19165
677 Ga0163161_10027620 3300017792 Bacteria 4027
678 Ga0163161_10080174 3300017792 Bacteria 2402
679 Ga0163161_10194839 3300017792 Bacteria 1559
680 Ga0206356_11768000 3300020070 Bacteria 4419
681 Ga0214544_1000002 3300021320 Bacteria 753857
682 Ga0214542_1000001 3300021321 Bacteria 1018696
683 Ga0214545_1000001 3300021324 Bacteria 1092817
684 Ga0214543_1000001 3300021327 Bacteria 776921
685 Ga0213872_10003952 3300021361 Bacteria 8008
686 Ga0213872_10055816 3300021361 Bacteria 1790
687 Ga0213874_10008081 3300021377 Bacteria 2551
688 Ga0213876_10001306 3300021384 Bacteria 15675
689 Ga0213876_10002183 3300021384 Bacteria 11561
690 Ga0213876_10010793 3300021384 Bacteria 4894
691 Ga0213876_10073389 3300021384 Bacteria 1807
692 Ga0213875_10000036 3300021388 Bacteria 166707
693 Ga0213875_10002463 3300021388 Bacteria 11047
694 Ga0213875_10003211 3300021388 Bacteria 9390
695 Ga0213875_10021442 3300021388 Bacteria 3095
696 Ga0213875_10021972 3300021388 Bacteria 3054
697 Ga0213871_10001174 3300021441 Bacteria 4205
698 Ga0213871_10009084 3300021441 Bacteria 2214
699 Ga0224712_10040306 3300022467 Bacteria 1757
700 Ga0224712_10065997 3300022467 Bacteria 1456
701 Ga0228711_1000007 3300022739 Bacteria 202413
702 Ga0228710_1000007 3300022740 Bacteria 189104
703 Ga0224572_1000531 3300024225 Bacteria 4621
704 Ga0228598_1000795 3300024227 Bacteria 6784
705 Ga0209435_100018 3300025206 Bacteria 274625
706 Ga0209435_100240 3300025206 Bacteria 14674
707 Ga0209784_100009 3300025224 Bacteria 688031
708 Ga0209566_100007 3300025225 Bacteria 688031
709 Ga0209674_100018 3300025226 Bacteria 688031
710 Ga0209672_101842 3300025228 Bacteria 6376
711 Ga0209147_100051 3300025229 Bacteria 274605
712 Ga0209563_100020 3300025230 Bacteria 688031
713 Ga0209437_101200 3300025233 Bacteria 7546
714 Ga0209258_101977 3300025242 Bacteria 5949
715 Ga0209646_1000172 3300025246 Bacteria 84840
716 Ga0209646_1000186 3300025246 Bacteria 77615
717 Ga0209026_1000005 3300025250 Bacteria 731387
718 Ga0209026_1000042 3300025250 Bacteria 273111
719 Ga0209677_100010 3300025253 Bacteria 688031
720 Ga0209677_101018 3300025253 Bacteria 13392
721 Ga0209148_1000056 3300025254 Bacteria 363380
722 Ga0209148_1000475 3300025254 Bacteria 42476
723 Ga0209148_1006213 3300025254 Bacteria 2615
724 Ga0209759_1000538 3300025256 Bacteria 39836
725 Ga0209759_1000547 3300025256 Bacteria 38694
726 Ga0209759_1000933 3300025256 Bacteria 21089
727 Ga0209233_1000068 3300025261 Bacteria 377969
728 Ga0209233_1002185 3300025261 Bacteria 7325
729 Ga0209233_1003457 3300025261 Bacteria 5564
730 Ga0209233_1004993 3300025261 Bacteria 4458
731 Ga0209233_1025477 3300025261 Bacteria 1462
732 Ga0207666_1000037 3300025271 Bacteria 27148
733 Ga0207666_1000419 3300025271 Bacteria 5538
734 Ga0209455_1000238 3300025272 Bacteria 68798
735 Ga0209455_1001687 3300025272 Bacteria 9461
736 Ga0209455_1002135 3300025272 Bacteria 7850
737 Ga0209455_1009858 3300025272 Bacteria 2472
738 Ga0209130_1001022 3300025284 Bacteria 21581
739 Ga0207673_1000102 3300025290 Bacteria 7698
740 Ga0209675_1000633 3300025291 Bacteria 25016
741 Ga0209676_1003848 3300025292 Bacteria 8798
742 Ga0209025_1000017 3300025294 Bacteria 768983
743 Ga0209025_1000227 3300025294 Bacteria 132244
744 Ga0209025_1000291 3300025294 Bacteria 112755
745 Ga0209025_1015469 3300025294 Bacteria 4598
746 Ga0209025_1015993 3300025294 Bacteria 4469
747 Ga0209564_1000031 3300025295 Bacteria 494703
748 Ga0209564_1000082 3300025295 Bacteria 261494
749 Ga0209564_1001979 3300025295 Bacteria 17989
750 Ga0209564_1016460 3300025295 Bacteria 2941
751 Ga0209758_1000140 3300025297 Bacteria 174267
752 Ga0209758_1001460 3300025297 Bacteria 27753
753 Ga0209758_1002072 3300025297 Bacteria 21375
754 Ga0209758_1003468 3300025297 Bacteria 14294
755 Ga0209758_1006144 3300025297 Bacteria 8800
756 Ga0209758_1011521 3300025297 Bacteria 5106
757 Ga0209050_1000142 3300025298 Bacteria 172356
758 Ga0209050_1000671 3300025298 Bacteria 51908
759 Ga0209256_1000033 3300025299 Bacteria 393924
760 Ga0209256_1000130 3300025299 Bacteria 163227
761 Ga0209256_1001059 3300025299 Bacteria 31924
762 Ga0209256_1004348 3300025299 Bacteria 8979
763 Ga0209256_1031562 3300025299 Bacteria 1447
764 Ga0207426_1000434 3300025302 Bacteria 68127
765 Ga0207426_1000855 3300025302 Bacteria 32019
766 Ga0207426_1018849 3300025302 Bacteria 2423
767 Ga0207426_1025686 3300025302 Bacteria 1981
768 Ga0209051_1000035 3300025303 Bacteria 346999
769 Ga0209051_1000544 3300025303 Bacteria 46205
770 Ga0209257_1000494 3300025304 Bacteria 70693
771 Ga0209257_1001932 3300025304 Bacteria 22369
772 Ga0207697_10000293 3300025315 Bacteria 27911
773 Ga0207656_10005412 3300025321 Bacteria 4510
774 Ga0207656_10009022 3300025321 Bacteria 3696
775 Ga0207656_10026610 3300025321 Bacteria 2360
776 Ga0207713_1029023 3300025735 Bacteria 2485
777 Ga0207653_10016484 3300025885 Bacteria 2321
778 Ga0207682_10000081 3300025893 Bacteria 42361
779 Ga0207682_10001282 3300025893 Bacteria 11542
780 Ga0207692_10000504 3300025898 Bacteria 13779
781 Ga0207692_10013638 3300025898 Bacteria 3531
782 Ga0207692_10014597 3300025898 Bacteria 3435
783 Ga0207692_10030702 3300025898 Bacteria 2566
784 Ga0207692_10038782 3300025898 Bacteria 2339
785 Ga0207692_10040515 3300025898 Bacteria 2299
786 Ga0207692_10119510 3300025898 Bacteria 1473
787 Ga0207642_10004660 3300025899 Bacteria 4428
788 Ga0207642_10005716 3300025899 Bacteria 4080
789 Ga0207642_10063847 3300025899 Bacteria 1724
790 Ga0207710_10006913 3300025900 Bacteria 4828
791 Ga0207710_10048821 3300025900 Bacteria 1895
792 Ga0207710_10083539 3300025900 Bacteria 1485
793 Ga0207688_10000487 3300025901 Bacteria 19060
794 Ga0207688_10002068 3300025901 Bacteria 10784
795 Ga0207680_10119664 3300025903 Bacteria 1720
796 Ga0207680_10129668 3300025903 Bacteria 1660
797 Ga0207647_10001362 3300025904 Bacteria 18775
798 Ga0207647_10004059 3300025904 Bacteria 10903
799 Ga0207647_10007664 3300025904 Bacteria 7779
800 Ga0207647_10010142 3300025904 Bacteria 6663
801 Ga0207647_10013913 3300025904 Bacteria 5569
802 Ga0207647_10024727 3300025904 Bacteria 3958
803 Ga0207647_10125778 3300025904 Bacteria 1509
804 Ga0207685_10061965 3300025905 Bacteria 1485
805 Ga0207685_10078370 3300025905 Bacteria 1360
806 Ga0207699_10000508 3300025906 Bacteria 19334
807 Ga0207699_10010294 3300025906 Bacteria 4687
808 Ga0207699_10014968 3300025906 Bacteria 4017
809 Ga0207645_10000792 3300025907 Bacteria 26448
810 Ga0207645_10007259 3300025907 Bacteria 7842
811 Ga0207645_10017134 3300025907 Bacteria 4785
812 Ga0207645_10029304 3300025907 Bacteria 3550
813 Ga0207643_10000392 3300025908 Bacteria 29123
814 Ga0207643_10000657 3300025908 Bacteria 21585
815 Ga0207705_10011559 3300025909 Bacteria 6383
816 Ga0207705_10035072 3300025909 Bacteria 3589
817 Ga0207705_10075031 3300025909 Bacteria 2455
818 Ga0207684_10036233 3300025910 Bacteria 4188
819 Ga0207654_10002172 3300025911 Bacteria 10047
820 Ga0207654_10023733 3300025911 Bacteria 3290
821 Ga0207654_10049566 3300025911 Bacteria 2409
822 Ga0207654_10064204 3300025911 Bacteria 2158
823 Ga0207707_10002890 3300025912 Bacteria 15331
824 Ga0207707_10005173 3300025912 Bacteria 11433
825 Ga0207707_10011878 3300025912 Bacteria 7576
826 Ga0207707_10011983 3300025912 Bacteria 7538
827 Ga0207707_10018389 3300025912 Bacteria 6092
828 Ga0207707_10021037 3300025912 Bacteria 5698
829 Ga0207707_10028853 3300025912 Bacteria 4849
830 Ga0207707_10043434 3300025912 Bacteria 3921
831 Ga0207707_10089849 3300025912 Bacteria 2684
832 Ga0207707_10116613 3300025912 Bacteria 2333
833 Ga0207707_10123314 3300025912 Bacteria 2266
834 Ga0207707_10164977 3300025912 Bacteria 1936
835 Ga0207707_10215466 3300025912 Bacteria 1672
836 Ga0207707_10219240 3300025912 Bacteria 1656
837 Ga0207707_10301618 3300025912 Bacteria 1385
838 Ga0207695_10000008 3300025913 Bacteria 1058268
839 Ga0207695_10005095 3300025913 Bacteria 17608
840 Ga0207695_10012818 3300025913 Bacteria 10040
841 Ga0207695_10030124 3300025913 Bacteria 5979
842 Ga0207695_10034276 3300025913 Bacteria 5524
843 Ga0207695_10079160 3300025913 Bacteria 3332
844 Ga0207695_10140481 3300025913 Bacteria 2364
845 Ga0207695_10198453 3300025913 Bacteria 1922
846 Ga0207671_10003541 3300025914 Bacteria 15487
847 Ga0207671_10018613 3300025914 Bacteria 5322
848 Ga0207671_10040346 3300025914 Bacteria 3456
849 Ga0207671_10043529 3300025914 Bacteria 3320
850 Ga0207693_10000581 3300025915 Bacteria 32715
851 Ga0207693_10002467 3300025915 Bacteria 16076
852 Ga0207693_10002907 3300025915 Bacteria 14826
853 Ga0207693_10004238 3300025915 Bacteria 12158
854 Ga0207693_10004411 3300025915 Bacteria 11896
855 Ga0207693_10008804 3300025915 Bacteria 8248
856 Ga0207693_10011407 3300025915 Bacteria 7195
857 Ga0207693_10027698 3300025915 Bacteria 4479
858 Ga0207693_10051877 3300025915 Bacteria 3217
859 Ga0207693_10070059 3300025915 Bacteria 2744
860 Ga0207693_10081644 3300025915 Bacteria 2531
861 Ga0207693_10118274 3300025915 Bacteria 2081
862 Ga0207663_10000084 3300025916 Bacteria 44454
863 Ga0207663_10000732 3300025916 Bacteria 14686
864 Ga0207663_10020836 3300025916 Bacteria 3721
865 Ga0207660_10007083 3300025917 Bacteria 7262
866 Ga0207660_10015824 3300025917 Bacteria 4985
867 Ga0207660_10026809 3300025917 Bacteria 3927
868 Ga0207660_10036904 3300025917 Bacteria 3400
869 Ga0207660_10080994 3300025917 Bacteria 2385
870 Ga0207660_10167024 3300025917 Bacteria 1701
871 Ga0207660_10185145 3300025917 Bacteria 1619
872 Ga0207662_10003086 3300025918 Bacteria 8502
873 Ga0207662_10013452 3300025918 Bacteria 4578
874 Ga0207662_10038307 3300025918 Bacteria 2809
875 Ga0207657_10001069 3300025919 Bacteria 29010
876 Ga0207657_10004955 3300025919 Bacteria 14013
877 Ga0207657_10047517 3300025919 Bacteria 3752
878 Ga0207657_10061319 3300025919 Bacteria 3225
879 Ga0207657_10070879 3300025919 Bacteria 2953
880 Ga0207657_10141441 3300025919 Bacteria 1966
881 Ga0207649_10001901 3300025920 Bacteria 11923
882 Ga0207649_10032314 3300025920 Bacteria 3119
883 Ga0207652_10006216 3300025921 Bacteria 9644
884 Ga0207652_10011506 3300025921 Bacteria 7134
885 Ga0207652_10019271 3300025921 Bacteria 5609
886 Ga0207652_10024457 3300025921 Bacteria 5011
887 Ga0207652_10024840 3300025921 Bacteria 4973
888 Ga0207652_10149044 3300025921 Bacteria 2094
889 Ga0207646_10005334 3300025922 Bacteria 13548
890 Ga0207646_10083857 3300025922 Bacteria 2850
891 Ga0207681_10000738 3300025923 Bacteria 21439
892 Ga0207681_10204761 3300025923 Bacteria 1517
893 Ga0207681_10264669 3300025923 Bacteria 1347
894 Ga0207694_10000050 3300025924 Bacteria 159920
895 Ga0207694_10000110 3300025924 Bacteria 85854
896 Ga0207694_10011528 3300025924 Bacteria 6671
897 Ga0207694_10035357 3300025924 Bacteria 3832
898 Ga0207694_10065780 3300025924 Bacteria 2827
899 Ga0207694_10135037 3300025924 Bacteria 1980
900 Ga0207694_10258981 3300025924 Bacteria 1425
901 Ga0207650_10002215 3300025925 Bacteria 13575
902 Ga0207650_10005378 3300025925 Bacteria 8733
903 Ga0207650_10010692 3300025925 Bacteria 6304
904 Ga0207650_10159713 3300025925 Bacteria 1785
905 Ga0207650_10178404 3300025925 Bacteria 1692
906 Ga0207659_10000288 3300025926 Bacteria 30505
907 Ga0207659_10034549 3300025926 Bacteria 3487
908 Ga0207659_10039801 3300025926 Bacteria 3282
909 Ga0207659_10044513 3300025926 Bacteria 3123
910 Ga0207659_10169141 3300025926 Bacteria 1723
911 Ga0207687_10000520 3300025927 Bacteria 25824
912 Ga0207687_10007944 3300025927 Bacteria 6947
913 Ga0207687_10047813 3300025927 Bacteria 2967
914 Ga0207687_10185784 3300025927 Bacteria 1614
915 Ga0207687_10208913 3300025927 Bacteria 1530
916 Ga0207700_10003137 3300025928 Bacteria 9542
917 Ga0207700_10008693 3300025928 Bacteria 6308
918 Ga0207700_10015401 3300025928 Bacteria 5044
919 Ga0207700_10018117 3300025928 Bacteria 4723
920 Ga0207700_10020581 3300025928 Bacteria 4485
921 Ga0207700_10073707 3300025928 Bacteria 2637
922 Ga0207700_10084327 3300025928 Bacteria 2490
923 Ga0207700_10101369 3300025928 Bacteria 2297
924 Ga0207700_10120743 3300025928 Bacteria 2124
925 Ga0207664_10016357 3300025929 Bacteria 5410
926 Ga0207664_10018977 3300025929 Bacteria 5074
927 Ga0207664_10029248 3300025929 Bacteria 4195
928 Ga0207664_10039092 3300025929 Bacteria 3682
929 Ga0207664_10054997 3300025929 Bacteria 3156
930 Ga0207664_10083524 3300025929 Bacteria 2604
931 Ga0207664_10160779 3300025929 Bacteria 1915
932 Ga0207644_10006166 3300025931 Bacteria 7816
933 Ga0207644_10009382 3300025931 Bacteria 6427
934 Ga0207644_10010162 3300025931 Bacteria 6200
935 Ga0207644_10020651 3300025931 Bacteria 4482
936 Ga0207644_10066682 3300025931 Bacteria 2621
937 Ga0207690_10000953 3300025932 Bacteria 18524
938 Ga0207690_10020076 3300025932 Bacteria 4123
939 Ga0207690_10051950 3300025932 Bacteria 2743
940 Ga0207690_10105442 3300025932 Bacteria 2021
941 Ga0207706_10009006 3300025933 Bacteria 9185
942 Ga0207706_10020589 3300025933 Bacteria 5928
943 Ga0207706_10022836 3300025933 Bacteria 5613
944 Ga0207706_10025278 3300025933 Bacteria 5322
945 Ga0207706_10026762 3300025933 Bacteria 5163
946 Ga0207706_10034150 3300025933 Bacteria 4525
947 Ga0207686_10004859 3300025934 Bacteria 7224
948 Ga0207709_10004590 3300025935 Bacteria 7946
949 Ga0207709_10009427 3300025935 Bacteria 5372
950 Ga0207709_10092041 3300025935 Bacteria 1984
951 Ga0207670_10000731 3300025936 Bacteria 17259
952 Ga0207670_10002332 3300025936 Bacteria 9942
953 Ga0207670_10016264 3300025936 Bacteria 4466
954 Ga0207670_10085361 3300025936 Bacteria 2218
955 Ga0207670_10096410 3300025936 Bacteria 2103
956 Ga0207669_10000538 3300025937 Bacteria 16538
957 Ga0207669_10007894 3300025937 Bacteria 4960
958 Ga0207669_10014485 3300025937 Bacteria 3953
959 Ga0207669_10020048 3300025937 Bacteria 3496
960 Ga0207704_10001761 3300025938 Bacteria 9683
961 Ga0207704_10008415 3300025938 Bacteria 4932
962 Ga0207704_10118292 3300025938 Bacteria 1807
963 Ga0207704_10131047 3300025938 Bacteria 1736
964 Ga0207704_10185300 3300025938 Bacteria 1508
965 Ga0207665_10001296 3300025939 Bacteria 16883
966 Ga0207665_10001463 3300025939 Bacteria 15900
967 Ga0207665_10002892 3300025939 Bacteria 11522
968 Ga0207665_10003511 3300025939 Bacteria 10469
969 Ga0207665_10017491 3300025939 Bacteria 4712
970 Ga0207665_10024541 3300025939 Bacteria 3976
971 Ga0207665_10125079 3300025939 Bacteria 1820
972 Ga0207665_10180038 3300025939 Bacteria 1530
973 Ga0207691_10001399 3300025940 Bacteria 24140
974 Ga0207691_10001984 3300025940 Bacteria 20012
975 Ga0207691_10018717 3300025940 Bacteria 6561
976 Ga0207691_10048406 3300025940 Bacteria 3898
977 Ga0207711_10002344 3300025941 Bacteria 16966
978 Ga0207711_10010081 3300025941 Bacteria 7855
979 Ga0207711_10022179 3300025941 Bacteria 5309
980 Ga0207711_10024759 3300025941 Bacteria 5034
981 Ga0207711_10034149 3300025941 Bacteria 4308
982 Ga0207689_10000503 3300025942 Bacteria 36892
983 Ga0207689_10003495 3300025942 Bacteria 14359
984 Ga0207689_10010214 3300025942 Bacteria 8089
985 Ga0207661_10001274 3300025944 Bacteria 16851
986 Ga0207661_10036312 3300025944 Bacteria 3845
987 Ga0207661_10044111 3300025944 Bacteria 3522
988 Ga0207679_10007046 3300025945 Bacteria 7128
989 Ga0207679_10093556 3300025945 Bacteria 2332
990 Ga0207679_10159422 3300025945 Bacteria 1846
991 Ga0207667_10002525 3300025949 Bacteria 22786
992 Ga0207667_10005244 3300025949 Bacteria 15813
993 Ga0207667_10006325 3300025949 Bacteria 14350
994 Ga0207667_10012846 3300025949 Bacteria 9622
995 Ga0207667_10021610 3300025949 Bacteria 7129
996 Ga0207667_10046023 3300025949 Bacteria 4619
997 Ga0207667_10054142 3300025949 Bacteria 4220
998 Ga0207667_10115861 3300025949 Bacteria 2762
999 Ga0207651_10012345 3300025960 Bacteria 4830
1000 Ga0207651_10012534 3300025960 Bacteria 4803
1001 Ga0207651_10014181 3300025960 Bacteria 4593
1002 Ga0207651_10040996 3300025960 Bacteria 3069
1003 Ga0207651_10104472 3300025960 Bacteria 2111
1004 Ga0207712_10001942 3300025961 Bacteria 13572
1005 Ga0207712_10005326 3300025961 Bacteria 8123
1006 Ga0207712_10028620 3300025961 Bacteria 3729
1007 Ga0207712_10239083 3300025961 Bacteria 1462
1008 Ga0207668_10003473 3300025972 Bacteria 9247
1009 Ga0207668_10025269 3300025972 Bacteria 3842
1010 Ga0207668_10028713 3300025972 Bacteria 3640
1011 Ga0207668_10045029 3300025972 Bacteria 3006
1012 Ga0207668_10057581 3300025972 Bacteria 2712
1013 Ga0207640_10007626 3300025981 Bacteria 5974
1014 Ga0207640_10046659 3300025981 Bacteria 2790
1015 Ga0207640_10050100 3300025981 Bacteria 2707
1016 Ga0207658_10012739 3300025986 Bacteria 5744
1017 Ga0207658_10349489 3300025986 Bacteria 1287
1018 Ga0207677_10002538 3300026023 Bacteria 9574
1019 Ga0207677_10047395 3300026023 Bacteria 2885
1020 Ga0207677_10096948 3300026023 Bacteria 2159
1021 Ga0207703_10001883 3300026035 Bacteria 18645
1022 Ga0207703_10013028 3300026035 Bacteria 6480
1023 Ga0207703_10064594 3300026035 Bacteria 3005
1024 Ga0207703_10113385 3300026035 Bacteria 2317
1025 Ga0207639_10002783 3300026041 Bacteria 11742
1026 Ga0207639_10008102 3300026041 Bacteria 7185
1027 Ga0207639_10009386 3300026041 Bacteria 6747
1028 Ga0207639_10010395 3300026041 Bacteria 6445
1029 Ga0207639_10150609 3300026041 Bacteria 1948
1030 Ga0207639_10216561 3300026041 Bacteria 1651
1031 Ga0207678_10001725 3300026067 Bacteria 20014
1032 Ga0207678_10004088 3300026067 Bacteria 13123
1033 Ga0207678_10009392 3300026067 Bacteria 8605
1034 Ga0207678_10027585 3300026067 Bacteria 4955
1035 Ga0207678_10048870 3300026067 Bacteria 3655
1036 Ga0207678_10069767 3300026067 Bacteria 3013
1037 Ga0207678_10104634 3300026067 Bacteria 2415
1038 Ga0207678_10147494 3300026067 Bacteria 2008
1039 Ga0207708_10000547 3300026075 Bacteria 28999
1040 Ga0207708_10004170 3300026075 Bacteria 10623
1041 Ga0207708_10007309 3300026075 Bacteria 8167
1042 Ga0207702_10000002 3300026078 Bacteria 491507
1043 Ga0207702_10000126 3300026078 Bacteria 90550
1044 Ga0207702_10004224 3300026078 Bacteria 12831
1045 Ga0207702_10023264 3300026078 Bacteria 5138
1046 Ga0207702_10032072 3300026078 Bacteria 4383
1047 Ga0207702_10061307 3300026078 Bacteria 3208
1048 Ga0207702_10236649 3300026078 Bacteria 1709
1049 Ga0207702_10326981 3300026078 Bacteria 1461
1050 Ga0207641_10003985 3300026088 Bacteria 12890
1051 Ga0207648_10001178 3300026089 Bacteria 29263
1052 Ga0207648_10001416 3300026089 Bacteria 26440
1053 Ga0207648_10038200 3300026089 Bacteria 4225
1054 Ga0207648_10045343 3300026089 Bacteria 3857
1055 Ga0207648_10098110 3300026089 Bacteria 2565
1056 Ga0207648_10125780 3300026089 Bacteria 2255
1057 Ga0207648_10126834 3300026089 Bacteria 2245
1058 Ga0207676_10001299 3300026095 Bacteria 18580
1059 Ga0207676_10002095 3300026095 Bacteria 14448
1060 Ga0207676_10054111 3300026095 Bacteria 3144
1061 Ga0207676_10071537 3300026095 Bacteria 2785
1062 Ga0207676_10100799 3300026095 Bacteria 2393
1063 Ga0207676_10167048 3300026095 Bacteria 1913
1064 Ga0207676_10417416 3300026095 Bacteria 1258
1065 Ga0207674_10007592 3300026116 Bacteria 12635
1066 Ga0207674_10042017 3300026116 Bacteria 4725
1067 Ga0207674_10046689 3300026116 Bacteria 4445
1068 Ga0207674_10079786 3300026116 Bacteria 3276
1069 Ga0207674_10086147 3300026116 Bacteria 3136
1070 Ga0207674_10204712 3300026116 Bacteria 1923
1071 Ga0207674_10355247 3300026116 Bacteria 1417
1072 Ga0207675_100000190 3300026118 Bacteria 55772
1073 Ga0207675_100002065 3300026118 Bacteria 20012
1074 Ga0207675_100016489 3300026118 Bacteria 6899
1075 Ga0207675_100023453 3300026118 Bacteria 5740
1076 Ga0207683_10000069 3300026121 Bacteria 78741
1077 Ga0207683_10002867 3300026121 Bacteria 15038
1078 Ga0207683_10014712 3300026121 Bacteria 6664
1079 Ga0207683_10020473 3300026121 Bacteria 5658
1080 Ga0207683_10042619 3300026121 Bacteria 3964
1081 Ga0207683_10073526 3300026121 Bacteria 3024
1082 Ga0207683_10078716 3300026121 Bacteria 2921
1083 Ga0207683_10088268 3300026121 Bacteria 2759
1084 Ga0207683_10092545 3300026121 Bacteria 2694
1085 Ga0207683_10113164 3300026121 Bacteria 2431
1086 Ga0207698_10006596 3300026142 Bacteria 7257
1087 Ga0207698_10027648 3300026142 Bacteria 4030
1088 Ga0207698_10029389 3300026142 Bacteria 3936
1089 Ga0207698_10073697 3300026142 Bacteria 2720
1090 Ga0207698_10110754 3300026142 Bacteria 2300
1091 Ga0209281_1000076 3300027111 Bacteria 263350
1092 Ga0209281_1000128 3300027111 Bacteria 199265
1093 Ga0209281_1000496 3300027111 Bacteria 53494
1094 Ga0209281_1007629 3300027111 Bacteria 2701
1095 Ga0209389_1000040 3300027296 Bacteria 124256
1096 Ga0209389_1000123 3300027296 Bacteria 70041
1097 Ga0209371_1000022 3300027312 Bacteria 536342
1098 Ga0209371_1002845 3300027312 Bacteria 9157
1099 Ga0209589_1000001 3300027357 Bacteria 794224
1100 Ga0209589_1000036 3300027357 Bacteria 131278
1101 Ga0209969_1002406 3300027360 Bacteria 2586
1102 Ga0209489_100001 3300027361 Bacteria 794224
1103 Ga0209489_100006 3300027361 Bacteria 475698
1104 Ga0209700_100001 3300027363 Bacteria 794224
1105 Ga0209700_100005 3300027363 Bacteria 573969
1106 Ga0209999_1003561 3300027543 Bacteria 2790
1107 Ga0210002_1001002 3300027617 Bacteria 3909
1108 Ga0209282_1000039 3300027666 Bacteria 128517
1109 Ga0209282_1000100 3300027666 Bacteria 59184
1110 Ga0209971_1004787 3300027682 Bacteria 3215
1111 Ga0209966_1000576 3300027695 Bacteria 8921
1112 Ga0209998_10000606 3300027717 Bacteria 9633
1113 Ga0209998_10002913 3300027717 Bacteria 3832
1114 Ga0209813_10013666 3300027866 Bacteria 2172
1115 Ga0209974_10046815 3300027876 Bacteria 1447
1116 Ga0207428_10000198 3300027907 Bacteria 84187
1117 Ga0207428_10000312 3300027907 Bacteria 64494
1118 Ga0207428_10000578 3300027907 Bacteria 43283
1119 Ga0207428_10000908 3300027907 Bacteria 33083
1120 Ga0207428_10008834 3300027907 Bacteria 9084
1121 Ga0207428_10051612 3300027907 Bacteria 3287
1122 Ga0268266_10059811 3300028379 Bacteria 3282
1123 Ga0268266_10103610 3300028379 Bacteria 2511
1124 Ga0268266_10173694 3300028379 Bacteria 1957
1125 Ga0268265_10065606 3300028380 Bacteria 2802
1126 Ga0268264_10000065 3300028381 Bacteria 298403
1127 Ga0268264_10004307 3300028381 Bacteria 12144
1128 Ga0268264_10051309 3300028381 Bacteria 3437
1129 Ga0265337_1002249 3300028556 Bacteria 8967
1130 Ga0265337_1002492 3300028556 Bacteria 8393
1131 Ga0265326_10011167 3300028558 Bacteria 2651
1132 Ga0265334_10001756 3300028573 Bacteria 10354
1133 Ga0265334_10032169 3300028573 Bacteria 2093
1134 Ga0265318_10004183 3300028577 Bacteria 7049
1135 Ga0265323_10001892 3300028653 Bacteria 9875
1136 Ga0265322_10019041 3300028654 Bacteria 1971
1137 Ga0265336_10001788 3300028666 Bacteria 9401
1138 Ga0307517_10000008 3300028786 Bacteria 243202
1139 Ga0265338_10000321 3300028800 Bacteria 87046
1140 Ga0265338_10022608 3300028800 Bacteria 6501
1141 Ga0265338_10033094 3300028800 Bacteria 5025
1142 Ga0265338_10143091 3300028800 Bacteria 1870
1143 Ga0265324_10002078 3300029957 Bacteria 10605
1144 Ga0268256_1000019 3300030500 Bacteria 587949
1145 Ga0268256_1004441 3300030500 Bacteria 5813
1146 Ga0307511_10075112 3300030521 Bacteria 2429
1147 Ga0316181_1006667 3300030744 Bacteria 2660
1148 Ga0265760_10014211 3300031090 Bacteria 2279
1149 Ga0265332_10004954 3300031238 Bacteria 6189
1150 Ga0265320_10042368 3300031240 Bacteria 2258
1151 Ga0265325_10000004 3300031241 Bacteria 347347
1152 Ga0265325_10000172 3300031241 Bacteria 45954
1153 Ga0265325_10003859 3300031241 Bacteria 9628
1154 Ga0265325_10005573 3300031241 Bacteria 7766
1155 Ga0265325_10008790 3300031241 Bacteria 5936
1156 Ga0265325_10023370 3300031241 Bacteria 3376
1157 Ga0265325_10082433 3300031241 Bacteria 1596
1158 Ga0265325_10122730 3300031241 Bacteria 1250
1159 Ga0265340_10000674 3300031247 Bacteria 19133
1160 Ga0265340_10013956 3300031247 Bacteria 4209
1161 Ga0265340_10017773 3300031247 Bacteria 3678
1162 Ga0265340_10034740 3300031247 Bacteria 2507
1163 Ga0265340_10038971 3300031247 Bacteria 2348
1164 Ga0265340_10047672 3300031247 Bacteria 2085
1165 Ga0265339_10000330 3300031249 Bacteria 38106
1166 Ga0265339_10003099 3300031249 Bacteria 11697
1167 Ga0265339_10004140 3300031249 Bacteria 9989
1168 Ga0265339_10009592 3300031249 Bacteria 6066
1169 Ga0265339_10019287 3300031249 Bacteria 4008
1170 Ga0265339_10046228 3300031249 Bacteria 2394
1171 Ga0265331_10009183 3300031250 Bacteria 5575
1172 Ga0265331_10022871 3300031250 Bacteria 3184
1173 Ga0265316_10057734 3300031344 Bacteria 3025
1174 Ga0265316_10114951 3300031344 Bacteria 2035
1175 Ga0265316_10245546 3300031344 Bacteria 1316
1176 Ga0307513_10002722 3300031456 Bacteria 24331
1177 Ga0307513_10035190 3300031456 Bacteria 5607
1178 Ga0307513_10062899 3300031456 Bacteria 3920
1179 Ga0307513_10102323 3300031456 Bacteria 2884
1180 Ga0307513_10322657 3300031456 Bacteria 1302
1181 Ga0307509_10089892 3300031507 Bacteria 3147
1182 Ga0307509_10244860 3300031507 Bacteria 1582
1183 Ga0307408_100090426 3300031548 Unclassified 2310
1184 Ga0265313_10000176 3300031595 Bacteria 68037
1185 Ga0265313_10000572 3300031595 Bacteria 38438
1186 Ga0265313_10002253 3300031595 Bacteria 16951
1187 Ga0265313_10008621 3300031595 Bacteria 6745
1188 Ga0265313_10016010 3300031595 Bacteria 4334
1189 Ga0265313_10016397 3300031595 Bacteria 4260
1190 Ga0265313_10042830 3300031595 Bacteria 2220
1191 Ga0265313_10087204 3300031595 Bacteria 1407
1192 Ga0307508_10000018 3300031616 Bacteria 202701
1193 Ga0307508_10080781 3300031616 Bacteria 2833
1194 Ga0307508_10158279 3300031616 Bacteria 1868
1195 Ga0316575_10041734 3300031665 Bacteria 1815
1196 Ga0265314_10001133 3300031711 Bacteria 30864
1197 Ga0265314_10002100 3300031711 Bacteria 20973
1198 Ga0265314_10009137 3300031711 Bacteria 8412
1199 Ga0265314_10014338 3300031711 Bacteria 6350
1200 Ga0265314_10024621 3300031711 Bacteria 4561
1201 Ga0265314_10088673 3300031711 Bacteria 2019
1202 Ga0265314_10104967 3300031711 Bacteria 1808
1203 Ga0265342_10000148 3300031712 Bacteria 79748
1204 Ga0265342_10000196 3300031712 Bacteria 67364
1205 Ga0265342_10005459 3300031712 Bacteria 9682
1206 Ga0265342_10015115 3300031712 Bacteria 5091
1207 Ga0307516_10014561 3300031730 Bacteria 8313
1208 Ga0307516_10066954 3300031730 Bacteria 3462
1209 Ga0307516_10071784 3300031730 Bacteria 3323
1210 Ga0307413_10005951 3300031824 Bacteria 5514
1211 Ga0307410_10006626 3300031852 Bacteria 6268
1212 Ga0307410_10151734 3300031852 Bacteria 1726
1213 Ga0307406_10062745 3300031901 Bacteria 2405
1214 Ga0307407_10105260 3300031903 Bacteria 1760
1215 Ga0307407_10143414 3300031903 Bacteria 1544
1216 Ga0307412_10001651 3300031911 Bacteria 12316
1217 Ga0307412_10165201 3300031911 Bacteria 1650
1218 Ga0315914_1000010 3300031967 Bacteria 171642
1219 Ga0307409_100107636 3300031995 Bacteria 2329
1220 Ga0307409_100157231 3300031995 Bacteria 1983
1221 Ga0307409_100276336 3300031995 Bacteria 1550
1222 Ga0307414_10031373 3300032004 Unclassified 3485
1223 Ga0307414_10070407 3300032004 Bacteria 2519
1224 Ga0307411_10041309 3300032005 Bacteria 2933
1225 Ga0307411_10229286 3300032005 Bacteria 1446
1226 Ga0307507_10024914 3300033179 Bacteria 6503
1227 Ga0307510_10002813 3300033180 Bacteria 19952
1228 Ga0307510_10020196 3300033180 Bacteria 7791
1229 Ga0307510_10061161 3300033180 Bacteria 3865
1230 Ga0307510_10067745 3300033180 Bacteria 3590
1231 Ga0315913_1000005 3300033430 Bacteria 171651
1232 Ga0315911_1000006 3300033442 Bacteria 414563
1233 Ga0315915_1000012 3300033464 Bacteria 199284
1234 Ga0373930_0000062 3300034816 Bacteria 10314
1235 Ga0373948_0000051 3300034817 Bacteria 12492
1236 Ga0373950_0000418 3300034818 Bacteria 5189
1237 Ga0373950_0001085 3300034818 Bacteria 3475
1238 Ga0373950_0002232 3300034818 Bacteria 2644
1239 Ga0373958_0000123 3300034819 Bacteria 8540
1240 Ga0373959_0000191 3300034820 Bacteria 13735
1241 Ga0373938_0000141 3300034957 Bacteria 10420
1242 Ga0373938_0000287 3300034957 Bacteria 8101
1243 Ga0373926_0014543 3300035083 Bacteria 2676
1244 Ga0373926_0023841 3300035083 Bacteria 2127
1245 Ga0373928_0003217 3300035084 Bacteria 3126
1246 Ga0373929_0001387 3300035085 Bacteria 4642
1247 Ga0373929_0012687 3300035085 Bacteria 1605
1248 Ga0373934_0004739 3300035086 Bacteria 5029
1249 Ga0373934_0011693 3300035086 Bacteria 3305
1250 Ga0373934_0070997 3300035086 Bacteria 1393
1251 Ga0373940_0000365 3300035088 Bacteria 6788
1252 Ga0373940_0008793 3300035088 Bacteria 2328
1253 Ga0373944_0003497 3300035089 Bacteria 4059
1254 Ga0373944_0008808 3300035089 Bacteria 2727
1255 Ga0373944_0009077 3300035089 Bacteria 2690
1256 Ga0373944_0023567 3300035089 Bacteria 1797
1257 Ga0373944_0037297 3300035089 Bacteria 1488
1258 Ga0373949_0004024 3300035090 Bacteria 3408
1259 Ga0373949_0007442 3300035090 Bacteria 2397
1260 Ga0373951_0001019 3300035091 Bacteria 7538
1261 Ga0373952_0000465 3300035092 Bacteria 7082
1262 Ga0373952_0002504 3300035092 Bacteria 3309
1263 Ga0373952_0010270 3300035092 Bacteria 1807
1264 Ga0373923_0003017 3300035111 Bacteria 5319
1265 Ga0373923_0003695 3300035111 Bacteria 4953
1266 Ga0373923_0006013 3300035111 Bacteria 4162
1267 Ga0373923_0012345 3300035111 Bacteria 3156
1268 Ga0373923_0013075 3300035111 Bacteria 3086
1269 Ga0373923_0017037 3300035111 Bacteria 2773
1270 Ga0373932_0000305 3300035112 Bacteria 14847
1271 Ga0373932_0001852 3300035112 Bacteria 5670
1272 Ga0373932_0026993 3300035112 Bacteria 1567
1273 Ga0373936_0000082 3300035113 Bacteria 35991
1274 Ga0373936_0000290 3300035113 Bacteria 16812
1275 Ga0373936_0000946 3300035113 Bacteria 10370
1276 Ga0373936_0007442 3300035113 Bacteria 4117
1277 Ga0373936_0012489 3300035113 Bacteria 3232
1278 Ga0373936_0013610 3300035113 Bacteria 3105
1279 Ga0373936_0014254 3300035113 Bacteria 3038
1280 Ga0373936_0057060 3300035113 Bacteria 1588
1281 Ga0373939_0000355 3300035114 Bacteria 11602
1282 Ga0373939_0003430 3300035114 Bacteria 3718
1283 Ga0373939_0005402 3300035114 Bacteria 3043
1284 Ga0373941_0001908 3300035115 Bacteria 4515
1285 Ga0373941_0002882 3300035115 Bacteria 3835
1286 Ga0373945_0005133 3300035116 Bacteria 4179
1287 Ga0373945_0034466 3300035116 Bacteria 1804
1288 Ga0373945_0059657 3300035116 Bacteria 1421
1289 Ga0373953_0006758 3300035117 Bacteria 3799
1290 Ga0373953_0010746 3300035117 Bacteria 3196
1291 Ga0373953_0026996 3300035117 Bacteria 2203
1292 Ga0373953_0035276 3300035117 Bacteria 1965
1293 Ga0373953_0052471 3300035117 Bacteria 1650
1294 Ga0373954_0003768 3300035118 Bacteria 6466
1295 Ga0373954_0006443 3300035118 Bacteria 5119
1296 Ga0373954_0009287 3300035118 Bacteria 4327
1297 Ga0373954_0009326 3300035118 Bacteria 4317
1298 Ga0373954_0012508 3300035118 Bacteria 3774
1299 Ga0373954_0012944 3300035118 Bacteria 3715
1300 Ga0373954_0035182 3300035118 Bacteria 2322
1301 Ga0373954_0085459 3300035118 Bacteria 1511
1302 Ga0373956_0005842 3300035119 Bacteria 4922
1303 Ga0373956_0027831 3300035119 Bacteria 2457
1304 Ga0373956_0037968 3300035119 Bacteria 2130
1305 Ga0373957_0003174 3300035120 Bacteria 4815
1306 Ga0373957_0003945 3300035120 Bacteria 4455
1307 Ga0373957_0029892 3300035120 Bacteria 1993
1308 Ga0373957_0046275 3300035120 Bacteria 1651
1309 Ga0373960_0000049 3300035121 Bacteria 16154
1310 Ga0373960_0000939 3300035121 Bacteria 6241
1311 Ga0373960_0006872 3300035121 Bacteria 2680
1312 Ga0373960_0012406 3300035121 Bacteria 2117
1313 Ga0373960_0015179 3300035121 Bacteria 1961
1314 Ga0373943_0000731 3300035170 Bacteria 14311
1315 Ga0373943_0001740 3300035170 Bacteria 9873
1316 Ga0373943_0009675 3300035170 Bacteria 4318
1317 Ga0373943_0032340 3300035170 Bacteria 2486
1318 Ga0373943_0066731 3300035170 Bacteria 1813
1319 Ga0373946_0001140 3300035171 Bacteria 9196
1320 Ga0373946_0004807 3300035171 Bacteria 4862
1321 Ga0373946_0012296 3300035171 Bacteria 3202
1322 Ga0373946_0014320 3300035171 Bacteria 2989
1323 Ga0373946_0042153 3300035171 Bacteria 1875
1324 Ga0373955_0000306 3300035172 Bacteria 20291
1325 Ga0373955_0004397 3300035172 Bacteria 6236
1326 Ga0373955_0020245 3300035172 Bacteria 3341
1327 Ga0373955_0027638 3300035172 Bacteria 2935
1328 Ga0373942_0000263 3300035207 Bacteria 14039
1329 Ga0373942_0002162 3300035207 Bacteria 4848
1330 Ga0373961_0000821 3300035241 Bacteria 10558
1331 Ga0373962_0000166 3300035242 Bacteria 14061
1332 Ga0373962_0001762 3300035242 Bacteria 5150
1333 Ga0373962_0004665 3300035242 Bacteria 3307
1334 Ga0373962_0006951 3300035242 Bacteria 2758
1335 Ga0316574_0004257 3300035398 Bacteria 7477
1336 Ga0373924_0000437 3300035410 Bacteria 12805
1337 Ga0373924_0005336 3300035410 Bacteria 4544
1338 Ga0373924_0008896 3300035410 Bacteria 3665
1339 Ga0373924_0025681 3300035410 Bacteria 2329
1340 Ga0373924_0033174 3300035410 Bacteria 2083
1341 Ga0373924_0054754 3300035410 Bacteria 1659
1342 Ga0373931_0000251 3300035691 Bacteria 22877
1343 Ga0373931_0002892 3300035691 Bacteria 7657
1344 Ga0373931_0003067 3300035691 Bacteria 7469
1345 Ga0373931_0003885 3300035691 Bacteria 6758
1346 Ga0373931_0006942 3300035691 Bacteria 5328
1347 Ga0373931_0007466 3300035691 Bacteria 5151
1348 Ga0373931_0014118 3300035691 Bacteria 3900
1349 Ga0373931_0058607 3300035691 Bacteria 2068
1350 Ga0373935_0000287 3300035692 Bacteria 24929
1351 Ga0373935_0000382 3300035692 Bacteria 22745
1352 Ga0373935_0004967 3300035692 Bacteria 7823
1353 Ga0373935_0012579 3300035692 Bacteria 5093
1354 Ga0373935_0019053 3300035692 Bacteria 4185
1355 Ga0373935_0025698 3300035692 Bacteria 3629
1356 Ga0373935_0032906 3300035692 Bacteria 3224
1357 Ga0373935_0103576 3300035692 Bacteria 1880
1358 Ga0373935_0107899 3300035692 Bacteria 1844
1359 Ga0373927_0001986 3300035695 Bacteria 15072
1360 Ga0373927_0002885 3300035695 Bacteria 12521
1361 Ga0373927_0003772 3300035695 Bacteria 10756
1362 Ga0373927_0006211 3300035695 Bacteria 8159
1363 Ga0373927_0006833 3300035695 Bacteria 7765
1364 Ga0373927_0024472 3300035695 Bacteria 3949
1365 Ga0373927_0027258 3300035695 Bacteria 3731
1366 Ga0373927_0034185 3300035695 Bacteria 3307
1367 Ga0373927_0035489 3300035695 Bacteria 3242
1368 Ga0373927_0048028 3300035695 Bacteria 2760
1369 Ga0373927_0049440 3300035695 Bacteria 2718
1370 Ga0373927_0057068 3300035695 Bacteria 2525
1371 Ga0373927_0120841 3300035695 Bacteria 1709
1372 Ga0373933_0000110 3300035724 Bacteria 52519
1373 Ga0373933_0002816 3300035724 Bacteria 9717
1374 Ga0373933_0004137 3300035724 Bacteria 7991
1375 Ga0373933_0005829 3300035724 Bacteria 6699
1376 Ga0373933_0006160 3300035724 Bacteria 6530
1377 Ga0373933_0008646 3300035724 Bacteria 5554
1378 Ga0373933_0020415 3300035724 Bacteria 3754
1379 Ga0373947_0000156 3300035725 Bacteria 36048
1380 Ga0373947_0001850 3300035725 Bacteria 12909
1381 Ga0373947_0002644 3300035725 Bacteria 10766
1382 Ga0373947_0004465 3300035725 Bacteria 8211
1383 Ga0373947_0004860 3300035725 Bacteria 7855
1384 Ga0373947_0005528 3300035725 Bacteria 7375
1385 Ga0373947_0008142 3300035725 Bacteria 6044
1386 Ga0373947_0011440 3300035725 Bacteria 5092
1387 Ga0373947_0012827 3300035725 Bacteria 4803
1388 Ga0373947_0022837 3300035725 Bacteria 3631
1389 Ga0373947_0042745 3300035725 Bacteria 2705
1390 Ga0373947_0088100 3300035725 Bacteria 1931
1391 Ga0373947_0101709 3300035725 Bacteria 1807
1392 Ga0373937_0000269 3300036401 Bacteria 50111
1393 Ga0373937_0003306 3300036401 Bacteria 13538
1394 Ga0373937_0007162 3300036401 Bacteria 9645
1395 Ga0373937_0007207 3300036401 Bacteria 9622
1396 Ga0373937_0008870 3300036401 Bacteria 8730
1397 Ga0373937_0012150 3300036401 Bacteria 7558
1398 Ga0373937_0022596 3300036401 Bacteria 5657
1399 Ga0373937_0023869 3300036401 Bacteria 5514
1400 Ga0373937_0039555 3300036401 Bacteria 4297
1401 Ga0373937_0046402 3300036401 Bacteria 3973
1402 Ga0373937_0048939 3300036401 Bacteria 3870
1403 Ga0373937_0052305 3300036401 Bacteria 3744
1404 Ga0373937_0122394 3300036401 Bacteria 2425
1405 Ga0373937_0191120 3300036401 Bacteria 1924
1406 Ga0373937_0203326 3300036401 Bacteria 1862
1407 Ga0373937_0205428 3300036401 Bacteria 1852
1408 Ga0373937_0393298 3300036401 Bacteria 1315
1409 Ga0373925_0000075 3300037068 Bacteria 105395
1410 Ga0373925_0002634 3300037068 Bacteria 14243
1411 Ga0373925_0002995 3300037068 Bacteria 13303
1412 Ga0373925_0025219 3300037068 Bacteria 4341
1413 Ga0373925_0030557 3300037068 Bacteria 3954
1414 Ga0373925_0050209 3300037068 Bacteria 3111
1415 Ga0373925_0058607 3300037068 Bacteria 2887
1416 Ga0373925_0076823 3300037068 Bacteria 2534
1417 Ga0373925_0122814 3300037068 Bacteria 2017
1418 Ga0373925_0161133 3300037068 Bacteria 1767
1419 Ga0373925_0161974 3300037068 Bacteria 1762
1420 Ga0373925_0209548 3300037068 Bacteria 1552
1421 Ga0395899_0000090 3300037312 Bacteria 156587
1422 Ga0395899_0021302 3300037312 Bacteria 4917
1423 Ga0395899_0031696 3300037312 Bacteria 3972
1424 Ga0395899_0141965 3300037312 Bacteria 1708
1425 Ga0395900_0000017 3300037418 Bacteria 369602
1426 Ga0395900_0000940 3300037418 Bacteria 38072
1427 Ga0395900_0034081 3300037418 Bacteria 5241
1428 Ga0395900_0147352 3300037418 Bacteria 2407
1429 Ga0395900_0206362 3300037418 Bacteria 1986
1430 Ga0395898_0000030 3300037466 Bacteria 369577
1431 Ga0395898_0029285 3300037466 Bacteria 5517
1432 Ga0395898_0029616 3300037466 Bacteria 5480
1433 Ga0395898_0032592 3300037466 Bacteria 5202
1434 Ga0395898_0061821 3300037466 Bacteria 3638
1435 Ga0395898_0079128 3300037466 Bacteria 3171
1436 Ga0395898_0118976 3300037466 Bacteria 2531
1437 Ga0395898_0140265 3300037466 Bacteria 2314
1438 Ga0395905_0000081 3300037471 Bacteria 160409
1439 Ga0395905_0004739 3300037471 Bacteria 14053
1440 Ga0395905_0005715 3300037471 Bacteria 12643
1441 Ga0395905_0030761 3300037471 Bacteria 5056
1442 Ga0395905_0079814 3300037471 Bacteria 3067
1443 Ga0395905_0180690 3300037471 Bacteria 1981
1444 Ga0436364_0010736 3300037853 Bacteria 24036
1445 Ga0436364_0281278 3300037853 Bacteria 34090
1446 Ga0436364_0400687 3300037853 Bacteria 4078
1447 Ga0436364_0409058 3300037853 Bacteria 2189
1448 Ga0436364_0529683 3300037853 Bacteria 5388
1449 Ga0436364_0612608 3300037853 Bacteria 3125
1450 Ga0436364_0711898 3300037853 Bacteria 3155
1451 Ga0436364_0777339 3300037853 Bacteria 3070
1452 Ga0436364_0817653 3300037853 Bacteria 49922
1453 Ga0436364_1320386 3300037853 Bacteria 1512
1454 Ga0436364_1385698 3300037853 Bacteria 2965
1455 Ga0395901_0000015 3300038443 Bacteria 373388
1456 Ga0395901_0000055 3300038443 Bacteria 157964
1457 Ga0395901_0024150 3300038443 Bacteria 6236
1458 Ga0395901_0050570 3300038443 Bacteria 4317
1459 Ga0395901_0051490 3300038443 Bacteria 4281
1460 Ga0395901_0072724 3300038443 Bacteria 3585
1461 Ga0395901_0083716 3300038443 Bacteria 3334
1462 Ga0395901_0132765 3300038443 Bacteria 2616
1463 Ga0395901_0338810 3300038443 Bacteria 1554
1464 Ga0395901_0353499 3300038443 Bacteria 1516
1465 Ga0400483_222177 3300039062 Bacteria 2165
1466 Ga0400483_222778 3300039062 Bacteria 11316
1467 Ga0400483_239471 3300039062 Bacteria 7323
1468 Ga0436365_0134733 3300039437 Bacteria 5028
1469 Ga0436365_0154683 3300039437 Bacteria 12355
1470 Ga0436365_1332159 3300039437 Bacteria 25414
1471 Ga0436365_1463106 3300039437 Bacteria 11734
1472 Ga0436365_1713855 3300039437 Bacteria 2438
1473 Ga0436365_1748556 3300039437 Bacteria 2728
1474 Ga0436365_1892050 3300039437 Bacteria 2719
1475 Ga0436360_0049575 3300039438 Bacteria 3015
1476 Ga0436360_0205335 3300039438 Bacteria 6585
1477 Ga0436360_0370851 3300039438 Bacteria 1646
1478 Ga0436360_0822831 3300039438 Bacteria 1631
1479 Ga0436360_1106222 3300039438 Bacteria 6379
1480 Ga0436361_0052401 3300039447 Bacteria 12376
1481 Ga0436361_0365828 3300039447 Bacteria 13089
1482 Ga0436361_1108010 3300039447 Bacteria 1528
1483 Ga0436363_0267009 3300039450 Bacteria 1257
1484 Ga0436363_0410105 3300039450 Bacteria 2479
1485 Ga0436363_0660862 3300039450 Bacteria 3711
1486 Ga0436363_0878076 3300039450 Bacteria 2174
1487 Ga0436363_1159398 3300039450 Bacteria 2747
1488 Ga0436363_1595676 3300039450 Bacteria 2940
1489 Ga0436362_0057416 3300039453 Bacteria 2387
1490 Ga0436362_1133249 3300039453 Bacteria 2638
1491 Ga0439453_0000022 3300041408 Bacteria 9833
1492 Ga0439465_0022466 3300041413 Bacteria 1982
1493 Ga0439449_0007041 3300042007 Bacteria 4283
1494 Ga0439462_0024753 3300042015 Bacteria 1579
1495 Ga0450894_014274 3300042131 Bacteria 1046
1496 Ga0450902_000021 3300042137 Bacteria 14340
1497 Ga0451577_0214895 3300042876 Bacteria 1738
1498 Ga0439440_0029940 3300042993 Bacteria 1280
1499 Ga0466972_0000160 3300044658 Bacteria 54154
1500 Ga0466972_0001455 3300044658 Bacteria 11506
1501 Ga0466972_0023293 3300044658 Bacteria 3080
1502 Ga0466972_0031030 3300044658 Bacteria 2630
1503 Ga0466973_0019539 3300044659 Bacteria 6459
1504 Ga0466977_0000186 3300044666 Bacteria 16059
1505 Ga0466965_0027283 3300044683 Bacteria 2771
1506 Ga0466966_0006283 3300044684 Bacteria 7861
1507 Ga0466966_0047612 3300044684 Bacteria 2733
1508 Ga0466961_0000154 3300044693 Bacteria 46518
1509 Ga0466961_0040920 3300044693 Bacteria 2971
1510 Ga0466961_0055444 3300044693 Bacteria 2527
1511 Ga0466961_0062880 3300044693 Bacteria 2358
1512 Ga0466961_0069702 3300044693 Bacteria 2232
1513 Ga0466961_0144001 3300044693 Bacteria 1491
1514 Ga0466963_0004891 3300044694 Bacteria 7811
1515 Ga0466963_0011092 3300044694 Bacteria 5480
1516 Ga0466963_0024315 3300044694 Bacteria 3856
1517 Ga0466963_0115850 3300044694 Bacteria 1842
1518 Ga0466963_0250084 3300044694 Bacteria 1244
1519 Ga0453684_0125689 3300044712 Bacteria 3087
1520 Ga0453684_0156952 3300044712 Bacteria 2696
1521 Ga0466968_0027966 3300044735 Bacteria 2322
1522 Ga0466968_0032688 3300044735 Bacteria 2165
1523 Ga0466957_0000233 3300044842 Bacteria 26263
1524 Ga0466957_0019829 3300044842 Bacteria 3958
1525 Ga0466957_0044390 3300044842 Bacteria 2693
1526 Ga0466957_0086419 3300044842 Bacteria 1960
1527 Ga0466960_0129397 3300044901 Bacteria 1331
1528 Ga0466959_0012963 3300045049 Bacteria 6035
1529 Ga0466959_0016488 3300045049 Bacteria 5399
1530 Ga0466959_0022731 3300045049 Bacteria 4635
1531 Ga0466959_0202610 3300045049 Bacteria 1381
1532 Ga0451576_0011255 3300045051 Bacteria 10184
1533 Ga0451576_0027106 3300045051 Bacteria 6158
1534 Ga0466958_0010635 3300045836 Bacteria 5160
1535 Ga0466958_0074628 3300045836 Bacteria 2079
1536 Ga0466958_0108940 3300045836 Bacteria 1728
1537 Ga0466967_0003827 3300045976 Bacteria 9960
1538 Ga0466967_0022912 3300045976 Bacteria 5107
1539 Ga0466967_0137698 3300045976 Bacteria 2271
1540 Ga0466967_0431118 3300045976 Bacteria 1286
1541 Ga0495627_001678 3300046453 Bacteria 12186
1542 Ga0495592_0000060 3300046454 Bacteria 100113
1543 Ga0495592_0001659 3300046454 Bacteria 15603
1544 Ga0495592_0002937 3300046454 Bacteria 12135
1545 Ga0495592_0016948 3300046454 Bacteria 5532
1546 Ga0495592_0039427 3300046454 Bacteria 3548
1547 Ga0495592_0053403 3300046454 Bacteria 2997
1548 Ga0495592_0082148 3300046454 Bacteria 2329
1549 Ga0495592_0107397 3300046454 Bacteria 1980
1550 Ga0495603_0006274 3300046455 Bacteria 7111
1551 Ga0495603_0008489 3300046455 Bacteria 6205
1552 Ga0495603_0009274 3300046455 Bacteria 5952
1553 Ga0495603_0030358 3300046455 Bacteria 3255
1554 Ga0495603_0168148 3300046455 Bacteria 1270
1555 Ga0495629_0000820 3300046459 Bacteria 25209
1556 Ga0495629_0001281 3300046459 Bacteria 19758
1557 Ga0495629_0004130 3300046459 Bacteria 10893
1558 Ga0495629_0005499 3300046459 Bacteria 9461
1559 Ga0495629_0021353 3300046459 Bacteria 4620
1560 Ga0495629_0041636 3300046459 Bacteria 3232
1561 Ga0495629_0070245 3300046459 Bacteria 2443
1562 Ga0495629_0138616 3300046459 Bacteria 1693
1563 Ga0495629_0156648 3300046459 Bacteria 1582
1564 Ga0495638_0034133 3300046460 Bacteria 3249
1565 Ga0495638_0047300 3300046460 Bacteria 2697
1566 Ga0495638_0112582 3300046460 Bacteria 1615
1567 Ga0495641_0013534 3300046461 Bacteria 4473
1568 Ga0495641_0020456 3300046461 Bacteria 3355
1569 Ga0495641_0033444 3300046461 Bacteria 2439
1570 Ga0495651_0000762 3300046462 Bacteria 24938
1571 Ga0495651_0000821 3300046462 Bacteria 24117
1572 Ga0495651_0004144 3300046462 Bacteria 11105
1573 Ga0495651_0008754 3300046462 Bacteria 7763
1574 Ga0495651_0029252 3300046462 Bacteria 4296
1575 Ga0495651_0048772 3300046462 Bacteria 3270
1576 Ga0495651_0175092 3300046462 Bacteria 1524
1577 Ga0495653_0000129 3300046463 Bacteria 62515
1578 Ga0495653_0002057 3300046463 Bacteria 15818
1579 Ga0495653_0002307 3300046463 Bacteria 15112
1580 Ga0495653_0010963 3300046463 Bacteria 7419
1581 Ga0495653_0063797 3300046463 Bacteria 2778
1582 Ga0495653_0211822 3300046463 Bacteria 1308
1583 Ga0495650_0026363 3300046471 Bacteria 2705
1584 Ga0495580_0006533 3300046472 Bacteria 9486
1585 Ga0495580_0010022 3300046472 Bacteria 7410
1586 Ga0495582_0002118 3300046473 Bacteria 11108
1587 Ga0495582_0002522 3300046473 Bacteria 10188
1588 Ga0495582_0037881 3300046473 Bacteria 2652
1589 Ga0495582_0051934 3300046473 Bacteria 2261
1590 Ga0495582_0098419 3300046473 Bacteria 1636
1591 Ga0495605_0101675 3300046474 Bacteria 1320
1592 Ga0495639_0000077 3300046475 Bacteria 46394
1593 Ga0495639_0039061 3300046475 Bacteria 2133
1594 Ga0495639_0067982 3300046475 Bacteria 1642
1595 Ga0495662_0000558 3300046476 Bacteria 17109
1596 Ga0495662_0001138 3300046476 Bacteria 13118
1597 Ga0495662_0003102 3300046476 Bacteria 8379
1598 Ga0495662_0005023 3300046476 Bacteria 6628
1599 Ga0495662_0024743 3300046476 Bacteria 2897
1600 Ga0495662_0070723 3300046476 Bacteria 1691
1601 Ga0495664_0000003 3300046477 Bacteria 551602
1602 Ga0495664_0000393 3300046477 Bacteria 21384
1603 Ga0495664_0008391 3300046477 Bacteria 5763
1604 Ga0495664_0015614 3300046477 Bacteria 4319
1605 Ga0495664_0037381 3300046477 Bacteria 2865
1606 Ga0495664_0057799 3300046477 Bacteria 2307
1607 Ga0495664_0082115 3300046477 Bacteria 1932
1608 Ga0495584_0033835 3300046491 Bacteria 2586
1609 Ga0495584_0052272 3300046491 Bacteria 2056
1610 Ga0495584_0060796 3300046491 Bacteria 1899
1611 Ga0495584_0090714 3300046491 Bacteria 1541
1612 Ga0495585_0001819 3300046492 Bacteria 16149
1613 Ga0495585_0015259 3300046492 Bacteria 4464
1614 Ga0495585_0148941 3300046492 Bacteria 1221
1615 Ga0495594_0004654 3300046499 Bacteria 7070
1616 Ga0495594_0008785 3300046499 Bacteria 5209
1617 Ga0495594_0035529 3300046499 Bacteria 2715
1618 Ga0495594_0036792 3300046499 Bacteria 2670
1619 Ga0495607_0000071 3300046501 Bacteria 100353
1620 Ga0495607_0000280 3300046501 Bacteria 54943
1621 Ga0495607_0015399 3300046501 Bacteria 4957
1622 Ga0495606_0001988 3300046507 Bacteria 25210
1623 Ga0495608_0000005 3300046511 Bacteria 350726
1624 Ga0495608_0000180 3300046511 Bacteria 45181
1625 Ga0495608_0000456 3300046511 Bacteria 28492
1626 Ga0495608_0022036 3300046511 Bacteria 4368
1627 Ga0495608_0035091 3300046511 Bacteria 3384
1628 Ga0495608_0060608 3300046511 Bacteria 2489
1629 Ga0495608_0111535 3300046511 Bacteria 1758
1630 Ga0495608_0131640 3300046511 Bacteria 1600
1631 Ga0495608_0170517 3300046511 Bacteria 1380
1632 Ga0495610_0035245 3300046512 Bacteria 2571
1633 Ga0495610_0063639 3300046512 Bacteria 1746
1634 Ga0495616_0010819 3300046513 Bacteria 5259
1635 Ga0495618_0000044 3300046514 Bacteria 95526
1636 Ga0495618_0004121 3300046514 Bacteria 8969
1637 Ga0495618_0004321 3300046514 Bacteria 8746
1638 Ga0495618_0008722 3300046514 Bacteria 6126
1639 Ga0495618_0088268 3300046514 Bacteria 1983
1640 Ga0495620_0033982 3300046515 Bacteria 2309
1641 Ga0495628_0000001 3300046516 Bacteria 917742
1642 Ga0495628_0001503 3300046516 Bacteria 21373
1643 Ga0495628_0022057 3300046516 Bacteria 5233
1644 Ga0495628_0047631 3300046516 Bacteria 3400
1645 Ga0495628_0055004 3300046516 Bacteria 3135
1646 Ga0495628_0069229 3300046516 Bacteria 2752
1647 Ga0495628_0069396 3300046516 Bacteria 2749
1648 Ga0495628_0117253 3300046516 Bacteria 2044
1649 Ga0495630_0000530 3300046517 Bacteria 28063
1650 Ga0495630_0001279 3300046517 Bacteria 17334
1651 Ga0495630_0011535 3300046517 Bacteria 6399
1652 Ga0495630_0029799 3300046517 Bacteria 4057
1653 Ga0495630_0035236 3300046517 Bacteria 3740
1654 Ga0495630_0080145 3300046517 Bacteria 2463
1655 Ga0495630_0085140 3300046517 Bacteria 2386
1656 Ga0495630_0173753 3300046517 Bacteria 1642
1657 Ga0495637_0034213 3300046520 Bacteria 2227
1658 Ga0495637_0034650 3300046520 Bacteria 2209
1659 Ga0495643_0021142 3300046522 Bacteria 3739
1660 Ga0495644_0000332 3300046523 Bacteria 21605
1661 Ga0495644_0009287 3300046523 Bacteria 3790
1662 Ga0495648_0004264 3300046524 Bacteria 12265
1663 Ga0495648_0006745 3300046524 Bacteria 9285
1664 Ga0495663_0009551 3300046525 Bacteria 2691
1665 Ga0495666_0006830 3300046526 Bacteria 5730
1666 Ga0495666_0015122 3300046526 Bacteria 3842
1667 Ga0495642_0014122 3300046528 Bacteria 3094
1668 Ga0495652_0000002 3300046529 Bacteria 946606
1669 Ga0495652_0002402 3300046529 Bacteria 19345
1670 Ga0495652_0003331 3300046529 Bacteria 15948
1671 Ga0495652_0005063 3300046529 Bacteria 12476
1672 Ga0495652_0010705 3300046529 Bacteria 8311
1673 Ga0495652_0051726 3300046529 Bacteria 3506
1674 Ga0495652_0057979 3300046529 Bacteria 3282
1675 Ga0495652_0155033 3300046529 Bacteria 1784
1676 Ga0495652_0174810 3300046529 Bacteria 1654
1677 Ga0495652_0208727 3300046529 Bacteria 1476
1678 Ga0495652_0305259 3300046529 Bacteria 1155
1679 Ga0495654_0044044 3300046530 Bacteria 2209
1680 Ga0495665_0005354 3300046531 Bacteria 6918
1681 Ga0495665_0007168 3300046531 Bacteria 6018
1682 Ga0495665_0052102 3300046531 Bacteria 2167
1683 Ga0495665_0085239 3300046531 Bacteria 1660
1684 Ga0495640_0000001 3300046533 Bacteria 853827
1685 Ga0495640_0001485 3300046533 Bacteria 18461
1686 Ga0495640_0004699 3300046533 Bacteria 10884
1687 Ga0495640_0009310 3300046533 Bacteria 7652
1688 Ga0495640_0010468 3300046533 Bacteria 7164
1689 Ga0495640_0018557 3300046533 Bacteria 5153
1690 Ga0495640_0030218 3300046533 Bacteria 3881
1691 Ga0495640_0036301 3300046533 Bacteria 3482
1692 Ga0495640_0080681 3300046533 Bacteria 2163
1693 Ga0495640_0127557 3300046533 Bacteria 1649
1694 Ga0495640_0149600 3300046533 Bacteria 1501
1695 Ga0495586_0025121 3300046535 Bacteria 3187
1696 Ga0495586_0034731 3300046535 Bacteria 2709
1697 Ga0495587_0000001 3300046536 Bacteria 724132
1698 Ga0495587_0006392 3300046536 Bacteria 7685
1699 Ga0495587_0006778 3300046536 Bacteria 7455
1700 Ga0495587_0009149 3300046536 Bacteria 6354
1701 Ga0495587_0016455 3300046536 Bacteria 4599
1702 Ga0495587_0055111 3300046536 Bacteria 2342
1703 Ga0495598_0004524 3300046537 Bacteria 3018
1704 Ga0495621_0039499 3300046539 Bacteria 1650
1705 Ga0495597_0044482 3300046542 Bacteria 1974
1706 Ga0495645_0000002 3300046543 Bacteria 651644
1707 Ga0495645_0000399 3300046543 Bacteria 30028
1708 Ga0495645_0000911 3300046543 Bacteria 20141
1709 Ga0495645_0016639 3300046543 Bacteria 5256
1710 Ga0495645_0021556 3300046543 Bacteria 4656
1711 Ga0495645_0054262 3300046543 Bacteria 2912
1712 Ga0495645_0064957 3300046543 Bacteria 2640
1713 Ga0495622_0001874 3300046557 Bacteria 10356
1714 Ga0495622_0011900 3300046557 Bacteria 4024
1715 Ga0495622_0015051 3300046557 Bacteria 3596
1716 Ga0495622_0021777 3300046557 Bacteria 2985
1717 Ga0495622_0094905 3300046557 Bacteria 1369
1718 Ga0495633_0002835 3300046558 Bacteria 11935
1719 Ga0495633_0018437 3300046558 Bacteria 3546
1720 Ga0495633_0039921 3300046558 Bacteria 2238
1721 Ga0495667_0000039 3300046559 Bacteria 131308
1722 Ga0495667_0000832 3300046559 Bacteria 19943
1723 Ga0495667_0003030 3300046559 Bacteria 11262
1724 Ga0495667_0033501 3300046559 Bacteria 3438
1725 Ga0495667_0039300 3300046559 Bacteria 3146
1726 Ga0495667_0040203 3300046559 Bacteria 3106
1727 Ga0495667_0053211 3300046559 Bacteria 2667
1728 Ga0495667_0056873 3300046559 Bacteria 2571
1729 Ga0495656_0000480 3300046615 Bacteria 12974
1730 Ga0495656_0005889 3300046615 Bacteria 4264
1731 Ga0495656_0009875 3300046615 Bacteria 3448
1732 Ga0495656_0010749 3300046615 Bacteria 3337
1733 Ga0495656_0025146 3300046615 Bacteria 2358
1734 Ga0495656_0034711 3300046615 Bacteria 2067
1735 Ga0495668_0066126 3300046616 Bacteria 1990
1736 Ga0495634_0000010 3300046642 Bacteria 143792
1737 Ga0495634_0001976 3300046642 Bacteria 17475
1738 Ga0495634_0007301 3300046642 Bacteria 8315
1739 Ga0495634_0011570 3300046642 Bacteria 6420
1740 Ga0495634_0022903 3300046642 Bacteria 4398
1741 Ga0495634_0069268 3300046642 Bacteria 2328
1742 Ga0495634_0078394 3300046642 Bacteria 2164
1743 Ga0495634_0126035 3300046642 Bacteria 1636
1744 Ga0495625_0001042 3300046660 Bacteria 36418
1745 Ga0495625_0060789 3300046660 Bacteria 2676
1746 Ga0495625_0159260 3300046660 Bacteria 1513
1747 Ga0495635_0000001 3300046663 Bacteria 704901
1748 Ga0495635_0002471 3300046663 Bacteria 12619
1749 Ga0495635_0014085 3300046663 Bacteria 5596
1750 Ga0495635_0014978 3300046663 Bacteria 5424
1751 Ga0495635_0017755 3300046663 Bacteria 4969
1752 Ga0495635_0027461 3300046663 Bacteria 3958
1753 Ga0495635_0027843 3300046663 Bacteria 3930
1754 Ga0495635_0034447 3300046663 Bacteria 3511
1755 Ga0495635_0100736 3300046663 Bacteria 1974
1756 Ga0495659_0014731 3300046664 Bacteria 2564
1757 Ga0495661_0003988 3300046665 Bacteria 10766
1758 Ga0495661_0022266 3300046665 Bacteria 4123
1759 Ga0495661_0110362 3300046665 Bacteria 1534
1760 Ga0495661_0144400 3300046665 Bacteria 1291
1761 Ga0495588_0001123 3300046674 Bacteria 11533
1762 Ga0495588_0001283 3300046674 Bacteria 10760
1763 Ga0495588_0046212 3300046674 Bacteria 2233
1764 Ga0495588_0050113 3300046674 Bacteria 2148
1765 Ga0495588_0097587 3300046674 Bacteria 1542
1766 Ga0495657_0000042 3300046675 Bacteria 114669
1767 Ga0495657_0008710 3300046675 Bacteria 7742
1768 Ga0495657_0015882 3300046675 Bacteria 5497
1769 Ga0495657_0016840 3300046675 Bacteria 5315
1770 Ga0495657_0059158 3300046675 Bacteria 2542
1771 Ga0495599_0000013 3300046678 Bacteria 179828
1772 Ga0495599_0003635 3300046678 Bacteria 9042
1773 Ga0495599_0005435 3300046678 Bacteria 7616
1774 Ga0495599_0010526 3300046678 Bacteria 5659
1775 Ga0495599_0060421 3300046678 Bacteria 2369
1776 Ga0495599_0094460 3300046678 Bacteria 1865
1777 Ga0495599_0139257 3300046678 Bacteria 1505
1778 Ga0495623_0000050 3300046679 Bacteria 72959
1779 Ga0495623_0000372 3300046679 Bacteria 29382
1780 Ga0495623_0009213 3300046679 Bacteria 6405
1781 Ga0495623_0009394 3300046679 Bacteria 6349
1782 Ga0495623_0010249 3300046679 Bacteria 6064
1783 Ga0495623_0017926 3300046679 Bacteria 4574
1784 Ga0495623_0026859 3300046679 Bacteria 3704
1785 Ga0495623_0147730 3300046679 Bacteria 1392
1786 Ga0495646_0000009 3300046680 Bacteria 200698
1787 Ga0495646_0001728 3300046680 Bacteria 13099
1788 Ga0495646_0013938 3300046680 Bacteria 5108
1789 Ga0495646_0015084 3300046680 Bacteria 4908
1790 Ga0495646_0021040 3300046680 Bacteria 4123
1791 Ga0495646_0024603 3300046680 Bacteria 3791
1792 Ga0495646_0025467 3300046680 Bacteria 3721
1793 Ga0495646_0028255 3300046680 Bacteria 3513
1794 Ga0495646_0071640 3300046680 Bacteria 2039
1795 Ga0495646_0074176 3300046680 Bacteria 1997
1796 Ga0495647_0000134 3300046681 Bacteria 18591
1797 Ga0495647_0012083 3300046681 Bacteria 2968
1798 Ga0495658_0000479 3300046683 Bacteria 22023
1799 Ga0495658_0001615 3300046683 Bacteria 11744
1800 Ga0495658_0013570 3300046683 Bacteria 4149
1801 Ga0495658_0018146 3300046683 Bacteria 3651
1802 Ga0495658_0018389 3300046683 Bacteria 3633
1803 Ga0495658_0024645 3300046683 Bacteria 3206
1804 Ga0495658_0031178 3300046683 Bacteria 2901
1805 Ga0495658_0045601 3300046683 Bacteria 2461
1806 Ga0495658_0055136 3300046683 Bacteria 2263
1807 Ga0495658_0101589 3300046683 Bacteria 1717
1808 Ga0495669_0026867 3300046684 Bacteria 2516
1809 Ga0495669_0043054 3300046684 Bacteria 2009
1810 Ga0495669_0108558 3300046684 Bacteria 1294
1811 Ga0495613_0004515 3300046689 Bacteria 10436
1812 Ga0495613_0013924 3300046689 Bacteria 5968
1813 Ga0495613_0017495 3300046689 Bacteria 5337
1814 Ga0495613_0033948 3300046689 Bacteria 3790
1815 Ga0495613_0054098 3300046689 Bacteria 2952
1816 Ga0495613_0122846 3300046689 Bacteria 1863
1817 Ga0495613_0145084 3300046689 Bacteria 1694
1818 Ga0495624_0002021 3300046690 Bacteria 15445
1819 Ga0495624_0003130 3300046690 Bacteria 12351
1820 Ga0495624_0005517 3300046690 Bacteria 9105
1821 Ga0495624_0018581 3300046690 Bacteria 4648
1822 Ga0495624_0021002 3300046690 Bacteria 4335
1823 Ga0495624_0061013 3300046690 Bacteria 2363
1824 Ga0495624_0064486 3300046690 Bacteria 2289
1825 Ga0495670_0008138 3300046691 Bacteria 5154
1826 Ga0495670_0014312 3300046691 Bacteria 3901
1827 Ga0495670_0118683 3300046691 Bacteria 1373
1828 Ga0495671_0000618 3300046692 Bacteria 26020
1829 Ga0495671_0015600 3300046692 Bacteria 4067
1830 Ga0495671_0056245 3300046692 Bacteria 1948
1831 Ga0495671_0068501 3300046692 Bacteria 1745
1832 Ga0495671_0084324 3300046692 Bacteria 1557
1833 Ga0495589_0029050 3300046794 Bacteria 2788
1834 Ga0495589_0102532 3300046794 Bacteria 1384
1835 Ga0495600_0000035 3300046809 Bacteria 80552
1836 Ga0495600_0011402 3300046809 Bacteria 5536
1837 Ga0495600_0012452 3300046809 Bacteria 5320
1838 Ga0495600_0022024 3300046809 Bacteria 4088
1839 Ga0495600_0049651 3300046809 Bacteria 2737
1840 Ga0495600_0129028 3300046809 Bacteria 1644
1841 Ga0495581_0000503 3300047315 Bacteria 19983
1842 Ga0495581_0014816 3300047315 Bacteria 4523
1843 Ga0495581_0015374 3300047315 Bacteria 4444
1844 Ga0495581_0103190 3300047315 Bacteria 1657
1845 Ga0495581_0152153 3300047315 Bacteria 1351
1846 Ga0495604_0000069 3300047317 Bacteria 89935
1847 Ga0495604_0000241 3300047317 Bacteria 48922
1848 Ga0495604_0000702 3300047317 Bacteria 28428
1849 Ga0495604_0003178 3300047317 Bacteria 13125
1850 Ga0495604_0006376 3300047317 Bacteria 9353
1851 Ga0495604_0023347 3300047317 Bacteria 4933
1852 Ga0495604_0049389 3300047317 Bacteria 3269
1853 Ga0495604_0085915 3300047317 Bacteria 2347
1854 Ga0495604_0157590 3300047317 Bacteria 1607
1855 Ga0495604_0163032 3300047317 Bacteria 1574
1856 Ga0495636_0060692 3300047318 Bacteria 1598
1857 Ga0495674_0000002 3300047319 Bacteria 642785
1858 Ga0495674_0001363 3300047319 Bacteria 23830
1859 Ga0495674_0009848 3300047319 Bacteria 9072
1860 Ga0495674_0010172 3300047319 Bacteria 8912
1861 Ga0495674_0010576 3300047319 Bacteria 8733
1862 Ga0495674_0017131 3300047319 Bacteria 6748
1863 Ga0495674_0035825 3300047319 Bacteria 4473
1864 Ga0495674_0081957 3300047319 Bacteria 2767
1865 Ga0495674_0093453 3300047319 Bacteria 2566
1866 Ga0495674_0096869 3300047319 Bacteria 2513
1867 Ga0495674_0142364 3300047319 Bacteria 2015
1868 Ga0495674_0295740 3300047319 Bacteria 1323
1869 Ga0495674_0345522 3300047319 Bacteria 1208
1870 Ga0495672_0020588 3300047320 Bacteria 4317
1871 Ga0495672_0024913 3300047320 Bacteria 3843
1872 Ga0495672_0037370 3300047320 Bacteria 2972
1873 Ga0495672_0078278 3300047320 Bacteria 1850
1874 Ga0495676_0009761 3300047321 Bacteria 8722
1875 Ga0495676_0024072 3300047321 Bacteria 5276
1876 Ga0495676_0035814 3300047321 Bacteria 4149
1877 Ga0495676_0105518 3300047321 Bacteria 2077
1878 Ga0495680_0000497 3300047322 Bacteria 44425
1879 Ga0495680_0000994 3300047322 Bacteria 31554
1880 Ga0495680_0002292 3300047322 Bacteria 19664
1881 Ga0495680_0002523 3300047322 Bacteria 18717
1882 Ga0495680_0006821 3300047322 Bacteria 10546
1883 Ga0495680_0007750 3300047322 Bacteria 9806
1884 Ga0495680_0019186 3300047322 Bacteria 5784
1885 Ga0495680_0050134 3300047322 Bacteria 3265
1886 Ga0495680_0117700 3300047322 Bacteria 1964
1887 Ga0495683_0066187 3300047323 Bacteria 1781
1888 Ga0495687_000091 3300047443 Bacteria 140319
1889 Ga0495687_010818 3300047443 Bacteria 4963
1890 Ga0495675_0000164 3300047444 Bacteria 47361
1891 Ga0495675_0003053 3300047444 Bacteria 10065
1892 Ga0495675_0011479 3300047444 Bacteria 5561
1893 Ga0495675_0021384 3300047444 Bacteria 4119
1894 Ga0495675_0028161 3300047444 Bacteria 3582
1895 Ga0495675_0114789 3300047444 Bacteria 1679
1896 Ga0495681_0011395 3300047470 Bacteria 5294
1897 Ga0495684_0000016 3300047471 Bacteria 169338
1898 Ga0495684_0002016 3300047471 Bacteria 16338
1899 Ga0495684_0006620 3300047471 Bacteria 8988
1900 Ga0495684_0009241 3300047471 Bacteria 7612
1901 Ga0495684_0010790 3300047471 Bacteria 7062
1902 Ga0495684_0013942 3300047471 Bacteria 6184
1903 Ga0495684_0016455 3300047471 Bacteria 5695
1904 Ga0495684_0017301 3300047471 Bacteria 5549
1905 Ga0495684_0055741 3300047471 Bacteria 3014
1906 Ga0495684_0067103 3300047471 Bacteria 2728
1907 Ga0495684_0160931 3300047471 Bacteria 1674
1908 Ga0495684_0174443 3300047471 Bacteria 1597
1909 Ga0495686_0003430 3300047472 Bacteria 13748
1910 Ga0495686_0014825 3300047472 Bacteria 5354
1911 Ga0495686_0097311 3300047472 Bacteria 1779
1912 Ga0495593_0000500 3300047673 Bacteria 22173
1913 Ga0495593_0001200 3300047673 Bacteria 15172
1914 Ga0495593_0008925 3300047673 Bacteria 5819
1915 Ga0495593_0011269 3300047673 Bacteria 5138
1916 Ga0495593_0047105 3300047673 Bacteria 2294
1917 Ga0495602_0000240 3300048088 Bacteria 51242
1918 Ga0495602_0001314 3300048088 Bacteria 24503
1919 Ga0495602_0002214 3300048088 Bacteria 19624
1920 Ga0495602_0002373 3300048088 Bacteria 19095
1921 Ga0495602_0015855 3300048088 Bacteria 7590
1922 Ga0495602_0073081 3300048088 Bacteria 2921
1923 Ga0495614_0007099 3300048089 Bacteria 4995
1924 Ga0495614_0042403 3300048089 Bacteria 1951
1925 Ga0495615_0016460 3300048090 Bacteria 1595
1926 Ga0496100_0000894 3300048903 Bacteria 14217
1927 Ga0496100_0001914 3300048903 Bacteria 10423
1928 Ga0496100_0017089 3300048903 Bacteria 4275
1929 Ga0496100_0029132 3300048903 Bacteria 3413
1930 Ga0496100_0149792 3300048903 Bacteria 1662
1931 Ga0496100_0202533 3300048903 Bacteria 1447
1932 Ga0496101_0002235 3300048904 Bacteria 11838
1933 Ga0496101_0006818 3300048904 Bacteria 7369
1934 Ga0496101_0010083 3300048904 Bacteria 6227
1935 Ga0496101_0017259 3300048904 Bacteria 4893
1936 Ga0496101_0017359 3300048904 Bacteria 4883
1937 Ga0496101_0018376 3300048904 Bacteria 4753
1938 Ga0496101_0034478 3300048904 Bacteria 3574
1939 Ga0496101_0038342 3300048904 Bacteria 3403
1940 Ga0496101_0050303 3300048904 Bacteria 2999
1941 Ga0496101_0086232 3300048904 Bacteria 2328
1942 Ga0496101_0100572 3300048904 Bacteria 2163
1943 Ga0496101_0144441 3300048904 Bacteria 1816
1944 Ga0496101_0168803 3300048904 Bacteria 1681
1945 Ga0496102_0002866 3300048905 Bacteria 14649
1946 Ga0496102_0005027 3300048905 Bacteria 11199
1947 Ga0496102_0007763 3300048905 Bacteria 9170
1948 Ga0496102_0012150 3300048905 Bacteria 7443
1949 Ga0496102_0017100 3300048905 Bacteria 6349
1950 Ga0496102_0020900 3300048905 Bacteria 5786
1951 Ga0496102_0083804 3300048905 Bacteria 2941
1952 Ga0496102_0084929 3300048905 Bacteria 2922
1953 Ga0496102_0094089 3300048905 Bacteria 2776
1954 Ga0496102_0124750 3300048905 Bacteria 2406
1955 Ga0496102_0152258 3300048905 Bacteria 2174
1956 Ga0496102_0171071 3300048905 Bacteria 2045
1957 Ga0496102_0388576 3300048905 Bacteria 1313
1958 Ga0496103_0002892 3300048906 Bacteria 10656
1959 Ga0496103_0003599 3300048906 Bacteria 9454
1960 Ga0496103_0006142 3300048906 Bacteria 7178
1961 Ga0496103_0052397 3300048906 Bacteria 2527
1962 Ga0496103_0053875 3300048906 Bacteria 2493
1963 Ga0496103_0074492 3300048906 Bacteria 2128
1964 Ga0496103_0084224 3300048906 Bacteria 2002
1965 Ga0496103_0103945 3300048906 Bacteria 1800
1966 Ga0496104_0000061 3300048907 Bacteria 117394
1967 Ga0496104_0000194 3300048907 Bacteria 54525
1968 Ga0496104_0000577 3300048907 Bacteria 31297
1969 Ga0496104_0000591 3300048907 Bacteria 30958
1970 Ga0496104_0001608 3300048907 Bacteria 19461
1971 Ga0496104_0005904 3300048907 Bacteria 10722
1972 Ga0496104_0009816 3300048907 Bacteria 8534
1973 Ga0496104_0010521 3300048907 Bacteria 8265
1974 Ga0496104_0011884 3300048907 Bacteria 7814
1975 Ga0496104_0016737 3300048907 Bacteria 6666
1976 Ga0496104_0020587 3300048907 Bacteria 6048
1977 Ga0496104_0044813 3300048907 Bacteria 4157
1978 Ga0496104_0072979 3300048907 Bacteria 3264
1979 Ga0496104_0189988 3300048907 Bacteria 1965
1980 Ga0496105_0000365 3300048908 Bacteria 30018
1981 Ga0496105_0002920 3300048908 Bacteria 12546
1982 Ga0496105_0003112 3300048908 Bacteria 12204
1983 Ga0496105_0004541 3300048908 Bacteria 10460
1984 Ga0496105_0005828 3300048908 Bacteria 9397
1985 Ga0496105_0006281 3300048908 Bacteria 9125
1986 Ga0496105_0014088 3300048908 Bacteria 6362
1987 Ga0496105_0014128 3300048908 Bacteria 6353
1988 Ga0496105_0024367 3300048908 Bacteria 4916
1989 Ga0496105_0027670 3300048908 Bacteria 4634
1990 Ga0496105_0083381 3300048908 Bacteria 2640
1991 Ga0496106_0000990 3300048909 Bacteria 20724
1992 Ga0496106_0001140 3300048909 Bacteria 19677
1993 Ga0496106_0002884 3300048909 Bacteria 12771
1994 Ga0496106_0007418 3300048909 Bacteria 8104
1995 Ga0496106_0020125 3300048909 Bacteria 4950
1996 Ga0496106_0024426 3300048909 Bacteria 4493
1997 Ga0496106_0043386 3300048909 Bacteria 3374
1998 Ga0496106_0063690 3300048909 Bacteria 2803
1999 Ga0496106_0070094 3300048909 Bacteria 2677
2000 Ga0496106_0123320 3300048909 Bacteria 2027
2001 Ga0496106_0210197 3300048909 Bacteria 1550
2002 Ga0496107_0005244 3300048910 Bacteria 8847
2003 Ga0496107_0005579 3300048910 Bacteria 8619
2004 Ga0496107_0016685 3300048910 Bacteria 5161
2005 Ga0496107_0020521 3300048910 Bacteria 4667
2006 Ga0496107_0022051 3300048910 Bacteria 4499
2007 Ga0496107_0031230 3300048910 Bacteria 3799
2008 Ga0496107_0046671 3300048910 Bacteria 3118
2009 Ga0496107_0059511 3300048910 Bacteria 2764
2010 Ga0496107_0060830 3300048910 Bacteria 2733
2011 Ga0496107_0070560 3300048910 Bacteria 2537
2012 Ga0496107_0090658 3300048910 Bacteria 2233
2013 Ga0496108_0000322 3300048911 Bacteria 40621
2014 Ga0496108_0000515 3300048911 Bacteria 30277
2015 Ga0496108_0001664 3300048911 Bacteria 17632
2016 Ga0496108_0002753 3300048911 Bacteria 14079
2017 Ga0496108_0009720 3300048911 Bacteria 7796
2018 Ga0496108_0015807 3300048911 Bacteria 6153
2019 Ga0496108_0029173 3300048911 Bacteria 4568
2020 Ga0496108_0039592 3300048911 Bacteria 3928
2021 Ga0496108_0048324 3300048911 Bacteria 3557
2022 Ga0496108_0055977 3300048911 Bacteria 3312
2023 Ga0496108_0069354 3300048911 Bacteria 2975
2024 Ga0496108_0203032 3300048911 Bacteria 1720
2025 Ga0496108_0300997 3300048911 Bacteria 1397
2026 Ga0496108_0346332 3300048911 Bacteria 1296
2027 Ga0496109_0000394 3300048912 Bacteria 39667
2028 Ga0496109_0001619 3300048912 Bacteria 18811
2029 Ga0496109_0002891 3300048912 Bacteria 14365
2030 Ga0496109_0003998 3300048912 Bacteria 12318
2031 Ga0496109_0004579 3300048912 Bacteria 11541
2032 Ga0496109_0005428 3300048912 Bacteria 10662
2033 Ga0496109_0016198 3300048912 Bacteria 6514
2034 Ga0496109_0025734 3300048912 Bacteria 5244
2035 Ga0496109_0035560 3300048912 Bacteria 4495
2036 Ga0496109_0090349 3300048912 Bacteria 2832
2037 Ga0496109_0131368 3300048912 Bacteria 2337
2038 Ga0496110_0001173 3300048913 Bacteria 18616
2039 Ga0496110_0005945 3300048913 Bacteria 9603
2040 Ga0496110_0009681 3300048913 Bacteria 7804
2041 Ga0496110_0017791 3300048913 Bacteria 5948
2042 Ga0496110_0024430 3300048913 Bacteria 5150
2043 Ga0496110_0031329 3300048913 Bacteria 4588
2044 Ga0496110_0037159 3300048913 Bacteria 4232
2045 Ga0496110_0076056 3300048913 Bacteria 2984
2046 Ga0496110_0096299 3300048913 Bacteria 2652
2047 Ga0496110_0141887 3300048913 Bacteria 2172
2048 Ga0496110_0220308 3300048913 Bacteria 1725
2049 Ga0496110_0229379 3300048913 Bacteria 1688
2050 Ga0496110_0229641 3300048913 Bacteria 1687
2051 Ga0496111_0006536 3300048914 Bacteria 7580
2052 Ga0496111_0007757 3300048914 Bacteria 7064
2053 Ga0496111_0010326 3300048914 Bacteria 6260
2054 Ga0496111_0020692 3300048914 Bacteria 4585
2055 Ga0496111_0023272 3300048914 Bacteria 4349
2056 Ga0496111_0026872 3300048914 Bacteria 4067
2057 Ga0496111_0031493 3300048914 Bacteria 3778
2058 Ga0496111_0033103 3300048914 Bacteria 3686
2059 Ga0496111_0036490 3300048914 Bacteria 3514
2060 Ga0496111_0055919 3300048914 Bacteria 2854
2061 Ga0496111_0158525 3300048914 Bacteria 1680
2062 Ga0496112_0000004 3300048915 Bacteria 553294
2063 Ga0496112_0000732 3300048915 Bacteria 22851
2064 Ga0496112_0000803 3300048915 Bacteria 22130
2065 Ga0496112_0002254 3300048915 Bacteria 15406
2066 Ga0496112_0004421 3300048915 Bacteria 11903
2067 Ga0496112_0016454 3300048915 Bacteria 6929
2068 Ga0496112_0026288 3300048915 Bacteria 5598
2069 Ga0496112_0031239 3300048915 Bacteria 5163
2070 Ga0496112_0038139 3300048915 Bacteria 4692
2071 Ga0496112_0046586 3300048915 Bacteria 4253
2072 Ga0496112_0050327 3300048915 Bacteria 4085
2073 Ga0496112_0051168 3300048915 Bacteria 4052
2074 Ga0496112_0057233 3300048915 Bacteria 3838
2075 Ga0496112_0109917 3300048915 Bacteria 2727
2076 Ga0496112_0137952 3300048915 Bacteria 2409
2077 Ga0496112_0310281 3300048915 Bacteria 1523
2078 Ga0496113_0001285 3300048916 Bacteria 13859
2079 Ga0496113_0002162 3300048916 Bacteria 11352
2080 Ga0496113_0007860 3300048916 Bacteria 6895
2081 Ga0496113_0010581 3300048916 Bacteria 6105
2082 Ga0496113_0017394 3300048916 Bacteria 4989
2083 Ga0496113_0018648 3300048916 Bacteria 4836
2084 Ga0496113_0029024 3300048916 Bacteria 3988
2085 Ga0496113_0038211 3300048916 Bacteria 3529
2086 Ga0496113_0066998 3300048916 Bacteria 2721
2087 Ga0496113_0092431 3300048916 Bacteria 2333
2088 Ga0496113_0118074 3300048916 Bacteria 2071
2089 Ga0496113_0162012 3300048916 Bacteria 1768
2090 Ga0496114_0008740 3300048917 Bacteria 8025
2091 Ga0496114_0027667 3300048917 Bacteria 4647
2092 Ga0496114_0048533 3300048917 Bacteria 3531
2093 Ga0496114_0048921 3300048917 Bacteria 3517
2094 Ga0496114_0051863 3300048917 Bacteria 3416
2095 Ga0496114_0059654 3300048917 Bacteria 3187
2096 Ga0496114_0088839 3300048917 Bacteria 2622
2097 Ga0496114_0112567 3300048917 Bacteria 2333
2098 Ga0496114_0113559 3300048917 Bacteria 2322
2099 Ga0496114_0174044 3300048917 Bacteria 1877
2100 Ga0496114_0230121 3300048917 Bacteria 1629
2101 Ga0496114_0240919 3300048917 Bacteria 1590
2102 Ga0496115_0005923 3300048918 Bacteria 8918
2103 Ga0496115_0007543 3300048918 Bacteria 8012
2104 Ga0496115_0007578 3300048918 Bacteria 7995
2105 Ga0496115_0013541 3300048918 Bacteria 6170
2106 Ga0496115_0025561 3300048918 Bacteria 4599
2107 Ga0496115_0038161 3300048918 Bacteria 3810
2108 Ga0496115_0038187 3300048918 Bacteria 3809
2109 Ga0496115_0046759 3300048918 Bacteria 3460
2110 Ga0496115_0121285 3300048918 Bacteria 2151
2111 Ga0496115_0158374 3300048918 Bacteria 1871
2112 Ga0496115_0247780 3300048918 Bacteria 1467
2113 Ga0496115_0297816 3300048918 Bacteria 1322
2114 Ga0496116_0003689 3300048919 Bacteria 14990
2115 Ga0496116_0018926 3300048919 Bacteria 5288
2116 Ga0496116_0020398 3300048919 Bacteria 5034
2117 Ga0496117_0000036 3300048920 Bacteria 325635
2118 Ga0496117_0012904 3300048920 Bacteria 7324
2119 Ga0496117_0015481 3300048920 Bacteria 6500
2120 Ga0496117_0024395 3300048920 Bacteria 4785
2121 Ga0496117_0032448 3300048920 Bacteria 3967
2122 Ga0496117_0036596 3300048920 Bacteria 3670
2123 Ga0496117_0175913 3300048920 Bacteria 1236
2124 Ga0496118_0003337 3300048921 Bacteria 20313
2125 Ga0496118_0008209 3300048921 Bacteria 10846
2126 Ga0496118_0020646 3300048921 Bacteria 5834
2127 Ga0496118_0047108 3300048921 Bacteria 3346
2128 Ga0496118_0056599 3300048921 Bacteria 2946
2129 Ga0496118_0076879 3300048921 Bacteria 2370
2130 Ga0496119_0003438 3300048922 Bacteria 16444
2131 Ga0496119_0009369 3300048922 Bacteria 8419
2132 Ga0496119_0014973 3300048922 Bacteria 6019
2133 Ga0496119_0079562 3300048922 Bacteria 1893
2134 Ga0496119_0096340 3300048922 Bacteria 1670
2135 Ga0496120_0001678 3300048923 Bacteria 25416
2136 Ga0496120_0005900 3300048923 Bacteria 9553
2137 Ga0496120_0012920 3300048923 Bacteria 5651
2138 Ga0496120_0025464 3300048923 Bacteria 3671
2139 Ga0496120_0065903 3300048923 Bacteria 2005
2140 Ga0496121_0000458 3300048924 Bacteria 80207
2141 Ga0496121_0000574 3300048924 Bacteria 69107
2142 Ga0496121_0000668 3300048924 Bacteria 64093
2143 Ga0496121_0005012 3300048924 Bacteria 17321
2144 Ga0496121_0016457 3300048924 Bacteria 7634
2145 Ga0496121_0030756 3300048924 Bacteria 4925
2146 Ga0496121_0038705 3300048924 Bacteria 4216
2147 Ga0496121_0054796 3300048924 Bacteria 3329
2148 Ga0496121_0063866 3300048924 Bacteria 3005
2149 Ga0496121_0110020 3300048924 Bacteria 2103
2150 Ga0496122_0000002 3300048925 Bacteria 905834
2151 Ga0496122_0000074 3300048925 Bacteria 219900
2152 Ga0496122_0005799 3300048925 Bacteria 14518
2153 Ga0496122_0017627 3300048925 Bacteria 6662
2154 Ga0496122_0020971 3300048925 Bacteria 5871
2155 Ga0496122_0024524 3300048925 Bacteria 5275
2156 Ga0496122_0032207 3300048925 Bacteria 4341
2157 Ga0496122_0041965 3300048925 Bacteria 3607
2158 Ga0496122_0051385 3300048925 Bacteria 3132
2159 Ga0496122_0065558 3300048925 Bacteria 2632
2160 Ga0496123_0000002 3300048926 Bacteria 1811682
2161 Ga0496123_0000062 3300048926 Bacteria 219882
2162 Ga0496123_0004614 3300048926 Bacteria 14331
2163 Ga0496123_0008775 3300048926 Bacteria 9221
2164 Ga0496123_0016930 3300048926 Bacteria 5889
2165 Ga0496123_0022456 3300048926 Bacteria 4862
2166 Ga0496123_0038669 3300048926 Bacteria 3349
2167 Ga0496124_0007696 3300048927 Bacteria 11395
2168 Ga0496124_0013261 3300048927 Bacteria 8056
2169 Ga0496124_0023362 3300048927 Bacteria 5645
2170 Ga0496124_0050197 3300048927 Bacteria 3556
2171 Ga0496124_0078400 3300048927 Bacteria 2723
2172 Ga0496124_0210343 3300048927 Bacteria 1472
2173 Ga0496125_0000060 3300048928 Bacteria 264143
2174 Ga0496125_0000116 3300048928 Bacteria 180492
2175 Ga0496125_0001496 3300048928 Bacteria 33472
2176 Ga0496125_0006111 3300048928 Bacteria 13137
2177 Ga0496125_0008272 3300048928 Bacteria 10924
2178 Ga0496125_0026780 3300048928 Bacteria 5239
2179 Ga0496125_0034560 3300048928 Bacteria 4453
2180 Ga0496125_0046531 3300048928 Bacteria 3639
2181 Ga0496125_0069040 3300048928 Bacteria 2775
2182 Ga0496125_0075447 3300048928 Bacteria 2609
2183 Ga0496125_0084942 3300048928 Bacteria 2401
2184 Ga0496126_0003422 3300048929 Bacteria 20029
2185 Ga0496126_0004802 3300048929 Bacteria 15878
2186 Ga0496126_0007480 3300048929 Bacteria 11964
2187 Ga0496126_0014201 3300048929 Bacteria 8059
2188 Ga0496126_0014911 3300048929 Bacteria 7837
2189 Ga0496126_0015313 3300048929 Bacteria 7717
2190 Ga0496126_0020126 3300048929 Bacteria 6551
2191 Ga0496126_0021658 3300048929 Bacteria 6274
2192 Ga0496126_0022450 3300048929 Bacteria 6140
2193 Ga0496126_0025527 3300048929 Bacteria 5682
2194 Ga0496126_0095694 3300048929 Bacteria 2604
2195 Ga0496126_0101955 3300048929 Bacteria 2510
2196 Ga0496126_0102454 3300048929 Bacteria 2502
2197 Ga0496126_0119071 3300048929 Bacteria 2292
2198 Ga0496126_0213579 3300048929 Bacteria 1623
2199 Ga0496126_0263677 3300048929 Bacteria 1432
2200 Ga0495682_0021095 3300049460 Bacteria 2443
2201 Ga0501031_0001597 3300049568 Bacteria 14151
2202 Ga0501031_0002121 3300049568 Bacteria 12512
2203 Ga0501031_0003092 3300049568 Bacteria 10652
2204 Ga0501031_0032796 3300049568 Bacteria 3387
2205 Ga0501031_0055347 3300049568 Bacteria 2585
2206 Ga0501031_0063639 3300049568 Bacteria 2403
2207 Ga0501032_0000008 3300049569 Bacteria 240313
2208 Ga0501032_0000619 3300049569 Bacteria 28816
2209 Ga0501032_0001926 3300049569 Bacteria 16354
2210 Ga0501032_0008343 3300049569 Bacteria 7550
2211 Ga0501032_0010824 3300049569 Bacteria 6566
2212 Ga0501032_0017460 3300049569 Bacteria 5040
2213 Ga0501032_0060433 3300049569 Bacteria 2541
2214 Ga0501032_0075832 3300049569 Bacteria 2239
2215 Ga0501032_0117881 3300049569 Bacteria 1755
2216 Ga0501032_0168080 3300049569 Bacteria 1438
2217 Ga0501033_0000012 3300049570 Bacteria 241599
2218 Ga0501033_0000108 3300049570 Bacteria 79903
2219 Ga0501033_0005509 3300049570 Bacteria 10017
2220 Ga0501033_0008737 3300049570 Bacteria 7832
2221 Ga0501033_0009630 3300049570 Bacteria 7433
2222 Ga0501033_0010896 3300049570 Bacteria 6971
2223 Ga0501033_0013189 3300049570 Bacteria 6296
2224 Ga0501033_0021175 3300049570 Bacteria 4906
2225 Ga0501033_0041393 3300049570 Bacteria 3438
2226 Ga0501033_0096688 3300049570 Bacteria 2158
2227 Ga0501033_0122816 3300049570 Bacteria 1883
2228 Ga0501033_0128007 3300049570 Bacteria 1841
2229 Ga0501033_0139633 3300049570 Bacteria 1752
2230 Ga0501033_0219564 3300049570 Bacteria 1353
2231 Ga0501034_0000035 3300049571 Bacteria 241623
2232 Ga0501034_0000100 3300049571 Bacteria 159536
2233 Ga0501034_0000319 3300049571 Bacteria 84488
2234 Ga0501034_0001353 3300049571 Bacteria 33136
2235 Ga0501034_0005498 3300049571 Bacteria 13829
2236 Ga0501034_0010766 3300049571 Bacteria 9500
2237 Ga0501034_0013826 3300049571 Bacteria 8307
2238 Ga0501034_0014581 3300049571 Bacteria 8092
2239 Ga0501034_0058957 3300049571 Bacteria 3856
2240 Ga0501034_0070062 3300049571 Bacteria 3518
2241 Ga0501034_0129420 3300049571 Bacteria 2508
2242 Ga0501034_0137276 3300049571 Bacteria 2426
2243 Ga0501034_0142897 3300049571 Bacteria 2372
2244 Ga0501034_0157141 3300049571 Bacteria 2247
2245 Ga0501034_0204816 3300049571 Bacteria 1929
2246 Ga0501034_0372640 3300049571 Bacteria 1353
2247 Ga0501034_0408264 3300049571 Bacteria 1280
2248 Ga0501036_0000006 3300049572 Bacteria 241623
2249 Ga0501036_0000769 3300049572 Bacteria 23752
2250 Ga0501036_0001566 3300049572 Bacteria 17669
2251 Ga0501036_0004308 3300049572 Bacteria 11493
2252 Ga0501036_0014462 3300049572 Bacteria 6575
2253 Ga0501036_0029821 3300049572 Bacteria 4610
2254 Ga0501036_0065821 3300049572 Bacteria 3066
2255 Ga0501036_0104953 3300049572 Bacteria 2389
2256 Ga0501036_0233052 3300049572 Bacteria 1545
2257 Ga0501036_0280263 3300049572 Bacteria 1395
2258 Ga0501036_0297235 3300049572 Bacteria 1351
2259 Ga0501037_0000072 3300049573 Bacteria 94452
2260 Ga0501037_0000153 3300049573 Bacteria 64239
2261 Ga0501037_0000386 3300049573 Bacteria 36578
2262 Ga0501037_0008879 3300049573 Bacteria 7360
2263 Ga0501037_0010014 3300049573 Bacteria 6953
2264 Ga0501037_0010426 3300049573 Bacteria 6820
2265 Ga0501037_0012514 3300049573 Bacteria 6249
2266 Ga0501037_0019253 3300049573 Bacteria 5032
2267 Ga0501037_0047037 3300049573 Bacteria 3163
2268 Ga0501037_0062776 3300049573 Bacteria 2708
2269 Ga0501037_0072307 3300049573 Bacteria 2508
2270 Ga0501037_0109022 3300049573 Bacteria 1995
2271 Ga0501037_0132149 3300049573 Bacteria 1789
2272 Ga0501037_0141424 3300049573 Bacteria 1722
2273 Ga0501038_0000007 3300049574 Bacteria 210775
2274 Ga0501038_0000138 3300049574 Bacteria 62493
2275 Ga0501038_0000575 3300049574 Bacteria 32506
2276 Ga0501038_0000999 3300049574 Bacteria 25463
2277 Ga0501038_0004019 3300049574 Bacteria 13668
2278 Ga0501038_0012452 3300049574 Bacteria 7773
2279 Ga0501038_0026001 3300049574 Bacteria 5214
2280 Ga0501038_0031485 3300049574 Bacteria 4687
2281 Ga0501038_0039232 3300049574 Bacteria 4143
2282 Ga0501038_0041394 3300049574 Bacteria 4018
2283 Ga0501038_0051632 3300049574 Bacteria 3547
2284 Ga0501038_0071647 3300049574 Bacteria 2939
2285 Ga0501038_0079031 3300049574 Bacteria 2774
2286 Ga0501038_0090799 3300049574 Bacteria 2560
2287 Ga0501038_0196696 3300049574 Bacteria 1620
2288 Ga0501038_0222342 3300049574 Bacteria 1506
2289 Ga0501038_0265978 3300049574 Bacteria 1353
2290 Ga0501039_0000012 3300049575 Bacteria 241623
2291 Ga0501039_0005026 3300049575 Bacteria 10027
2292 Ga0501039_0007888 3300049575 Bacteria 8112
2293 Ga0501039_0036387 3300049575 Bacteria 3799
2294 Ga0501039_0044093 3300049575 Bacteria 3444
2295 Ga0501039_0048916 3300049575 Bacteria 3268
2296 Ga0501039_0060551 3300049575 Bacteria 2932
2297 Ga0501039_0069857 3300049575 Bacteria 2728
2298 Ga0501039_0074160 3300049575 Bacteria 2644
2299 Ga0501039_0081004 3300049575 Bacteria 2527
2300 Ga0501039_0083826 3300049575 Bacteria 2482
2301 Ga0501039_0104889 3300049575 Bacteria 2207
2302 Ga0501039_0115394 3300049575 Bacteria 2102
2303 Ga0501039_0131202 3300049575 Bacteria 1967
2304 Ga0501039_0137252 3300049575 Bacteria 1920
2305 Ga0501039_0160231 3300049575 Bacteria 1768
2306 Ga0501040_0001880 3300049576 Bacteria 13465
2307 Ga0501040_0024632 3300049576 Bacteria 4040
2308 Ga0501040_0063855 3300049576 Bacteria 2534
2309 Ga0501041_0075539 3300049577 Bacteria 2072
2310 Ga0501042_0053387 3300049578 Bacteria 2883
2311 Ga0501042_0109750 3300049578 Bacteria 1986
2312 Ga0501043_0000022 3300049579 Bacteria 154467
2313 Ga0501043_0000085 3300049579 Bacteria 83544
2314 Ga0501043_0000211 3300049579 Bacteria 53464
2315 Ga0501043_0019496 3300049579 Bacteria 5323
2316 Ga0501043_0025654 3300049579 Bacteria 4624
2317 Ga0501043_0031144 3300049579 Bacteria 4194
2318 Ga0501043_0035591 3300049579 Bacteria 3916
2319 Ga0501043_0039538 3300049579 Bacteria 3706
2320 Ga0501043_0042729 3300049579 Bacteria 3562
2321 Ga0501043_0043378 3300049579 Bacteria 3535
2322 Ga0501043_0046856 3300049579 Bacteria 3399
2323 Ga0501043_0050782 3300049579 Bacteria 3259
2324 Ga0501043_0054900 3300049579 Bacteria 3129
2325 Ga0501043_0062866 3300049579 Bacteria 2915
2326 Ga0501043_0071468 3300049579 Bacteria 2726
2327 Ga0501043_0072831 3300049579 Bacteria 2698
2328 Ga0501043_0201500 3300049579 Bacteria 1545
2329 Ga0501043_0246896 3300049579 Bacteria 1375
2330 Ga0501046_0000267 3300049580 Bacteria 53185
2331 Ga0501046_0001536 3300049580 Bacteria 22030
2332 Ga0501046_0013460 3300049580 Bacteria 6924
2333 Ga0501046_0026846 3300049580 Bacteria 4703
2334 Ga0501046_0062164 3300049580 Bacteria 2918
2335 Ga0501046_0075547 3300049580 Bacteria 2612
2336 Ga0501046_0082690 3300049580 Bacteria 2479
2337 Ga0501046_0091570 3300049580 Bacteria 2338
2338 Ga0501046_0275014 3300049580 Bacteria 1234
2339 Ga0501047_0000079 3300049581 Bacteria 122998
2340 Ga0501047_0000221 3300049581 Bacteria 68563
2341 Ga0501047_0000380 3300049581 Bacteria 50128
2342 Ga0501047_0012718 3300049581 Bacteria 7973
2343 Ga0501047_0015912 3300049581 Bacteria 7170
2344 Ga0501047_0017518 3300049581 Bacteria 6861
2345 Ga0501047_0031463 3300049581 Bacteria 5117
2346 Ga0501047_0041124 3300049581 Bacteria 4467
2347 Ga0501047_0049538 3300049581 Bacteria 4056
2348 Ga0501047_0086994 3300049581 Bacteria 3003
2349 Ga0501047_0123188 3300049581 Bacteria 2473
2350 Ga0501047_0174771 3300049581 Bacteria 2015
2351 Ga0501047_0215616 3300049581 Bacteria 1776
2352 Ga0501047_0279342 3300049581 Bacteria 1515
2353 Ga0501048_0000582 3300049582 Bacteria 25900
2354 Ga0501048_0000858 3300049582 Bacteria 22423
2355 Ga0501048_0002076 3300049582 Bacteria 15247
2356 Ga0501048_0008960 3300049582 Bacteria 7534
2357 Ga0501048_0135146 3300049582 Bacteria 1743
2358 Ga0501048_0260187 3300049582 Bacteria 1233
2359 Ga0501067_0000104 3300049583 Bacteria 48290
2360 Ga0501067_0008785 3300049583 Bacteria 5598
2361 Ga0501067_0046728 3300049583 Bacteria 2402
2362 Ga0501067_0055784 3300049583 Bacteria 2189
2363 Ga0501068_0000689 3300049584 Bacteria 17292
2364 Ga0501068_0021689 3300049584 Bacteria 3753
2365 Ga0501068_0034598 3300049584 Bacteria 3013
2366 Ga0501068_0049382 3300049584 Bacteria 2541
2367 Ga0501069_0000284 3300049585 Bacteria 23001
2368 Ga0501069_0003185 3300049585 Bacteria 8404
2369 Ga0501069_0018590 3300049585 Bacteria 3751
2370 Ga0501069_0071911 3300049585 Bacteria 1939
2371 Ga0501069_0086027 3300049585 Bacteria 1775
2372 Ga0501070_0000103 3300049586 Bacteria 74597
2373 Ga0501070_0000601 3300049586 Bacteria 32926
2374 Ga0501070_0003323 3300049586 Bacteria 13965
2375 Ga0501070_0015274 3300049586 Bacteria 6461
2376 Ga0501070_0026619 3300049586 Bacteria 4852
2377 Ga0501070_0028528 3300049586 Bacteria 4682
2378 Ga0501070_0040501 3300049586 Bacteria 3884
2379 Ga0501070_0041137 3300049586 Bacteria 3850
2380 Ga0501070_0146822 3300049586 Bacteria 1946
2381 Ga0501070_0257447 3300049586 Bacteria 1427
2382 Ga0501070_0268111 3300049586 Bacteria 1395
2383 Ga0501071_0022525 3300049587 Bacteria 4392
2384 Ga0501071_0054744 3300049587 Bacteria 2879
2385 Ga0501071_0069838 3300049587 Bacteria 2558
2386 Ga0501071_0083339 3300049587 Bacteria 2342
2387 Ga0501071_0102904 3300049587 Bacteria 2106
2388 Ga0501071_0105884 3300049587 Bacteria 2076
2389 Ga0501072_0001082 3300049588 Bacteria 20218
2390 Ga0501072_0001591 3300049588 Bacteria 16965
2391 Ga0501072_0009005 3300049588 Bacteria 7589
2392 Ga0501072_0020421 3300049588 Bacteria 5132
2393 Ga0501072_0043055 3300049588 Bacteria 3548
2394 Ga0501072_0159238 3300049588 Bacteria 1801
2395 Ga0501073_0000290 3300049589 Bacteria 33072
2396 Ga0501073_0026954 3300049589 Bacteria 4113
2397 Ga0501073_0047809 3300049589 Bacteria 3005
2398 Ga0501073_0064742 3300049589 Bacteria 2550
2399 Ga0501073_0092831 3300049589 Bacteria 2098
2400 Ga0501073_0175172 3300049589 Bacteria 1484
2401 Ga0501074_0000094 3300049590 Bacteria 42565
2402 Ga0501074_0000627 3300049590 Bacteria 21914
2403 Ga0501074_0008381 3300049590 Bacteria 7493
2404 Ga0501074_0078327 3300049590 Bacteria 2372
2405 Ga0501074_0084640 3300049590 Bacteria 2273
2406 Ga0501074_0093634 3300049590 Bacteria 2152
2407 Ga0501074_0114939 3300049590 Bacteria 1925
2408 Ga0501074_0130983 3300049590 Bacteria 1794
2409 Ga0501074_0166927 3300049590 Bacteria 1571
2410 Ga0501075_0009599 3300049591 Bacteria 6775
2411 Ga0501075_0033946 3300049591 Bacteria 3797
2412 Ga0501075_0037983 3300049591 Bacteria 3600
2413 Ga0501075_0039882 3300049591 Bacteria 3515
2414 Ga0501075_0042960 3300049591 Bacteria 3390
2415 Ga0501075_0186834 3300049591 Bacteria 1581
2416 Ga0501076_0010260 3300049592 Bacteria 6944
2417 Ga0501076_0016240 3300049592 Bacteria 5640
2418 Ga0501076_0067934 3300049592 Bacteria 2847
2419 Ga0501076_0232011 3300049592 Bacteria 1509
2420 Ga0501077_0009864 3300049593 Bacteria 5939
2421 Ga0501077_0024032 3300049593 Bacteria 3867
2422 Ga0501079_0000727 3300049741 Bacteria 22255
2423 Ga0501079_0002574 3300049741 Bacteria 13174
2424 Ga0501079_0027439 3300049741 Bacteria 4366
2425 Ga0501079_0045485 3300049741 Bacteria 3388
2426 Ga0501079_0120828 3300049741 Bacteria 2037
2427 Ga0501080_0007905 3300049742 Bacteria 9633
2428 Ga0501080_0008900 3300049742 Bacteria 9127
2429 Ga0501080_0009419 3300049742 Bacteria 8907
2430 Ga0501080_0029767 3300049742 Bacteria 5082
2431 Ga0501080_0036485 3300049742 Bacteria 4588
2432 Ga0501080_0047761 3300049742 Bacteria 3985
2433 Ga0501080_0055234 3300049742 Bacteria 3699
2434 Ga0501080_0087084 3300049742 Bacteria 2902
2435 Ga0501080_0121138 3300049742 Bacteria 2424
2436 Ga0501080_0202660 3300049742 Bacteria 1821
2437 Ga0501080_0344415 3300049742 Bacteria 1346
2438 Ga0501081_0001063 3300049743 Bacteria 16481
2439 Ga0501081_0056938 3300049743 Bacteria 2702
2440 Ga0501081_0057668 3300049743 Bacteria 2686
2441 Ga0501083_0000087 3300049744 Bacteria 62691
2442 Ga0501083_0000374 3300049744 Bacteria 28288
2443 Ga0501083_0001525 3300049744 Bacteria 15834
2444 Ga0501083_0003683 3300049744 Bacteria 10765
2445 Ga0501083_0053580 3300049744 Bacteria 2708
2446 Ga0501083_0116504 3300049744 Bacteria 1754
2447 Ga0501083_0149420 3300049744 Bacteria 1530
2448 Ga0501083_0170214 3300049744 Bacteria 1424
2449 Ga0501083_0189189 3300049744 Bacteria 1343
2450 Ga0501035_0000035 3300049822 Bacteria 166916
2451 Ga0501035_0000223 3300049822 Bacteria 67732
2452 Ga0501035_0001800 3300049822 Bacteria 21664
2453 Ga0501035_0003063 3300049822 Bacteria 16035
2454 Ga0501035_0003617 3300049822 Bacteria 14753
2455 Ga0501035_0013006 3300049822 Bacteria 7679
2456 Ga0501035_0013765 3300049822 Bacteria 7467
2457 Ga0501035_0016640 3300049822 Bacteria 6781
2458 Ga0501035_0019507 3300049822 Bacteria 6234
2459 Ga0501035_0021754 3300049822 Bacteria 5896
2460 Ga0501035_0021999 3300049822 Bacteria 5857
2461 Ga0501035_0029550 3300049822 Bacteria 4999
2462 Ga0501035_0033390 3300049822 Bacteria 4680
2463 Ga0501035_0048984 3300049822 Bacteria 3787
2464 Ga0501035_0059069 3300049822 Bacteria 3415
2465 Ga0501035_0060562 3300049822 Bacteria 3370
2466 Ga0501035_0075059 3300049822 Bacteria 2990
2467 Ga0501035_0128079 3300049822 Bacteria 2215
2468 Ga0501035_0139838 3300049822 Bacteria 2105
2469 Ga0501035_0182242 3300049822 Bacteria 1809
2470 Ga0501044_0000015 3300049823 Bacteria 241623
2471 Ga0501044_0000369 3300049823 Bacteria 56363
2472 Ga0501044_0000516 3300049823 Bacteria 47012
2473 Ga0501044_0000578 3300049823 Bacteria 44504
2474 Ga0501044_0008397 3300049823 Bacteria 11327
2475 Ga0501044_0008812 3300049823 Bacteria 11035
2476 Ga0501044_0013155 3300049823 Bacteria 8957
2477 Ga0501044_0015943 3300049823 Bacteria 8086
2478 Ga0501044_0016305 3300049823 Bacteria 7982
2479 Ga0501044_0016560 3300049823 Bacteria 7912
2480 Ga0501044_0017409 3300049823 Bacteria 7709
2481 Ga0501044_0018763 3300049823 Bacteria 7409
2482 Ga0501044_0023766 3300049823 Bacteria 6517
2483 Ga0501044_0065124 3300049823 Bacteria 3717
2484 Ga0501044_0067647 3300049823 Bacteria 3639
2485 Ga0501044_0071838 3300049823 Bacteria 3519
2486 Ga0501044_0072377 3300049823 Bacteria 3504
2487 Ga0501044_0073799 3300049823 Bacteria 3467
2488 Ga0501044_0094349 3300049823 Bacteria 3017
2489 Ga0501044_0116320 3300049823 Bacteria 2679
2490 Ga0501044_0191864 3300049823 Bacteria 2005
2491 Ga0501044_0222535 3300049823 Bacteria 1837
2492 Ga0501044_0358921 3300049823 Bacteria 1375
2493 Ga0501044_0380401 3300049823 Bacteria 1327
2494 Ga0501044_0396900 3300049823 Bacteria 1292
2495 Ga0501045_0003601 3300049824 Bacteria 10642
2496 Ga0501045_0015619 3300049824 Bacteria 5387
2497 Ga0501045_0027818 3300049824 Bacteria 4077
2498 Ga0501045_0030334 3300049824 Bacteria 3913
2499 Ga0501045_0213603 3300049824 Bacteria 1437
2500 nmdc:mga03683_21282_c1 3300050489 Bacteria 2497
2501 nmdc:mga03683_37247_c1 3300050489 Bacteria 1981
2502 nmdc:mga03683_3875_c1 3300050489 Bacteria 4888
2503 nmdc:mga03n38_380_c1 3300050490 Bacteria 10915
2504 nmdc:mga00v17_12168_c2 3300050491 Bacteria 3442
2505 nmdc:mga00v17_125571_c1 3300050491 Bacteria 1227
2506 nmdc:mga00v17_51_c1 3300050491 Bacteria 73235
2507 nmdc:mga0yw44_131209_c1 3300050492 Bacteria 1622
2508 nmdc:mga0yw44_21266_c1 3300050492 Bacteria 3616
2509 nmdc:mga0yw44_23613_c1 3300050492 Bacteria 3467
2510 nmdc:mga0yw44_2950_c1 3300050492 Bacteria 6720
2511 nmdc:mga0yw44_29741_c1 3300050492 Bacteria 3157
2512 nmdc:mga0yw44_5645_c1 3300050492 Bacteria 5950
2513 nmdc:mga0yw44_78188_c1 3300050492 Bacteria 2069
2514 nmdc:mga0k408_127740_c1 3300050493 Bacteria 1508
2515 nmdc:mga0k408_33002_c1 3300050493 Bacteria 2959
2516 nmdc:mga06z11_11646_c1 3300050494 Bacteria 3800
2517 nmdc:mga06z11_1301_c1 3300050494 Bacteria 9228
2518 nmdc:mga06z11_143627_c1 3300050494 Bacteria 1351
2519 nmdc:mga06z11_24940_c1 3300050494 Bacteria 2827
2520 nmdc:mga06z11_27745_c1 3300050494 Bacteria 2709
2521 nmdc:mga06z11_36507_c1 3300050494 Bacteria 2427
2522 nmdc:mga06z11_81524_c1 3300050494 Bacteria 1737
2523 nmdc:mga04h51_54215_c1 3300050495 Bacteria 1355
2524 nmdc:mga07m45_49149_c1 3300050496 Bacteria 2373
2525 nmdc:mga07m45_5309_c2 3300050496 Bacteria 3527
2526 nmdc:mga05p37_113589_c1 3300050507 Bacteria 3330
2527 nmdc:mga05p37_1242_c1 3300050507 Bacteria 29598
2528 nmdc:mga05p37_196059_c1 3300050507 Bacteria 2449
2529 nmdc:mga05p37_2458_c1 3300050507 Bacteria 21543
2530 nmdc:mga05p37_292909_c1 3300050507 Bacteria 1937
2531 nmdc:mga05p37_324851_c1 3300050507 Bacteria 1820
2532 nmdc:mga05p37_62833_c1 3300050507 Bacteria 4570
2533 nmdc:mga05p37_7606_c1 3300050507 Bacteria 12784
2534 nmdc:mga05p37_83403_c1 3300050507 Bacteria 3937
2535 nmdc:mga05p37_8850_c1 3300050507 Bacteria 11895
2536 nmdc:mga05p37_9470_c1 3300050507 Bacteria 11532
2537 nmdc:mga09592_10948_c1 3300050508 Bacteria 7379
2538 nmdc:mga09592_480_c1 3300050508 Bacteria 29887
2539 nmdc:mga09592_800_c1 3300050508 Bacteria 24361
2540 nmdc:mga09592_848_c1 3300050508 Bacteria 23773
2541 nmdc:mga0qj67_17812_c1 3300050509 Bacteria 5404
2542 nmdc:mga0qj67_23821_c1 3300050509 Bacteria 4714
2543 nmdc:mga0qj67_514_c1 3300050509 Bacteria 26446
2544 nmdc:mga0qj67_873_c1 3300050509 Bacteria 20663
2545 nmdc:mga06r32_117911_c1 3300050510 Bacteria 2616
2546 nmdc:mga06r32_1406_c1 3300050510 Bacteria 21718
2547 nmdc:mga06r32_417029_c1 3300050510 Bacteria 1324
2548 nmdc:mga06r32_62800_c1 3300050510 Bacteria 3579
2549 nmdc:mga06r32_94_c1 3300050510 Bacteria 61840
2550 nmdc:mga06r32_9941_c1 3300050510 Bacteria 8586
2551 nmdc:mga08y16_1532_c1 3300050511 Bacteria 23233
2552 nmdc:mga08y16_1541_c2 3300050511 Bacteria 16835
2553 nmdc:mga08y16_160_c1 3300050511 Bacteria 58113
2554 nmdc:mga08y16_1962_c1 3300050511 Bacteria 20974
2555 nmdc:mga08y16_20423_c1 3300050511 Bacteria 6991
2556 nmdc:mga08y16_236041_c1 3300050511 Bacteria 1891
2557 nmdc:mga08y16_238449_c1 3300050511 Bacteria 1880
2558 nmdc:mga08y16_2747_c1 3300050511 Bacteria 18041
2559 nmdc:mga08y16_410_c1 3300050511 Bacteria 39418
2560 nmdc:mga08y16_44609_c1 3300050511 Bacteria 4645
2561 nmdc:mga08y16_89906_c1 3300050511 Bacteria 3200
2562 nmdc:mga0n895_114842_c1 3300050512 Bacteria 2710
2563 nmdc:mga0n895_1152_c1 3300050512 Bacteria 19359
2564 nmdc:mga0n895_174865_c1 3300050512 Bacteria 2178
2565 nmdc:mga0n895_21004_c1 3300050512 Bacteria 6099
2566 nmdc:mga0n895_271922_c1 3300050512 Bacteria 1719
2567 nmdc:mga0n895_31905_c1 3300050512 Bacteria 5050
2568 nmdc:mga0n895_32724_c1 3300050512 Bacteria 4992
2569 nmdc:mga0n895_358_c1 3300050512 Bacteria 30661
2570 nmdc:mga0n895_791_c2 3300050512 Bacteria 13197
2571 nmdc:mga0rr50_266743_c1 3300050513 Bacteria 1426
2572 nmdc:mga08x19_29347_c1 3300050514 Bacteria 3449
2573 nmdc:mga08x19_6_c1 3300050514 Bacteria 405679
2574 nmdc:mga0a205_102898_c1 3300050515 Bacteria 2754
2575 nmdc:mga0a205_133555_c1 3300050515 Bacteria 2382
2576 nmdc:mga0a205_234740_c1 3300050515 Bacteria 1716
2577 nmdc:mga0a205_35179_c1 3300050515 Bacteria 4809
2578 nmdc:mga0a205_39044_c1 3300050515 Bacteria 4569
2579 Ga0495601_0000001 3300053077 Bacteria 549454
2580 Ga0495601_0000095 3300053077 Bacteria 48556
2581 Ga0495601_0000316 3300053077 Bacteria 25622
2582 Ga0495601_0002508 3300053077 Bacteria 10448
2583 Ga0495601_0004144 3300053077 Bacteria 8355
2584 Ga0495601_0006189 3300053077 Bacteria 6987
2585 Ga0495601_0031775 3300053077 Bacteria 3282
2586 Ga0495601_0033666 3300053077 Bacteria 3193
2587 Ga0495601_0041563 3300053077 Bacteria 2883
2588 Ga0495601_0042354 3300053077 Bacteria 2856
2589 Ga0495601_0133294 3300053077 Bacteria 1619
2590 Ga0495601_0155440 3300053077 Bacteria 1493
2591 Ga0495601_0170181 3300053077 Bacteria 1424
2592 Ga0495612_0000017 3300053078 Bacteria 152112
2593 Ga0495612_0000118 3300053078 Bacteria 33388
2594 Ga0495612_0000812 3300053078 Bacteria 12723
2595 Ga0495612_0000834 3300053078 Bacteria 12533
2596 Ga0495612_0012919 3300053078 Bacteria 3364
2597 Ga0495612_0100551 3300053078 Bacteria 1231
2598 Ga0500610_0033875 3300053079 Bacteria 2610
2599 Ga0500635_0000553 3300053080 Bacteria 9959
2600 Ga0495655_0009867 3300053083 Bacteria 1866
2601 Ga0495595_0000010 3300053084 Bacteria 178819
2602 Ga0495595_0000214 3300053084 Bacteria 23362
2603 Ga0495595_0000261 3300053084 Bacteria 20962
2604 Ga0495595_0002798 3300053084 Bacteria 6863
2605 Ga0495595_0017420 3300053084 Bacteria 3090
2606 Ga0495595_0017958 3300053084 Bacteria 3049
2607 Ga0495595_0033329 3300053084 Bacteria 2323
2608 Ga0495595_0035642 3300053084 Bacteria 2254
2609 Ga0495595_0037724 3300053084 Bacteria 2198
2610 Ga0495595_0045461 3300053084 Bacteria 2020
2611 Ga0495595_0066140 3300053084 Bacteria 1701
2612 Ga0495619_0000014 3300053085 Bacteria 261449
2613 Ga0495619_0000056 3300053085 Bacteria 95385
2614 Ga0495619_0000351 3300053085 Bacteria 32176
2615 Ga0495619_0000498 3300053085 Bacteria 26335
2616 Ga0495619_0001245 3300053085 Bacteria 16673
2617 Ga0495619_0002197 3300053085 Bacteria 12929
2618 Ga0495619_0012921 3300053085 Bacteria 5260
2619 Ga0495619_0023467 3300053085 Bacteria 3955
2620 Ga0495619_0027358 3300053085 Bacteria 3671
2621 Ga0495619_0030001 3300053085 Bacteria 3518
2622 Ga0495619_0037857 3300053085 Bacteria 3145
2623 Ga0495619_0078589 3300053085 Bacteria 2218
2624 Ga0495619_0079671 3300053085 Bacteria 2203
2625 Ga0495619_0086632 3300053085 Bacteria 2117
2626 Ga0495619_0184490 3300053085 Bacteria 1443
2627 Ga0495619_0205481 3300053085 Bacteria 1363
2628 Ga0495619_0241310 3300053085 Bacteria 1252
2629 Ga0500643_000035 3300053087 Bacteria 184794
2630 Ga0500643_004228 3300053087 Bacteria 6574
2631 Ga0500644_0000325 3300053088 Bacteria 24740
2632 Ga0500581_068891 3300053089 Bacteria 1782
2633 Ga0500651_0008405 3300053093 Bacteria 6072
2634 Ga0500651_0040446 3300053093 Bacteria 2937
2635 Ga0500651_0086345 3300053093 Bacteria 1938
2636 Ga0500566_0000006 3300053094 Bacteria 153632
2637 Ga0500566_0001514 3300053094 Bacteria 13633
2638 Ga0500566_0002990 3300053094 Bacteria 10093
2639 Ga0500566_0014528 3300053094 Bacteria 4627
2640 Ga0500640_000996 3300053095 Bacteria 8055
2641 Ga0500641_0001371 3300053096 Bacteria 8681
2642 Ga0500641_0003439 3300053096 Bacteria 5596
2643 Ga0500641_0011224 3300053096 Bacteria 3250
2644 Ga0500650_0000139 3300053098 Bacteria 18956
2645 Ga0500555_005851 3300053103 Bacteria 3489
2646 Ga0500556_0000002 3300053104 Bacteria 773626
2647 Ga0500556_0005941 3300053104 Bacteria 3457
2648 Ga0500557_000004 3300053105 Bacteria 202318
2649 Ga0500560_000106 3300053107 Bacteria 8608
2650 Ga0500572_000205 3300053111 Bacteria 20946
2651 Ga0500572_001372 3300053111 Bacteria 6719
2652 Ga0500572_048050 3300053111 Bacteria 1262
2653 Ga0500593_024644 3300053117 Bacteria 2672
2654 Ga0500595_000001 3300053119 Bacteria 1088438
2655 Ga0500595_000152 3300053119 Bacteria 45452
2656 Ga0500595_002016 3300053119 Bacteria 10397
2657 Ga0500595_002270 3300053119 Bacteria 9692
2658 Ga0500595_008028 3300053119 Bacteria 4332
2659 Ga0500595_010226 3300053119 Bacteria 3738
2660 Ga0500607_003322 3300053121 Bacteria 11837
2661 Ga0500607_055260 3300053121 Bacteria 2099
2662 Ga0500608_000349 3300053122 Bacteria 17817
2663 Ga0500618_002246 3300053125 Bacteria 7520
2664 Ga0500618_006498 3300053125 Bacteria 3425
2665 Ga0500618_009304 3300053125 Bacteria 2688
2666 Ga0500618_016952 3300053125 Bacteria 1817
2667 Ga0500642_0000016 3300053130 Bacteria 176560
2668 Ga0500642_0008362 3300053130 Bacteria 3538
2669 Ga0500642_0009145 3300053130 Bacteria 3424
2670 Ga0500642_0062935 3300053130 Bacteria 1671
2671 Ga0500655_000041 3300053133 Bacteria 35332
2672 Ga0500655_016003 3300053133 Bacteria 1379
2673 Ga0500658_0007755 3300053134 Bacteria 3964
2674 Ga0500559_0001029 3300053136 Bacteria 17100
2675 Ga0500559_0001124 3300053136 Bacteria 16108
2676 Ga0500559_0001576 3300053136 Bacteria 12756
2677 Ga0500559_0022304 3300053136 Bacteria 2685
2678 Ga0500559_0072796 3300053136 Bacteria 1549
2679 Ga0500561_0000260 3300053137 Bacteria 9203
2680 Ga0500568_0000125 3300053139 Bacteria 68806
2681 Ga0500568_0001161 3300053139 Bacteria 17597
2682 Ga0500568_0032309 3300053139 Bacteria 2153
2683 Ga0500573_0034555 3300053140 Bacteria 2916
2684 Ga0500603_000671 3300053150 Bacteria 8328
2685 Ga0500603_001483 3300053150 Bacteria 5353
2686 Ga0500616_0000001 3300053153 Bacteria 1986011
2687 Ga0500616_0000061 3300053153 Bacteria 249158
2688 Ga0500616_0000296 3300053153 Bacteria 72493
2689 Ga0500616_0020934 3300053153 Bacteria 3672
2690 Ga0500616_0028797 3300053153 Bacteria 3059
2691 Ga0500616_0044050 3300053153 Bacteria 2382
2692 Ga0500616_0058950 3300053153 Bacteria 1995
2693 Ga0500620_000249 3300053155 Bacteria 10481
2694 Ga0500622_0000916 3300053156 Bacteria 25118
2695 Ga0500622_0003804 3300053156 Bacteria 9828
2696 Ga0500624_000316 3300053157 Bacteria 16592
2697 Ga0500624_001547 3300053157 Bacteria 3572
2698 Ga0500627_0034808 3300053158 Bacteria 2137
2699 Ga0500627_0041302 3300053158 Bacteria 1982
2700 Ga0500630_000954 3300053159 Bacteria 13513
2701 Ga0500638_000921 3300053162 Bacteria 8347
2702 Ga0500638_032968 3300053162 Bacteria 2502
2703 Ga0500639_000016 3300053163 Bacteria 118099
2704 Ga0500636_0000142 3300053177 Bacteria 37592
2705 Ga0500636_0000262 3300053177 Bacteria 29181
2706 Ga0500636_0005190 3300053177 Bacteria 7410
2707 Ga0500636_0007135 3300053177 Bacteria 6452
2708 Ga0500636_0012297 3300053177 Bacteria 5014
2709 Ga0500637_0000652 3300053178 Bacteria 13763
2710 Ga0500637_0002374 3300053178 Bacteria 8352
2711 Ga0500637_0080535 3300053178 Bacteria 1881
2712 Ga0500611_019458 3300053727 Bacteria 1268
2713 Ga0500625_013688 3300053729 Bacteria 3735
2714 Ga0500645_000629 3300053730 Bacteria 22510
2715 Ga0500599_000991 3300053736 Bacteria 3178
2716 Ga0501084_0006359 3300054114 Bacteria 9703
2717 Ga0501084_0031091 3300054114 Bacteria 4465
2718 Ga0501084_0038762 3300054114 Bacteria 3984
2719 Ga0501084_0056864 3300054114 Bacteria 3273
2720 Ga0501084_0057730 3300054114 Bacteria 3247
2721 Ga0501084_0118145 3300054114 Bacteria 2229
2722 Ga0590075_008941 3300059424 Bacteria 2397
2723 Ga0501082_0000002 3300060353 Bacteria 186546
2724 Ga0501082_0007109 3300060353 Bacteria 9658
2725 Ga0501082_0011831 3300060353 Bacteria 7500
2726 Ga0501082_0015300 3300060353 Bacteria 6605
2727 Ga0501082_0015319 3300060353 Bacteria 6600
2728 Ga0501082_0030845 3300060353 Bacteria 4621
2729 Ga0501082_0051155 3300060353 Bacteria 3561
2730 Ga0501082_0098807 3300060353 Bacteria 2524
2731 Ga0501082_0125631 3300060353 Bacteria 2225
2732 Ga0501082_0205053 3300060353 Bacteria 1715
2733 Ga0501082_0259513 3300060353 Bacteria 1512
2734 Ga0466962_0048349 3300061719 Bacteria 2033
2735 Ga0466962_0086052 3300061719 Bacteria 1505
2736 Ga0530510_0006156 3300061734 Bacteria 8335
2737 Ga0530510_0169227 3300061734 Bacteria 1618
2738 2503203487 2503198000 Bacteria 6884444
2739 2507508311 2507262055 Bacteria 8048963
2740 2508542377 2508501009 Bacteria 7784016
2741 2508691868 2508501042 Bacteria 8719808
2742 2508726764 2508501050 Bacteria 9633614
2743 2509074599 2508501114 Bacteria 7082538
2744 2509079242 2508501114 Bacteria 7082538
2745 2509115904 2508501123 Bacteria 6283661
2746 2509141632 2508501127 Bacteria 7037543
2747 2509151616 2508501128 Bacteria 8613869
2748 2509373691 2509276018 Bacteria 6910194
2749 2509397904 2509276022 Bacteria 6200534
2750 2510306343 2510065057 Bacteria 6649661
2751 2510316485 2510065059 Bacteria 6847884
2752 2511169516 2510917026 Bacteria 7046020
2753 2511249113 2511231003 Bacteria 5606035
2754 2511384206 2511231026 Bacteria 5225445
2755 2511390901 2511231027 Bacteria 5013807
2756 2511394985 2511231028 Bacteria 8046582
2757 2511501630 2511231052 Bacteria 6974333
2758 2512533069 2512047086 Bacteria 6850303
2759 2512929624 2512875016 Bacteria 6529530
2760 2512964408 2512875024 Bacteria 7195110
2761 2513586278 2513237086 Bacteria 7265287
2762 2513590269 2513237087 Bacteria 5817514
2763 2513608276 2513237090 Bacteria 7096802
2764 2513619836 2513237091 Bacteria 6900273
2765 2513622441 2513237092 Bacteria 8341956
2766 2513640621 2513237094 Bacteria 8789602
2767 2513645548 2513237095 Bacteria 8976980
2768 2513657858 2513237096 Bacteria 8722461
2769 2513674409 2513237098 Bacteria 9902361
2770 2513692857 2513237101 Bacteria 7952346
2771 2513702397 2513237102 Bacteria 7703324
2772 2513718480 2513237104 Bacteria 10034502
2773 2513855558 2513237137 Bacteria 9558895
2774 2513873045 2513237139 Bacteria 8737671
2775 2513884257 2513237140 Bacteria 7076289
2776 2513890205 2513237141 Bacteria 8496279
2777 2513906577 2513237143 Bacteria 6664116
2778 2513920049 2513237145 Bacteria 8979722
2779 2513961393 2513237151 Bacteria 6309801
2780 2514015657 2513237161 Bacteria 8871253
2781 2514036959 2513237164 Bacteria 7563725
2782 2514421419 2513237305 Bacteria 7293571
2783 2514591625 2513237351 Bacteria 6968952
2784 2515608533 2515154107 Bacteria 6795637
2785 2515627187 2515154112 Bacteria 8294334
2786 2516892949 2516653046 Bacteria 6989037
2787 2517102768 2517093001 Bacteria 9002274
2788 2517892103 2517572143 Bacteria 9484767
2789 2521559739 2521172590 Bacteria 5047645
2790 2524437625 2524023205 Bacteria 8918781
2791 2524453579 2524023207 Bacteria 6813453
2792 2524465785 2524023210 Bacteria 9029266
2793 2524534188 2524023228 Bacteria 10118060
2794 2528848579 2528768022 Bacteria 10457665
2795 2537873674 2537561587 Bacteria 5425293
2796 2545678747 2545555834 Bacteria 8130841
2797 2550693059 2548876994 Bacteria 4904866
2798 2551677560 2551306084 Bacteria 8942552
2799 2551686386 2551306085 Bacteria 7347181
2800 2551693908 2551306086 Bacteria 6843938
2801 2551698784 2551306087 Bacteria 7351905
2802 2551710672 2551306089 Bacteria 7162724
2803 2551723972 2551306090 Bacteria 7953713
2804 2551725541 2551306091 Bacteria 7086830
2805 2551745492 2551306093 Bacteria 7064773
2806 2553006225 2551306416 Bacteria 6152985
2807 2554246037 2554235003 Bacteria 5877155
2808 2559296197 2558860242 Bacteria 5568029
2809 2585997866 2585427633 Bacteria 6413184
2810 2586002455 2585427634 Bacteria 6455027
2811 2588515202 2588253730 Bacteria 6881675
2812 2596371787 2595698237 Bacteria 6712432
2813 2597815189 2597489875 Bacteria 7010078
2814 2599604649 2599185210 Bacteria 5624189
2815 2599939925 2599185301 Bacteria 6161860
2816 2601612930 2600255279 Bacteria 5605316
2817 2601748476 2600255308 Bacteria 5611129
2818 2603856742 2602042107 Bacteria 6226103
2819 2617347092 2617270735 Bacteria 9163226
2820 2617375487 2617270741 Bacteria 8201522
2821 2643758463 2643221547 Bacteria 4740017
2822 2643774116 2643221550 Bacteria 4619371
2823 2643774780 2643221551 Bacteria 3750538
2824 2643775630 2643221551 Bacteria 3750538
2825 2643793224 2643221555 Bacteria 3749717
2826 2643794077 2643221555 Bacteria 3749717
2827 2643810984 2643221558 Bacteria 5460675
2828 2643826423 2643221561 Bacteria 4984412
2829 2643838617 2643221564 Bacteria 4193379
2830 2643867307 2643221570 Bacteria 5103772
2831 2643989032 2643221595 Bacteria 6565519
2832 2643990224 2643221596 Bacteria 5006805
2833 2644132734 2643221623 Bacteria 5239945
2834 2644152217 2643221627 Bacteria 6761570
2835 2644288982 2643221651 Bacteria 4798932
2836 2644295717 2643221652 Bacteria 5140275
2837 2644329043 2643221658 Bacteria 6064537
2838 2644522977 2643221693 Bacteria 5513853
2839 2644532690 2643221696 Bacteria 5431823
2840 2644730220 2643221733 Bacteria 5690728
2841 2644737840 2643221734 Bacteria 5365412
2842 2644746359 2643221736 Bacteria 6608466
2843 2671121859 2667528175 Bacteria 7532676
2844 2688600318 2687453392 Bacteria 6880454
2845 2694632487 2693429783 Bacteria 7019804
2846 2694639782 2693429784 Bacteria 7241525
2847 2723577604 2721755686 Bacteria 7343952
2848 2723844776 2721755755 Bacteria 8322773
2849 2723878907 2721755763 Bacteria 4464185
2850 2728751093 2728368998 Bacteria 8720350
2851 2738945191 2738541317 Bacteria 5340176
2852 2739306647 2738543024 Bacteria 5603683
2853 2745079558 2744054633 Bacteria 8678936
2854 2756673119 2756170246 Bacteria 7451806
2855 2765570997 2765235838 Bacteria 5445269
2856 2770194974 2767802442 Bacteria 5747986
2857 2774871734 2773857925 Bacteria 6472445
2858 2776257767 2775506901 Bacteria 9631051
2859 2776272231 2775506902 Bacteria 6208009
2860 2776284171 2775506904 Bacteria 5954060
2861 2792750848 2791355123 Bacteria 8049106
2862 2793062692 2791355196 Bacteria 7323613
2863 2793068812 2791355197 Bacteria 8420563
2864 2793079880
2865 2805915056 2802429603 Bacteria 8777136
2866 2808984834 2808606386 Bacteria 4471946
2867 2808988418 2808606387 Bacteria 5697198
2868 2809128240 2808606415 Bacteria 4576710
2869 2809147861 2808606419 Bacteria 4576925
2870 2818238595 2816332527 Bacteria 8933356
2871 2819559483 2818991439 Bacteria 6907412
2872 2819595472 2818991445 Bacteria 4955017
2873 2819616036 2818991449 Bacteria 5518009
2874 2819721663 2818991467 Bacteria 5893227
2875 2824602457 2824600985 Bacteria 8488197
2876 2824610428 2824609381 Bacteria 8672835
2877 2824618005 2824617872 Bacteria 8814715
2878 2824626673 2824626560 Bacteria 8813858
2879 2824636692 2824635225 Bacteria 8785348
2880 2824648995 2824644064 Bacteria 8743947
2881 2824657380 2824653114 Bacteria 8493680
2882 2824661466 2824661429 Bacteria 9877870
2883 2824674912 2824671348 Bacteria 8369588
2884 2824687526 2824679649 Bacteria 8248951
2885 2824691337 2824687955 Bacteria 8360029
2886 2824699483 2824696289 Bacteria 8335049
2887 2824709725 2824704595 Bacteria 9667483
2888 2824719283 2824714736 Bacteria 8717648
2889 2824729674 2824723954 Bacteria 8758240
2890 2824733351 2824732956 Bacteria 7810675
2891 2824746522 2824746037 Bacteria 7911610
2892 2824754255 2824753945 Bacteria 9787441
2893 2824768992 2824763712 Bacteria 9792355
2894 2824775350 2824773399 Bacteria 8360218
2895 2828306613 2828305725 Bacteria 4916900
2896 2835315656 2835312727 Bacteria 7413381
2897 2837652503 2837651117 Bacteria 3772164
2898 2837679652 2837678835 Bacteria 5252418
2899 2838123448 2838122688 Bacteria 8803140
2900 2838679709 2838675328 Bacteria 4909118
2901 2838717521 2838714209 Bacteria 5525906
2902 2838724278 2838719591 Bacteria 5523910
2903 2838729405 2838724970 Bacteria 4908691
2904 2839099311 2839094727 Bacteria 5534556
2905 2839994547 2839993093 Bacteria 5512535
2906 2840765069 2840764183 Bacteria 6358399
2907 2841734624 2841734538 Bacteria 6784580
2908 2841766304 2841760612 Bacteria 6454112
2909 2841850833 2841846520 Bacteria 5345850
2910 2841861732 2841859092 Bacteria 5436171
2911 2841912323 2841911363 Bacteria 6173697
2912 2841919908 2841917233 Bacteria 6173500
2913 2841947779 2841941048 Bacteria 8688029
2914 2841949550 2841949485 Bacteria 8680857
2915 2841964145 2841957949 Bacteria 8652217
2916 2841971943 2841966195 Bacteria 8673214
2917 2841974714 2841974524 Bacteria 8931498
2918 2841983728 2841983080 Bacteria 8395090
2919 2842040088 2842038055 Bacteria 8002051
2920 2842046967 2842045827 Bacteria 8006841
2921 2842129638 2842124991 Bacteria 5346824
2922 2842134782 2842130223 Bacteria 4909145
2923 2842156700 2842152218 Bacteria 4908957
2924 2842172958 2842170452 Bacteria 5525737
2925 2842180318 2842175837 Bacteria 4908771
2926 2842192022 2842187318 Bacteria 5524014
2927 2842216338 2842211629 Bacteria 5523832
2928 2842229058 2842224351 Bacteria 5524473
2929 2842340302 2842333319 Bacteria 8899485
2930 2842518002 2842515876 Bacteria 5436280
2931 2842873757 2842871566 Bacteria 4827117
2932 2844005570 2844002411 Bacteria 7168230
2933 2844015631 2844009547 Bacteria 6728125
2934 2844106070 2844104063 Bacteria 6440972
2935 2844319321 2844315083 Bacteria 8138177
2936 2847672006 2847670302 Bacteria 6165597
2937 2847688231 2847686936 Bacteria 6278406
2938 2847936500 2847930680 Bacteria 9342022
2939 2847946846 2847939898 Bacteria 8606328
2940 2849079051 2849076700 Bacteria 7039503
2941 2851186576 2851182111 Bacteria 6047226
2942 2851246426 2851246043 Bacteria 6439203
2943 2852620728 2852618963 Bacteria 4577824
2944 2854901643 2854896431 Bacteria 5869725
2945 2854917580 2854916844 Bacteria 5725939
2946 2855734680 2855730933 Bacteria 7047938
2947 2855770270 2855767633 Bacteria 7049357
2948 2855825739 2855825444 Bacteria 6785811
2949 2855841111 2855839649 Bacteria 7135830
2950 2856318262 2856314179 Bacteria 6477897
2951 2856324229 2856320880 Bacteria 7263508
2952 2856328612 2856328259 Bacteria 6528202
2953 2856338472 2856334872 Bacteria 7037011
2954 2856345613 2856342000 Bacteria 7176905
2955 2856356132 2856349417 Bacteria 6230045
2956 2856364842 2856364286 Bacteria 6939991
2957 2857354898 2857349434 Bacteria 7926032
2958 2857369063 2857367948 Bacteria 6965560
2959 2857516699 2857509624 Bacteria 7472071
2960 2857528220 2857524615 Bacteria 6615449
2961 2857578469 2857576091 Bacteria 5465855
2962 2857580800 2857576091 Bacteria 5465855
2963 2858801644 2858800743 Bacteria 6603254
2964 2869165479 2869162929 Bacteria 6399702
2965 2869246574 2869242130 Bacteria 6609239
2966 2869261664 2869256925 Bacteria 6981691
2967 2869264631 2869264136 Bacteria 6880765
2968 2869277311 2869271264 Bacteria 6908218
2969 2869281773 2869278585 Bacteria 7077053
2970 2869289709 2869285874 Bacteria 6901219
2971 2871431775 2871429161 Bacteria 6547891
2972 2871450055 2871444079 Bacteria 6423508
2973 2871465749 2871459585 Bacteria 6866887
2974 2871469060 2871466892 Bacteria 6923287
2975 2871477876 2871474448 Bacteria 6806570
2976 2871486445 2871481445 Bacteria 6700002
2977 2871494113 2871488783 Bacteria 6929816
2978 2871497536 2871495908 Bacteria 6935695
2979 2874105529 2874102143 Bacteria 6342645
2980 2874115012 2874109183 Bacteria 6517025
2981 2874117406 2874116593 Bacteria 6674494
2982 2874127743 2874123672 Bacteria 7238285
2983 2874136450 2874131515 Bacteria 6820270
2984 2874140559 2874139085 Bacteria 7021506
2985 2874155453 2874146452 Bacteria 7533118
2986 2874162310 2874155637 Bacteria 6724144
2987 2874166579 2874162495 Bacteria 6174670
2988 2874175262 2874168670 Bacteria 8062617
2989 2874598323 2874590934 Bacteria 8299676
2990 2874605503 2874604998 Bacteria 7834745
2991 2874619472 2874612657 Bacteria 8252029
2992 2874627526 2874620515 Bacteria 8290088
2993 2874632154 2874628541 Bacteria 8630250
2994 2874652621 2874645413 Bacteria 8214782
2995 2876366814 2876363079 Bacteria 6544991
2996 2876379268 2876377896 Bacteria 6565995
2997 2876387085 2876386047 Bacteria 6698674
2998 2876398768 2876392853 Bacteria 6660880
2999 2876400604 2876399893 Bacteria 6927900
3000 2876420798 2876413966 Bacteria 6831344
3001 2876426982 2876420981 Bacteria 6687741
3002 2876764853 2876761206 Bacteria 10111113
3003 2876778199 2876771140 Bacteria 8287509
3004 2876813065 2876808645 Bacteria 8824342
3005 2876825932 2876818435 Bacteria 8274608
3006 2878037600 2878035449 Bacteria 6555736
3007 2878737016 2878730984 Bacteria 6380721
3008 2878742342 2878738818 Bacteria 7136951
3009 2878748381 2878745973 Bacteria 6867388
3010 2878756688 2878753008 Bacteria 6922523
3011 2878761754 2878760144 Bacteria 6823465
3012 2878768722 2878767105 Bacteria 6898628
3013 2878776726 2878774303 Bacteria 6108671
3014 2878792244 2878788777 Bacteria 6567085
3015 2879081993 2879074833 Bacteria 8279565
3016 2879089464 2879083081 Bacteria 8587928
3017 2879104570 2879099564 Bacteria 10442239
3018 2879115823 2879110137 Bacteria 8907982
3019 2879135115 2879127579 Bacteria 8294491
3020 2879149800 2879142872 Bacteria 8267021
3021 2881153876 2881147464 Bacteria 7779814
3022 2881157639 2881155292 Bacteria 6461656
3023 2881163000 2881161766 Bacteria 7127907
3024 2881368576 2881364244 Bacteria 7710352
3025 2881414491 2881412998 Bacteria 6492157
3026 2881672623 2881665667 Bacteria 8175609
3027 2881850019 2881845957 Bacteria 6611900
3028 2881853941 2881853255 Bacteria 6698367
3029 2881864153 2881861095 Bacteria 7128710
3030 2881928685 2881927736 Bacteria 3993927
3031 2882457226 2882456835 Bacteria 6863978
3032 2882462030 2882456835 Bacteria 6863978
3033 2882635326 2882632389 Bacteria 8154593
3034 2882919170 2882912400 Bacteria 6801539
3035 2883297215 2883291878 Bacteria 5894118
3036 2883359998 2883354860 Bacteria 5865246
3037 2883580499 2883577096 Bacteria 4709178
3038 2884298632 2884298095 Bacteria 3823049
3039 2884813188 2884811622 Bacteria 5552861
3040 2884815888 2884811622 Bacteria 5552861
3041 2884838724 2884836552 Bacteria 5219991
3042 2884841335 2884836552 Bacteria 5219991
3043 2884855016 2884852848 Bacteria 5221161
3044 2884856209 2884852848 Bacteria 5221161
3045 2885311810 2885305155 Bacteria 7348390
3046 2885316227 2885312484 Bacteria 6415165
3047 2885323888 2885318864 Bacteria 6729568
3048 2885333563 2885326080 Bacteria 7134805
3049 2885341840 2885334103 Bacteria 7216818
3050 2885347393 2885342637 Bacteria 7011821
3051 2885353419 2885350715 Bacteria 6787678
3052 2885369171 2885366525 Bacteria 8326213
3053 2885381704 2885374607 Bacteria 8927485
3054 2885391462 2885383462 Bacteria 9473874
3055 2885410479 2885409591 Bacteria 9235467
3056 2888341490 2888337043 Bacteria 6629336
3057 2888348637 2888343758 Bacteria 6611049
3058 2888350840 2888350351 Bacteria 7372807
3059 2888384375 2888378607 Bacteria 9652610
3060 2888393543 2888388044 Bacteria 7304136
3061 2888424803 2888419890 Bacteria 7857137
3062 2889013186 2889010040 Bacteria 6749192
3063 2889021961 2889016732 Bacteria 6700763
3064 2889039475 2889033259 Bacteria 9099371
3065 2889307077 2889306138 Bacteria 6358934
3066 2889790833 2889790730 Bacteria 5689708
3067 2889915215 2889914905 Bacteria 5702301
3068 2893068661 2893066018 Bacteria 6158120
3069 2894024052 2894023352 Bacteria 5167372
3070 2894242857 2894232714 Bacteria 8834183
3071 2894655100 2894652903 Bacteria 4587256
3072 2894772749 2894772417 Bacteria 5305674
3073 2896156316 2896154374 Bacteria 5221518
3074 2896156865 2896154374 Bacteria 5221518
3075 2899263069 2899259804 Bacteria 3320927
3076 2899275571 2899275550 Bacteria 3958688
3077 2899792820 2899792073 Bacteria 4926588
3078 2899807150 2899803654 Bacteria 5577784
3079 2899848540 2899845264 Bacteria 5672268
3080 2902336954 2902330777 Bacteria 6395352
3081 2902411217 2902405164 Bacteria 6784948
3082 2903452989 2903448605 Bacteria 7357801
3083 2903502383 2903492973 Bacteria 13473544
3084 2903506058 2903492973 Bacteria 13473544
3085 2903513508 2903513507 Bacteria 6344008
3086 2903524681 2903521522 Bacteria 6525694
3087 2903531076 2903528002 Bacteria 6586099
3088 2903542331 2903540706 Bacteria 7062119
3089 2903734262 2903727486 Bacteria 8281579
3090 2903753485 2903748898 Bacteria 9972761
3091 2903777535 2903768456 Bacteria 9749579
3092 2904443374 2904439833 Bacteria 5931679
3093 2904533085 2904530477 Bacteria 5876334
3094 2904578825 2904578770 Bacteria 5302906
3095 2904585638 2904584206 Bacteria 6028872
3096 2904593987 2904589729 Bacteria 6113573
3097 2904603858 2904601388 Bacteria 5884906
3098 2904665300 2904659560 Bacteria 6685615
3099 2904673154 2904666416 Bacteria 8226587
3100 2904694831 2904690495 Bacteria 9412302
3101 2904702225
3102 2904714978 2904711408 Bacteria 9771557
3103 2906311998 2906308376 Bacteria 6841989
3104 2906323736 2906321335 Bacteria 6579571
3105 2906331396 2906328253 Bacteria 6585166
3106 2906367039 2906363423 Bacteria 6856682
3107 2906375078 2906370794 Bacteria 6881062
3108 2906381827 2906378014 Bacteria 6911440
3109 2906389046 2906386501 Bacteria 5977019
3110 2906398145 2906393657 Bacteria 6790866
3111 2906402428 2906401398 Bacteria 6693206
3112 2906408413 2906408224 Bacteria 6162342
3113 2906418299 2906414383 Bacteria 6580790
3114 2906605507 2906602504 Bacteria 8295279
3115 2906617234
3116 2906633609 2906626472 Bacteria 8826946
3117 2906643377 2906635258 Bacteria 8601019
3118 2906645102 2906643746 Bacteria 8722424
3119 2906662492 2906660503 Bacteria 8595048
3120 2908742383 2908739725 Bacteria 8628932
3121 2908760051 2908756301 Bacteria 8864324
3122 2908780453 2908775508 Bacteria 8092255
3123 2913309817 2913308742 Bacteria 5350706
3124 2915992873 2915986958 Bacteria 6739310
3125 2915999499 2915993759 Bacteria 7016183
3126 2916001880 2916000859 Bacteria 6865702
3127 2916012755 2916007675 Bacteria 6898660
3128 2916020580 2916014648 Bacteria 6946486
3129 2916024578 2916021584 Bacteria 6854472
3130 2916032045 2916028427 Bacteria 6748433
3131 2916038975 2916035215 Bacteria 6755766
3132 2916045826 2916041962 Bacteria 6820487
3133 2916052593 2916048683 Bacteria 6543552
3134 2916059432 2916055098 Bacteria 6758838
3135 2916074132 2916068649 Bacteria 6943657
3136 2916078242 2916076590 Bacteria 6596108
3137 2917702558 2917699015 Bacteria 7043791
3138 2919047566 2919046199 Bacteria 5567169
3139 2919075643 2919073203 Bacteria 6531949
3140 2919081902 2919079590 Bacteria 5946433
3141 2919119273 2919114240 Bacteria 5700270
3142 2919122347 2919119836 Bacteria 5208557
3143 2919175698 2919171160 Bacteria 6499771
3144 2921207163 2921201388 Bacteria 6926299
3145 2921215232 2921208531 Bacteria 6745326
3146 2921241308 2921237296 Bacteria 6876710
3147 2921248221 2921244191 Bacteria 6568419
3148 2921262407 2921257292 Bacteria 6808382
3149 2921267786 2921263974 Bacteria 6864552
3150 2921284370 2921282425 Bacteria 6826397
3151 2921294871 2921289301 Bacteria 7316391
3152 2921301871 2921296804 Bacteria 7176999
3153 2922138664 2922130491 Bacteria 7173936
3154 2922153863 2922151315 Bacteria 6902399
3155 2922161253 2922158528 Bacteria 6573167
3156 2922178164 2922172374 Bacteria 6167644
3157 2922183517 2922178524 Bacteria 6025201
3158 2922193471 2922185730 Bacteria 7113964
3159 2922365639 2922361189 Bacteria 7436256
3160 2922374738
3161 2922391253 2922386360 Bacteria 7017218
3162 2922400522 2922393267 Bacteria 8285685
3163 2922430595
3164 2923513511 2923510766 Bacteria 5926163
3165 2924148383 2924144063 Bacteria 6883928
3166 2924154793 2924150972 Bacteria 7169444
3167 2924159802 2924158325 Bacteria 7188855
3168 2924167581 2924165586 Bacteria 7260590
3169 2924177239 2924172951 Bacteria 6749356
3170 2924185042 2924179722 Bacteria 6843264
3171 2924192386 2924186466 Bacteria 6876637
3172 2924198855 2924193448 Bacteria 6955718
3173 2924204328 2924200457 Bacteria 6757188
3174 2924211461 2924207177 Bacteria 6917007
3175 2924216964 2924214083 Bacteria 7080103
3176 2924227957 2924221636 Bacteria 7113495
3177 2924232940 2924228884 Bacteria 6633132
3178 2924725058 2924718760 Bacteria 6331356
3179 2924728117 2924726620 Bacteria 6271473
3180 2924740365 2924733363 Bacteria 7574837
3181 2924742766 2924741084 Bacteria 6661321
3182 2924752564 2924748358 Bacteria 6154725
3183 2924762344 2924754689 Bacteria 6774424
3184 2924764425 2924762789 Bacteria 6561353
3185 2924780142 2924776078 Bacteria 7492003
3186 2924788277 2924784321 Bacteria 7416538
3187 2926759303 2926754445 Bacteria 5964435
3188 2926759916 2926754445 Bacteria 5964435
3189 2926763146 2926760298 Bacteria 5505990
3190 2928128050 2928125067 Bacteria 5937560
3191 2928135570 2928130867 Bacteria 5467269
3192 2928526154 2928521798 Bacteria 4960112
3193 2928963016 2928959182 Bacteria 4725774
3194 2929203587 2929199973 Bacteria 7260745
3195 2929219152 2929212328 Bacteria 7708288
3196 2929525118 2929520902 Bacteria 6765052
3197 2929621811 2929615660 Bacteria 9193770
3198 2929629882 2929624759 Bacteria 9339455
3199 2932788671 2932784394 Bacteria 9704911
3200 2932798086 2932794094 Bacteria 7915132
3201 2932807058 2932801729 Bacteria 7987968
3202 2932817388 2932809354 Bacteria 9135765
3203 2932826157 2932818245 Bacteria 9955613
3204 2932830319 2932828146 Bacteria 9745859
3205 2933011306 2933006813 Bacteria 4912075
3206 2933013631 2933011516 Bacteria 5439334
3207 2933583913 2933577622 Bacteria 9116884
3208 2933596929 2933594066 Bacteria 5594265
3209 2935609204 2935608549 Bacteria 8203142
3210 2935616610 2935616580 Bacteria 9032984
3211 2935631240 2935630451 Bacteria 8169952
3212 2935642060 2935638405 Bacteria 10015038
3213 2935650994 2935648319 Bacteria 8801166
3214 2935659175 2935656913 Bacteria 8965014
3215 2935672556 2935665750 Bacteria 9571747
3216 2935675973 2935675223 Bacteria 9928132
3217 2935685970 2935684952 Bacteria 9590419
3218 2935697785 2935694250 Bacteria 9291695
3219 2935705811 2935703347 Bacteria 10242284
3220 2935714522 2935713505 Bacteria 9608509
3221 2935725141 2935722832 Bacteria 9608746
3222 2935732499 2935732158 Bacteria 9706831
3223 2935741878 2935741537 Bacteria 9707219
3224 2935751935 2935750917 Bacteria 9590372
3225 2935765188 2935760218 Bacteria 9817913
3226 2935771784 2935769743 Bacteria 7878163
3227 2935778777 2935777560 Bacteria 8077691
3228 2935788835 2935785616 Bacteria 7962367
3229 2935795365 2935793552 Bacteria 8012592
3230 2935802808 2935801545 Bacteria 9301974
3231 2935813360 2935810662 Bacteria 9401221
3232 2935822364 2935819856 Bacteria 8261050
3233 2935830227 2935827899 Bacteria 10038562
3234 2935838124 2935837841 Bacteria 9454360
3235 2935847946 2935847175 Bacteria 8228321
3236 2935855234 2935855204 Bacteria 9035059
3237 2935867503 2935864058 Bacteria 9784707
3238 2935875659 2935873716 Bacteria 9632195
3239 2935886814 2935883170 Bacteria 7964738
3240 2935908834 2935908558 Bacteria 8568796
3241 2935919554 2935916978 Bacteria 9113783
3242 2935926592 2935926038 Bacteria 8601059
3243 2935935042 2935934488 Bacteria 8602579
3244 2935943492 2935942939 Bacteria 8599779
3245 2935951930 2935951376 Bacteria 8602333
3246 2935960688 2935959822 Bacteria 7869783
3247 2935968055 2935967501 Bacteria 8603075
3248 2935978681 2935975950 Bacteria 8347125
3249 2935987447 2935984226 Bacteria 8302647
3250 2935996342 2935992306 Bacteria 9802711
3251 2936003625 2936002035 Bacteria 9362176
3252 2936013590 2936011229 Bacteria 8801034
3253 2936022283 2936019824 Bacteria 8804134
3254 2936030729 2936028420 Bacteria 8965941
3255 2936042309 2936037263 Bacteria 9446081
3256 2936048542 2936046547 Bacteria 8903709
3257 2936058756 2936055302 Bacteria 8785755
3258 2937002534 2936996657 Bacteria 6298727
3259 2937007512 2937002841 Bacteria 6934057
3260 2937013804 2937009748 Bacteria 6746052
3261 2937023009 2937016420 Bacteria 6782579
3262 2937027727 2937023124 Bacteria 6815156
3263 2937048454 2937042894 Bacteria 6741576
3264 2937051861 2937049772 Bacteria 6757901
3265 2937063176 2937056579 Bacteria 7107896
3266 2937068830 2937063883 Bacteria 7199456
3267 2937077434 2937071275 Bacteria 6984483
3268 2937098440 2937091812 Bacteria 6979387
3269 2937099260 2937098957 Bacteria 7249374
3270 2937107956 2937106411 Bacteria 6947143
3271 2937117137 2937113482 Bacteria 6505872
3272 2937124114 2937119839 Bacteria 6597547
3273 2937127495 2937126314 Bacteria 6771275
3274 2937818179 2937813078 Bacteria 7783518
3275 2937826954 2937822353 Bacteria 7290551
3276 2937842756 2937836603 Bacteria 6811263
3277 2937846610 2937843397 Bacteria 5256375
3278 2937850675 2937848649 Bacteria 6983481
3279 2937867401 2937861824 Bacteria 6660327
3280 2937882663 2937877337 Bacteria 7246526
3281 2937893451 2937891427 Bacteria 6357007
3282 2937973364 2937972304 Bacteria 7532020
3283 2937985503 2937980651 Bacteria 6517427
3284 2937996186 2937994558 Bacteria 7036190
3285 2938019558 2938014810 Bacteria 6700592
3286 2940557262 2940556831 Bacteria 9590747
3287 2941481212
3288 2941509981 2941507105 Bacteria 8166816
3289 2941518932 2941515067 Bacteria 8166720
3290 2941525380 2941523033 Bacteria 8169134
3291 2941533080 2941531003 Bacteria 7653939
3292 2941539209 2941538514 Bacteria 9402094
3293 2954014948 2954011201 Bacteria 4762601
3294 2957386681 2957382221 Bacteria 6737050
3295 2957393100 2957388812 Bacteria 6778072
3296 2957400341 2957395598 Bacteria 6822399
3297 2957407190 2957402308 Bacteria 6741770
3298 2957412970 2957408893 Bacteria 6558585
3299 2957417042 2957415311 Bacteria 6991633
3300 2957424787 2957422303 Bacteria 7172205
3301 2957434905 2957430029 Bacteria 7022557
3302 2957448592 2957443900 Bacteria 6869977
3303 2957457001 2957450854 Bacteria 6765715
3304 2957462200 2957457609 Bacteria 6967680
3305 2957469066 2957464669 Bacteria 6568877
3306 2957474741 2957471148 Bacteria 6797643
3307 2957481660 2957478035 Bacteria 6756658
3308 2957489343 2957484790 Bacteria 6703082
3309 2957496170 2957491536 Bacteria 6695180
3310 2957503491 2957498199 Bacteria 7126688
3311 2957510892 2957505466 Bacteria 7253085
3312 2958037734 2958034702 Bacteria 6989922
3313 2958047446 2958041894 Bacteria 13082850
3314 2958066117 2958064165 Bacteria 7158582
3315 2958074935 2958071322 Bacteria 6815895
3316 2958089788 2958084443 Bacteria 7312792
3317 2958092993 2958092219 Bacteria 6861151
3318 2958102130 2958100919 Bacteria 6800575
3319 2958116807 2958115193 Bacteria 6923548
3320 2958124573 2958122699 Bacteria 7280457
3321 2958134082 2958130278 Bacteria 6897202
3322 2958142503 2958137437 Bacteria 6050276
3323 2958166656 2958165035 Bacteria 6906348
3324 2958179425 2958172287 Bacteria 6716688
3325 2958183728 2958179912 Bacteria 6874908
3326 2960588613 2960584000 Bacteria 6864594
3327 2960600382 2960597568 Bacteria 6550735
3328 2960608906 2960603979 Bacteria 6898737
3329 2960615253 2960610863 Bacteria 6691244
3330 2960618978 2960617483 Bacteria 6727748
3331 2960628219 2960624210 Bacteria 6875384
3332 2960642780 2960637947 Bacteria 7296468
3333 2960649685 2960645483 Bacteria 7211087
3334 2960658061 2960652885 Bacteria 7083688
3335 2960664428 2960660292 Bacteria 7041660
3336 2960669388 2960667422 Bacteria 6763020
3337 2960680225 2960674078 Bacteria 6609048
3338 2960693598 2960687367 Bacteria 6535474
3339 2961081694 2961077736 Bacteria 7079850
3340 2961120300 2961114664 Bacteria 6680456
3341 2961132217 2961127735 Bacteria 7196641
3342 2961141767 2961136820 Bacteria 6775228
3343 2961165122 2961163497 Bacteria 6901077
3344 2961172978 2961170736 Bacteria 7072258
3345 2961184159 2961183825 Bacteria 6688536
3346 2963649608 2963644680 Bacteria 6530403
3347 2964614299 2964607997 Bacteria 7101408
3348 2964618971 2964615318 Bacteria 6809089
3349 2964627597 2964621998 Bacteria 6834995
3350 2964633524 2964628898 Bacteria 7083044
3351 2964640913 2964636051 Bacteria 7091832
3352 2964647643 2964643177 Bacteria 6820887
3353 2964652204 2964649959 Bacteria 6675118
3354 2964661553 2964656573 Bacteria 7100150
3355 2964667035 2964663802 Bacteria 7019362
3356 2964671667 2964670856 Bacteria 6851364
3357 2964684441 2964678106 Bacteria 6792020
3358 2964689321 2964685014 Bacteria 6839111
3359 2964697377 2964691889 Bacteria 6802758
3360 2964703123 2964698721 Bacteria 6765331
3361 2964709115 2964705432 Bacteria 7114648
3362 2964716881 2964712639 Bacteria 6695970
3363 2964722853 2964719344 Bacteria 7286602
3364 2965019946 2965018300 Bacteria 6883036
3365 2965026233 2965025482 Bacteria 6532201
3366 2965036325 2965032056 Bacteria 6887443
3367 2965046964 2965040258 Bacteria 6855979
3368 2965052141 2965047637 Bacteria 6623551
3369 2965069809 2965062239 Bacteria 7412989
3370 2965112597 2965110997 Bacteria 6693150
3371 2965124132 2965119406 Bacteria 6956431
3372 2967670357 2967664464 Bacteria 6948836
3373 2967676921 2967671571 Bacteria 7021409
3374 2967680823 2967678726 Bacteria 7264382
3375 2967697499 2967693043 Bacteria 6804451
3376 2967713670 2967706974 Bacteria 7186053
3377 2967715356 2967714385 Bacteria 7000047
3378 2967725429 2967721400 Bacteria 7073753
3379 2967741500 2967735183 Bacteria 6827012
3380 2967753151 2967748971 Bacteria 6733771
3381 2967760596 2967755722 Bacteria 6814706
3382 2967766898 2967762386 Bacteria 6923502
3383 2967773081 2967769361 Bacteria 6587838
3384 2967779545 2967775926 Bacteria 6738189
3385 2967998189 2967996073 Bacteria 6787468
3386 2968008841 2968003550 Bacteria 6929263
3387 2968019431 2968016561 Bacteria 7022047
3388 2968084770 2968083720 Bacteria 7351627
3389 2968092234 2968091066 Bacteria 6052692
3390 2968101657 2968097103 Bacteria 6107094
3391 2968116767 2968110612 Bacteria 6814636
3392 2968118512 2968117919 Bacteria 6536078
3393 2968131845 2968128360 Bacteria 6270294
3394 2968143928 2968138860 Bacteria 6605449
3395 2968173523 2968171901 Bacteria 6894245
3396 2970024664 2970019648 Bacteria 7072033
3397 2970038343 2970033650 Bacteria 7118744
3398 2970044998 2970040964 Bacteria 6731123
3399 2970051089 2970047711 Bacteria 7088379
3400 2970059924 2970054988 Bacteria 6611507
3401 2970066658 2970061556 Bacteria 7099761
3402 2970073633 2970068827 Bacteria 7123112
3403 2970079786 2970076120 Bacteria 6697332
3404 2970083761 2970082768 Bacteria 6183754
3405 2970093087 2970088815 Bacteria 6933825
3406 2970101127 2970095765 Bacteria 6936963
3407 2970107126 2970102677 Bacteria 6812532
3408 2970112832 2970109326 Bacteria 6863976
3409 2970120332 2970116247 Bacteria 6501857
3410 2970133788 2970129317 Bacteria 6806560
3411 2970138075 2970136068 Bacteria 7207982
3412 2970152853 2970149975 Bacteria 6779706
3413 2970158037 2970156795 Bacteria 7168044
3414 2970166408 2970164137 Bacteria 6861252
3415 2970176202 2970170962 Bacteria 6876229
3416 2970182309 2970177841 Bacteria 6768001
3417 2970188554 2970184632 Bacteria 7054431
3418 2970192692 2970191845 Bacteria 7032787
3419 2970472752 2970469710 Bacteria 6969209
3420 2970494743 2970489779 Bacteria 6517260
3421 2970505572 2970503327 Bacteria 7099517
3422 2970515872 2970510686 Bacteria 7006402
3423 2970529553 2970524798 Bacteria 6840927
3424 2970533936 2970532167 Bacteria 6553173
3425 2970546342 2970540015 Bacteria 6977556
3426 2970550631 2970547951 Bacteria 6931819
3427 2970556612 2970554993 Bacteria 6814252
3428 2970596377 2970593180 Bacteria 7073582
3429 2977521383 2977516862 Bacteria 6940108
3430 2977528624 2977523885 Bacteria 6960446
3431 2977541557 2977537788 Bacteria 6929320
3432 2977552677 2977551784 Bacteria 7125765
3433 2977563281 2977558990 Bacteria 6863948
3434 2977570972 2977565890 Bacteria 6901543
3435 2977576373 2977572785 Bacteria 6763888
3436 2977586244 2977579622 Bacteria 6772100
3437 2977825868 2977821940 Bacteria 6906439
3438 2977834834 2977828996 Bacteria 7007971
3439 2977851275 2977843712 Bacteria 6753583
3440 2977857798 2977851361 Bacteria 6694324
3441 2977864052 2977858184 Bacteria 6215359
3442 2977870575 2977864932 Bacteria 7534097
3443 2977875000 2977872689 Bacteria 7270173
3444 2977905397 2977898635 Bacteria 6675551
3445 2977919104 2977915119 Bacteria 6829656
3446 2977927636 2977922695 Bacteria 6956781
3447 2977938635 2977935797 Bacteria 6252826
3448 2977946682 2977942078 Bacteria 7570577
3449 2977975238 2977971508 Bacteria 7472917
3450 2977987666 2977986579 Bacteria 6581278
3451 2979091832 2979089926 Bacteria 5670289
3452 2979104333 2979100975 Bacteria 5423623
3453 2979716643 2979710463 Bacteria 6785254
3454 2979748309 2979742915 Bacteria 7301278
3455 2979766074 2979764755 Bacteria 6610066
3456 2979775124 2979772303 Bacteria 6618277
3457 2979796399 2979793036 Bacteria 6808957
3458 2979810293 2979808191 Bacteria 7179355
3459 2984511086 2984509177 Bacteria 5274802
3460 2984522551 2984518228 Bacteria 5277463
3461 2984541855 2984537506 Bacteria 5277481
3462 2987643500 2987636660 Bacteria 8088555
3463 2987651597 2987645492 Bacteria 6117018
3464 2987654979 2987652177 Bacteria 6969023
3465 2987661130 2987659509 Bacteria 6966464
3466 2987672729 2987666974 Bacteria 6509233
3467 2987678369 2987673487 Bacteria 6884027
3468 2990711052 2990710928 Bacteria 5002431
3469 2996313134 2996310559 Bacteria 6357320
3470 2996314660 2996310559 Bacteria 6357320
3471 2996340144 2996336353 Bacteria 5511628
3472 2996348568 2996341866 Bacteria 6643098
3473 2996352129 2996348954 Bacteria 7239054
3474 2996391977 2996386984 Bacteria 6978667
3475 3000142044 3000135777 Bacteria 6891109
3476 3002143081 3002141150 Bacteria 5254435
3477 3003671340 3003665799 Bacteria 7279786
3478 3004171107 3004167301 Bacteria 8330599
3479 3004190180 3004188549 Bacteria 6952365
3480 3004207045 3004203850 Bacteria 7307914
3481 3004214458 3004211236 Bacteria 7417683
3482 3004223561 3004218560 Bacteria 7421728
3483 3004232988 3004232784 Bacteria 6662140
3484 3004240702 3004239961 Bacteria 6892290
3485 3004273369 3004268573 Bacteria 7043476
3486 3004278827 3004275668 Bacteria 7114440
3487 3004339209 3004334049 Bacteria 8449246
3488 3005480505 3005474847 Bacteria 9259049
3489 3005484594 3005483717 Bacteria 7877331
3490 3005510592 3005506211 Bacteria 6943378
3491 3005587768 3005587118 Bacteria 7794411
3492 3005599509 3005594810 Bacteria 8716512
3493 3005715180 3005710791 Bacteria 7622528
3494 3005722567 3005718088 Bacteria 8283608
3495 637079368 637000159 Bacteria 7596297
3496 641646688 641522639 Bacteria 7737025
3497 643600776 643348564 Bacteria 8839022
3498 643604311 643348564 Bacteria 8839022
3499 648740734 648276728 Bacteria 6968865
3500 649874780 649633066 Bacteria 6690028
3501 650842594 650716007 Bacteria 5573770
3502 8002287989 8002285264 Bacteria 6717907
3503 8002393351 8002392321 Bacteria 4159911
3504 8003993595 8003992118 Bacteria 7266902
3505 8004304733 8004300914 Bacteria 6132239
3506 8004318609 8004312739 Bacteria 7444653
3507 8004378276 8004374579 Bacteria 6898112
3508 8004391587 8004387939 Bacteria 7049250
3509 8004448495 8004445564 Bacteria 6322258
3510 8004633813 8004633249 Bacteria 6723080
3511 8004641406 8004640170 Bacteria 6723001
3512 8004699986 8004695233 Bacteria 6731676
3513 8004710689 8004703790 Bacteria 8006957
3514 8004716956 8004714634 Bacteria 6776161
3515 8004731799 8004727605 Bacteria 6643904
3516 8006931970 8006926726 Bacteria 6749210
3517 8006940272 8006933436 Bacteria 10410654
3518 8006967028 8006964411 Bacteria 8966052
3519 8006980050 8006973647 Bacteria 10679141
3520 8006987982 8006984368 Bacteria 9651211
3521 8006995712 8006994254 Bacteria 8309700
3522 8016521985 8016511872 Bacteria 9921665
3523 8016529343 8016522445 Bacteria 8156687
3524 8016534558 8016530956 Bacteria 8155261
3525 8016547776 8016539877 Bacteria 8155419
3526 8016562729 8016557553 Bacteria 8154380
3527 8016572900 8016566248 Bacteria 8158151
3528 8016577059 8016575299 Bacteria 8154085
3529 8016593164 8016583857 Bacteria 10421953
3530 8016600511 8016595262 Bacteria 8149947
3531 8016610234 8016603502 Bacteria 8731218
3532 8016614698 8016613128 Bacteria 8794220
3533 8016626293 8016622563 Bacteria 7999408
3534 8016640029 8016630954 Bacteria 9217207
3535 8017063680 8017057580 Bacteria 10023680
3536 8019534321 8019530166 Bacteria 8155624
3537 8019553384 8019547302 Bacteria 7996444
3538 8019556254 8019555841 Bacteria 9642137
3539 8019569057 8019565922 Bacteria 9639779
3540 8019590806 8019586578 Bacteria 10212056
3541 8019618005 8019608314 Bacteria 10042931
3542 8019628482 8019619141 Bacteria 9218857
3543 8019634154 8019629233 Bacteria 8687553
3544 8019645576 8019638758 Bacteria 9062356
3545 8019658821 8019648815 Bacteria 10014479
3546 8019662031 8019659431 Bacteria 8577854
3547 8019671556 8019668869 Bacteria 8791617
3548 8054465417 8054460903 Bacteria 4872905
3549 8054560915 8054558443 Bacteria 5204801
3550 8054610865 8054609563 Bacteria 5170090
3551 8055622879 8055617313 Bacteria 7548464
3552 8055746023 8055742211 Bacteria 9226248
3553 8055911221 8055909800 Bacteria 7278581
3554 8056677654 8056673599 Bacteria 7871253
3555 8056688320 8056681323 Bacteria 8472857
3556 8056695694 8056689827 Bacteria 6712655
3557 8056877614 8056875544 Bacteria 4355797
3558 8056968297 8056967851 Bacteria 9038162
3559 8057531344 8057529695 Bacteria 6306553
3560 Ga0070704_100002708
3561 2214544919
3562 ARcpr5oldR_c000002
3563 ARSoilYngRDRAFT_c00003
3564 ARcpr5yngRDRAFT_c000036
3565 ARSoilOldRDRAFT_c000002
3566 ARCol0oldRDRAFT_c00314
3567 ARCol0yngRDRAFT_1000005
3568 JGI24032J14994_100147
3569 JGI24746J21847_1000131
3570 JGI24739J22299_10007211
3571 JGI24739J22299_10026188
3572 JGI24737J22298_10003920
3573 JGI24737J22298_10011733
3574 JGI24750J21931_1000047
3575 JGI24748J21848_1000620
3576 JGI24748J21848_1004239
3577 JGI24738J21930_10000265
3578 JGI24749J21850_1002322
3579 JGI24035J26624_1000154
3580 JGI24034J26672_10000826
3581 JGI24742J22300_10000044
3582 JGI24742J22300_10001628
3583 JGI24751J29686_10011524
3584 JGI25156J39149_1002014
3585 JGI25156J39149_1004416
3586 JGI25157J39369_1001113
3587 JGI25157J39369_1002073
3588 JGI25159J45721_1003796
3589 JGI25151J46595_10000036
3590 JGI25151J46595_10000209
3591 JGI25151J46595_10000244
3592 JGI25151J46595_10004420
3593 JGI25406J46586_10000093
3594 JGI25406J46586_10000412
3595 JGI25406J46586_10000504
3596 JGI25406J46586_10000565
3597 JGI25406J46586_10002895
3598 JGI25165J46597_1000016
3599 JGI25153J46596_10000462
3600 JGI25153J46596_10000860
3601 JGI25153J46596_10002078
3602 JGI25153J46596_10005256
3603 JGI25160J50197_1001585
3604 JGI25160J50197_1005731
3605 Ga0006562J51391_1082408
3606 Ga0006562J51391_1082410
3607 JGI25404J52841_10001115
3608 JGI25404J52841_10005561
3609 Ga0055539_1000125
3610 Ga0055533_1000132
3611 Ga0055532_1001641
3612 Ga0055525_1000171
3613 Ga0055529_1002195
3614 Ga0055526_1000017
3615 Ga0055526_1000391
3616 Ga0055524_1000014
3617 Ga0055524_1001064
3618 Ga0055524_1028695
3619 Ga0055536_1015634
3620 Ga0055530_10000614
3621 Ga0055530_10024263
3622 Ga0055540_1000014
3623 Ga0055540_1008590
3624 Ga0055531_10007927
3625 Ga0055531_10011219
3626 Ga0055541_1000083
3627 Ga0058692_1001859
3628 JGI25405J52794_10001403
3629 Ga0065165_1000048
3630 Ga0065165_1000231
3631 Ga0065165_1010260
3632 Ga0065165_1014736
3633 Ga0065165_1026652
3634 Ga0065717_1002078
3635 Ga0065704_10074116
3636 Ga0065704_10101877
3637 Ga0065712_10037077
3638 Ga0065712_10081299
3639 Ga0065712_10105846
3640 Ga0065715_10000449
3641 Ga0065715_10164600
3642 Ga0070658_10033732
3643 Ga0070676_10000308
3644 Ga0070683_100004737
3645 Ga0070683_100031574
3646 Ga0070683_100054561
3647 Ga0070683_100160548
3648 Ga0070683_100166639
3649 Ga0070683_100222817
3650 Ga0070690_100002356
3651 Ga0070690_100009282
3652 Ga0070690_100134039
3653 Ga0070670_100003132
3654 Ga0070670_100003645
3655 Ga0070670_100013025
3656 Ga0070670_100054159
3657 Ga0070670_100350918
3658 Ga0070677_10000203
3659 Ga0070677_10093224
3660 Ga0068869_100000290
3661 Ga0068869_100118106
3662 Ga0068869_100178225
3663 Ga0068869_100239011
3664 Ga0070666_10033208
3665 Ga0070666_10068460
3666 Ga0070680_100006358
3667 Ga0070680_100006548
3668 Ga0070680_100007952
3669 Ga0070680_100040562
3670 Ga0070680_100096638
3671 Ga0070680_100107144
3672 Ga0070680_100135402
3673 Ga0070680_100170904
3674 Ga0070682_100000982
3675 Ga0070682_100001061
3676 Ga0070682_100038624
3677 Ga0070682_100066366
3678 Ga0068868_100000505
3679 Ga0070660_100000419
3680 Ga0070660_100002532
3681 Ga0070660_100016441
3682 Ga0070660_100039991
3683 Ga0070660_100042109
3684 Ga0070660_100216086
3685 Ga0070689_100000567
3686 Ga0070689_100000784
3687 Ga0070689_100006577
3688 Ga0070689_100010941
3689 Ga0070689_100017607
3690 Ga0070689_100019683
3691 Ga0070689_100024286
3692 Ga0070691_10001059
3693 Ga0070691_10016994
3694 Ga0070691_10080215
3695 Ga0070687_100000145
3696 Ga0070687_100001424
3697 Ga0070661_100004369
3698 Ga0070661_100015609
3699 Ga0070661_100063942
3700 Ga0070661_100067273
3701 Ga0070661_100102307
3702 Ga0070661_100151584
3703 Ga0070692_10000927
3704 Ga0070668_100003304
3705 Ga0070668_100044604
3706 Ga0070668_100049906
3707 Ga0070668_100071617
3708 Ga0070668_100090516
3709 Ga0070668_100353361
3710 Ga0070669_100003579
3711 Ga0070669_100026298
3712 Ga0070669_100118893
3713 Ga0070669_100170420
3714 Ga0070675_100000977
3715 Ga0070675_100006235
3716 Ga0070675_100047289
3717 Ga0070675_100053971
3718 Ga0070671_100000457
3719 Ga0070671_100005484
3720 Ga0070671_100013863
3721 Ga0070671_100024576
3722 Ga0070671_100056174
3723 Ga0070671_100102405
3724 Ga0070671_100162562
3725 Ga0070674_100003924
3726 Ga0070674_100005104
3727 Ga0070674_100010581
3728 Ga0070674_100023685
3729 Ga0070673_100002173
3730 Ga0070673_100002183
3731 Ga0070673_100091785
3732 Ga0070673_100095685
3733 Ga0070688_100000956
3734 Ga0070688_100008606
3735 Ga0070688_100036208
3736 Ga0070688_100061090
3737 Ga0070688_100071389
3738 Ga0070659_100001451
3739 Ga0070659_100016138
3740 Ga0070659_100049630
3741 Ga0070659_100059384
3742 Ga0070659_100233404
3743 Ga0070667_100156522
3744 Ga0070703_10011030
3745 Ga0070709_10004491
3746 Ga0070709_10011326
3747 Ga0070709_10022469
3748 Ga0070709_10030529
3749 Ga0070714_100005442
3750 Ga0070714_100011031
3751 Ga0070714_100016605
3752 Ga0070714_100016855
3753 Ga0070714_100019021
3754 Ga0070714_100036484
3755 Ga0070714_100042403
3756 Ga0070714_100083816
3757 Ga0070714_100194327
3758 Ga0070714_100196379
3759 Ga0070713_100000834
3760 Ga0070713_100008105
3761 Ga0070713_100015475
3762 Ga0070713_100051872
3763 Ga0070713_100092085
3764 Ga0070713_100095586
3765 Ga0070710_10000567
3766 Ga0070710_10009242
3767 Ga0070710_10019974
3768 Ga0070710_10027323
3769 Ga0070701_10000773
3770 Ga0070701_10052031
3771 Ga0070711_100000801
3772 Ga0070711_100006558
3773 Ga0070711_100019620
3774 Ga0070711_100067921
3775 Ga0070711_100073752
3776 Ga0070711_100146969
3777 Ga0070705_100012088
3778 Ga0070705_100114972
3779 Ga0070700_100002595
3780 Ga0070700_100005406
3781 Ga0070700_100015662
3782 Ga0070694_100005038
3783 Ga0070694_100019262
3784 Ga0070708_100016537
3785 Ga0070663_100007329
3786 Ga0070663_100013311
3787 Ga0070663_100016126
3788 Ga0070663_100018939
3789 Ga0070663_100020358
3790 Ga0070663_100080041
3791 Ga0070663_100081341
3792 Ga0070663_100236714
3793 Ga0070678_100000204
3794 Ga0070678_100006849
3795 Ga0070678_100016075
3796 Ga0070678_100019584
3797 Ga0070678_100026143
3798 Ga0070678_100062074
3799 Ga0070678_100064897
3800 Ga0070678_100069888
3801 Ga0070678_100071249
3802 Ga0070662_100051612
3803 Ga0070662_100077295
3804 Ga0070662_100124476
3805 Ga0070681_10001622
3806 Ga0070681_10004974
3807 Ga0070681_10016579
3808 Ga0070681_10018673
3809 Ga0070681_10034683
3810 Ga0070681_10062985
3811 Ga0070681_10064861
3812 Ga0070681_10106074
3813 Ga0070681_10301768
3814 Ga0068867_100016017
3815 Ga0068867_100021279
3816 Ga0068867_100024746
3817 Ga0068867_100068926
3818 Ga0068867_100095594
3819 Ga0068867_100183297
3820 Ga0070685_10017792
3821 Ga0070685_10023595
3822 Ga0070685_10057794
3823 Ga0070706_100096722
3824 Ga0070707_100064794
3825 Ga0070707_100108628
3826 Ga0070707_100190933
3827 Ga0070699_100004210
3828 Ga0070679_100003230
3829 Ga0070679_100004369
3830 Ga0070679_100006042
3831 Ga0070679_100020708
3832 Ga0070679_100066542
3833 Ga0070679_100296983
3834 Ga0070679_100437708
3835 Ga0070684_100006387
3836 Ga0070684_100017723
3837 Ga0070684_100069493
3838 Ga0070684_100138162
3839 Ga0070684_100221590
3840 Ga0070697_100003792
3841 Ga0070697_100219633
3842 Ga0068853_100000504
3843 Ga0068853_100006640
3844 Ga0068853_100014714
3845 Ga0068853_100018347
3846 Ga0068853_100028677
3847 Ga0068853_100112169
3848 Ga0070672_100000343
3849 Ga0070672_100014311
3850 Ga0070672_100014711
3851 Ga0070686_100000862
3852 Ga0070686_100003330
3853 Ga0070686_100015191
3854 Ga0070695_100000693
3855 Ga0070695_100003899
3856 Ga0070695_100017273
3857 Ga0070695_100036710
3858 Ga0070696_100008114
3859 Ga0070696_100116741
3860 Ga0070693_100008248
3861 Ga0070693_100008941
3862 Ga0070693_100124478
3863 Ga0070665_100021753
3864 Ga0070665_100032166
3865 Ga0070665_100087707
3866 Ga0070665_100095749
3867 Ga0070665_100193878
3868 Ga0070665_100292379
3869 Ga0070704_100000799
3870 Ga0070704_100002929
3871 Ga0070704_100024943
3872 Ga0068855_100012892
3873 Ga0068855_100016222
3874 Ga0068855_100019843
3875 Ga0068855_100040429
3876 Ga0068855_100040447
3877 Ga0068855_100096594
3878 Ga0068855_100146506
3879 Ga0068855_100155994
3880 Ga0068855_100326594
3881 Ga0068855_100363645
3882 Ga0070664_100022786
3883 Ga0070664_100094573
3884 Ga0068857_100000979
3885 Ga0068857_100100623
3886 Ga0068857_100139657
3887 Ga0068857_100341286
3888 Ga0068854_100000702
3889 Ga0068854_100056438
3890 Ga0068856_100000020
3891 Ga0068856_100010469
3892 Ga0068856_100021168
3893 Ga0068856_100039666
3894 Ga0068856_100276730
3895 Ga0068856_100291136
3896 Ga0070702_100001050
3897 Ga0068852_100001019
3898 Ga0068852_100002168
3899 Ga0068852_100002288
3900 Ga0068852_100038925
3901 Ga0068852_100046632
3902 Ga0068852_100052790
3903 Ga0068852_100059057
3904 Ga0068852_100093147
3905 Ga0068852_100383865
3906 Ga0068859_100045113
3907 Ga0068859_100067415
3908 Ga0068859_100231421
3909 Ga0068864_100004079
3910 Ga0068864_100241508
3911 Ga0068866_10002039
3912 Ga0068861_100005424
3913 Ga0068861_100011655
3914 Ga0068861_100124311
3915 Ga0068861_100303730
3916 Ga0068851_10001344
3917 Ga0068851_10007440
3918 Ga0068851_10071673
3919 Ga0068870_10000442
3920 Ga0068863_100022454
3921 Ga0068858_100000657
3922 Ga0068858_100024985
3923 Ga0068858_100025080
3924 Ga0068858_100051225
3925 Ga0068858_100152855
3926 Ga0068858_100258627
3927 Ga0068860_100000633
3928 Ga0068860_100012235
3929 Ga0068860_100029184
3930 Ga0068860_100140686
3931 Ga0068862_100002115
3932 Ga0068862_100084095
3933 Ga0068862_100123886
3934 Ga0068862_100154356
3935 Ga0081455_10000012
3936 Ga0081455_10000678
3937 Ga0081455_10001814
3938 Ga0081455_10005602
3939 Ga0081455_10008012
3940 Ga0081455_10011296
3941 Ga0081455_10044146
3942 Ga0081455_10056922
3943 Ga0081455_10067121
3944 Ga0081455_10071109
3945 Ga0081455_10240205
3946 Ga0081538_10005596
3947 Ga0081538_10011536
3948 Ga0081538_10053242
3949 Ga0081538_10059528
3950 Ga0081540_1000019
3951 Ga0081540_1000933
3952 Ga0081540_1001603
3953 Ga0081540_1001730
3954 Ga0081540_1002812
3955 Ga0081540_1004950
3956 Ga0081540_1011886
3957 Ga0081540_1024213
3958 Ga0081540_1027590
3959 Ga0081540_1047883
3960 Ga0081539_10000059
3961 Ga0081539_10000140
3962 Ga0081539_10000862
3963 Ga0081539_10002946
3964 Ga0081539_10003950
3965 Ga0081539_10008084
3966 Ga0081539_10041228
3967 Ga0081539_10044663
3968 Ga0070717_10000720
3969 Ga0070717_10002391
3970 Ga0070717_10004566
3971 Ga0070717_10012075
3972 Ga0070717_10101140
3973 Ga0070717_10121488
3974 Ga0070717_10124748
3975 Ga0070717_10126620
3976 Ga0070717_10175268
3977 Ga0075365_10019560
3978 Ga0075365_10093037
3979 Ga0075368_10014679
3980 Ga0075368_10024855
3981 Ga0075368_10037252
3982 Ga0075363_100025038
3983 Ga0075363_100087500
3984 Ga0075364_10004310
3985 Ga0075364_10066064
3986 Ga0075432_10002045
3987 Ga0075432_10011462
3988 Ga0070715_10002602
3989 Ga0070715_10012885
3990 Ga0070716_100003115
3991 Ga0070716_100004945
3992 Ga0070712_100000405
3993 Ga0070712_100006221
3994 Ga0070712_100084821
3995 Ga0070712_100096644
3996 Ga0075362_10010694
3997 Ga0075362_10026595
3998 Ga0075362_10065967
3999 Ga0075367_10000606
4000 Ga0075367_10027570
4001 Ga0075367_10031335
4002 Ga0075369_10005848
4003 Ga0075427_10000374
4004 Ga0075366_10052684
4005 Ga0075366_10064748
4006 Ga0097621_100000568
4007 Ga0097621_100031502
4008 Ga0097621_100122529
4009 Ga0097621_100159633
4010 Ga0097621_100252451
4011 Ga0075370_10015666
4012 Ga0075370_10022235
4013 Ga0068871_100000203
4014 Ga0068871_100034225
4015 Ga0075428_100001488
4016 Ga0075428_100001638
4017 Ga0075428_100001971
4018 Ga0075428_100007729
4019 Ga0075428_100045691
4020 Ga0075430_100000132
4021 Ga0075430_100000251
4022 Ga0075430_100024107
4023 Ga0075430_100072799
4024 Ga0075430_100102368
4025 Ga0075431_100000504
4026 Ga0075431_100001119
4027 Ga0075431_100006760
4028 Ga0075431_100017432
4029 Ga0075431_100050893
4030 Ga0075431_100099529
4031 Ga0075431_100115251
4032 Ga0075431_100236707
4033 Ga0075431_100269808
4034 Ga0075433_10000152
4035 Ga0075433_10038769
4036 Ga0075433_10053555
4037 Ga0075434_100003370
4038 Ga0075434_100022796
4039 Ga0075434_100025594
4040 Ga0075434_100036086
4041 Ga0075434_100044526
4042 Ga0075434_100133060
4043 Ga0075434_100176158
4044 Ga0075434_100270499
4045 Ga0075429_100000459
4046 Ga0075429_100000855
4047 Ga0075429_100002649
4048 Ga0075429_100029010
4049 Ga0075429_100105058
4050 Ga0075429_100292969
4051 Ga0068865_100000155
4052 Ga0068865_100024484
4053 Ga0068865_100103481
4054 Ga0068865_100130394
4055 Ga0075436_100003747
4056 Ga0075436_100013840
4057 Ga0097620_100045113
4058 Ga0097620_100067407
4059 Ga0097620_100068299
4060 Ga0097620_100231398
4061 Ga0099825_1023236
4062 Ga0099824_1011525
4063 Ga0099824_1016950
4064 Ga0099822_1002297
4065 Ga0079104_1000013
4066 Ga0079104_1004572
4067 Ga0079104_1015986
4068 Ga0075435_100008956
4069 Ga0075435_100008983
4070 Ga0075435_100020212
4071 Ga0075435_100089012
4072 Ga0075435_100128461
4073 Ga0105251_10013625
4074 Ga0105244_10022126
4075 Ga0105240_10009843
4076 Ga0105240_10011032
4077 Ga0105240_10038752
4078 Ga0105240_10070355
4079 Ga0105240_10117923
4080 Ga0105240_10132741
4081 Ga0105240_10335532
4082 Ga0111539_10000114
4083 Ga0111539_10000367
4084 Ga0111539_10000673
4085 Ga0111539_10002196
4086 Ga0111539_10005040
4087 Ga0111539_10010049
4088 Ga0111539_10025425
4089 Ga0111539_10036276
4090 Ga0111539_10058399
4091 Ga0111539_10097831
4092 Ga0111539_10108668
4093 Ga0111539_10122343
4094 Ga0111539_10172350
4095 Ga0105245_10001558
4096 Ga0105245_10043604
4097 Ga0105245_10124344
4098 Ga0105245_10316628
4099 Ga0105247_10012387
4100 Ga0105247_10152833
4101 Ga0114129_10000593
4102 Ga0114129_10007730
4103 Ga0114129_10012376
4104 Ga0114129_10016320
4105 Ga0114129_10022324
4106 Ga0114129_10037856
4107 Ga0114129_10081687
4108 Ga0114129_10126328
4109 Ga0114129_10379780
4110 Ga0114129_10530940
4111 Ga0105243_10000960
4112 Ga0105243_10016776
4113 Ga0105243_10019267
4114 Ga0105241_10001324
4115 Ga0105241_10002167
4116 Ga0105241_10002458
4117 Ga0105241_10034550
4118 Ga0105241_10108268
4119 Ga0105241_10237971
4120 Ga0105242_10001412
4121 Ga0105242_10134459
4122 Ga0105242_10329696
4123 Ga0105248_10001378
4124 Ga0105248_10004213
4125 Ga0105248_10009339
4126 Ga0105248_10038312
4127 Ga0105248_10048628
4128 Ga0105248_10124692
4129 Ga0105248_10130378
4130 Ga0105248_10326079
4131 Ga0105248_10631395
4132 Ga0105237_10007091
4133 Ga0105237_10010293
4134 Ga0105237_10034611
4135 Ga0105237_10043126
4136 Ga0105237_10052821
4137 Ga0105237_10053424
4138 Ga0105237_10080663
4139 Ga0105237_10085649
4140 Ga0105237_10368426
4141 Ga0105238_10000006
4142 Ga0105238_10025766
4143 Ga0105238_10038823
4144 Ga0105238_10075539
4145 Ga0105238_10092943
4146 Ga0105249_10000925
4147 Ga0105249_10000930
4148 Ga0105249_10008708
4149 Ga0105249_10212680
4150 Ga0099796_10009432
4151 Ga0105239_10003131
4152 Ga0105239_10009354
4153 Ga0105239_10010180
4154 Ga0105239_10033065
4155 Ga0105239_10033364
4156 Ga0105239_10053228
4157 Ga0105239_10089057
4158 Ga0105239_10097520
4159 Ga0105239_10118722
4160 Ga0105239_10122398
4161 Ga0105239_10123931
4162 Ga0105239_10163330
4163 Ga0105239_10178685
4164 Ga0105239_10281271
4165 Ga0105239_10447064
4166 Ga0105246_10029413
4167 Ga0105246_10036496
4168 Ga0105246_10049577
4169 Ga0105246_10077053
4170 Ga0105246_10179703
4171 Ga0157342_1000469
4172 Ga0157326_1003442
4173 Ga0157373_10011335
4174 Ga0157373_10011392
4175 Ga0157373_10020149
4176 Ga0157373_10058571
4177 Ga0157373_10139478
4178 Ga0157371_10000268
4179 Ga0157371_10002137
4180 Ga0157371_10004410
4181 Ga0157370_10006303
4182 Ga0157370_10009085
4183 Ga0157370_10013966
4184 Ga0157370_10031648
4185 Ga0157370_10056849
4186 Ga0157370_10159190
4187 Ga0157369_10018324
4188 Ga0157369_10058415
4189 Ga0157369_10082850
4190 Ga0157369_10391079
4191 Ga0171462_1007
4192 Ga0157374_10006983
4193 Ga0157374_10081595
4194 Ga0157374_10185883
4195 Ga0157378_10006990
4196 Ga0157378_10013694
4197 Ga0157378_10056690
4198 Ga0163162_10002587
4199 Ga0163162_10007934
4200 Ga0163162_10062058
4201 Ga0163162_10068389
4202 Ga0163162_10171987
4203 Ga0157372_10038427
4204 Ga0157372_10053251
4205 Ga0157372_10068346
4206 Ga0157372_10236564
4207 Ga0157372_10274136
4208 Ga0157372_10309064
4209 Ga0157375_10000697
4210 Ga0157375_10006290
4211 Ga0157375_10019881
4212 Ga0157375_10042254
4213 Ga0157375_10153889
4214 Ga0157375_10157330
4215 Ga0163163_10002553
4216 Ga0163163_10020492
4217 Ga0163163_10022591
4218 Ga0163163_10036664
4219 Ga0163163_10073045
4220 Ga0157380_10002235
4221 Ga0157380_10022132
4222 Ga0182008_10022719
4223 Ga0157377_10000454
4224 Ga0157377_10018242
4225 Ga0157379_10000539
4226 Ga0157379_10087747
4227 Ga0157379_10221421
4228 Ga0157376_10001949
4229 Ga0157376_10023925
4230 Ga0157376_10048612
4231 Ga0157376_10114658
4232 Ga0182006_1023156
4233 Ga0182006_1026458
4234 Ga0182006_1039122
4235 Ga0163161_10001235
4236 Ga0163161_10027620
4237 Ga0163161_10080174
4238 Ga0163161_10194839
4239 Ga0206356_11768000
4240 Ga0214544_1000002
4241 Ga0214542_1000001
4242 Ga0214545_1000001
4243 Ga0214543_1000001
4244 Ga0213872_10003952
4245 Ga0213872_10055816
4246 Ga0213874_10008081
4247 Ga0213876_10001306
4248 Ga0213876_10002183
4249 Ga0213876_10010793
4250 Ga0213876_10073389
4251 Ga0213875_10000036
4252 Ga0213875_10002463
4253 Ga0213875_10003211
4254 Ga0213875_10021442
4255 Ga0213875_10021972
4256 Ga0213871_10001174
4257 Ga0213871_10009084
4258 Ga0224712_10040306
4259 Ga0224712_10065997
4260 Ga0228711_1000007
4261 Ga0228710_1000007
4262 Ga0224572_1000531
4263 Ga0228598_1000795
4264 Ga0209435_100018
4265 Ga0209435_100240
4266 Ga0209784_100009
4267 Ga0209566_100007
4268 Ga0209674_100018
4269 Ga0209672_101842
4270 Ga0209147_100051
4271 Ga0209563_100020
4272 Ga0209437_101200
4273 Ga0209258_101977
4274 Ga0209646_1000172
4275 Ga0209646_1000186
4276 Ga0209026_1000005
4277 Ga0209026_1000042
4278 Ga0209677_100010
4279 Ga0209677_101018
4280 Ga0209148_1000056
4281 Ga0209148_1000475
4282 Ga0209148_1006213
4283 Ga0209759_1000538
4284 Ga0209759_1000547
4285 Ga0209759_1000933
4286 Ga0209233_1000068
4287 Ga0209233_1002185
4288 Ga0209233_1003457
4289 Ga0209233_1004993
4290 Ga0209233_1025477
4291 Ga0207666_1000037
4292 Ga0207666_1000419
4293 Ga0209455_1000238
4294 Ga0209455_1001687
4295 Ga0209455_1002135
4296 Ga0209455_1009858
4297 Ga0209130_1001022
4298 Ga0207673_1000102
4299 Ga0209675_1000633
4300 Ga0209676_1003848
4301 Ga0209025_1000017
4302 Ga0209025_1000227
4303 Ga0209025_1000291
4304 Ga0209025_1015469
4305 Ga0209025_1015993
4306 Ga0209564_1000031
4307 Ga0209564_1000082
4308 Ga0209564_1001979
4309 Ga0209564_1016460
4310 Ga0209758_1000140
4311 Ga0209758_1001460
4312 Ga0209758_1002072
4313 Ga0209758_1003468
4314 Ga0209758_1006144
4315 Ga0209758_1011521
4316 Ga0209050_1000142
4317 Ga0209050_1000671
4318 Ga0209256_1000033
4319 Ga0209256_1000130
4320 Ga0209256_1001059
4321 Ga0209256_1004348
4322 Ga0209256_1031562
4323 Ga0207426_1000434
4324 Ga0207426_1000855
4325 Ga0207426_1018849
4326 Ga0207426_1025686
4327 Ga0209051_1000035
4328 Ga0209051_1000544
4329 Ga0209257_1000494
4330 Ga0209257_1001932
4331 Ga0207697_10000293
4332 Ga0207656_10005412
4333 Ga0207656_10009022
4334 Ga0207656_10026610
4335 Ga0207713_1029023
4336 Ga0207653_10016484
4337 Ga0207682_10000081
4338 Ga0207682_10001282
4339 Ga0207692_10000504
4340 Ga0207692_10013638
4341 Ga0207692_10014597
4342 Ga0207692_10030702
4343 Ga0207692_10038782
4344 Ga0207692_10040515
4345 Ga0207692_10119510
4346 Ga0207642_10004660
4347 Ga0207642_10005716
4348 Ga0207642_10063847
4349 Ga0207710_10006913
4350 Ga0207710_10048821
4351 Ga0207710_10083539
4352 Ga0207688_10000487
4353 Ga0207688_10002068
4354 Ga0207680_10119664
4355 Ga0207680_10129668
4356 Ga0207647_10001362
4357 Ga0207647_10004059
4358 Ga0207647_10007664
4359 Ga0207647_10010142
4360 Ga0207647_10013913
4361 Ga0207647_10024727
4362 Ga0207647_10125778
4363 Ga0207685_10061965
4364 Ga0207685_10078370
4365 Ga0207699_10000508
4366 Ga0207699_10010294
4367 Ga0207699_10014968
4368 Ga0207645_10000792
4369 Ga0207645_10007259
4370 Ga0207645_10017134
4371 Ga0207645_10029304
4372 Ga0207643_10000392
4373 Ga0207643_10000657
4374 Ga0207705_10011559
4375 Ga0207705_10035072
4376 Ga0207705_10075031
4377 Ga0207684_10036233
4378 Ga0207654_10002172
4379 Ga0207654_10023733
4380 Ga0207654_10049566
4381 Ga0207654_10064204
4382 Ga0207707_10002890
4383 Ga0207707_10005173
4384 Ga0207707_10011878
4385 Ga0207707_10011983
4386 Ga0207707_10018389
4387 Ga0207707_10021037
4388 Ga0207707_10028853
4389 Ga0207707_10043434
4390 Ga0207707_10089849
4391 Ga0207707_10116613
4392 Ga0207707_10123314
4393 Ga0207707_10164977
4394 Ga0207707_10215466
4395 Ga0207707_10219240
4396 Ga0207707_10301618
4397 Ga0207695_10000008
4398 Ga0207695_10005095
4399 Ga0207695_10012818
4400 Ga0207695_10030124
4401 Ga0207695_10034276
4402 Ga0207695_10079160
4403 Ga0207695_10140481
4404 Ga0207695_10198453
4405 Ga0207671_10003541
4406 Ga0207671_10018613
4407 Ga0207671_10040346
4408 Ga0207671_10043529
4409 Ga0207693_10000581
4410 Ga0207693_10002467
4411 Ga0207693_10002907
4412 Ga0207693_10004238
4413 Ga0207693_10004411
4414 Ga0207693_10008804
4415 Ga0207693_10011407
4416 Ga0207693_10027698
4417 Ga0207693_10051877
4418 Ga0207693_10070059
4419 Ga0207693_10081644
4420 Ga0207693_10118274
4421 Ga0207663_10000084
4422 Ga0207663_10000732
4423 Ga0207663_10020836
4424 Ga0207660_10007083
4425 Ga0207660_10015824
4426 Ga0207660_10026809
4427 Ga0207660_10036904
4428 Ga0207660_10080994
4429 Ga0207660_10167024
4430 Ga0207660_10185145
4431 Ga0207662_10003086
4432 Ga0207662_10013452
4433 Ga0207662_10038307
4434 Ga0207657_10001069
4435 Ga0207657_10004955
4436 Ga0207657_10047517
4437 Ga0207657_10061319
4438 Ga0207657_10070879
4439 Ga0207657_10141441
4440 Ga0207649_10001901
4441 Ga0207649_10032314
4442 Ga0207652_10006216
4443 Ga0207652_10011506
4444 Ga0207652_10019271
4445 Ga0207652_10024457
4446 Ga0207652_10024840
4447 Ga0207652_10149044
4448 Ga0207646_10005334
4449 Ga0207646_10083857
4450 Ga0207681_10000738
4451 Ga0207681_10204761
4452 Ga0207681_10264669
4453 Ga0207694_10000050
4454 Ga0207694_10000110
4455 Ga0207694_10011528
4456 Ga0207694_10035357
4457 Ga0207694_10065780
4458 Ga0207694_10135037
4459 Ga0207694_10258981
4460 Ga0207650_10002215
4461 Ga0207650_10005378
4462 Ga0207650_10010692
4463 Ga0207650_10159713
4464 Ga0207650_10178404
4465 Ga0207659_10000288
4466 Ga0207659_10034549
4467 Ga0207659_10039801
4468 Ga0207659_10044513
4469 Ga0207659_10169141
4470 Ga0207687_10000520
4471 Ga0207687_10007944
4472 Ga0207687_10047813
4473 Ga0207687_10185784
4474 Ga0207687_10208913
4475 Ga0207700_10003137
4476 Ga0207700_10008693
4477 Ga0207700_10015401
4478 Ga0207700_10018117
4479 Ga0207700_10020581
4480 Ga0207700_10073707
4481 Ga0207700_10084327
4482 Ga0207700_10101369
4483 Ga0207700_10120743
4484 Ga0207664_10016357
4485 Ga0207664_10018977
4486 Ga0207664_10029248
4487 Ga0207664_10039092
4488 Ga0207664_10054997
4489 Ga0207664_10083524
4490 Ga0207664_10160779
4491 Ga0207644_10006166
4492 Ga0207644_10009382
4493 Ga0207644_10010162
4494 Ga0207644_10020651
4495 Ga0207644_10066682
4496 Ga0207690_10000953
4497 Ga0207690_10020076
4498 Ga0207690_10051950
4499 Ga0207690_10105442
4500 Ga0207706_10009006
4501 Ga0207706_10020589
4502 Ga0207706_10022836
4503 Ga0207706_10025278
4504 Ga0207706_10026762
4505 Ga0207706_10034150
4506 Ga0207686_10004859
4507 Ga0207709_10004590
4508 Ga0207709_10009427
4509 Ga0207709_10092041
4510 Ga0207670_10000731
4511 Ga0207670_10002332
4512 Ga0207670_10016264
4513 Ga0207670_10085361
4514 Ga0207670_10096410
4515 Ga0207669_10000538
4516 Ga0207669_10007894
4517 Ga0207669_10014485
4518 Ga0207669_10020048
4519 Ga0207704_10001761
4520 Ga0207704_10008415
4521 Ga0207704_10118292
4522 Ga0207704_10131047
4523 Ga0207704_10185300
4524 Ga0207665_10001296
4525 Ga0207665_10001463
4526 Ga0207665_10002892
4527 Ga0207665_10003511
4528 Ga0207665_10017491
4529 Ga0207665_10024541
4530 Ga0207665_10125079
4531 Ga0207665_10180038
4532 Ga0207691_10001399
4533 Ga0207691_10001984
4534 Ga0207691_10018717
4535 Ga0207691_10048406
4536 Ga0207711_10002344
4537 Ga0207711_10010081
4538 Ga0207711_10022179
4539 Ga0207711_10024759
4540 Ga0207711_10034149
4541 Ga0207689_10000503
4542 Ga0207689_10003495
4543 Ga0207689_10010214
4544 Ga0207661_10001274
4545 Ga0207661_10036312
4546 Ga0207661_10044111
4547 Ga0207679_10007046
4548 Ga0207679_10093556
4549 Ga0207679_10159422
4550 Ga0207667_10002525
4551 Ga0207667_10005244
4552 Ga0207667_10006325
4553 Ga0207667_10012846
4554 Ga0207667_10021610
4555 Ga0207667_10046023
4556 Ga0207667_10054142
4557 Ga0207667_10115861
4558 Ga0207651_10012345
4559 Ga0207651_10012534
4560 Ga0207651_10014181
4561 Ga0207651_10040996
4562 Ga0207651_10104472
4563 Ga0207712_10001942
4564 Ga0207712_10005326
4565 Ga0207712_10028620
4566 Ga0207712_10239083
4567 Ga0207668_10003473
4568 Ga0207668_10025269
4569 Ga0207668_10028713
4570 Ga0207668_10045029
4571 Ga0207668_10057581
4572 Ga0207640_10007626
4573 Ga0207640_10046659
4574 Ga0207640_10050100
4575 Ga0207658_10012739
4576 Ga0207658_10349489
4577 Ga0207677_10002538
4578 Ga0207677_10047395
4579 Ga0207677_10096948
4580 Ga0207703_10001883
4581 Ga0207703_10013028
4582 Ga0207703_10064594
4583 Ga0207703_10113385
4584 Ga0207639_10002783
4585 Ga0207639_10008102
4586 Ga0207639_10009386
4587 Ga0207639_10010395
4588 Ga0207639_10150609
4589 Ga0207639_10216561
4590 Ga0207678_10001725
4591 Ga0207678_10004088
4592 Ga0207678_10009392
4593 Ga0207678_10027585
4594 Ga0207678_10048870
4595 Ga0207678_10069767
4596 Ga0207678_10104634
4597 Ga0207678_10147494
4598 Ga0207708_10000547
4599 Ga0207708_10004170
4600 Ga0207708_10007309
4601 Ga0207702_10000002
4602 Ga0207702_10000126
4603 Ga0207702_10004224
4604 Ga0207702_10023264
4605 Ga0207702_10032072
4606 Ga0207702_10061307
4607 Ga0207702_10236649
4608 Ga0207702_10326981
4609 Ga0207641_10003985
4610 Ga0207648_10001178
4611 Ga0207648_10001416
4612 Ga0207648_10038200
4613 Ga0207648_10045343
4614 Ga0207648_10098110
4615 Ga0207648_10125780
4616 Ga0207648_10126834
4617 Ga0207676_10001299
4618 Ga0207676_10002095
4619 Ga0207676_10054111
4620 Ga0207676_10071537
4621 Ga0207676_10100799
4622 Ga0207676_10167048
4623 Ga0207676_10417416
4624 Ga0207674_10007592
4625 Ga0207674_10042017
4626 Ga0207674_10046689
4627 Ga0207674_10079786
4628 Ga0207674_10086147
4629 Ga0207674_10204712
4630 Ga0207674_10355247
4631 Ga0207675_100000190
4632 Ga0207675_100002065
4633 Ga0207675_100016489
4634 Ga0207675_100023453
4635 Ga0207683_10000069
4636 Ga0207683_10002867
4637 Ga0207683_10014712
4638 Ga0207683_10020473
4639 Ga0207683_10042619
4640 Ga0207683_10073526
4641 Ga0207683_10078716
4642 Ga0207683_10088268
4643 Ga0207683_10092545
4644 Ga0207683_10113164
4645 Ga0207698_10006596
4646 Ga0207698_10027648
4647 Ga0207698_10029389
4648 Ga0207698_10073697
4649 Ga0207698_10110754
4650 Ga0209281_1000076
4651 Ga0209281_1000128
4652 Ga0209281_1000496
4653 Ga0209281_1007629
4654 Ga0209389_1000040
4655 Ga0209389_1000123
4656 Ga0209371_1000022
4657 Ga0209371_1002845
4658 Ga0209589_1000001
4659 Ga0209589_1000036
4660 Ga0209969_1002406
4661 Ga0209489_100001
4662 Ga0209489_100006
4663 Ga0209700_100001
4664 Ga0209700_100005
4665 Ga0209999_1003561
4666 Ga0210002_1001002
4667 Ga0209282_1000039
4668 Ga0209282_1000100
4669 Ga0209971_1004787
4670 Ga0209966_1000576
4671 Ga0209998_10000606
4672 Ga0209998_10002913
4673 Ga0209813_10013666
4674 Ga0209974_10046815
4675 Ga0207428_10000198
4676 Ga0207428_10000312
4677 Ga0207428_10000578
4678 Ga0207428_10000908
4679 Ga0207428_10008834
4680 Ga0207428_10051612
4681 Ga0268266_10059811
4682 Ga0268266_10103610
4683 Ga0268266_10173694
4684 Ga0268265_10065606
4685 Ga0268264_10000065
4686 Ga0268264_10004307
4687 Ga0268264_10051309
4688 Ga0265337_1002249
4689 Ga0265337_1002492
4690 Ga0265326_10011167
4691 Ga0265334_10001756
4692 Ga0265334_10032169
4693 Ga0265318_10004183
4694 Ga0265323_10001892
4695 Ga0265322_10019041
4696 Ga0265336_10001788
4697 Ga0307517_10000008
4698 Ga0265338_10000321
4699 Ga0265338_10022608
4700 Ga0265338_10033094
4701 Ga0265338_10143091
4702 Ga0265324_10002078
4703 Ga0268256_1000019
4704 Ga0268256_1004441
4705 Ga0307511_10075112
4706 Ga0316181_1006667
4707 Ga0265760_10014211
4708 Ga0265332_10004954
4709 Ga0265320_10042368
4710 Ga0265325_10000004
4711 Ga0265325_10000172
4712 Ga0265325_10003859
4713 Ga0265325_10005573
4714 Ga0265325_10008790
4715 Ga0265325_10023370
4716 Ga0265325_10082433
4717 Ga0265325_10122730
4718 Ga0265340_10000674
4719 Ga0265340_10013956
4720 Ga0265340_10017773
4721 Ga0265340_10034740
4722 Ga0265340_10038971
4723 Ga0265340_10047672
4724 Ga0265339_10000330
4725 Ga0265339_10003099
4726 Ga0265339_10004140
4727 Ga0265339_10009592
4728 Ga0265339_10019287
4729 Ga0265339_10046228
4730 Ga0265331_10009183
4731 Ga0265331_10022871
4732 Ga0265316_10057734
4733 Ga0265316_10114951
4734 Ga0265316_10245546
4735 Ga0307513_10002722
4736 Ga0307513_10035190
4737 Ga0307513_10062899
4738 Ga0307513_10102323
4739 Ga0307513_10322657
4740 Ga0307509_10089892
4741 Ga0307509_10244860
4742 Ga0307408_100090426
4743 Ga0265313_10000176
4744 Ga0265313_10000572
4745 Ga0265313_10002253
4746 Ga0265313_10008621
4747 Ga0265313_10016010
4748 Ga0265313_10016397
4749 Ga0265313_10042830
4750 Ga0265313_10087204
4751 Ga0307508_10000018
4752 Ga0307508_10080781
4753 Ga0307508_10158279
4754 Ga0316575_10041734
4755 Ga0265314_10001133
4756 Ga0265314_10002100
4757 Ga0265314_10009137
4758 Ga0265314_10014338
4759 Ga0265314_10024621
4760 Ga0265314_10088673
4761 Ga0265314_10104967
4762 Ga0265342_10000148
4763 Ga0265342_10000196
4764 Ga0265342_10005459
4765 Ga0265342_10015115
4766 Ga0307516_10014561
4767 Ga0307516_10066954
4768 Ga0307516_10071784
4769 Ga0307413_10005951
4770 Ga0307410_10006626
4771 Ga0307410_10151734
4772 Ga0307406_10062745
4773 Ga0307407_10105260
4774 Ga0307407_10143414
4775 Ga0307412_10001651
4776 Ga0307412_10165201
4777 Ga0315914_1000010
4778 Ga0307409_100107636
4779 Ga0307409_100157231
4780 Ga0307409_100276336
4781 Ga0307414_10031373
4782 Ga0307414_10070407
4783 Ga0307411_10041309
4784 Ga0307411_10229286
4785 Ga0307507_10024914
4786 Ga0307510_10002813
4787 Ga0307510_10020196
4788 Ga0307510_10061161
4789 Ga0307510_10067745
4790 Ga0315913_1000005
4791 Ga0315911_1000006
4792 Ga0315915_1000012
4793 Ga0373930_0000062
4794 Ga0373948_0000051
4795 Ga0373950_0000418
4796 Ga0373950_0001085
4797 Ga0373950_0002232
4798 Ga0373958_0000123
4799 Ga0373959_0000191
4800 Ga0373938_0000141
4801 Ga0373938_0000287
4802 Ga0373926_0014543
4803 Ga0373926_0023841
4804 Ga0373928_0003217
4805 Ga0373929_0001387
4806 Ga0373929_0012687
4807 Ga0373934_0004739
4808 Ga0373934_0011693
4809 Ga0373934_0070997
4810 Ga0373940_0000365
4811 Ga0373940_0008793
4812 Ga0373944_0003497
4813 Ga0373944_0008808
4814 Ga0373944_0009077
4815 Ga0373944_0023567
4816 Ga0373944_0037297
4817 Ga0373949_0004024
4818 Ga0373949_0007442
4819 Ga0373951_0001019
4820 Ga0373952_0000465
4821 Ga0373952_0002504
4822 Ga0373952_0010270
4823 Ga0373923_0003017
4824 Ga0373923_0003695
4825 Ga0373923_0006013
4826 Ga0373923_0012345
4827 Ga0373923_0013075
4828 Ga0373923_0017037
4829 Ga0373932_0000305
4830 Ga0373932_0001852
4831 Ga0373932_0026993
4832 Ga0373936_0000082
4833 Ga0373936_0000290
4834 Ga0373936_0000946
4835 Ga0373936_0007442
4836 Ga0373936_0012489
4837 Ga0373936_0013610
4838 Ga0373936_0014254
4839 Ga0373936_0057060
4840 Ga0373939_0000355
4841 Ga0373939_0003430
4842 Ga0373939_0005402
4843 Ga0373941_0001908
4844 Ga0373941_0002882
4845 Ga0373945_0005133
4846 Ga0373945_0034466
4847 Ga0373945_0059657
4848 Ga0373953_0006758
4849 Ga0373953_0010746
4850 Ga0373953_0026996
4851 Ga0373953_0035276
4852 Ga0373953_0052471
4853 Ga0373954_0003768
4854 Ga0373954_0006443
4855 Ga0373954_0009287
4856 Ga0373954_0009326
4857 Ga0373954_0012508
4858 Ga0373954_0012944
4859 Ga0373954_0035182
4860 Ga0373954_0085459
4861 Ga0373956_0005842
4862 Ga0373956_0027831
4863 Ga0373956_0037968
4864 Ga0373957_0003174
4865 Ga0373957_0003945
4866 Ga0373957_0029892
4867 Ga0373957_0046275
4868 Ga0373960_0000049
4869 Ga0373960_0000939
4870 Ga0373960_0006872
4871 Ga0373960_0012406
4872 Ga0373960_0015179
4873 Ga0373943_0000731
4874 Ga0373943_0001740
4875 Ga0373943_0009675
4876 Ga0373943_0032340
4877 Ga0373943_0066731
4878 Ga0373946_0001140
4879 Ga0373946_0004807
4880 Ga0373946_0012296
4881 Ga0373946_0014320
4882 Ga0373946_0042153
4883 Ga0373955_0000306
4884 Ga0373955_0004397
4885 Ga0373955_0020245
4886 Ga0373955_0027638
4887 Ga0373942_0000263
4888 Ga0373942_0002162
4889 Ga0373961_0000821
4890 Ga0373962_0000166
4891 Ga0373962_0001762
4892 Ga0373962_0004665
4893 Ga0373962_0006951
4894 Ga0316574_0004257
4895 Ga0373924_0000437
4896 Ga0373924_0005336
4897 Ga0373924_0008896
4898 Ga0373924_0025681
4899 Ga0373924_0033174
4900 Ga0373924_0054754
4901 Ga0373931_0000251
4902 Ga0373931_0002892
4903 Ga0373931_0003067
4904 Ga0373931_0003885
4905 Ga0373931_0006942
4906 Ga0373931_0007466
4907 Ga0373931_0014118
4908 Ga0373931_0058607
4909 Ga0373935_0000287
4910 Ga0373935_0000382
4911 Ga0373935_0004967
4912 Ga0373935_0012579
4913 Ga0373935_0019053
4914 Ga0373935_0025698
4915 Ga0373935_0032906
4916 Ga0373935_0103576
4917 Ga0373935_0107899
4918 Ga0373927_0001986
4919 Ga0373927_0002885
4920 Ga0373927_0003772
4921 Ga0373927_0006211
4922 Ga0373927_0006833
4923 Ga0373927_0024472
4924 Ga0373927_0027258
4925 Ga0373927_0034185
4926 Ga0373927_0035489
4927 Ga0373927_0048028
4928 Ga0373927_0049440
4929 Ga0373927_0057068
4930 Ga0373927_0120841
4931 Ga0373933_0000110
4932 Ga0373933_0002816
4933 Ga0373933_0004137
4934 Ga0373933_0005829
4935 Ga0373933_0006160
4936 Ga0373933_0008646
4937 Ga0373933_0020415
4938 Ga0373947_0000156
4939 Ga0373947_0001850
4940 Ga0373947_0002644
4941 Ga0373947_0004465
4942 Ga0373947_0004860
4943 Ga0373947_0005528
4944 Ga0373947_0008142
4945 Ga0373947_0011440
4946 Ga0373947_0012827
4947 Ga0373947_0022837
4948 Ga0373947_0042745
4949 Ga0373947_0088100
4950 Ga0373947_0101709
4951 Ga0373937_0000269
4952 Ga0373937_0003306
4953 Ga0373937_0007162
4954 Ga0373937_0007207
4955 Ga0373937_0008870
4956 Ga0373937_0012150
4957 Ga0373937_0022596
4958 Ga0373937_0023869
4959 Ga0373937_0039555
4960 Ga0373937_0046402
4961 Ga0373937_0048939
4962 Ga0373937_0052305
4963 Ga0373937_0122394
4964 Ga0373937_0191120
4965 Ga0373937_0203326
4966 Ga0373937_0205428
4967 Ga0373937_0393298
4968 Ga0373925_0000075
4969 Ga0373925_0002634
4970 Ga0373925_0002995
4971 Ga0373925_0025219
4972 Ga0373925_0030557
4973 Ga0373925_0050209
4974 Ga0373925_0058607
4975 Ga0373925_0076823
4976 Ga0373925_0122814
4977 Ga0373925_0161133
4978 Ga0373925_0161974
4979 Ga0373925_0209548
4980 Ga0395899_0000090
4981 Ga0395899_0021302
4982 Ga0395899_0031696
4983 Ga0395899_0141965
4984 Ga0395900_0000017
4985 Ga0395900_0000940
4986 Ga0395900_0034081
4987 Ga0395900_0147352
4988 Ga0395900_0206362
4989 Ga0395898_0000030
4990 Ga0395898_0029285
4991 Ga0395898_0029616
4992 Ga0395898_0032592
4993 Ga0395898_0061821
4994 Ga0395898_0079128
4995 Ga0395898_0118976
4996 Ga0395898_0140265
4997 Ga0395905_0000081
4998 Ga0395905_0004739
4999 Ga0395905_0005715
5000 Ga0395905_0030761
5001 Ga0395905_0079814
5002 Ga0395905_0180690
5003 Ga0436364_0010736
5004 Ga0436364_0281278
5005 Ga0436364_0400687
5006 Ga0436364_0409058
5007 Ga0436364_0529683
5008 Ga0436364_0612608
5009 Ga0436364_0711898
5010 Ga0436364_0777339
5011 Ga0436364_0817653
5012 Ga0436364_1320386
5013 Ga0436364_1385698
5014 Ga0395901_0000015
5015 Ga0395901_0000055
5016 Ga0395901_0024150
5017 Ga0395901_0050570
5018 Ga0395901_0051490
5019 Ga0395901_0072724
5020 Ga0395901_0083716
5021 Ga0395901_0132765
5022 Ga0395901_0338810
5023 Ga0395901_0353499
5024 Ga0400483_222177
5025 Ga0400483_222778
5026 Ga0400483_239471
5027 Ga0436365_0134733
5028 Ga0436365_0154683
5029 Ga0436365_1332159
5030 Ga0436365_1463106
5031 Ga0436365_1713855
5032 Ga0436365_1748556
5033 Ga0436365_1892050
5034 Ga0436360_0049575
5035 Ga0436360_0205335
5036 Ga0436360_0370851
5037 Ga0436360_0822831
5038 Ga0436360_1106222
5039 Ga0436361_0052401
5040 Ga0436361_0365828
5041 Ga0436361_1108010
5042 Ga0436363_0267009
5043 Ga0436363_0410105
5044 Ga0436363_0660862
5045 Ga0436363_0878076
5046 Ga0436363_1159398
5047 Ga0436363_1595676
5048 Ga0436362_0057416
5049 Ga0436362_1133249
5050 Ga0439453_0000022
5051 Ga0439465_0022466
5052 Ga0439449_0007041
5053 Ga0439462_0024753
5054 Ga0450894_014274
5055 Ga0450902_000021
5056 Ga0451577_0214895
5057 Ga0439440_0029940
5058 Ga0466972_0000160
5059 Ga0466972_0001455
5060 Ga0466972_0023293
5061 Ga0466972_0031030
5062 Ga0466973_0019539
5063 Ga0466977_0000186
5064 Ga0466965_0027283
5065 Ga0466966_0006283
5066 Ga0466966_0047612
5067 Ga0466961_0000154
5068 Ga0466961_0040920
5069 Ga0466961_0055444
5070 Ga0466961_0062880
5071 Ga0466961_0069702
5072 Ga0466961_0144001
5073 Ga0466963_0004891
5074 Ga0466963_0011092
5075 Ga0466963_0024315
5076 Ga0466963_0115850
5077 Ga0466963_0250084
5078 Ga0453684_0125689
5079 Ga0453684_0156952
5080 Ga0466968_0027966
5081 Ga0466968_0032688
5082 Ga0466957_0000233
5083 Ga0466957_0019829
5084 Ga0466957_0044390
5085 Ga0466957_0086419
5086 Ga0466960_0129397
5087 Ga0466959_0012963
5088 Ga0466959_0016488
5089 Ga0466959_0022731
5090 Ga0466959_0202610
5091 Ga0451576_0011255
5092 Ga0451576_0027106
5093 Ga0466958_0010635
5094 Ga0466958_0074628
5095 Ga0466958_0108940
5096 Ga0466967_0003827
5097 Ga0466967_0022912
5098 Ga0466967_0137698
5099 Ga0466967_0431118
5100 Ga0495627_001678
5101 Ga0495592_0000060
5102 Ga0495592_0001659
5103 Ga0495592_0002937
5104 Ga0495592_0016948
5105 Ga0495592_0039427
5106 Ga0495592_0053403
5107 Ga0495592_0082148
5108 Ga0495592_0107397
5109 Ga0495603_0006274
5110 Ga0495603_0008489
5111 Ga0495603_0009274
5112 Ga0495603_0030358
5113 Ga0495603_0168148
5114 Ga0495629_0000820
5115 Ga0495629_0001281
5116 Ga0495629_0004130
5117 Ga0495629_0005499
5118 Ga0495629_0021353
5119 Ga0495629_0041636
5120 Ga0495629_0070245
5121 Ga0495629_0138616
5122 Ga0495629_0156648
5123 Ga0495638_0034133
5124 Ga0495638_0047300
5125 Ga0495638_0112582
5126 Ga0495641_0013534
5127 Ga0495641_0020456
5128 Ga0495641_0033444
5129 Ga0495651_0000762
5130 Ga0495651_0000821
5131 Ga0495651_0004144
5132 Ga0495651_0008754
5133 Ga0495651_0029252
5134 Ga0495651_0048772
5135 Ga0495651_0175092
5136 Ga0495653_0000129
5137 Ga0495653_0002057
5138 Ga0495653_0002307
5139 Ga0495653_0010963
5140 Ga0495653_0063797
5141 Ga0495653_0211822
5142 Ga0495650_0026363
5143 Ga0495580_0006533
5144 Ga0495580_0010022
5145 Ga0495582_0002118
5146 Ga0495582_0002522
5147 Ga0495582_0037881
5148 Ga0495582_0051934
5149 Ga0495582_0098419
5150 Ga0495605_0101675
5151 Ga0495639_0000077
5152 Ga0495639_0039061
5153 Ga0495639_0067982
5154 Ga0495662_0000558
5155 Ga0495662_0001138
5156 Ga0495662_0003102
5157 Ga0495662_0005023
5158 Ga0495662_0024743
5159 Ga0495662_0070723
5160 Ga0495664_0000003
5161 Ga0495664_0000393
5162 Ga0495664_0008391
5163 Ga0495664_0015614
5164 Ga0495664_0037381
5165 Ga0495664_0057799
5166 Ga0495664_0082115
5167 Ga0495584_0033835
5168 Ga0495584_0052272
5169 Ga0495584_0060796
5170 Ga0495584_0090714
5171 Ga0495585_0001819
5172 Ga0495585_0015259
5173 Ga0495585_0148941
5174 Ga0495594_0004654
5175 Ga0495594_0008785
5176 Ga0495594_0035529
5177 Ga0495594_0036792
5178 Ga0495607_0000071
5179 Ga0495607_0000280
5180 Ga0495607_0015399
5181 Ga0495606_0001988
5182 Ga0495608_0000005
5183 Ga0495608_0000180
5184 Ga0495608_0000456
5185 Ga0495608_0022036
5186 Ga0495608_0035091
5187 Ga0495608_0060608
5188 Ga0495608_0111535
5189 Ga0495608_0131640
5190 Ga0495608_0170517
5191 Ga0495610_0035245
5192 Ga0495610_0063639
5193 Ga0495616_0010819
5194 Ga0495618_0000044
5195 Ga0495618_0004121
5196 Ga0495618_0004321
5197 Ga0495618_0008722
5198 Ga0495618_0088268
5199 Ga0495620_0033982
5200 Ga0495628_0000001
5201 Ga0495628_0001503
5202 Ga0495628_0022057
5203 Ga0495628_0047631
5204 Ga0495628_0055004
5205 Ga0495628_0069229
5206 Ga0495628_0069396
5207 Ga0495628_0117253
5208 Ga0495630_0000530
5209 Ga0495630_0001279
5210 Ga0495630_0011535
5211 Ga0495630_0029799
5212 Ga0495630_0035236
5213 Ga0495630_0080145
5214 Ga0495630_0085140
5215 Ga0495630_0173753
5216 Ga0495637_0034213
5217 Ga0495637_0034650
5218 Ga0495643_0021142
5219 Ga0495644_0000332
5220 Ga0495644_0009287
5221 Ga0495648_0004264
5222 Ga0495648_0006745
5223 Ga0495663_0009551
5224 Ga0495666_0006830
5225 Ga0495666_0015122
5226 Ga0495642_0014122
5227 Ga0495652_0000002
5228 Ga0495652_0002402
5229 Ga0495652_0003331
5230 Ga0495652_0005063
5231 Ga0495652_0010705
5232 Ga0495652_0051726
5233 Ga0495652_0057979
5234 Ga0495652_0155033
5235 Ga0495652_0174810
5236 Ga0495652_0208727
5237 Ga0495652_0305259
5238 Ga0495654_0044044
5239 Ga0495665_0005354
5240 Ga0495665_0007168
5241 Ga0495665_0052102
5242 Ga0495665_0085239
5243 Ga0495640_0000001
5244 Ga0495640_0001485
5245 Ga0495640_0004699
5246 Ga0495640_0009310
5247 Ga0495640_0010468
5248 Ga0495640_0018557
5249 Ga0495640_0030218
5250 Ga0495640_0036301
5251 Ga0495640_0080681
5252 Ga0495640_0127557
5253 Ga0495640_0149600
5254 Ga0495586_0025121
5255 Ga0495586_0034731
5256 Ga0495587_0000001
5257 Ga0495587_0006392
5258 Ga0495587_0006778
5259 Ga0495587_0009149
5260 Ga0495587_0016455
5261 Ga0495587_0055111
5262 Ga0495598_0004524
5263 Ga0495621_0039499
5264 Ga0495597_0044482
5265 Ga0495645_0000002
5266 Ga0495645_0000399
5267 Ga0495645_0000911
5268 Ga0495645_0016639
5269 Ga0495645_0021556
5270 Ga0495645_0054262
5271 Ga0495645_0064957
5272 Ga0495622_0001874
5273 Ga0495622_0011900
5274 Ga0495622_0015051
5275 Ga0495622_0021777
5276 Ga0495622_0094905
5277 Ga0495633_0002835
5278 Ga0495633_0018437
5279 Ga0495633_0039921
5280 Ga0495667_0000039
5281 Ga0495667_0000832
5282 Ga0495667_0003030
5283 Ga0495667_0033501
5284 Ga0495667_0039300
5285 Ga0495667_0040203
5286 Ga0495667_0053211
5287 Ga0495667_0056873
5288 Ga0495656_0000480
5289 Ga0495656_0005889
5290 Ga0495656_0009875
5291 Ga0495656_0010749
5292 Ga0495656_0025146
5293 Ga0495656_0034711
5294 Ga0495668_0066126
5295 Ga0495634_0000010
5296 Ga0495634_0001976
5297 Ga0495634_0007301
5298 Ga0495634_0011570
5299 Ga0495634_0022903
5300 Ga0495634_0069268
5301 Ga0495634_0078394
5302 Ga0495634_0126035
5303 Ga0495625_0001042
5304 Ga0495625_0060789
5305 Ga0495625_0159260
5306 Ga0495635_0000001
5307 Ga0495635_0002471
5308 Ga0495635_0014085
5309 Ga0495635_0014978
5310 Ga0495635_0017755
5311 Ga0495635_0027461
5312 Ga0495635_0027843
5313 Ga0495635_0034447
5314 Ga0495635_0100736
5315 Ga0495659_0014731
5316 Ga0495661_0003988
5317 Ga0495661_0022266
5318 Ga0495661_0110362
5319 Ga0495661_0144400
5320 Ga0495588_0001123
5321 Ga0495588_0001283
5322 Ga0495588_0046212
5323 Ga0495588_0050113
5324 Ga0495588_0097587
5325 Ga0495657_0000042
5326 Ga0495657_0008710
5327 Ga0495657_0015882
5328 Ga0495657_0016840
5329 Ga0495657_0059158
5330 Ga0495599_0000013
5331 Ga0495599_0003635
5332 Ga0495599_0005435
5333 Ga0495599_0010526
5334 Ga0495599_0060421
5335 Ga0495599_0094460
5336 Ga0495599_0139257
5337 Ga0495623_0000050
5338 Ga0495623_0000372
5339 Ga0495623_0009213
5340 Ga0495623_0009394
5341 Ga0495623_0010249
5342 Ga0495623_0017926
5343 Ga0495623_0026859
5344 Ga0495623_0147730
5345 Ga0495646_0000009
5346 Ga0495646_0001728
5347 Ga0495646_0013938
5348 Ga0495646_0015084
5349 Ga0495646_0021040
5350 Ga0495646_0024603
5351 Ga0495646_0025467
5352 Ga0495646_0028255
5353 Ga0495646_0071640
5354 Ga0495646_0074176
5355 Ga0495647_0000134
5356 Ga0495647_0012083
5357 Ga0495658_0000479
5358 Ga0495658_0001615
5359 Ga0495658_0013570
5360 Ga0495658_0018146
5361 Ga0495658_0018389
5362 Ga0495658_0024645
5363 Ga0495658_0031178
5364 Ga0495658_0045601
5365 Ga0495658_0055136
5366 Ga0495658_0101589
5367 Ga0495669_0026867
5368 Ga0495669_0043054
5369 Ga0495669_0108558
5370 Ga0495613_0004515
5371 Ga0495613_0013924
5372 Ga0495613_0017495
5373 Ga0495613_0033948
5374 Ga0495613_0054098
5375 Ga0495613_0122846
5376 Ga0495613_0145084
5377 Ga0495624_0002021
5378 Ga0495624_0003130
5379 Ga0495624_0005517
5380 Ga0495624_0018581
5381 Ga0495624_0021002
5382 Ga0495624_0061013
5383 Ga0495624_0064486
5384 Ga0495670_0008138
5385 Ga0495670_0014312
5386 Ga0495670_0118683
5387 Ga0495671_0000618
5388 Ga0495671_0015600
5389 Ga0495671_0056245
5390 Ga0495671_0068501
5391 Ga0495671_0084324
5392 Ga0495589_0029050
5393 Ga0495589_0102532
5394 Ga0495600_0000035
5395 Ga0495600_0011402
5396 Ga0495600_0012452
5397 Ga0495600_0022024
5398 Ga0495600_0049651
5399 Ga0495600_0129028
5400 Ga0495581_0000503
5401 Ga0495581_0014816
5402 Ga0495581_0015374
5403 Ga0495581_0103190
5404 Ga0495581_0152153
5405 Ga0495604_0000069
5406 Ga0495604_0000241
5407 Ga0495604_0000702
5408 Ga0495604_0003178
5409 Ga0495604_0006376
5410 Ga0495604_0023347
5411 Ga0495604_0049389
5412 Ga0495604_0085915
5413 Ga0495604_0157590
5414 Ga0495604_0163032
5415 Ga0495636_0060692
5416 Ga0495674_0000002
5417 Ga0495674_0001363
5418 Ga0495674_0009848
5419 Ga0495674_0010172
5420 Ga0495674_0010576
5421 Ga0495674_0017131
5422 Ga0495674_0035825
5423 Ga0495674_0081957
5424 Ga0495674_0093453
5425 Ga0495674_0096869
5426 Ga0495674_0142364
5427 Ga0495674_0295740
5428 Ga0495674_0345522
5429 Ga0495672_0020588
5430 Ga0495672_0024913
5431 Ga0495672_0037370
5432 Ga0495672_0078278
5433 Ga0495676_0009761
5434 Ga0495676_0024072
5435 Ga0495676_0035814
5436 Ga0495676_0105518
5437 Ga0495680_0000497
5438 Ga0495680_0000994
5439 Ga0495680_0002292
5440 Ga0495680_0002523
5441 Ga0495680_0006821
5442 Ga0495680_0007750
5443 Ga0495680_0019186
5444 Ga0495680_0050134
5445 Ga0495680_0117700
5446 Ga0495683_0066187
5447 Ga0495687_000091
5448 Ga0495687_010818
5449 Ga0495675_0000164
5450 Ga0495675_0003053
5451 Ga0495675_0011479
5452 Ga0495675_0021384
5453 Ga0495675_0028161
5454 Ga0495675_0114789
5455 Ga0495681_0011395
5456 Ga0495684_0000016
5457 Ga0495684_0002016
5458 Ga0495684_0006620
5459 Ga0495684_0009241
5460 Ga0495684_0010790
5461 Ga0495684_0013942
5462 Ga0495684_0016455
5463 Ga0495684_0017301
5464 Ga0495684_0055741
5465 Ga0495684_0067103
5466 Ga0495684_0160931
5467 Ga0495684_0174443
5468 Ga0495686_0003430
5469 Ga0495686_0014825
5470 Ga0495686_0097311
5471 Ga0495593_0000500
5472 Ga0495593_0001200
5473 Ga0495593_0008925
5474 Ga0495593_0011269
5475 Ga0495593_0047105
5476 Ga0495602_0000240
5477 Ga0495602_0001314
5478 Ga0495602_0002214
5479 Ga0495602_0002373
5480 Ga0495602_0015855
5481 Ga0495602_0073081
5482 Ga0495614_0007099
5483 Ga0495614_0042403
5484 Ga0495615_0016460
5485 Ga0496100_0000894
5486 Ga0496100_0001914
5487 Ga0496100_0017089
5488 Ga0496100_0029132
5489 Ga0496100_0149792
5490 Ga0496100_0202533
5491 Ga0496101_0002235
5492 Ga0496101_0006818
5493 Ga0496101_0010083
5494 Ga0496101_0017259
5495 Ga0496101_0017359
5496 Ga0496101_0018376
5497 Ga0496101_0034478
5498 Ga0496101_0038342
5499 Ga0496101_0050303
5500 Ga0496101_0086232
5501 Ga0496101_0100572
5502 Ga0496101_0144441
5503 Ga0496101_0168803
5504 Ga0496102_0002866
5505 Ga0496102_0005027
5506 Ga0496102_0007763
5507 Ga0496102_0012150
5508 Ga0496102_0017100
5509 Ga0496102_0020900
5510 Ga0496102_0083804
5511 Ga0496102_0084929
5512 Ga0496102_0094089
5513 Ga0496102_0124750
5514 Ga0496102_0152258
5515 Ga0496102_0171071
5516 Ga0496102_0388576
5517 Ga0496103_0002892
5518 Ga0496103_0003599
5519 Ga0496103_0006142
5520 Ga0496103_0052397
5521 Ga0496103_0053875
5522 Ga0496103_0074492
5523 Ga0496103_0084224
5524 Ga0496103_0103945
5525 Ga0496104_0000061
5526 Ga0496104_0000194
5527 Ga0496104_0000577
5528 Ga0496104_0000591
5529 Ga0496104_0001608
5530 Ga0496104_0005904
5531 Ga0496104_0009816
5532 Ga0496104_0010521
5533 Ga0496104_0011884
5534 Ga0496104_0016737
5535 Ga0496104_0020587
5536 Ga0496104_0044813
5537 Ga0496104_0072979
5538 Ga0496104_0189988
5539 Ga0496105_0000365
5540 Ga0496105_0002920
5541 Ga0496105_0003112
5542 Ga0496105_0004541
5543 Ga0496105_0005828
5544 Ga0496105_0006281
5545 Ga0496105_0014088
5546 Ga0496105_0014128
5547 Ga0496105_0024367
5548 Ga0496105_0027670
5549 Ga0496105_0083381
5550 Ga0496106_0000990
5551 Ga0496106_0001140
5552 Ga0496106_0002884
5553 Ga0496106_0007418
5554 Ga0496106_0020125
5555 Ga0496106_0024426
5556 Ga0496106_0043386
5557 Ga0496106_0063690
5558 Ga0496106_0070094
5559 Ga0496106_0123320
5560 Ga0496106_0210197
5561 Ga0496107_0005244
5562 Ga0496107_0005579
5563 Ga0496107_0016685
5564 Ga0496107_0020521
5565 Ga0496107_0022051
5566 Ga0496107_0031230
5567 Ga0496107_0046671
5568 Ga0496107_0059511
5569 Ga0496107_0060830
5570 Ga0496107_0070560
5571 Ga0496107_0090658
5572 Ga0496108_0000322
5573 Ga0496108_0000515
5574 Ga0496108_0001664
5575 Ga0496108_0002753
5576 Ga0496108_0009720
5577 Ga0496108_0015807
5578 Ga0496108_0029173
5579 Ga0496108_0039592
5580 Ga0496108_0048324
5581 Ga0496108_0055977
5582 Ga0496108_0069354
5583 Ga0496108_0203032
5584 Ga0496108_0300997
5585 Ga0496108_0346332
5586 Ga0496109_0000394
5587 Ga0496109_0001619
5588 Ga0496109_0002891
5589 Ga0496109_0003998
5590 Ga0496109_0004579
5591 Ga0496109_0005428
5592 Ga0496109_0016198
5593 Ga0496109_0025734
5594 Ga0496109_0035560
5595 Ga0496109_0090349
5596 Ga0496109_0131368
5597 Ga0496110_0001173
5598 Ga0496110_0005945
5599 Ga0496110_0009681
5600 Ga0496110_0017791
5601 Ga0496110_0024430
5602 Ga0496110_0031329
5603 Ga0496110_0037159
5604 Ga0496110_0076056
5605 Ga0496110_0096299
5606 Ga0496110_0141887
5607 Ga0496110_0220308
5608 Ga0496110_0229379
5609 Ga0496110_0229641
5610 Ga0496111_0006536
5611 Ga0496111_0007757
5612 Ga0496111_0010326
5613 Ga0496111_0020692
5614 Ga0496111_0023272
5615 Ga0496111_0026872
5616 Ga0496111_0031493
5617 Ga0496111_0033103
5618 Ga0496111_0036490
5619 Ga0496111_0055919
5620 Ga0496111_0158525
5621 Ga0496112_0000004
5622 Ga0496112_0000732
5623 Ga0496112_0000803
5624 Ga0496112_0002254
5625 Ga0496112_0004421
5626 Ga0496112_0016454
5627 Ga0496112_0026288
5628 Ga0496112_0031239
5629 Ga0496112_0038139
5630 Ga0496112_0046586
5631 Ga0496112_0050327
5632 Ga0496112_0051168
5633 Ga0496112_0057233
5634 Ga0496112_0109917
5635 Ga0496112_0137952
5636 Ga0496112_0310281
5637 Ga0496113_0001285
5638 Ga0496113_0002162
5639 Ga0496113_0007860
5640 Ga0496113_0010581
5641 Ga0496113_0017394
5642 Ga0496113_0018648
5643 Ga0496113_0029024
5644 Ga0496113_0038211
5645 Ga0496113_0066998
5646 Ga0496113_0092431
5647 Ga0496113_0118074
5648 Ga0496113_0162012
5649 Ga0496114_0008740
5650 Ga0496114_0027667
5651 Ga0496114_0048533
5652 Ga0496114_0048921
5653 Ga0496114_0051863
5654 Ga0496114_0059654
5655 Ga0496114_0088839
5656 Ga0496114_0112567
5657 Ga0496114_0113559
5658 Ga0496114_0174044
5659 Ga0496114_0230121
5660 Ga0496114_0240919
5661 Ga0496115_0005923
5662 Ga0496115_0007543
5663 Ga0496115_0007578
5664 Ga0496115_0013541
5665 Ga0496115_0025561
5666 Ga0496115_0038161
5667 Ga0496115_0038187
5668 Ga0496115_0046759
5669 Ga0496115_0121285
5670 Ga0496115_0158374
5671 Ga0496115_0247780
5672 Ga0496115_0297816
5673 Ga0496116_0003689
5674 Ga0496116_0018926
5675 Ga0496116_0020398
5676 Ga0496117_0000036
5677 Ga0496117_0012904
5678 Ga0496117_0015481
5679 Ga0496117_0024395
5680 Ga0496117_0032448
5681 Ga0496117_0036596
5682 Ga0496117_0175913
5683 Ga0496118_0003337
5684 Ga0496118_0008209
5685 Ga0496118_0020646
5686 Ga0496118_0047108
5687 Ga0496118_0056599
5688 Ga0496118_0076879
5689 Ga0496119_0003438
5690 Ga0496119_0009369
5691 Ga0496119_0014973
5692 Ga0496119_0079562
5693 Ga0496119_0096340
5694 Ga0496120_0001678
5695 Ga0496120_0005900
5696 Ga0496120_0012920
5697 Ga0496120_0025464
5698 Ga0496120_0065903
5699 Ga0496121_0000458
5700 Ga0496121_0000574
5701 Ga0496121_0000668
5702 Ga0496121_0005012
5703 Ga0496121_0016457
5704 Ga0496121_0030756
5705 Ga0496121_0038705
5706 Ga0496121_0054796
5707 Ga0496121_0063866
5708 Ga0496121_0110020
5709 Ga0496122_0000002
5710 Ga0496122_0000074
5711 Ga0496122_0005799
5712 Ga0496122_0017627
5713 Ga0496122_0020971
5714 Ga0496122_0024524
5715 Ga0496122_0032207
5716 Ga0496122_0041965
5717 Ga0496122_0051385
5718 Ga0496122_0065558
5719 Ga0496123_0000002
5720 Ga0496123_0000062
5721 Ga0496123_0004614
5722 Ga0496123_0008775
5723 Ga0496123_0016930
5724 Ga0496123_0022456
5725 Ga0496123_0038669
5726 Ga0496124_0007696
5727 Ga0496124_0013261
5728 Ga0496124_0023362
5729 Ga0496124_0050197
5730 Ga0496124_0078400
5731 Ga0496124_0210343
5732 Ga0496125_0000060
5733 Ga0496125_0000116
5734 Ga0496125_0001496
5735 Ga0496125_0006111
5736 Ga0496125_0008272
5737 Ga0496125_0026780
5738 Ga0496125_0034560
5739 Ga0496125_0046531
5740 Ga0496125_0069040
5741 Ga0496125_0075447
5742 Ga0496125_0084942
5743 Ga0496126_0003422
5744 Ga0496126_0004802
5745 Ga0496126_0007480
5746 Ga0496126_0014201
5747 Ga0496126_0014911
5748 Ga0496126_0015313
5749 Ga0496126_0020126
5750 Ga0496126_0021658
5751 Ga0496126_0022450
5752 Ga0496126_0025527
5753 Ga0496126_0095694
5754 Ga0496126_0101955
5755 Ga0496126_0102454
5756 Ga0496126_0119071
5757 Ga0496126_0213579
5758 Ga0496126_0263677
5759 Ga0495682_0021095
5760 Ga0501031_0001597
5761 Ga0501031_0002121
5762 Ga0501031_0003092
5763 Ga0501031_0032796
5764 Ga0501031_0055347
5765 Ga0501031_0063639
5766 Ga0501032_0000008
5767 Ga0501032_0000619
5768 Ga0501032_0001926
5769 Ga0501032_0008343
5770 Ga0501032_0010824
5771 Ga0501032_0017460
5772 Ga0501032_0060433
5773 Ga0501032_0075832
5774 Ga0501032_0117881
5775 Ga0501032_0168080
5776 Ga0501033_0000012
5777 Ga0501033_0000108
5778 Ga0501033_0005509
5779 Ga0501033_0008737
5780 Ga0501033_0009630
5781 Ga0501033_0010896
5782 Ga0501033_0013189
5783 Ga0501033_0021175
5784 Ga0501033_0041393
5785 Ga0501033_0096688
5786 Ga0501033_0122816
5787 Ga0501033_0128007
5788 Ga0501033_0139633
5789 Ga0501033_0219564
5790 Ga0501034_0000035
5791 Ga0501034_0000100
5792 Ga0501034_0000319
5793 Ga0501034_0001353
5794 Ga0501034_0005498
5795 Ga0501034_0010766
5796 Ga0501034_0013826
5797 Ga0501034_0014581
5798 Ga0501034_0058957
5799 Ga0501034_0070062
5800 Ga0501034_0129420
5801 Ga0501034_0137276
5802 Ga0501034_0142897
5803 Ga0501034_0157141
5804 Ga0501034_0204816
5805 Ga0501034_0372640
5806 Ga0501034_0408264
5807 Ga0501036_0000006
5808 Ga0501036_0000769
5809 Ga0501036_0001566
5810 Ga0501036_0004308
5811 Ga0501036_0014462
5812 Ga0501036_0029821
5813 Ga0501036_0065821
5814 Ga0501036_0104953
5815 Ga0501036_0233052
5816 Ga0501036_0280263
5817 Ga0501036_0297235
5818 Ga0501037_0000072
5819 Ga0501037_0000153
5820 Ga0501037_0000386
5821 Ga0501037_0008879
5822 Ga0501037_0010014
5823 Ga0501037_0010426
5824 Ga0501037_0012514
5825 Ga0501037_0019253
5826 Ga0501037_0047037
5827 Ga0501037_0062776
5828 Ga0501037_0072307
5829 Ga0501037_0109022
5830 Ga0501037_0132149
5831 Ga0501037_0141424
5832 Ga0501038_0000007
5833 Ga0501038_0000138
5834 Ga0501038_0000575
5835 Ga0501038_0000999
5836 Ga0501038_0004019
5837 Ga0501038_0012452
5838 Ga0501038_0026001
5839 Ga0501038_0031485
5840 Ga0501038_0039232
5841 Ga0501038_0041394
5842 Ga0501038_0051632
5843 Ga0501038_0071647
5844 Ga0501038_0079031
5845 Ga0501038_0090799
5846 Ga0501038_0196696
5847 Ga0501038_0222342
5848 Ga0501038_0265978
5849 Ga0501039_0000012
5850 Ga0501039_0005026
5851 Ga0501039_0007888
5852 Ga0501039_0036387
5853 Ga0501039_0044093
5854 Ga0501039_0048916
5855 Ga0501039_0060551
5856 Ga0501039_0069857
5857 Ga0501039_0074160
5858 Ga0501039_0081004
5859 Ga0501039_0083826
5860 Ga0501039_0104889
5861 Ga0501039_0115394
5862 Ga0501039_0131202
5863 Ga0501039_0137252
5864 Ga0501039_0160231
5865 Ga0501040_0001880
5866 Ga0501040_0024632
5867 Ga0501040_0063855
5868 Ga0501041_0075539
5869 Ga0501042_0053387
5870 Ga0501042_0109750
5871 Ga0501043_0000022
5872 Ga0501043_0000085
5873 Ga0501043_0000211
5874 Ga0501043_0019496
5875 Ga0501043_0025654
5876 Ga0501043_0031144
5877 Ga0501043_0035591
5878 Ga0501043_0039538
5879 Ga0501043_0042729
5880 Ga0501043_0043378
5881 Ga0501043_0046856
5882 Ga0501043_0050782
5883 Ga0501043_0054900
5884 Ga0501043_0062866
5885 Ga0501043_0071468
5886 Ga0501043_0072831
5887 Ga0501043_0201500
5888 Ga0501043_0246896
5889 Ga0501046_0000267
5890 Ga0501046_0001536
5891 Ga0501046_0013460
5892 Ga0501046_0026846
5893 Ga0501046_0062164
5894 Ga0501046_0075547
5895 Ga0501046_0082690
5896 Ga0501046_0091570
5897 Ga0501046_0275014
5898 Ga0501047_0000079
5899 Ga0501047_0000221
5900 Ga0501047_0000380
5901 Ga0501047_0012718
5902 Ga0501047_0015912
5903 Ga0501047_0017518
5904 Ga0501047_0031463
5905 Ga0501047_0041124
5906 Ga0501047_0049538
5907 Ga0501047_0086994
5908 Ga0501047_0123188
5909 Ga0501047_0174771
5910 Ga0501047_0215616
5911 Ga0501047_0279342
5912 Ga0501048_0000582
5913 Ga0501048_0000858
5914 Ga0501048_0002076
5915 Ga0501048_0008960
5916 Ga0501048_0135146
5917 Ga0501048_0260187
5918 Ga0501067_0000104
5919 Ga0501067_0008785
5920 Ga0501067_0046728
5921 Ga0501067_0055784
5922 Ga0501068_0000689
5923 Ga0501068_0021689
5924 Ga0501068_0034598
5925 Ga0501068_0049382
5926 Ga0501069_0000284
5927 Ga0501069_0003185
5928 Ga0501069_0018590
5929 Ga0501069_0071911
5930 Ga0501069_0086027
5931 Ga0501070_0000103
5932 Ga0501070_0000601
5933 Ga0501070_0003323
5934 Ga0501070_0015274
5935 Ga0501070_0026619
5936 Ga0501070_0028528
5937 Ga0501070_0040501
5938 Ga0501070_0041137
5939 Ga0501070_0146822
5940 Ga0501070_0257447
5941 Ga0501070_0268111
5942 Ga0501071_0022525
5943 Ga0501071_0054744
5944 Ga0501071_0069838
5945 Ga0501071_0083339
5946 Ga0501071_0102904
5947 Ga0501071_0105884
5948 Ga0501072_0001082
5949 Ga0501072_0001591
5950 Ga0501072_0009005
5951 Ga0501072_0020421
5952 Ga0501072_0043055
5953 Ga0501072_0159238
5954 Ga0501073_0000290
5955 Ga0501073_0026954
5956 Ga0501073_0047809
5957 Ga0501073_0064742
5958 Ga0501073_0092831
5959 Ga0501073_0175172
5960 Ga0501074_0000094
5961 Ga0501074_0000627
5962 Ga0501074_0008381
5963 Ga0501074_0078327
5964 Ga0501074_0084640
5965 Ga0501074_0093634
5966 Ga0501074_0114939
5967 Ga0501074_0130983
5968 Ga0501074_0166927
5969 Ga0501075_0009599
5970 Ga0501075_0033946
5971 Ga0501075_0037983
5972 Ga0501075_0039882
5973 Ga0501075_0042960
5974 Ga0501075_0186834
5975 Ga0501076_0010260
5976 Ga0501076_0016240
5977 Ga0501076_0067934
5978 Ga0501076_0232011
5979 Ga0501077_0009864
5980 Ga0501077_0024032
5981 Ga0501079_0000727
5982 Ga0501079_0002574
5983 Ga0501079_0027439
5984 Ga0501079_0045485
5985 Ga0501079_0120828
5986 Ga0501080_0007905
5987 Ga0501080_0008900
5988 Ga0501080_0009419
5989 Ga0501080_0029767
5990 Ga0501080_0036485
5991 Ga0501080_0047761
5992 Ga0501080_0055234
5993 Ga0501080_0087084
5994 Ga0501080_0121138
5995 Ga0501080_0202660
5996 Ga0501080_0344415
5997 Ga0501081_0001063
5998 Ga0501081_0056938
5999 Ga0501081_0057668
6000 Ga0501083_0000087
6001 Ga0501083_0000374
6002 Ga0501083_0001525
6003 Ga0501083_0003683
6004 Ga0501083_0053580
6005 Ga0501083_0116504
6006 Ga0501083_0149420
6007 Ga0501083_0170214
6008 Ga0501083_0189189
6009 Ga0501035_0000035
6010 Ga0501035_0000223
6011 Ga0501035_0001800
6012 Ga0501035_0003063
6013 Ga0501035_0003617
6014 Ga0501035_0013006
6015 Ga0501035_0013765
6016 Ga0501035_0016640
6017 Ga0501035_0019507
6018 Ga0501035_0021754
6019 Ga0501035_0021999
6020 Ga0501035_0029550
6021 Ga0501035_0033390
6022 Ga0501035_0048984
6023 Ga0501035_0059069
6024 Ga0501035_0060562
6025 Ga0501035_0075059
6026 Ga0501035_0128079
6027 Ga0501035_0139838
6028 Ga0501035_0182242
6029 Ga0501044_0000015
6030 Ga0501044_0000369
6031 Ga0501044_0000516
6032 Ga0501044_0000578
6033 Ga0501044_0008397
6034 Ga0501044_0008812
6035 Ga0501044_0013155
6036 Ga0501044_0015943
6037 Ga0501044_0016305
6038 Ga0501044_0016560
6039 Ga0501044_0017409
6040 Ga0501044_0018763
6041 Ga0501044_0023766
6042 Ga0501044_0065124
6043 Ga0501044_0067647
6044 Ga0501044_0071838
6045 Ga0501044_0072377
6046 Ga0501044_0073799
6047 Ga0501044_0094349
6048 Ga0501044_0116320
6049 Ga0501044_0191864
6050 Ga0501044_0222535
6051 Ga0501044_0358921
6052 Ga0501044_0380401
6053 Ga0501044_0396900
6054 Ga0501045_0003601
6055 Ga0501045_0015619
6056 Ga0501045_0027818
6057 Ga0501045_0030334
6058 Ga0501045_0213603
6059 nmdc:mga03683_21282_c1
6060 nmdc:mga03683_37247_c1
6061 nmdc:mga03683_3875_c1
6062 nmdc:mga03n38_380_c1
6063 nmdc:mga00v17_12168_c2
6064 nmdc:mga00v17_125571_c1
6065 nmdc:mga00v17_51_c1
6066 nmdc:mga0yw44_131209_c1
6067 nmdc:mga0yw44_21266_c1
6068 nmdc:mga0yw44_23613_c1
6069 nmdc:mga0yw44_2950_c1
6070 nmdc:mga0yw44_29741_c1
6071 nmdc:mga0yw44_5645_c1
6072 nmdc:mga0yw44_78188_c1
6073 nmdc:mga0k408_127740_c1
6074 nmdc:mga0k408_33002_c1
6075 nmdc:mga06z11_11646_c1
6076 nmdc:mga06z11_1301_c1
6077 nmdc:mga06z11_143627_c1
6078 nmdc:mga06z11_24940_c1
6079 nmdc:mga06z11_27745_c1
6080 nmdc:mga06z11_36507_c1
6081 nmdc:mga06z11_81524_c1
6082 nmdc:mga04h51_54215_c1
6083 nmdc:mga07m45_49149_c1
6084 nmdc:mga07m45_5309_c2
6085 nmdc:mga05p37_113589_c1
6086 nmdc:mga05p37_1242_c1
6087 nmdc:mga05p37_196059_c1
6088 nmdc:mga05p37_2458_c1
6089 nmdc:mga05p37_292909_c1
6090 nmdc:mga05p37_324851_c1
6091 nmdc:mga05p37_62833_c1
6092 nmdc:mga05p37_7606_c1
6093 nmdc:mga05p37_83403_c1
6094 nmdc:mga05p37_8850_c1
6095 nmdc:mga05p37_9470_c1
6096 nmdc:mga09592_10948_c1
6097 nmdc:mga09592_480_c1
6098 nmdc:mga09592_800_c1
6099 nmdc:mga09592_848_c1
6100 nmdc:mga0qj67_17812_c1
6101 nmdc:mga0qj67_23821_c1
6102 nmdc:mga0qj67_514_c1
6103 nmdc:mga0qj67_873_c1
6104 nmdc:mga06r32_117911_c1
6105 nmdc:mga06r32_1406_c1
6106 nmdc:mga06r32_417029_c1
6107 nmdc:mga06r32_62800_c1
6108 nmdc:mga06r32_94_c1
6109 nmdc:mga06r32_9941_c1
6110 nmdc:mga08y16_1532_c1
6111 nmdc:mga08y16_1541_c2
6112 nmdc:mga08y16_160_c1
6113 nmdc:mga08y16_1962_c1
6114 nmdc:mga08y16_20423_c1
6115 nmdc:mga08y16_236041_c1
6116 nmdc:mga08y16_238449_c1
6117 nmdc:mga08y16_2747_c1
6118 nmdc:mga08y16_410_c1
6119 nmdc:mga08y16_44609_c1
6120 nmdc:mga08y16_89906_c1
6121 nmdc:mga0n895_114842_c1
6122 nmdc:mga0n895_1152_c1
6123 nmdc:mga0n895_174865_c1
6124 nmdc:mga0n895_21004_c1
6125 nmdc:mga0n895_271922_c1
6126 nmdc:mga0n895_31905_c1
6127 nmdc:mga0n895_32724_c1
6128 nmdc:mga0n895_358_c1
6129 nmdc:mga0n895_791_c2
6130 nmdc:mga0rr50_266743_c1
6131 nmdc:mga08x19_29347_c1
6132 nmdc:mga08x19_6_c1
6133 nmdc:mga0a205_102898_c1
6134 nmdc:mga0a205_133555_c1
6135 nmdc:mga0a205_234740_c1
6136 nmdc:mga0a205_35179_c1
6137 nmdc:mga0a205_39044_c1
6138 Ga0495601_0000001
6139 Ga0495601_0000095
6140 Ga0495601_0000316
6141 Ga0495601_0002508
6142 Ga0495601_0004144
6143 Ga0495601_0006189
6144 Ga0495601_0031775
6145 Ga0495601_0033666
6146 Ga0495601_0041563
6147 Ga0495601_0042354
6148 Ga0495601_0133294
6149 Ga0495601_0155440
6150 Ga0495601_0170181
6151 Ga0495612_0000017
6152 Ga0495612_0000118
6153 Ga0495612_0000812
6154 Ga0495612_0000834
6155 Ga0495612_0012919
6156 Ga0495612_0100551
6157 Ga0500610_0033875
6158 Ga0500635_0000553
6159 Ga0495655_0009867
6160 Ga0495595_0000010
6161 Ga0495595_0000214
6162 Ga0495595_0000261
6163 Ga0495595_0002798
6164 Ga0495595_0017420
6165 Ga0495595_0017958
6166 Ga0495595_0033329
6167 Ga0495595_0035642
6168 Ga0495595_0037724
6169 Ga0495595_0045461
6170 Ga0495595_0066140
6171 Ga0495619_0000014
6172 Ga0495619_0000056
6173 Ga0495619_0000351
6174 Ga0495619_0000498
6175 Ga0495619_0001245
6176 Ga0495619_0002197
6177 Ga0495619_0012921
6178 Ga0495619_0023467
6179 Ga0495619_0027358
6180 Ga0495619_0030001
6181 Ga0495619_0037857
6182 Ga0495619_0078589
6183 Ga0495619_0079671
6184 Ga0495619_0086632
6185 Ga0495619_0184490
6186 Ga0495619_0205481
6187 Ga0495619_0241310
6188 Ga0500643_000035
6189 Ga0500643_004228
6190 Ga0500644_0000325
6191 Ga0500581_068891
6192 Ga0500651_0008405
6193 Ga0500651_0040446
6194 Ga0500651_0086345
6195 Ga0500566_0000006
6196 Ga0500566_0001514
6197 Ga0500566_0002990
6198 Ga0500566_0014528
6199 Ga0500640_000996
6200 Ga0500641_0001371
6201 Ga0500641_0003439
6202 Ga0500641_0011224
6203 Ga0500650_0000139
6204 Ga0500555_005851
6205 Ga0500556_0000002
6206 Ga0500556_0005941
6207 Ga0500557_000004
6208 Ga0500560_000106
6209 Ga0500572_000205
6210 Ga0500572_001372
6211 Ga0500572_048050
6212 Ga0500593_024644
6213 Ga0500595_000001
6214 Ga0500595_000152
6215 Ga0500595_002016
6216 Ga0500595_002270
6217 Ga0500595_008028
6218 Ga0500595_010226
6219 Ga0500607_003322
6220 Ga0500607_055260
6221 Ga0500608_000349
6222 Ga0500618_002246
6223 Ga0500618_006498
6224 Ga0500618_009304
6225 Ga0500618_016952
6226 Ga0500642_0000016
6227 Ga0500642_0008362
6228 Ga0500642_0009145
6229 Ga0500642_0062935
6230 Ga0500655_000041
6231 Ga0500655_016003
6232 Ga0500658_0007755
6233 Ga0500559_0001029
6234 Ga0500559_0001124
6235 Ga0500559_0001576
6236 Ga0500559_0022304
6237 Ga0500559_0072796
6238 Ga0500561_0000260
6239 Ga0500568_0000125
6240 Ga0500568_0001161
6241 Ga0500568_0032309
6242 Ga0500573_0034555
6243 Ga0500603_000671
6244 Ga0500603_001483
6245 Ga0500616_0000001
6246 Ga0500616_0000061
6247 Ga0500616_0000296
6248 Ga0500616_0020934
6249 Ga0500616_0028797
6250 Ga0500616_0044050
6251 Ga0500616_0058950
6252 Ga0500620_000249
6253 Ga0500622_0000916
6254 Ga0500622_0003804
6255 Ga0500624_000316
6256 Ga0500624_001547
6257 Ga0500627_0034808
6258 Ga0500627_0041302
6259 Ga0500630_000954
6260 Ga0500638_000921
6261 Ga0500638_032968
6262 Ga0500639_000016
6263 Ga0500636_0000142
6264 Ga0500636_0000262
6265 Ga0500636_0005190
6266 Ga0500636_0007135
6267 Ga0500636_0012297
6268 Ga0500637_0000652
6269 Ga0500637_0002374
6270 Ga0500637_0080535
6271 Ga0500611_019458
6272 Ga0500625_013688
6273 Ga0500645_000629
6274 Ga0500599_000991
6275 Ga0501084_0006359
6276 Ga0501084_0031091
6277 Ga0501084_0038762
6278 Ga0501084_0056864
6279 Ga0501084_0057730
6280 Ga0501084_0118145
6281 Ga0590075_008941
6282 Ga0501082_0000002
6283 Ga0501082_0007109
6284 Ga0501082_0011831
6285 Ga0501082_0015300
6286 Ga0501082_0015319
6287 Ga0501082_0030845
6288 Ga0501082_0051155
6289 Ga0501082_0098807
6290 Ga0501082_0125631
6291 Ga0501082_0205053
6292 Ga0501082_0259513
6293 Ga0466962_0048349
6294 Ga0466962_0086052
6295 Ga0530510_0006156
6296 Ga0530510_0169227
6297 2503203487
6298 2507508311
6299 2508542377
6300 2508691868
6301 2508726764
6302 2509074599
6303 2509079242
6304 2509115904
6305 2509141632
6306 2509151616
6307 2509373691
6308 2509397904
6309 2510306343
6310 2510316485
6311 2511169516
6312 2511249113
6313 2511384206
6314 2511390901
6315 2511394985
6316 2511501630
6317 2512533069
6318 2512929624
6319 2512964408
6320 2513586278
6321 2513590269
6322 2513608276
6323 2513619836
6324 2513622441
6325 2513640621
6326 2513645548
6327 2513657858
6328 2513674409
6329 2513692857
6330 2513702397
6331 2513718480
6332 2513855558
6333 2513873045
6334 2513884257
6335 2513890205
6336 2513906577
6337 2513920049
6338 2513961393
6339 2514015657
6340 2514036959
6341 2514421419
6342 2514591625
6343 2515608533
6344 2515627187
6345 2516892949
6346 2517102768
6347 2517892103
6348 2521559739
6349 2524437625
6350 2524453579
6351 2524465785
6352 2524534188
6353 2528848579
6354 2537873674
6355 2545678747
6356 2550693059
6357 2551677560
6358 2551686386
6359 2551693908
6360 2551698784
6361 2551710672
6362 2551723972
6363 2551725541
6364 2551745492
6365 2553006225
6366 2554246037
6367 2559296197
6368 2585997866
6369 2586002455
6370 2588515202
6371 2596371787
6372 2597815189
6373 2599604649
6374 2599939925
6375 2601612930
6376 2601748476
6377 2603856742
6378 2617347092
6379 2617375487
6380 2643758463
6381 2643774116
6382 2643774780
6383 2643775630
6384 2643793224
6385 2643794077
6386 2643810984
6387 2643826423
6388 2643838617
6389 2643867307
6390 2643989032
6391 2643990224
6392 2644132734
6393 2644152217
6394 2644288982
6395 2644295717
6396 2644329043
6397 2644522977
6398 2644532690
6399 2644730220
6400 2644737840
6401 2644746359
6402 2671121859
6403 2688600318
6404 2694632487
6405 2694639782
6406 2723577604
6407 2723844776
6408 2723878907
6409 2728751093
6410 2738945191
6411 2739306647
6412 2745079558
6413 2756673119
6414 2765570997
6415 2770194974
6416 2774871734
6417 2776257767
6418 2776272231
6419 2776284171
6420 2792750848
6421 2793062692
6422 2793068812
6423 2793079880
6424 2805915056
6425 2808984834
6426 2808988418
6427 2809128240
6428 2809147861
6429 2818238595
6430 2819559483
6431 2819595472
6432 2819616036
6433 2819721663
6434 2824602457
6435 2824610428
6436 2824618005
6437 2824626673
6438 2824636692
6439 2824648995
6440 2824657380
6441 2824661466
6442 2824674912
6443 2824687526
6444 2824691337
6445 2824699483
6446 2824709725
6447 2824719283
6448 2824729674
6449 2824733351
6450 2824746522
6451 2824754255
6452 2824768992
6453 2824775350
6454 2828306613
6455 2835315656
6456 2837652503
6457 2837679652
6458 2838123448
6459 2838679709
6460 2838717521
6461 2838724278
6462 2838729405
6463 2839099311
6464 2839994547
6465 2840765069
6466 2841734624
6467 2841766304
6468 2841850833
6469 2841861732
6470 2841912323
6471 2841919908
6472 2841947779
6473 2841949550
6474 2841964145
6475 2841971943
6476 2841974714
6477 2841983728
6478 2842040088
6479 2842046967
6480 2842129638
6481 2842134782
6482 2842156700
6483 2842172958
6484 2842180318
6485 2842192022
6486 2842216338
6487 2842229058
6488 2842340302
6489 2842518002
6490 2842873757
6491 2844005570
6492 2844015631
6493 2844106070
6494 2844319321
6495 2847672006
6496 2847688231
6497 2847936500
6498 2847946846
6499 2849079051
6500 2851186576
6501 2851246426
6502 2852620728
6503 2854901643
6504 2854917580
6505 2855734680
6506 2855770270
6507 2855825739
6508 2855841111
6509 2856318262
6510 2856324229
6511 2856328612
6512 2856338472
6513 2856345613
6514 2856356132
6515 2856364842
6516 2857354898
6517 2857369063
6518 2857516699
6519 2857528220
6520 2857578469
6521 2857580800
6522 2858801644
6523 2869165479
6524 2869246574
6525 2869261664
6526 2869264631
6527 2869277311
6528 2869281773
6529 2869289709
6530 2871431775
6531 2871450055
6532 2871465749
6533 2871469060
6534 2871477876
6535 2871486445
6536 2871494113
6537 2871497536
6538 2874105529
6539 2874115012
6540 2874117406
6541 2874127743
6542 2874136450
6543 2874140559
6544 2874155453
6545 2874162310
6546 2874166579
6547 2874175262
6548 2874598323
6549 2874605503
6550 2874619472
6551 2874627526
6552 2874632154
6553 2874652621
6554 2876366814
6555 2876379268
6556 2876387085
6557 2876398768
6558 2876400604
6559 2876420798
6560 2876426982
6561 2876764853
6562 2876778199
6563 2876813065
6564 2876825932
6565 2878037600
6566 2878737016
6567 2878742342
6568 2878748381
6569 2878756688
6570 2878761754
6571 2878768722
6572 2878776726
6573 2878792244
6574 2879081993
6575 2879089464
6576 2879104570
6577 2879115823
6578 2879135115
6579 2879149800
6580 2881153876
6581 2881157639
6582 2881163000
6583 2881368576
6584 2881414491
6585 2881672623
6586 2881850019
6587 2881853941
6588 2881864153
6589 2881928685
6590 2882457226
6591 2882462030
6592 2882635326
6593 2882919170
6594 2883297215
6595 2883359998
6596 2883580499
6597 2884298632
6598 2884813188
6599 2884815888
6600 2884838724
6601 2884841335
6602 2884855016
6603 2884856209
6604 2885311810
6605 2885316227
6606 2885323888
6607 2885333563
6608 2885341840
6609 2885347393
6610 2885353419
6611 2885369171
6612 2885381704
6613 2885391462
6614 2885410479
6615 2888341490
6616 2888348637
6617 2888350840
6618 2888384375
6619 2888393543
6620 2888424803
6621 2889013186
6622 2889021961
6623 2889039475
6624 2889307077
6625 2889790833
6626 2889915215
6627 2893068661
6628 2894024052
6629 2894242857
6630 2894655100
6631 2894772749
6632 2896156316
6633 2896156865
6634 2899263069
6635 2899275571
6636 2899792820
6637 2899807150
6638 2899848540
6639 2902336954
6640 2902411217
6641 2903452989
6642 2903502383
6643 2903506058
6644 2903513508
6645 2903524681
6646 2903531076
6647 2903542331
6648 2903734262
6649 2903753485
6650 2903777535
6651 2904443374
6652 2904533085
6653 2904578825
6654 2904585638
6655 2904593987
6656 2904603858
6657 2904665300
6658 2904673154
6659 2904694831
6660 2904702225
6661 2904714978
6662 2906311998
6663 2906323736
6664 2906331396
6665 2906367039
6666 2906375078
6667 2906381827
6668 2906389046
6669 2906398145
6670 2906402428
6671 2906408413
6672 2906418299
6673 2906605507
6674 2906617234
6675 2906633609
6676 2906643377
6677 2906645102
6678 2906662492
6679 2908742383
6680 2908760051
6681 2908780453
6682 2913309817
6683 2915992873
6684 2915999499
6685 2916001880
6686 2916012755
6687 2916020580
6688 2916024578
6689 2916032045
6690 2916038975
6691 2916045826
6692 2916052593
6693 2916059432
6694 2916074132
6695 2916078242
6696 2917702558
6697 2919047566
6698 2919075643
6699 2919081902
6700 2919119273
6701 2919122347
6702 2919175698
6703 2921207163
6704 2921215232
6705 2921241308
6706 2921248221
6707 2921262407
6708 2921267786
6709 2921284370
6710 2921294871
6711 2921301871
6712 2922138664
6713 2922153863
6714 2922161253
6715 2922178164
6716 2922183517
6717 2922193471
6718 2922365639
6719 2922374738
6720 2922391253
6721 2922400522
6722 2922430595
6723 2923513511
6724 2924148383
6725 2924154793
6726 2924159802
6727 2924167581
6728 2924177239
6729 2924185042
6730 2924192386
6731 2924198855
6732 2924204328
6733 2924211461
6734 2924216964
6735 2924227957
6736 2924232940
6737 2924725058
6738 2924728117
6739 2924740365
6740 2924742766
6741 2924752564
6742 2924762344
6743 2924764425
6744 2924780142
6745 2924788277
6746 2926759303
6747 2926759916
6748 2926763146
6749 2928128050
6750 2928135570
6751 2928526154
6752 2928963016
6753 2929203587
6754 2929219152
6755 2929525118
6756 2929621811
6757 2929629882
6758 2932788671
6759 2932798086
6760 2932807058
6761 2932817388
6762 2932826157
6763 2932830319
6764 2933011306
6765 2933013631
6766 2933583913
6767 2933596929
6768 2935609204
6769 2935616610
6770 2935631240
6771 2935642060
6772 2935650994
6773 2935659175
6774 2935672556
6775 2935675973
6776 2935685970
6777 2935697785
6778 2935705811
6779 2935714522
6780 2935725141
6781 2935732499
6782 2935741878
6783 2935751935
6784 2935765188
6785 2935771784
6786 2935778777
6787 2935788835
6788 2935795365
6789 2935802808
6790 2935813360
6791 2935822364
6792 2935830227
6793 2935838124
6794 2935847946
6795 2935855234
6796 2935867503
6797 2935875659
6798 2935886814
6799 2935908834
6800 2935919554
6801 2935926592
6802 2935935042
6803 2935943492
6804 2935951930
6805 2935960688
6806 2935968055
6807 2935978681
6808 2935987447
6809 2935996342
6810 2936003625
6811 2936013590
6812 2936022283
6813 2936030729
6814 2936042309
6815 2936048542
6816 2936058756
6817 2937002534
6818 2937007512
6819 2937013804
6820 2937023009
6821 2937027727
6822 2937048454
6823 2937051861
6824 2937063176
6825 2937068830
6826 2937077434
6827 2937098440
6828 2937099260
6829 2937107956
6830 2937117137
6831 2937124114
6832 2937127495
6833 2937818179
6834 2937826954
6835 2937842756
6836 2937846610
6837 2937850675
6838 2937867401
6839 2937882663
6840 2937893451
6841 2937973364
6842 2937985503
6843 2937996186
6844 2938019558
6845 2940557262
6846 2941481212
6847 2941509981
6848 2941518932
6849 2941525380
6850 2941533080
6851 2941539209
6852 2954014948
6853 2957386681
6854 2957393100
6855 2957400341
6856 2957407190
6857 2957412970
6858 2957417042
6859 2957424787
6860 2957434905
6861 2957448592
6862 2957457001
6863 2957462200
6864 2957469066
6865 2957474741
6866 2957481660
6867 2957489343
6868 2957496170
6869 2957503491
6870 2957510892
6871 2958037734
6872 2958047446
6873 2958066117
6874 2958074935
6875 2958089788
6876 2958092993
6877 2958102130
6878 2958116807
6879 2958124573
6880 2958134082
6881 2958142503
6882 2958166656
6883 2958179425
6884 2958183728
6885 2960588613
6886 2960600382
6887 2960608906
6888 2960615253
6889 2960618978
6890 2960628219
6891 2960642780
6892 2960649685
6893 2960658061
6894 2960664428
6895 2960669388
6896 2960680225
6897 2960693598
6898 2961081694
6899 2961120300
6900 2961132217
6901 2961141767
6902 2961165122
6903 2961172978
6904 2961184159
6905 2963649608
6906 2964614299
6907 2964618971
6908 2964627597
6909 2964633524
6910 2964640913
6911 2964647643
6912 2964652204
6913 2964661553
6914 2964667035
6915 2964671667
6916 2964684441
6917 2964689321
6918 2964697377
6919 2964703123
6920 2964709115
6921 2964716881
6922 2964722853
6923 2965019946
6924 2965026233
6925 2965036325
6926 2965046964
6927 2965052141
6928 2965069809
6929 2965112597
6930 2965124132
6931 2967670357
6932 2967676921
6933 2967680823
6934 2967697499
6935 2967713670
6936 2967715356
6937 2967725429
6938 2967741500
6939 2967753151
6940 2967760596
6941 2967766898
6942 2967773081
6943 2967779545
6944 2967998189
6945 2968008841
6946 2968019431
6947 2968084770
6948 2968092234
6949 2968101657
6950 2968116767
6951 2968118512
6952 2968131845
6953 2968143928
6954 2968173523
6955 2970024664
6956 2970038343
6957 2970044998
6958 2970051089
6959 2970059924
6960 2970066658
6961 2970073633
6962 2970079786
6963 2970083761
6964 2970093087
6965 2970101127
6966 2970107126
6967 2970112832
6968 2970120332
6969 2970133788
6970 2970138075
6971 2970152853
6972 2970158037
6973 2970166408
6974 2970176202
6975 2970182309
6976 2970188554
6977 2970192692
6978 2970472752
6979 2970494743
6980 2970505572
6981 2970515872
6982 2970529553
6983 2970533936
6984 2970546342
6985 2970550631
6986 2970556612
6987 2970596377
6988 2977521383
6989 2977528624
6990 2977541557
6991 2977552677
6992 2977563281
6993 2977570972
6994 2977576373
6995 2977586244
6996 2977825868
6997 2977834834
6998 2977851275
6999 2977857798
7000 2977864052
7001 2977870575
7002 2977875000
7003 2977905397
7004 2977919104
7005 2977927636
7006 2977938635
7007 2977946682
7008 2977975238
7009 2977987666
7010 2979091832
7011 2979104333
7012 2979716643
7013 2979748309
7014 2979766074
7015 2979775124
7016 2979796399
7017 2979810293
7018 2984511086
7019 2984522551
7020 2984541855
7021 2987643500
7022 2987651597
7023 2987654979
7024 2987661130
7025 2987672729
7026 2987678369
7027 2990711052
7028 2996313134
7029 2996314660
7030 2996340144
7031 2996348568
7032 2996352129
7033 2996391977
7034 3000142044
7035 3002143081
7036 3003671340
7037 3004171107
7038 3004190180
7039 3004207045
7040 3004214458
7041 3004223561
7042 3004232988
7043 3004240702
7044 3004273369
7045 3004278827
7046 3004339209
7047 3005480505
7048 3005484594
7049 3005510592
7050 3005587768
7051 3005599509
7052 3005715180
7053 3005722567
7054 637079368
7055 641646688
7056 643600776
7057 643604311
7058 648740734
7059 649874780
7060 650842594
7061 8002287989
7062 8002393351
7063 8003993595
7064 8004304733
7065 8004318609
7066 8004378276
7067 8004391587
7068 8004448495
7069 8004633813
7070 8004641406
7071 8004699986
7072 8004710689
7073 8004716956
7074 8004731799
7075 8006931970
7076 8006940272
7077 8006967028
7078 8006980050
7079 8006987982
7080 8006995712
7081 8016521985
7082 8016529343
7083 8016534558
7084 8016547776
7085 8016562729
7086 8016572900
7087 8016577059
7088 8016593164
7089 8016600511
7090 8016610234
7091 8016614698
7092 8016626293
7093 8016640029
7094 8017063680
7095 8019534321
7096 8019553384
7097 8019556254
7098 8019569057
7099 8019590806
7100 8019618005
7101 8019628482
7102 8019634154
7103 8019645576
7104 8019658821
7105 8019662031
7106 8019671556
7107 8054465417
7108 8054560915
7109 8054610865
7110 8055622879
7111 8055746023
7112 8055911221
7113 8056677654
7114 8056688320
7115 8056695694
7116 8056877614
7117 8056968297
7118 8057531344

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22691

Thiolase_C_1

Thiolase C-terminal domain-like

279

423

0.95

PF00109

ketoacyl-synt

Beta-ketoacyl synthase, N-terminal domain

107

162

0.92

PF02803

Thiolase_C

Thiolase, C-terminal domain

278

417

0.86

PF00108

Thiolase_N

Thiolase, N-terminal domain

39

263

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4bi9-assembly2.cif.gz_C crystal structure of wild-type scp2 thiolase from trypanosoma brucei. 0.9121 1 342
6esq-assembly1.cif.gz_C structure of the acetoacetyl-coa thiolase/hmg-coa synthase complex from methanothermococcus thermolithotrophicus soaked with acetyl-coa 0.91 2 342
6et9-assembly1.cif.gz_C structure of the acetoacetyl-coa-thiolase/hmg-coa-synthase complex from methanothermococcus thermolithotrophicus at 2.75 a 0.9089 2 342
3zbg-assembly1.cif.gz_B crystal structure of wild-type scp2 thiolase from leishmania mexicana at 1.85 a 0.9085 2 342
3zbl-assembly1.cif.gz_B crystal structure of scp2 thiolase from leishmania mexicana: the c123s mutant. 0.908 1 342
ID Description Score Start End Superfamily
af_Q58944_3_392_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9089 3 342 3.40.47.10
af_A4I0C0_12_441_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9088 2 342 3.40.47.10
af_A4I0C0_12_441_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.8939 2 342 3.40.47.10
af_I6XWJ8_3_408_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.8916 1 342 3.40.47.10
af_Q58944_3_392_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.8911 3 342 3.40.47.10
ID Description Score Start End GO Terms
AF-A0A435D576-F1-model_v4 Thiolase domain-containing protein 0.9896 65 256 GO:0016747
AF-A0A528AKN5-F1-model_v4 Thiolase domain-containing protein 0.9889 1 231 GO:0016747
AF-A0A529K1P4-F1-model_v4 Thiolase domain-containing protein 0.9887 94 295 GO:0016746
AF-A0A3S1Z625-F1-model_v4 deleted 0.9871 27 232
AF-A0A5R2MUF1-F1-model_v4 Thiolase domain-containing protein 0.9865 9 106 GO:0016747

Map