F497344

General Info

Members Datasets Scaffolds Average Seq Length
3574 1082 3310 93

Family's Representative Sequence

Representative Sequence 3300035089|Ga0373944_0095413|Ga0373944_0095413_13_336
Length 107
Sequence MSRSVWKGPFVDGYLLKKAEAARSLGRHDVIKIWSRRSTILPQFVGLTFGVYNGHKHIPVLVTEEMVGHKFGEFSLTRTFHGHSSDRKAKRAPGASGAAPAPAAKPS

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501050 Microvirga lupini Lut6 Isolate Nodule
5 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
6 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
7 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
8 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
9 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
10 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
11 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
12 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
13 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
14 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
15 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
16 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
17 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
18 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
19 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
20 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
21 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
22 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
23 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
24 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
25 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
26 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
27 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
28 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
29 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
30 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
31 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
32 2643221651 Afipia sp. Root123D2 Isolate Unclassified
33 2643221733 Bosea sp. Root381 Isolate Unclassified
34 2643221734 Bosea sp. Root670 Isolate Unclassified
35 2643221736 Bosea sp. Root483D1 Isolate Unclassified
36 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
37 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
38 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
39 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
40 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
41 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
42 2773857925 Microvirga vignae BR3299 Isolate Unclassified
43 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
44 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
45 2791355199
46 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
47 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
48 2818991467 Bosea vestrisii 3192 Isolate Unclassified
49 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
50 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
51 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
52 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
53 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
54 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
55 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
56 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
57 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
58 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
59 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
60 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
61 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
62 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
63 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
64 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
65 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
66 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
67 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
68 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
69 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
70 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
71 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
72 2841760612 Bosea sp. Tri-49 Isolate Nodule
73 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
74 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
75 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
76 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
77 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
78 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
79 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
80 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
81 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
82 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
83 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
84 2844104063 Bosea sp. Tri-39 Isolate Nodule
85 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
86 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
87 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
88 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
89 2851182111 Bosea sp. Tri-44 Isolate Nodule
90 2851246043 Bosea sp. Tri-54 Isolate Nodule
91 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
92 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
93 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
94 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
95 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
96 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
97 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
98 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
99 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
100 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
101 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
102 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
103 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
104 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
105 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
106 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
107 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
108 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
109 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
110 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
111 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
112 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
113 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
114 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
115 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
116 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
117 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
118 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
119 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
120 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
121 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
122 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
123 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
124 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
125 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
126 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
127 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
128 2904699407
129 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
130 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
131 2906610324
132 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
133 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
134 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
135 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
136 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
137 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
138 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
139 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
140 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
141 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
142 2922368715
143 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
144 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
145 2922425934
146 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
147 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
148 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
149 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
150 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
151 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
152 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
153 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
154 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
155 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
156 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
157 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
158 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
159 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
160 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
161 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
162 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
163 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
164 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
165 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
166 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
167 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
168 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
169 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
170 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
171 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
172 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
173 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
174 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
175 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
176 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
177 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
178 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
179 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
180 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
181 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
182 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
183 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
184 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
185 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
186 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
187 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
188 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
189 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
190 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
191 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
192 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
193 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
194 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
195 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
196 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
197 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
198 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
199 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
200 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
201 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
202 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
203 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
204 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
205 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
206 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
207 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
208 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
209 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
210 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
211 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
212 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
213 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
214 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
215 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
216 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
217 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
218 3300000531 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled Metagenome Rhizosphere
219 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
220 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
221 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
222 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
223 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
224 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
225 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
226 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
227 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
228 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
229 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
230 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
231 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
232 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
233 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
234 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
235 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
236 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
237 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
238 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
239 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
240 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
241 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
242 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
243 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
244 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
245 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
246 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
247 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
248 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
249 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
250 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
251 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
252 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
253 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
254 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
255 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
256 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
257 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
258 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
259 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
260 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
261 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
262 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
263 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
264 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
265 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
266 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
267 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
268 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
269 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
270 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
271 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
272 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
273 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
274 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
275 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
276 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
277 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
278 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
279 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
280 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
281 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
282 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
283 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
284 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
285 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
286 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
287 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
288 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
289 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
290 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
291 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
292 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
293 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
294 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
295 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
296 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
297 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
298 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
299 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
300 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
301 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
302 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
303 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
304 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
305 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
306 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
307 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
308 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
309 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
310 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
311 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
312 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
313 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
314 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
315 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
316 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
317 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
318 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
319 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
320 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
321 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
322 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
323 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
324 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
325 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
326 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
327 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
328 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
329 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
330 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
331 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
332 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
333 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
334 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
335 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
336 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
337 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
338 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
339 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
340 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
341 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
342 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
343 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
344 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
345 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
346 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
347 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
348 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
349 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
350 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
351 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
352 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
353 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
354 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
355 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
356 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
357 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
358 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
359 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
360 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
361 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
362 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
363 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
364 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
365 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
366 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
367 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
368 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
369 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
370 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
371 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
372 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
373 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
374 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
375 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
376 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
377 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
378 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
379 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
380 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
381 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
382 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
383 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
384 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
385 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
386 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
387 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
388 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
389 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
390 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
391 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
392 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
393 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
394 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
395 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
396 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
397 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
398 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
399 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
400 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
401 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
402 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
403 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
404 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
405 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
406 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
407 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
408 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
409 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
410 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
411 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
412 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
413 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
414 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
415 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
416 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
417 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
418 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
419 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
420 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
421 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
422 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
423 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
424 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
425 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
426 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
427 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
428 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
429 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
430 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
431 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
432 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
433 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
434 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
435 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
436 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
437 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
438 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
439 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
440 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
441 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
442 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
443 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
444 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
445 3300023563 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
446 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
447 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
448 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
449 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
450 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
451 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
452 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
453 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
454 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
455 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
456 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
457 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
458 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
459 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
460 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
461 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
462 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
463 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
464 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
465 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
466 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
467 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
468 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
469 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
470 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
471 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
472 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
473 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
474 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
475 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
476 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
477 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
478 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
479 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
480 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
481 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
482 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
483 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
484 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
485 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
486 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
487 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
488 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
489 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
490 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
491 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
492 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
493 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
494 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
495 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
496 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
497 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
498 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
499 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
500 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
501 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
502 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
503 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
504 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
505 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
506 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
507 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
508 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
509 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
510 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
511 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
512 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
513 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
514 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
515 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
516 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
517 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
518 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
519 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
520 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
521 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
522 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
523 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
524 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
525 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
526 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
527 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
528 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
529 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
530 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
531 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
532 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
533 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
534 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
535 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
536 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
537 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
538 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
539 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
540 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
541 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
542 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
543 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
544 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
545 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
546 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
547 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
548 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
549 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
550 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
551 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
552 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
553 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
554 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
555 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
556 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
557 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
558 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
559 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
560 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
561 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
562 3300029285 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 Metatranscriptome Rhizosphere
563 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
564 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
565 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
566 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
567 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
568 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
569 3300030882 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
570 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
571 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
572 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
573 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
574 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
575 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
576 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
577 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
578 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
579 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
580 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
581 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
582 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
583 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
584 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
585 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
586 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
587 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
588 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
589 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
590 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
591 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
592 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
593 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
594 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
595 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
596 3300031810 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Unclassified
597 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
598 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
599 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
600 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
601 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
602 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
603 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
604 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
605 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
606 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
607 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
608 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
609 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
610 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
611 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
612 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
613 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
614 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
615 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
616 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
617 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
618 3300033546 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 Metagenome Unclassified
619 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
620 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
621 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
622 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
623 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
624 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
625 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
626 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
627 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
628 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
629 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
630 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
631 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
632 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
633 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
634 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
635 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
636 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
637 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
638 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
639 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
640 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
641 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
642 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
643 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
644 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
645 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
646 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
647 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
648 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
649 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
650 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
651 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
652 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
653 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
654 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
655 3300036242 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
656 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
657 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
658 3300036458 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
659 3300036534 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
660 3300036535 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU6 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
661 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
662 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
663 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
664 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
665 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
666 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
667 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
668 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
669 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
670 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
671 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
672 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
673 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
674 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
675 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
676 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
677 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
678 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
679 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
680 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
681 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
682 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
683 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
684 3300041444 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT Metatranscriptome Rhizoplane
685 3300041446 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT Metatranscriptome Rhizoplane
686 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
687 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
688 3300041455 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaT Metatranscriptome Rhizoplane
689 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
690 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
691 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
692 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
693 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
694 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
695 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
696 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
697 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
698 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
699 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
700 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
701 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
702 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
703 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
704 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
705 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
706 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
707 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
708 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
709 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
710 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
711 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
712 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
713 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
714 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
715 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
716 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
717 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
718 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
719 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
720 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
721 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
722 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
723 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
724 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
725 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
726 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
727 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
728 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
729 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
730 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
731 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
732 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
733 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
734 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
735 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
736 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
737 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
738 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
739 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
740 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
741 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
742 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
743 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
744 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
745 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
746 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
747 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
748 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
749 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
750 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
751 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
752 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
753 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
754 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
755 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
756 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
757 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
758 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
759 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
760 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
761 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
762 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
763 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
764 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
765 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
766 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
767 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
768 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
769 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
770 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
771 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
772 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
773 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
774 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
775 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
776 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
777 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
778 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
779 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
780 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
781 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
782 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
783 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
784 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
785 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
786 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
787 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
788 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
789 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
790 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
791 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
792 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
793 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
794 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
795 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
796 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
797 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
798 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
799 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
800 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
801 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
802 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
803 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
804 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
805 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
806 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
807 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
808 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
809 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
810 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
811 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
812 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
813 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
814 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
815 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
816 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
817 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
818 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
819 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
820 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
821 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
822 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
823 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
824 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
825 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
826 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
827 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
828 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
829 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
830 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
831 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
832 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
833 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
834 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
835 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
836 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
837 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
838 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
839 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
840 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
841 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
842 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
843 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
844 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
845 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
846 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
847 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
848 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
849 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
850 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
851 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
852 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
853 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
854 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
855 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
856 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
857 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
858 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
859 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
860 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
861 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
862 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
863 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
864 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
865 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
866 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
867 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
868 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
869 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
870 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
871 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
872 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
873 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
874 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
875 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
876 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
877 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
878 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
879 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
880 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
881 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
882 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
883 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
884 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
885 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
886 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
887 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
888 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
889 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
890 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
891 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
892 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
893 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
894 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
895 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
896 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
897 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
898 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
899 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
900 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
901 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
902 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
903 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
904 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
905 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
906 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
907 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
908 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
909 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
910 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
911 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
912 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
913 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
914 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
915 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
916 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
917 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
918 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
919 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
920 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
921 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
922 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
923 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
924 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
925 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
926 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
927 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
928 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
929 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
930 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
931 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
932 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
933 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
934 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
935 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
936 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
937 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
938 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
939 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
940 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
941 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
942 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
943 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
944 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
945 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
946 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
947 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
948 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
949 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
950 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
951 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
952 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
953 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
954 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
955 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
956 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
957 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
958 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
959 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
960 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
961 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
962 3300053112 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 endosphere Metagenome Endosphere
963 3300053114 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere Metagenome Endosphere
964 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
965 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
966 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
967 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
968 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
969 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
970 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
971 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
972 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
973 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
974 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
975 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
976 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
977 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
978 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
979 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
980 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
981 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
982 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
983 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
984 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
985 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
986 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
987 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
988 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
989 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
990 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
991 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
992 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
993 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
994 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
995 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
996 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
997 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
998 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
999 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
1000 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
1001 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
1002 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
1003 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
1004 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
1005 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
1006 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
1007 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
1008 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
1009 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
1010 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
1011 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
1012 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
1013 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
1014 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
1015 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
1016 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
1017 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
1018 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
1019 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1020 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1021 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1022 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1023 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1024 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1025 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1026 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1027 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1028 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1029 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1030 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1031 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1032 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1033 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1034 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
1035 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
1036 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
1037 641522639 Methylobacterium sp. 4-46 Isolate Nodule
1038 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
1039 8002060224 Methylocystis sp. Sn-Cys Isolate Unclassified
1040 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
1041 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
1042 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
1043 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
1044 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
1045 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
1046 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
1047 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
1048 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
1049 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
1050 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
1051 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
1052 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
1053 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
1054 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
1055 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
1056 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
1057 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
1058 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
1059 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
1060 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
1061 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
1062 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
1063 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
1064 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
1065 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
1066 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
1067 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
1068 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
1069 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
1070 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
1071 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
1072 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
1073 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
1074 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
1075 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
1076 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
1077 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
1078 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
1079 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
1080 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule
1081 8057132660 Paracoccus rhizosphaerae LMG 21293 Isolate Rhizosphere
1082 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 90.39
Metatranscriptomes 2.38
Isolates 7.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.04
Nodule 5.48
Rhizoplane 5.4
Rhizosphere 70.06
Stem 0
Stem Tuber 0
Unclassified 9.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNBas_1000198 3300000531 Bacteria 2230
2 CNAas_1000763 3300000532 Bacteria 3069
3 CNXas_1013658 3300000545 Bacteria 581
4 LJNas_1007153 3300000546 Bacteria 1206
5 LJQas_1002516 3300000549 Bacteria 2539
6 JGI24736J21556_1015172 3300001904 Bacteria 1236
7 JGI24736J21556_1060949 3300001904 Bacteria 583
8 JGI24741J21665_1029516 3300001915 Bacteria 825
9 JGI24752J21851_1060219 3300001976 Bacteria 523
10 JGI24752J21851_1066629 3300001976 Bacteria 502
11 JGI24740J21852_10003752 3300001979 Bacteria 6614
12 JGI24740J21852_10040096 3300001979 Bacteria 1423
13 JGI24740J21852_10059197 3300001979 Bacteria 1062
14 JGI24740J21852_10159078 3300001979 Bacteria 560
15 JGI24739J22299_10010687 3300001989 Bacteria 3404
16 JGI24739J22299_10083041 3300001989 Bacteria 982
17 JGI24739J22299_10210856 3300001989 Bacteria 569
18 JGI24737J22298_10002998 3300001990 Bacteria 5985
19 JGI24737J22298_10015196 3300001990 Bacteria 2493
20 JGI24737J22298_10039795 3300001990 Bacteria 1444
21 JGI24743J22301_10055961 3300001991 Bacteria 808
22 JGI24743J22301_10088746 3300001991 Bacteria 658
23 JGI24735J21928_10036819 3300002067 Bacteria 1435
24 JGI24735J21928_10071289 3300002067 Bacteria 995
25 JGI24735J21928_10080656 3300002067 Bacteria 932
26 JGI24750J21931_1003618 3300002070 Bacteria 1856
27 JGI24745J21846_1007638 3300002073 Bacteria 1211
28 JGI24748J21848_1009620 3300002074 Bacteria 1138
29 JGI24738J21930_10008836 3300002075 Bacteria 2283
30 JGI24738J21930_10045902 3300002075 Bacteria 889
31 JGI24738J21930_10107237 3300002075 Bacteria 600
32 JGI24749J21850_1006751 3300002076 Bacteria 1596
33 JGI24749J21850_1045662 3300002076 Bacteria 647
34 JGI24744J21845_10016250 3300002077 Bacteria 1482
35 JGI24033J26618_1010324 3300002155 Bacteria 1099
36 JGI24034J26672_10003374 3300002239 Bacteria 2227
37 JGI24034J26672_10008215 3300002239 Bacteria 1523
38 JGI24034J26672_10085257 3300002239 Bacteria 581
39 JGI24742J22300_10001461 3300002244 Bacteria 3725
40 JGI25151J46595_10000038 3300003187 Bacteria 180430
41 JGI25406J46586_10002015 3300003203 Bacteria 9596
42 JGI25406J46586_10037973 3300003203 Bacteria 1730
43 JGI25406J46586_10126597 3300003203 Bacteria 750
44 JGI25165J46597_1007977 3300003214 Bacteria 1703
45 JGI25165J46597_1010113 3300003214 Bacteria 1387
46 JGI25153J46596_10001601 3300003215 Bacteria 13411
47 Ga0006770J48903_1084366 3300003305 Bacteria 579
48 JGI25160J50197_1015787 3300003354 Bacteria 2463
49 JGI25407J50210_10144840 3300003373 Bacteria 585
50 Ga0007410J51695_1089125 3300003574 Bacteria 587
51 Ga0007410J51695_1104424 3300003574 Bacteria 508
52 Ga0006562J51391_1028159 3300003578 Bacteria 1292
53 JGI25404J52841_10000285 3300003659 Bacteria 6540
54 JGI25404J52841_10018143 3300003659 Bacteria 1524
55 JGI25404J52841_10026754 3300003659 Bacteria 1241
56 JGI25404J52841_10039088 3300003659 Bacteria 1005
57 Ga0055539_1034370 3300003752 Bacteria 564
58 Ga0055539_1036865 3300003752 Bacteria 537
59 Ga0055525_1005236 3300003759 Bacteria 1102
60 Ga0055526_1040475 3300003771 Bacteria 1174
61 Ga0055526_1058946 3300003771 Bacteria 828
62 Ga0055526_1059001 3300003771 Bacteria 828
63 Ga0055524_1034854 3300003775 Bacteria 1383
64 Ga0055524_1043404 3300003775 Bacteria 1106
65 Ga0055524_1073859 3300003775 Bacteria 646
66 Ga0055536_1070838 3300003781 Bacteria 688
67 Ga0055528_1049333 3300003790 Bacteria 863
68 Ga0055531_10017791 3300003794 Bacteria 2976
69 JGI25405J52794_10006513 3300003911 Bacteria 2134
70 JGI25405J52794_10016220 3300003911 Bacteria 1470
71 Ga0058863_11944502 3300004799 Bacteria 669
72 Ga0058862_12836675 3300004803 Bacteria 568
73 Ga0065165_1000631 3300005262 Bacteria 51108
74 Ga0065165_1037117 3300005262 Bacteria 1480
75 Ga0065165_1042482 3300005262 Bacteria 1341
76 Ga0065165_1048930 3300005262 Bacteria 1211
77 Ga0065704_10043305 3300005289 Bacteria 972
78 Ga0065712_10166356 3300005290 Bacteria 1258
79 Ga0065712_10494040 3300005290 Bacteria 654
80 Ga0065715_10210058 3300005293 Bacteria 1309
81 Ga0065707_10032468 3300005295 Bacteria 1171
82 Ga0070658_10003484 3300005327 Bacteria 12924
83 Ga0070658_10018691 3300005327 Bacteria 5551
84 Ga0070658_10059824 3300005327 Bacteria 3102
85 Ga0070658_10141482 3300005327 Bacteria 2010
86 Ga0070658_10149675 3300005327 Bacteria 1954
87 Ga0070658_10377135 3300005327 Bacteria 1216
88 Ga0070658_10449241 3300005327 Bacteria 1110
89 Ga0070658_10554365 3300005327 Bacteria 995
90 Ga0070658_10929140 3300005327 Bacteria 756
91 Ga0070658_11721721 3300005327 Bacteria 542
92 Ga0070676_10091040 3300005328 Bacteria 1868
93 Ga0070676_10795038 3300005328 Bacteria 698
94 Ga0070676_11479585 3300005328 Bacteria 522
95 Ga0070683_100048217 3300005329 Bacteria 3938
96 Ga0070683_100109825 3300005329 Bacteria 2601
97 Ga0070683_100162727 3300005329 Bacteria 2117
98 Ga0070683_100315096 3300005329 Bacteria 1489
99 Ga0070683_100428820 3300005329 Bacteria 1261
100 Ga0070683_100851129 3300005329 Bacteria 874
101 Ga0070683_102329977 3300005329 Bacteria 513
102 Ga0070690_100344106 3300005330 Bacteria 1081
103 Ga0070690_100490346 3300005330 Bacteria 917
104 Ga0070690_100617413 3300005330 Bacteria 825
105 Ga0070690_100639155 3300005330 Bacteria 811
106 Ga0070690_100850454 3300005330 Bacteria 711
107 Ga0070670_100384152 3300005331 Bacteria 1237
108 Ga0070670_100418983 3300005331 Bacteria 1184
109 Ga0070677_10087420 3300005333 Bacteria 1348
110 Ga0070677_10448297 3300005333 Bacteria 690
111 Ga0070677_10579788 3300005333 Bacteria 618
112 Ga0068869_100337079 3300005334 Bacteria 1226
113 Ga0068869_101608402 3300005334 Bacteria 579
114 Ga0070666_10187494 3300005335 Bacteria 1452
115 Ga0070666_10425810 3300005335 Bacteria 956
116 Ga0070666_11232056 3300005335 Bacteria 558
117 Ga0070666_11305010 3300005335 Bacteria 541
118 Ga0070666_11415347 3300005335 Bacteria 519
119 Ga0070680_100013921 3300005336 Bacteria 6276
120 Ga0070680_100052990 3300005336 Bacteria 3311
121 Ga0070680_100098147 3300005336 Bacteria 2429
122 Ga0070680_100111384 3300005336 Bacteria 2278
123 Ga0070680_100544621 3300005336 Bacteria 994
124 Ga0070680_100870914 3300005336 Bacteria 777
125 Ga0070680_100941596 3300005336 Bacteria 745
126 Ga0070680_101314560 3300005336 Bacteria 626
127 Ga0070680_101714104 3300005336 Bacteria 545
128 Ga0070682_100221310 3300005337 Bacteria 1347
129 Ga0070682_100590212 3300005337 Bacteria 875
130 Ga0070682_100882137 3300005337 Bacteria 733
131 Ga0068868_100089546 3300005338 Bacteria 2477
132 Ga0068868_100335413 3300005338 Bacteria 1292
133 Ga0068868_101482100 3300005338 Bacteria 635
134 Ga0068868_101866344 3300005338 Bacteria 569
135 Ga0068868_101930181 3300005338 Bacteria 560
136 Ga0070660_100020152 3300005339 Bacteria 4897
137 Ga0070660_100043206 3300005339 Bacteria 3443
138 Ga0070660_100379061 3300005339 Bacteria 1167
139 Ga0070660_100828844 3300005339 Bacteria 779
140 Ga0070660_100905969 3300005339 Bacteria 744
141 Ga0070660_100965125 3300005339 Bacteria 720
142 Ga0070660_101060444 3300005339 Bacteria 685
143 Ga0070660_101781534 3300005339 Bacteria 524
144 Ga0070689_101005573 3300005340 Bacteria 742
145 Ga0070689_101055203 3300005340 Bacteria 725
146 Ga0070689_101743560 3300005340 Bacteria 567
147 Ga0070689_102073726 3300005340 Bacteria 520
148 Ga0070691_10050230 3300005341 Bacteria 1989
149 Ga0070691_10112188 3300005341 Bacteria 1365
150 Ga0070691_10194944 3300005341 Bacteria 1061
151 Ga0070691_10412336 3300005341 Bacteria 763
152 Ga0070691_11022946 3300005341 Bacteria 517
153 Ga0070687_100606939 3300005343 Bacteria 752
154 Ga0070687_101056434 3300005343 Bacteria 591
155 Ga0070687_101542990 3300005343 Bacteria 500
156 Ga0070661_100273191 3300005344 Bacteria 1309
157 Ga0070661_100617823 3300005344 Bacteria 877
158 Ga0070661_100851251 3300005344 Bacteria 750
159 Ga0070661_101388297 3300005344 Bacteria 591
160 Ga0070692_10315344 3300005345 Bacteria 959
161 Ga0070692_11402456 3300005345 Bacteria 504
162 Ga0070668_100288942 3300005347 Bacteria 1372
163 Ga0070668_100446810 3300005347 Bacteria 1111
164 Ga0070668_100989015 3300005347 Bacteria 756
165 Ga0070668_101285038 3300005347 Bacteria 665
166 Ga0070669_100254933 3300005353 Bacteria 1398
167 Ga0070669_100508770 3300005353 Bacteria 1000
168 Ga0070669_101804504 3300005353 Bacteria 534
169 Ga0070675_100138918 3300005354 Bacteria 2075
170 Ga0070675_100745428 3300005354 Bacteria 893
171 Ga0070675_101617184 3300005354 Bacteria 598
172 Ga0070675_101660687 3300005354 Bacteria 589
173 Ga0070675_102079071 3300005354 Bacteria 523
174 Ga0070671_100247662 3300005355 Bacteria 1513
175 Ga0070674_100212363 3300005356 Bacteria 1501
176 Ga0070674_100305102 3300005356 Bacteria 1270
177 Ga0070674_100873442 3300005356 Bacteria 782
178 Ga0070674_101347732 3300005356 Bacteria 637
179 Ga0070674_101485949 3300005356 Bacteria 609
180 Ga0070674_101517589 3300005356 Bacteria 602
181 Ga0070673_100149123 3300005364 Bacteria 1979
182 Ga0070673_100257319 3300005364 Bacteria 1524
183 Ga0070673_100545820 3300005364 Bacteria 1052
184 Ga0070673_100559426 3300005364 Bacteria 1040
185 Ga0070673_101005202 3300005364 Bacteria 777
186 Ga0070673_101579545 3300005364 Bacteria 619
187 Ga0070688_100204268 3300005365 Bacteria 1384
188 Ga0070688_100219192 3300005365 Bacteria 1340
189 Ga0070688_100412907 3300005365 Bacteria 1002
190 Ga0070688_100438104 3300005365 Bacteria 974
191 Ga0070688_101148087 3300005365 Bacteria 622
192 Ga0070688_101653647 3300005365 Bacteria 523
193 Ga0070659_100077071 3300005366 Bacteria 2658
194 Ga0070659_100173078 3300005366 Bacteria 1769
195 Ga0070659_100279605 3300005366 Bacteria 1388
196 Ga0070659_100405512 3300005366 Bacteria 1151
197 Ga0070659_101176116 3300005366 Bacteria 678
198 Ga0070659_101205016 3300005366 Bacteria 670
199 Ga0070659_101938453 3300005366 Bacteria 528
200 Ga0070667_100582091 3300005367 Bacteria 1030
201 Ga0070667_100649895 3300005367 Bacteria 974
202 Ga0070667_101502818 3300005367 Bacteria 632
203 Ga0070703_10006956 3300005406 Bacteria 3171
204 Ga0070703_10290824 3300005406 Bacteria 677
205 Ga0070709_10020478 3300005434 Bacteria 3837
206 Ga0070709_10022452 3300005434 Bacteria 3691
207 Ga0070709_10147752 3300005434 Bacteria 1621
208 Ga0070709_10425917 3300005434 Bacteria 995
209 Ga0070709_10641184 3300005434 Bacteria 821
210 Ga0070709_10974319 3300005434 Bacteria 674
211 Ga0070709_11089290 3300005434 Bacteria 638
212 Ga0070709_11319130 3300005434 Bacteria 582
213 Ga0070709_11594002 3300005434 Bacteria 531
214 Ga0070714_100026711 3300005435 Bacteria 4773
215 Ga0070714_100101173 3300005435 Bacteria 2539
216 Ga0070714_100164548 3300005435 Bacteria 2009
217 Ga0070714_100241439 3300005435 Bacteria 1667
218 Ga0070714_100400871 3300005435 Bacteria 1296
219 Ga0070714_100420033 3300005435 Bacteria 1267
220 Ga0070714_100648189 3300005435 Bacteria 1016
221 Ga0070714_100733224 3300005435 Bacteria 954
222 Ga0070714_100841621 3300005435 Bacteria 889
223 Ga0070714_100972381 3300005435 Bacteria 825
224 Ga0070714_101294377 3300005435 Bacteria 711
225 Ga0070714_101791224 3300005435 Bacteria 599
226 Ga0070714_101997586 3300005435 Bacteria 566
227 Ga0070714_102180766 3300005435 Bacteria 539
228 Ga0070714_102433937 3300005435 Bacteria 508
229 Ga0070713_100017903 3300005436 Bacteria 5375
230 Ga0070713_100036694 3300005436 Bacteria 3957
231 Ga0070713_100061311 3300005436 Bacteria 3146
232 Ga0070713_100102071 3300005436 Bacteria 2486
233 Ga0070713_100224386 3300005436 Bacteria 1706
234 Ga0070713_100237764 3300005436 Bacteria 1658
235 Ga0070713_100522757 3300005436 Bacteria 1121
236 Ga0070713_100590365 3300005436 Bacteria 1054
237 Ga0070713_100768387 3300005436 Bacteria 922
238 Ga0070713_100828385 3300005436 Bacteria 888
239 Ga0070713_100866824 3300005436 Bacteria 867
240 Ga0070713_101340900 3300005436 Bacteria 693
241 Ga0070713_102101011 3300005436 Bacteria 548
242 Ga0070710_10003270 3300005437 Bacteria 7682
243 Ga0070710_10005644 3300005437 Bacteria 5958
244 Ga0070710_10330465 3300005437 Bacteria 1003
245 Ga0070710_10487690 3300005437 Bacteria 841
246 Ga0070710_10615390 3300005437 Bacteria 757
247 Ga0070710_10771296 3300005437 Bacteria 684
248 Ga0070710_10916640 3300005437 Bacteria 633
249 Ga0070710_11133496 3300005437 Bacteria 575
250 Ga0070710_11327786 3300005437 Bacteria 536
251 Ga0070701_10430256 3300005438 Bacteria 843
252 Ga0070701_10757285 3300005438 Bacteria 658
253 Ga0070711_100004304 3300005439 Bacteria 8381
254 Ga0070711_100007497 3300005439 Bacteria 6640
255 Ga0070711_100016474 3300005439 Bacteria 4695
256 Ga0070711_100125941 3300005439 Bacteria 1901
257 Ga0070711_100144950 3300005439 Bacteria 1785
258 Ga0070711_100275314 3300005439 Bacteria 1330
259 Ga0070711_100297247 3300005439 Bacteria 1283
260 Ga0070711_100352833 3300005439 Bacteria 1183
261 Ga0070711_100414190 3300005439 Bacteria 1096
262 Ga0070711_100556072 3300005439 Bacteria 952
263 Ga0070711_100671284 3300005439 Bacteria 870
264 Ga0070711_101606653 3300005439 Bacteria 568
265 Ga0070711_102049765 3300005439 Bacteria 503
266 Ga0070705_101684137 3300005440 Bacteria 535
267 Ga0070700_100460691 3300005441 Bacteria 969
268 Ga0070694_101053568 3300005444 Bacteria 677
269 Ga0070694_101057506 3300005444 Bacteria 676
270 Ga0070694_101212620 3300005444 Bacteria 633
271 Ga0070708_100364714 3300005445 Bacteria 1361
272 Ga0070708_100625766 3300005445 Bacteria 1015
273 Ga0070663_100039409 3300005455 Bacteria 3301
274 Ga0070663_100193928 3300005455 Bacteria 1582
275 Ga0070663_100258561 3300005455 Bacteria 1380
276 Ga0070663_100486555 3300005455 Bacteria 1022
277 Ga0070663_101013197 3300005455 Bacteria 722
278 Ga0070663_101300299 3300005455 Bacteria 641
279 Ga0070663_101507321 3300005455 Bacteria 598
280 Ga0070663_101660539 3300005455 Bacteria 571
281 Ga0070663_101755910 3300005455 Bacteria 555
282 Ga0070663_101901435 3300005455 Bacteria 534
283 Ga0070663_102062086 3300005455 Bacteria 514
284 Ga0070678_100956144 3300005456 Bacteria 785
285 Ga0070678_101117904 3300005456 Bacteria 728
286 Ga0070678_101414841 3300005456 Bacteria 649
287 Ga0070662_100290526 3300005457 Bacteria 1325
288 Ga0070662_100302194 3300005457 Bacteria 1300
289 Ga0070662_100325146 3300005457 Bacteria 1255
290 Ga0070662_101017813 3300005457 Bacteria 709
291 Ga0070662_101407304 3300005457 Bacteria 601
292 Ga0070681_10029025 3300005458 Bacteria 5554
293 Ga0070681_10066848 3300005458 Bacteria 3563
294 Ga0070681_10118265 3300005458 Bacteria 2587
295 Ga0070681_10298378 3300005458 Bacteria 1521
296 Ga0070681_10406142 3300005458 Bacteria 1274
297 Ga0070681_10584946 3300005458 Bacteria 1030
298 Ga0070681_10717886 3300005458 Bacteria 915
299 Ga0070681_11181589 3300005458 Bacteria 687
300 Ga0068867_100382502 3300005459 Bacteria 1182
301 Ga0068867_101849110 3300005459 Bacteria 569
302 Ga0068867_102056228 3300005459 Bacteria 540
303 Ga0068867_102096808 3300005459 Bacteria 535
304 Ga0068867_102398290 3300005459 Bacteria 502
305 Ga0070685_10102663 3300005466 Bacteria 1748
306 Ga0070685_10650820 3300005466 Bacteria 763
307 Ga0070685_11006176 3300005466 Bacteria 626
308 Ga0070685_11214007 3300005466 Bacteria 573
309 Ga0070706_100134455 3300005467 Bacteria 2308
310 Ga0070706_100373318 3300005467 Bacteria 1329
311 Ga0070706_100638524 3300005467 Bacteria 988
312 Ga0070707_100158651 3300005468 Bacteria 2203
313 Ga0070707_100465880 3300005468 Bacteria 1225
314 Ga0070707_100531073 3300005468 Bacteria 1138
315 Ga0070707_100612267 3300005468 Bacteria 1052
316 Ga0070707_102134018 3300005468 Bacteria 528
317 Ga0070698_100118731 3300005471 Bacteria 2605
318 Ga0070698_100255878 3300005471 Bacteria 1683
319 Ga0070698_100430065 3300005471 Bacteria 1255
320 Ga0070698_101115145 3300005471 Bacteria 738
321 Ga0070699_100100989 3300005518 Bacteria 2528
322 Ga0070699_100368541 3300005518 Bacteria 1295
323 Ga0070679_100181575 3300005530 Bacteria 2076
324 Ga0070679_100301005 3300005530 Bacteria 1554
325 Ga0070679_100363121 3300005530 Bacteria 1395
326 Ga0070679_100421250 3300005530 Bacteria 1280
327 Ga0070679_100441297 3300005530 Bacteria 1246
328 Ga0070679_100442289 3300005530 Bacteria 1245
329 Ga0070679_100577763 3300005530 Bacteria 1067
330 Ga0070679_100582472 3300005530 Bacteria 1062
331 Ga0070679_100843424 3300005530 Bacteria 859
332 Ga0070679_101287858 3300005530 Bacteria 676
333 Ga0070679_101489590 3300005530 Bacteria 623
334 Ga0070684_100047080 3300005535 Bacteria 3737
335 Ga0070684_100457840 3300005535 Bacteria 1179
336 Ga0070684_100537056 3300005535 Bacteria 1084
337 Ga0070684_100707206 3300005535 Bacteria 939
338 Ga0070697_100077313 3300005536 Bacteria 2737
339 Ga0070697_100361137 3300005536 Bacteria 1255
340 Ga0070697_100577948 3300005536 Bacteria 987
341 Ga0070697_100609805 3300005536 Bacteria 960
342 Ga0070697_101226796 3300005536 Bacteria 668
343 Ga0068853_100099810 3300005539 Bacteria 2565
344 Ga0068853_100104886 3300005539 Bacteria 2503
345 Ga0068853_100114848 3300005539 Bacteria 2395
346 Ga0068853_100269466 3300005539 Bacteria 1567
347 Ga0068853_100655263 3300005539 Bacteria 999
348 Ga0070672_100293767 3300005543 Bacteria 1376
349 Ga0070672_100321003 3300005543 Bacteria 1316
350 Ga0070672_101256174 3300005543 Bacteria 660
351 Ga0070672_101502371 3300005543 Bacteria 603
352 Ga0070686_100378097 3300005544 Bacteria 1071
353 Ga0070686_100583651 3300005544 Bacteria 878
354 Ga0070695_100349851 3300005545 Bacteria 1107
355 Ga0070695_100851830 3300005545 Bacteria 733
356 Ga0070695_101125064 3300005545 Bacteria 643
357 Ga0070696_100085600 3300005546 Bacteria 2237
358 Ga0070696_100457166 3300005546 Bacteria 1008
359 Ga0070696_101629540 3300005546 Bacteria 555
360 Ga0070693_100069735 3300005547 Bacteria 2067
361 Ga0070693_100386757 3300005547 Bacteria 966
362 Ga0070693_100683740 3300005547 Bacteria 749
363 Ga0070693_100863099 3300005547 Bacteria 675
364 Ga0070665_100051080 3300005548 Bacteria 4148
365 Ga0070665_100522604 3300005548 Bacteria 1198
366 Ga0070665_100752502 3300005548 Bacteria 987
367 Ga0070665_100816497 3300005548 Bacteria 945
368 Ga0070665_100865640 3300005548 Bacteria 917
369 Ga0070665_102280687 3300005548 Bacteria 544
370 Ga0068855_100076631 3300005563 Bacteria 3880
371 Ga0068855_100351951 3300005563 Bacteria 1622
372 Ga0068855_100360625 3300005563 Bacteria 1599
373 Ga0068855_100364157 3300005563 Bacteria 1590
374 Ga0068855_100370886 3300005563 Bacteria 1573
375 Ga0068855_100455472 3300005563 Bacteria 1395
376 Ga0068855_100473801 3300005563 Bacteria 1363
377 Ga0068855_100767943 3300005563 Bacteria 1026
378 Ga0068855_100850852 3300005563 Bacteria 966
379 Ga0068855_101074344 3300005563 Bacteria 842
380 Ga0068855_101156176 3300005563 Bacteria 807
381 Ga0068855_101981109 3300005563 Bacteria 589
382 Ga0070664_100545637 3300005564 Bacteria 1072
383 Ga0070664_101008838 3300005564 Bacteria 782
384 Ga0070664_101018818 3300005564 Bacteria 778
385 Ga0070664_101544171 3300005564 Bacteria 628
386 Ga0068857_100268149 3300005577 Bacteria 1568
387 Ga0068857_100332988 3300005577 Bacteria 1403
388 Ga0068857_100337708 3300005577 Bacteria 1393
389 Ga0068857_100368967 3300005577 Bacteria 1331
390 Ga0068857_100679097 3300005577 Bacteria 977
391 Ga0068857_100761770 3300005577 Bacteria 922
392 Ga0068857_100887492 3300005577 Bacteria 854
393 Ga0068857_100955337 3300005577 Bacteria 823
394 Ga0068854_100203561 3300005578 Bacteria 1557
395 Ga0068854_100221518 3300005578 Bacteria 1497
396 Ga0068854_100234384 3300005578 Bacteria 1458
397 Ga0068854_100658593 3300005578 Bacteria 900
398 Ga0068854_101714491 3300005578 Bacteria 575
399 Ga0068854_101737477 3300005578 Bacteria 571
400 Ga0068854_102051326 3300005578 Bacteria 527
401 Ga0068854_102100530 3300005578 Bacteria 522
402 Ga0068856_100105907 3300005614 Bacteria 2806
403 Ga0068856_100106131 3300005614 Bacteria 2803
404 Ga0068856_100267768 3300005614 Bacteria 1724
405 Ga0068856_100480094 3300005614 Bacteria 1264
406 Ga0068856_100738474 3300005614 Bacteria 1004
407 Ga0068856_100878170 3300005614 Bacteria 916
408 Ga0068856_101323161 3300005614 Bacteria 736
409 Ga0068856_101977115 3300005614 Bacteria 593
410 Ga0068856_102336193 3300005614 Bacteria 542
411 Ga0070702_100391127 3300005615 Bacteria 992
412 Ga0070702_100740858 3300005615 Bacteria 753
413 Ga0070702_101493945 3300005615 Bacteria 555
414 Ga0068852_100022852 3300005616 Bacteria 5023
415 Ga0068852_100087957 3300005616 Bacteria 2773
416 Ga0068852_100363298 3300005616 Bacteria 1416
417 Ga0068852_101486830 3300005616 Bacteria 700
418 Ga0068852_101503762 3300005616 Bacteria 696
419 Ga0068852_101858687 3300005616 Bacteria 624
420 Ga0068859_100395497 3300005617 Bacteria 1478
421 Ga0068859_100830027 3300005617 Bacteria 1011
422 Ga0068859_101830182 3300005617 Bacteria 670
423 Ga0068864_100172362 3300005618 Bacteria 1974
424 Ga0068864_100473189 3300005618 Bacteria 1201
425 Ga0068864_100557120 3300005618 Bacteria 1109
426 Ga0068864_101817577 3300005618 Bacteria 615
427 Ga0068864_101940998 3300005618 Bacteria 595
428 Ga0068864_102418529 3300005618 Bacteria 531
429 Ga0068864_102636192 3300005618 Bacteria 508
430 Ga0068866_10427550 3300005718 Bacteria 860
431 Ga0068861_100197839 3300005719 Bacteria 1685
432 Ga0068861_100691853 3300005719 Bacteria 946
433 Ga0068861_100873425 3300005719 Bacteria 850
434 Ga0068861_101713882 3300005719 Bacteria 622
435 Ga0068851_10459785 3300005834 Bacteria 757
436 Ga0068851_10964493 3300005834 Bacteria 536
437 Ga0068870_10398977 3300005840 Bacteria 894
438 Ga0068870_10709802 3300005840 Bacteria 695
439 Ga0068870_11264272 3300005840 Bacteria 536
440 Ga0068863_100207871 3300005841 Bacteria 1884
441 Ga0068863_100946167 3300005841 Bacteria 863
442 Ga0068863_101843046 3300005841 Bacteria 615
443 Ga0068863_101861992 3300005841 Bacteria 611
444 Ga0068863_101915782 3300005841 Bacteria 603
445 Ga0068863_102115140 3300005841 Bacteria 573
446 Ga0068863_102207428 3300005841 Bacteria 560
447 Ga0068858_100181351 3300005842 Bacteria 1988
448 Ga0068858_100462293 3300005842 Bacteria 1224
449 Ga0068858_101661761 3300005842 Bacteria 630
450 Ga0068858_102072205 3300005842 Bacteria 562
451 Ga0068858_102205873 3300005842 Bacteria 544
452 Ga0068860_101737981 3300005843 Bacteria 646
453 Ga0068860_101780449 3300005843 Bacteria 638
454 Ga0068862_100796424 3300005844 Bacteria 923
455 Ga0081455_10004023 3300005937 Bacteria 16663
456 Ga0081455_10011724 3300005937 Bacteria 8787
457 Ga0081455_10069834 3300005937 Bacteria 2919
458 Ga0081455_10079097 3300005937 Bacteria 2701
459 Ga0081455_10390825 3300005937 Bacteria 969
460 Ga0081455_10514767 3300005937 Bacteria 800
461 Ga0081455_10559034 3300005937 Bacteria 755
462 Ga0081538_10006855 3300005981 Bacteria 9922
463 Ga0081538_10054870 3300005981 Bacteria 2351
464 Ga0081538_10091122 3300005981 Bacteria 1575
465 Ga0081538_10190369 3300005981 Bacteria 862
466 Ga0081540_1001166 3300005983 Bacteria 23099
467 Ga0081540_1012152 3300005983 Bacteria 5694
468 Ga0081540_1017063 3300005983 Bacteria 4513
469 Ga0081540_1035895 3300005983 Bacteria 2652
470 Ga0081540_1037580 3300005983 Bacteria 2564
471 Ga0081540_1231656 3300005983 Bacteria 652
472 Ga0081540_1349658 3300005983 Bacteria 506
473 Ga0081539_10000273 3300005985 Bacteria 117936
474 Ga0081539_10004794 3300005985 Bacteria 14563
475 Ga0081539_10032744 3300005985 Bacteria 3179
476 Ga0081539_10054324 3300005985 Bacteria 2237
477 Ga0070717_10027908 3300006028 Bacteria 4513
478 Ga0070717_10050273 3300006028 Bacteria 3425
479 Ga0070717_10309544 3300006028 Bacteria 1405
480 Ga0070717_10620990 3300006028 Bacteria 981
481 Ga0070717_10851838 3300006028 Bacteria 829
482 Ga0070717_10891657 3300006028 Bacteria 810
483 Ga0070717_10982916 3300006028 Bacteria 768
484 Ga0070717_11030346 3300006028 Bacteria 750
485 Ga0070717_11042971 3300006028 Bacteria 745
486 Ga0070717_11187140 3300006028 Bacteria 695
487 Ga0070717_11313344 3300006028 Bacteria 657
488 Ga0070717_11377307 3300006028 Bacteria 641
489 Ga0075365_10006087 3300006038 Bacteria 6591
490 Ga0075365_10128269 3300006038 Bacteria 1754
491 Ga0075365_10157292 3300006038 Bacteria 1582
492 Ga0075365_10277246 3300006038 Bacteria 1179
493 Ga0075365_10334533 3300006038 Bacteria 1067
494 Ga0075365_10430995 3300006038 Bacteria 931
495 Ga0075365_10730261 3300006038 Bacteria 699
496 Ga0075365_10928407 3300006038 Bacteria 613
497 Ga0075368_10182165 3300006042 Bacteria 885
498 Ga0075368_10193480 3300006042 Bacteria 859
499 Ga0075363_100064107 3300006048 Bacteria 1985
500 Ga0075363_100083702 3300006048 Bacteria 1748
501 Ga0075363_100232956 3300006048 Bacteria 1058
502 Ga0075363_100239693 3300006048 Bacteria 1042
503 Ga0075363_100487883 3300006048 Bacteria 731
504 Ga0075363_100939918 3300006048 Bacteria 531
505 Ga0075364_10019516 3300006051 Bacteria 4256
506 Ga0075364_10057357 3300006051 Bacteria 2551
507 Ga0075364_10742176 3300006051 Bacteria 670
508 Ga0075432_10121495 3300006058 Bacteria 981
509 Ga0070715_10082849 3300006163 Bacteria 1460
510 Ga0070715_10245927 3300006163 Bacteria 932
511 Ga0070715_10370713 3300006163 Bacteria 787
512 Ga0070715_10648913 3300006163 Bacteria 624
513 Ga0070715_10703806 3300006163 Bacteria 604
514 Ga0070715_10916185 3300006163 Bacteria 541
515 Ga0070716_100030514 3300006173 Bacteria 2925
516 Ga0070716_100150188 3300006173 Bacteria 1497
517 Ga0070716_100278294 3300006173 Bacteria 1153
518 Ga0070716_100501290 3300006173 Bacteria 895
519 Ga0070716_100633369 3300006173 Bacteria 809
520 Ga0070716_100696576 3300006173 Bacteria 776
521 Ga0070716_101014974 3300006173 Bacteria 657
522 Ga0070716_101021992 3300006173 Bacteria 655
523 Ga0070716_101074139 3300006173 Bacteria 640
524 Ga0070716_101177735 3300006173 Bacteria 614
525 Ga0070712_100037138 3300006175 Bacteria 3319
526 Ga0070712_100058938 3300006175 Bacteria 2702
527 Ga0070712_100092798 3300006175 Bacteria 2215
528 Ga0070712_100319323 3300006175 Bacteria 1262
529 Ga0070712_100385614 3300006175 Bacteria 1154
530 Ga0070712_100449310 3300006175 Bacteria 1073
531 Ga0070712_100775527 3300006175 Bacteria 821
532 Ga0070712_101005710 3300006175 Bacteria 722
533 Ga0070712_101078864 3300006175 Bacteria 696
534 Ga0070712_101624795 3300006175 Bacteria 565
535 Ga0075362_10109178 3300006177 Bacteria 1301
536 Ga0075362_10160772 3300006177 Bacteria 1081
537 Ga0075362_10276119 3300006177 Bacteria 830
538 Ga0075362_10628678 3300006177 Bacteria 556
539 Ga0075367_10313958 3300006178 Bacteria 987
540 Ga0075369_10085829 3300006186 Bacteria 1400
541 Ga0075369_10231421 3300006186 Bacteria 856
542 Ga0075369_10261604 3300006186 Bacteria 804
543 Ga0075369_10265409 3300006186 Bacteria 798
544 Ga0075369_10337159 3300006186 Bacteria 706
545 Ga0075427_10025326 3300006194 Bacteria 957
546 Ga0075366_10244133 3300006195 Bacteria 1095
547 Ga0075366_10568269 3300006195 Bacteria 702
548 Ga0075366_10813025 3300006195 Bacteria 581
549 Ga0097621_100400613 3300006237 Bacteria 1228
550 Ga0097621_100544857 3300006237 Bacteria 1055
551 Ga0075370_10031552 3300006353 Bacteria 2958
552 Ga0075370_10032069 3300006353 Bacteria 2935
553 Ga0075370_10207200 3300006353 Bacteria 1157
554 Ga0075370_10222117 3300006353 Bacteria 1117
555 Ga0075370_10255603 3300006353 Bacteria 1039
556 Ga0075370_10350196 3300006353 Bacteria 882
557 Ga0068871_100687347 3300006358 Bacteria 936
558 Ga0068871_101186708 3300006358 Bacteria 716
559 Ga0068871_101373614 3300006358 Bacteria 665
560 Ga0075428_100089056 3300006844 Bacteria 3366
561 Ga0075428_100089192 3300006844 Bacteria 3363
562 Ga0075428_100102636 3300006844 Bacteria 3118
563 Ga0075428_100397384 3300006844 Bacteria 1477
564 Ga0075430_100607453 3300006846 Bacteria 902
565 Ga0075430_100733403 3300006846 Bacteria 815
566 Ga0075430_100998212 3300006846 Bacteria 690
567 Ga0075431_101662886 3300006847 Bacteria 596
568 Ga0075433_10736599 3300006852 Bacteria 862
569 Ga0075434_100218638 3300006871 Bacteria 1925
570 Ga0075434_100264185 3300006871 Bacteria 1740
571 Ga0075434_100297025 3300006871 Bacteria 1635
572 Ga0075434_100394211 3300006871 Bacteria 1405
573 Ga0075434_101023729 3300006871 Bacteria 840
574 Ga0075434_101223768 3300006871 Bacteria 763
575 Ga0075434_102176875 3300006871 Bacteria 558
576 Ga0075434_102617616 3300006871 Bacteria 505
577 Ga0075429_100597932 3300006880 Bacteria 966
578 Ga0075429_100993338 3300006880 Bacteria 734
579 Ga0075429_101262149 3300006880 Bacteria 644
580 Ga0075429_101868567 3300006880 Bacteria 521
581 Ga0068865_100209012 3300006881 Bacteria 1519
582 Ga0068865_101384654 3300006881 Bacteria 627
583 Ga0075436_100018259 3300006914 Bacteria 4804
584 Ga0075436_100051091 3300006914 Bacteria 2853
585 Ga0075436_100122460 3300006914 Bacteria 1821
586 Ga0075436_100461810 3300006914 Bacteria 925
587 Ga0075436_100866344 3300006914 Bacteria 675
588 Ga0075436_101387133 3300006914 Bacteria 532
589 Ga0075436_101479239 3300006914 Bacteria 516
590 Ga0097620_100395504 3300006931 Bacteria 1478
591 Ga0097620_100830110 3300006931 Bacteria 1011
592 Ga0097620_101830185 3300006931 Bacteria 670
593 Ga0099825_1066225 3300006941 Bacteria 567
594 Ga0099824_1024882 3300006942 Bacteria 3398
595 Ga0099822_1017947 3300006943 Bacteria 7462
596 Ga0099822_1083415 3300006943 Bacteria 764
597 Ga0099826_10356490 3300006948 Bacteria 726
598 Ga0075435_100034006 3300007076 Bacteria 4035
599 Ga0075435_100344735 3300007076 Bacteria 1276
600 Ga0075435_100532358 3300007076 Bacteria 1017
601 Ga0075435_100768183 3300007076 Bacteria 839
602 Ga0075435_101328972 3300007076 Bacteria 630
603 Ga0075435_101501048 3300007076 Bacteria 591
604 Ga0075435_101706021 3300007076 Bacteria 553
605 Ga0099794_10005440 3300007265 Bacteria 5102
606 Ga0099794_10049367 3300007265 Bacteria 2022
607 Ga0099794_10300161 3300007265 Bacteria 832
608 Ga0099795_10002818 3300007788 Bacteria 4190
609 Ga0099795_10003077 3300007788 Bacteria 4071
610 Ga0099795_10067973 3300007788 Bacteria 1338
611 Ga0099795_10170243 3300007788 Bacteria 904
612 Ga0105244_10267186 3300009036 Bacteria 795
613 Ga0105250_10219143 3300009092 Bacteria 806
614 Ga0105250_10548239 3300009092 Bacteria 530
615 Ga0105240_10011051 3300009093 Bacteria 12622
616 Ga0105240_10041079 3300009093 Bacteria 5908
617 Ga0105240_10118848 3300009093 Bacteria 3185
618 Ga0105240_11465356 3300009093 Bacteria 716
619 Ga0105240_11974093 3300009093 Bacteria 607
620 Ga0105240_12610699 3300009093 Bacteria 522
621 Ga0105240_12629094 3300009093 Bacteria 520
622 Ga0111539_10105552 3300009094 Bacteria 3305
623 Ga0111539_10239084 3300009094 Bacteria 2114
624 Ga0111539_10543981 3300009094 Bacteria 1353
625 Ga0111539_10774838 3300009094 Bacteria 1116
626 Ga0111539_12044957 3300009094 Bacteria 664
627 Ga0111539_12919405 3300009094 Bacteria 553
628 Ga0105245_10350693 3300009098 Bacteria 1462
629 Ga0105245_10535605 3300009098 Bacteria 1191
630 Ga0105245_10828522 3300009098 Bacteria 964
631 Ga0105245_10849781 3300009098 Bacteria 953
632 Ga0105245_11383220 3300009098 Bacteria 754
633 Ga0105245_11438723 3300009098 Bacteria 740
634 Ga0105247_10035209 3300009101 Bacteria 3051
635 Ga0105247_10814556 3300009101 Bacteria 714
636 Ga0105247_11061418 3300009101 Bacteria 636
637 Ga0105247_11310239 3300009101 Bacteria 582
638 Ga0105247_11739614 3300009101 Bacteria 517
639 Ga0114129_10039201 3300009147 Bacteria 6680
640 Ga0114129_11019792 3300009147 Bacteria 1041
641 Ga0114129_11347340 3300009147 Bacteria 883
642 Ga0114129_11702836 3300009147 Bacteria 769
643 Ga0114129_11734890 3300009147 Bacteria 761
644 Ga0114129_12651848 3300009147 Bacteria 598
645 Ga0114129_13275682 3300009147 Bacteria 524
646 Ga0105243_10937754 3300009148 Bacteria 864
647 Ga0105243_11600575 3300009148 Bacteria 678
648 Ga0105241_10048962 3300009174 Bacteria 3217
649 Ga0105241_10431482 3300009174 Bacteria 1162
650 Ga0105241_10930479 3300009174 Bacteria 809
651 Ga0105241_11005640 3300009174 Bacteria 780
652 Ga0105241_11034154 3300009174 Bacteria 770
653 Ga0105242_10650071 3300009176 Bacteria 1025
654 Ga0105242_11011700 3300009176 Bacteria 840
655 Ga0105242_11817705 3300009176 Bacteria 648
656 Ga0105242_13124273 3300009176 Bacteria 513
657 Ga0105248_10821853 3300009177 Bacteria 1049
658 Ga0105248_12130616 3300009177 Bacteria 638
659 Ga0105248_12961344 3300009177 Bacteria 541
660 Ga0105237_10027530 3300009545 Bacteria 5801
661 Ga0105237_10246271 3300009545 Bacteria 1789
662 Ga0105237_10577316 3300009545 Bacteria 1131
663 Ga0105237_10933905 3300009545 Bacteria 874
664 Ga0105237_11051421 3300009545 Bacteria 821
665 Ga0105237_12269892 3300009545 Bacteria 552
666 Ga0105237_12355974 3300009545 Bacteria 542
667 Ga0105237_12417367 3300009545 Bacteria 536
668 Ga0105237_12512161 3300009545 Bacteria 526
669 Ga0105238_10110641 3300009551 Bacteria 2727
670 Ga0105238_10199951 3300009551 Bacteria 1974
671 Ga0105238_10285175 3300009551 Bacteria 1633
672 Ga0105238_10715878 3300009551 Bacteria 1013
673 Ga0105238_11062363 3300009551 Bacteria 832
674 Ga0105238_11186187 3300009551 Bacteria 788
675 Ga0105238_11270595 3300009551 Bacteria 762
676 Ga0105238_11352016 3300009551 Bacteria 739
677 Ga0105238_11546761 3300009551 Bacteria 693
678 Ga0105238_11894624 3300009551 Bacteria 629
679 Ga0105238_12284795 3300009551 Bacteria 576
680 Ga0105238_12967591 3300009551 Bacteria 510
681 Ga0105249_10119920 3300009553 Bacteria 2498
682 Ga0105249_11183669 3300009553 Bacteria 835
683 Ga0105249_11281180 3300009553 Bacteria 804
684 Ga0105249_11313983 3300009553 Bacteria 795
685 Ga0105249_12521290 3300009553 Bacteria 587
686 Ga0105249_12722510 3300009553 Bacteria 566
687 Ga0099796_10001539 3300010159 Bacteria 4696
688 Ga0099796_10002673 3300010159 Bacteria 3972
689 Ga0105239_10057391 3300010375 Bacteria 4270
690 Ga0105239_10082555 3300010375 Bacteria 3539
691 Ga0105239_10496319 3300010375 Bacteria 1388
692 Ga0105239_10938775 3300010375 Bacteria 993
693 Ga0105239_11994127 3300010375 Bacteria 674
694 Ga0105246_10264501 3300011119 Bacteria 1372
695 Ga0105246_10568219 3300011119 Bacteria 975
696 Ga0105246_12473444 3300011119 Bacteria 511
697 Ga0157317_1002820 3300012475 Bacteria 1049
698 Ga0157318_1007907 3300012482 Bacteria 735
699 Ga0157337_1003712 3300012483 Bacteria 941
700 Ga0157322_1001880 3300012490 Bacteria 1115
701 Ga0157329_1004972 3300012491 Bacteria 882
702 Ga0157323_1010716 3300012495 Bacteria 726
703 Ga0157323_1019059 3300012495 Bacteria 635
704 Ga0157345_1029760 3300012498 Bacteria 606
705 Ga0157313_1004056 3300012503 Bacteria 983
706 Ga0157339_1029754 3300012505 Bacteria 632
707 Ga0157324_1004804 3300012506 Bacteria 951
708 Ga0157342_1004227 3300012507 Bacteria 1265
709 Ga0157315_1004045 3300012508 Bacteria 1027
710 Ga0157316_1002522 3300012510 Bacteria 1249
711 Ga0157326_1018515 3300012513 Bacteria 842
712 Ga0157326_1092758 3300012513 Bacteria 511
713 Ga0157338_1004748 3300012515 Bacteria 1191
714 Ga0157338_1055070 3300012515 Bacteria 582
715 Ga0157373_10211942 3300013100 Bacteria 1366
716 Ga0157373_11503650 3300013100 Bacteria 514
717 Ga0157371_10247211 3300013102 Bacteria 1284
718 Ga0157371_11057567 3300013102 Bacteria 621
719 Ga0157371_11178437 3300013102 Bacteria 590
720 Ga0157370_10011636 3300013104 Bacteria 9184
721 Ga0157370_10188789 3300013104 Bacteria 1913
722 Ga0157370_10238859 3300013104 Bacteria 1681
723 Ga0157370_10410968 3300013104 Bacteria 1245
724 Ga0157370_10808302 3300013104 Bacteria 853
725 Ga0157370_11311886 3300013104 Bacteria 652
726 Ga0157370_11412938 3300013104 Bacteria 626
727 Ga0157370_11550298 3300013104 Bacteria 595
728 Ga0157370_11651225 3300013104 Bacteria 575
729 Ga0157370_11992654 3300013104 Bacteria 521
730 Ga0157369_10195577 3300013105 Bacteria 2124
731 Ga0157369_10500252 3300013105 Bacteria 1257
732 Ga0157369_10847295 3300013105 Bacteria 938
733 Ga0157369_11218747 3300013105 Bacteria 768
734 Ga0157369_11452762 3300013105 Bacteria 698
735 Ga0157369_11474745 3300013105 Bacteria 692
736 Ga0157369_11678955 3300013105 Bacteria 646
737 Ga0157369_12437235 3300013105 Bacteria 530
738 Ga0157369_12525952 3300013105 Bacteria 520
739 Ga0157369_12568694 3300013105 Bacteria 515
740 Ga0171462_1042 3300013250 Bacteria 66199
741 Ga0157374_10708208 3300013296 Bacteria 1020
742 Ga0157374_12710742 3300013296 Bacteria 523
743 Ga0157378_10148406 3300013297 Bacteria 2183
744 Ga0157378_10221436 3300013297 Bacteria 1799
745 Ga0157378_10426956 3300013297 Bacteria 1311
746 Ga0157378_10708695 3300013297 Bacteria 1026
747 Ga0163162_10235761 3300013306 Bacteria 1960
748 Ga0163162_10254865 3300013306 Bacteria 1886
749 Ga0163162_10466387 3300013306 Bacteria 1394
750 Ga0163162_10771430 3300013306 Bacteria 1080
751 Ga0163162_11758524 3300013306 Bacteria 708
752 Ga0163162_11958592 3300013306 Bacteria 671
753 Ga0157372_10568760 3300013307 Bacteria 1321
754 Ga0157372_10647322 3300013307 Bacteria 1231
755 Ga0157372_10830741 3300013307 Bacteria 1073
756 Ga0157372_10907769 3300013307 Bacteria 1022
757 Ga0157372_11345547 3300013307 Bacteria 824
758 Ga0157372_11768184 3300013307 Bacteria 711
759 Ga0157372_13314507 3300013307 Bacteria 513
760 Ga0157372_13444385 3300013307 Bacteria 503
761 Ga0157375_10726964 3300013308 Bacteria 1145
762 Ga0157375_11886308 3300013308 Bacteria 709
763 Ga0157375_13812275 3300013308 Bacteria 500
764 Ga0163163_10002310 3300014325 Bacteria 16099
765 Ga0163163_10216338 3300014325 Bacteria 1965
766 Ga0163163_10727503 3300014325 Bacteria 1056
767 Ga0163163_10989170 3300014325 Bacteria 904
768 Ga0163163_11928884 3300014325 Bacteria 651
769 Ga0163163_12288030 3300014325 Bacteria 599
770 Ga0163163_12359953 3300014325 Bacteria 590
771 Ga0163163_12462767 3300014325 Bacteria 578
772 Ga0157380_10446116 3300014326 Bacteria 1241
773 Ga0157380_10553956 3300014326 Bacteria 1128
774 Ga0157380_11318008 3300014326 Bacteria 770
775 Ga0157380_11325707 3300014326 Bacteria 768
776 Ga0157380_12406669 3300014326 Bacteria 592
777 Ga0182008_10238096 3300014497 Bacteria 935
778 Ga0182008_10597619 3300014497 Bacteria 619
779 Ga0157377_10226183 3300014745 Bacteria 1200
780 Ga0157377_10429759 3300014745 Bacteria 907
781 Ga0157377_11247563 3300014745 Bacteria 578
782 Ga0157379_10426975 3300014968 Bacteria 1221
783 Ga0157379_10544857 3300014968 Bacteria 1079
784 Ga0157379_10842013 3300014968 Bacteria 867
785 Ga0157376_10824388 3300014969 Bacteria 942
786 Ga0157376_11356395 3300014969 Bacteria 742
787 Ga0157376_12413926 3300014969 Bacteria 565
788 Ga0157376_12416138 3300014969 Bacteria 565
789 Ga0157376_12444065 3300014969 Bacteria 562
790 Ga0182006_1027833 3300015261 Bacteria 2304
791 Ga0182006_1094985 3300015261 Bacteria 1066
792 Ga0182007_10051388 3300015262 Bacteria 1360
793 Ga0182005_1106876 3300015265 Bacteria 788
794 Ga0182005_1130865 3300015265 Bacteria 720
795 Ga0182005_1141844 3300015265 Bacteria 695
796 Ga0163161_10151206 3300017792 Bacteria 1764
797 Ga0163161_10169715 3300017792 Bacteria 1667
798 Ga0163161_10255863 3300017792 Bacteria 1366
799 Ga0163161_11645718 3300017792 Bacteria 567
800 Ga0197907_10503768 3300020069 Bacteria 946
801 Ga0206356_10016837 3300020070 Bacteria 893
802 Ga0206356_11190343 3300020070 Bacteria 1474
803 Ga0206350_11182958 3300020080 Bacteria 1149
804 Ga0206354_10932261 3300020081 Bacteria 803
805 Ga0206354_11369192 3300020081 Bacteria 1070
806 Ga0206353_11000296 3300020082 Bacteria 824
807 Ga0154015_1089295 3300020610 Bacteria 505
808 Ga0154015_1342435 3300020610 Bacteria 558
809 Ga0214544_1000006 3300021320 Bacteria 380728
810 Ga0214542_1000002 3300021321 Bacteria 720798
811 Ga0214545_1000002 3300021324 Bacteria 727485
812 Ga0214543_1000017 3300021327 Bacteria 290109
813 Ga0213873_10008313 3300021358 Bacteria 2115
814 Ga0213873_10011776 3300021358 Bacteria 1881
815 Ga0213873_10271586 3300021358 Bacteria 541
816 Ga0213872_10023323 3300021361 Bacteria 2847
817 Ga0213872_10127793 3300021361 Bacteria 1121
818 Ga0213872_10216963 3300021361 Bacteria 815
819 Ga0213872_10271046 3300021361 Bacteria 710
820 Ga0213872_10287961 3300021361 Bacteria 684
821 Ga0213874_10005223 3300021377 Bacteria 3016
822 Ga0213874_10113224 3300021377 Bacteria 914
823 Ga0213874_10181192 3300021377 Bacteria 749
824 Ga0213874_10227745 3300021377 Bacteria 680
825 Ga0213874_10334713 3300021377 Bacteria 577
826 Ga0213874_10430378 3300021377 Bacteria 518
827 Ga0213876_10002961 3300021384 Bacteria 9840
828 Ga0213876_10008440 3300021384 Bacteria 5577
829 Ga0213876_10037256 3300021384 Bacteria 2566
830 Ga0213876_10114933 3300021384 Bacteria 1428
831 Ga0213876_10132828 3300021384 Bacteria 1323
832 Ga0213876_10142803 3300021384 Bacteria 1273
833 Ga0213876_10272182 3300021384 Bacteria 900
834 Ga0213876_10420148 3300021384 Bacteria 711
835 Ga0213876_10426579 3300021384 Bacteria 705
836 Ga0213875_10029044 3300021388 Bacteria 2622
837 Ga0213875_10158756 3300021388 Bacteria 1061
838 Ga0213875_10197307 3300021388 Bacteria 947
839 Ga0213875_10267557 3300021388 Bacteria 807
840 Ga0213875_10306693 3300021388 Bacteria 751
841 Ga0213875_10344909 3300021388 Bacteria 707
842 Ga0213875_10349705 3300021388 Bacteria 702
843 Ga0213875_10428980 3300021388 Bacteria 632
844 Ga0213875_10446232 3300021388 Bacteria 619
845 Ga0213875_10463123 3300021388 Bacteria 607
846 Ga0213875_10538670 3300021388 Bacteria 562
847 Ga0213871_10016747 3300021441 Bacteria 1771
848 Ga0213871_10042064 3300021441 Bacteria 1230
849 Ga0224712_10014062 3300022467 Bacteria 2565
850 Ga0224712_10277634 3300022467 Bacteria 779
851 Ga0247530_109344 3300023563 Bacteria 793
852 Ga0224572_1066080 3300024225 Bacteria 669
853 Ga0207672_1001920 3300025223 Bacteria 1375
854 Ga0209563_103013 3300025230 Bacteria 3610
855 Ga0207425_1016877 3300025245 Bacteria 1614
856 Ga0209677_100718 3300025253 Bacteria 16865
857 Ga0209677_100816 3300025253 Bacteria 15575
858 Ga0209148_1001736 3300025254 Bacteria 9496
859 Ga0209148_1004162 3300025254 Bacteria 3638
860 Ga0209129_1015811 3300025258 Bacteria 1537
861 Ga0209233_1003250 3300025261 Bacteria 5762
862 Ga0209233_1033139 3300025261 Bacteria 1188
863 Ga0209565_1037742 3300025263 Bacteria 913
864 Ga0207666_1007581 3300025271 Bacteria 1432
865 Ga0209455_1004495 3300025272 Bacteria 4536
866 Ga0209455_1005018 3300025272 Bacteria 4193
867 Ga0209673_1030556 3300025273 Bacteria 1694
868 Ga0209130_1001794 3300025284 Bacteria 12605
869 Ga0207673_1009809 3300025290 Bacteria 1226
870 Ga0209675_1002527 3300025291 Bacteria 9311
871 Ga0209675_1019183 3300025291 Bacteria 1889
872 Ga0209676_1004347 3300025292 Bacteria 7943
873 Ga0209676_1010666 3300025292 Bacteria 3791
874 Ga0209025_1000014 3300025294 Bacteria 865448
875 Ga0209025_1020659 3300025294 Bacteria 3587
876 Ga0209025_1147608 3300025294 Bacteria 655
877 Ga0209025_1196026 3300025294 Bacteria 502
878 Ga0209564_1002872 3300025295 Bacteria 12632
879 Ga0209564_1009622 3300025295 Bacteria 4572
880 Ga0209564_1017841 3300025295 Bacteria 2739
881 Ga0209564_1037651 3300025295 Bacteria 1359
882 Ga0209564_1038147 3300025295 Bacteria 1341
883 Ga0209758_1003798 3300025297 Bacteria 13299
884 Ga0209758_1006193 3300025297 Bacteria 8738
885 Ga0209758_1033717 3300025297 Bacteria 2050
886 Ga0209758_1094541 3300025297 Bacteria 866
887 Ga0209758_1099681 3300025297 Bacteria 829
888 Ga0209256_1000108 3300025299 Bacteria 185884
889 Ga0209256_1000540 3300025299 Bacteria 54759
890 Ga0209256_1012246 3300025299 Bacteria 3314
891 Ga0207426_1036160 3300025302 Bacteria 1572
892 Ga0209051_1123110 3300025303 Bacteria 654
893 Ga0209257_1005510 3300025304 Bacteria 8840
894 Ga0209257_1062890 3300025304 Bacteria 1002
895 Ga0207697_10030873 3300025315 Bacteria 2193
896 Ga0207697_10292706 3300025315 Bacteria 722
897 Ga0207656_10035068 3300025321 Bacteria 2098
898 Ga0207656_10260758 3300025321 Bacteria 851
899 Ga0207696_1047026 3300025711 Bacteria 1244
900 Ga0207653_10002069 3300025885 Bacteria 6392
901 Ga0207682_10030606 3300025893 Bacteria 2156
902 Ga0207682_10293941 3300025893 Bacteria 761
903 Ga0207692_10015483 3300025898 Bacteria 3357
904 Ga0207692_10040299 3300025898 Bacteria 2304
905 Ga0207692_10258100 3300025898 Bacteria 1047
906 Ga0207692_10371926 3300025898 Bacteria 885
907 Ga0207692_10869391 3300025898 Bacteria 592
908 Ga0207692_10994730 3300025898 Bacteria 554
909 Ga0207642_10040615 3300025899 Bacteria 2031
910 Ga0207642_10471282 3300025899 Bacteria 764
911 Ga0207710_10038695 3300025900 Bacteria 2110
912 Ga0207710_10045200 3300025900 Bacteria 1963
913 Ga0207688_10046894 3300025901 Bacteria 2413
914 Ga0207688_10482486 3300025901 Bacteria 775
915 Ga0207680_10135128 3300025903 Bacteria 1629
916 Ga0207680_10189271 3300025903 Bacteria 1396
917 Ga0207680_10374990 3300025903 Bacteria 1002
918 Ga0207647_10020149 3300025904 Bacteria 4476
919 Ga0207647_10067461 3300025904 Bacteria 2168
920 Ga0207647_10124631 3300025904 Bacteria 1517
921 Ga0207647_10377865 3300025904 Bacteria 800
922 Ga0207647_10453463 3300025904 Bacteria 719
923 Ga0207685_10015387 3300025905 Bacteria 2422
924 Ga0207685_10087112 3300025905 Bacteria 1306
925 Ga0207685_10156277 3300025905 Bacteria 1037
926 Ga0207685_10741514 3300025905 Bacteria 537
927 Ga0207685_10770685 3300025905 Bacteria 528
928 Ga0207685_10843291 3300025905 Bacteria 507
929 Ga0207699_10003266 3300025906 Bacteria 7726
930 Ga0207699_10008214 3300025906 Bacteria 5139
931 Ga0207699_10135227 3300025906 Bacteria 1613
932 Ga0207699_10295049 3300025906 Bacteria 1131
933 Ga0207699_10926887 3300025906 Bacteria 643
934 Ga0207699_11096295 3300025906 Bacteria 589
935 Ga0207699_11341024 3300025906 Bacteria 529
936 Ga0207645_10047744 3300025907 Bacteria 2734
937 Ga0207645_10219560 3300025907 Bacteria 1253
938 Ga0207645_10345865 3300025907 Bacteria 995
939 Ga0207645_10506502 3300025907 Bacteria 818
940 Ga0207643_10463471 3300025908 Bacteria 807
941 Ga0207643_10531219 3300025908 Bacteria 754
942 Ga0207705_10034426 3300025909 Bacteria 3621
943 Ga0207705_10075374 3300025909 Bacteria 2450
944 Ga0207705_10118251 3300025909 Bacteria 1964
945 Ga0207705_10124003 3300025909 Bacteria 1919
946 Ga0207705_10226168 3300025909 Bacteria 1422
947 Ga0207705_10384276 3300025909 Bacteria 1084
948 Ga0207684_10163353 3300025910 Bacteria 1918
949 Ga0207684_10308538 3300025910 Bacteria 1364
950 Ga0207684_10323744 3300025910 Bacteria 1328
951 Ga0207654_10003167 3300025911 Bacteria 8310
952 Ga0207654_10725709 3300025911 Bacteria 715
953 Ga0207707_10004335 3300025912 Bacteria 12560
954 Ga0207707_10051244 3300025912 Bacteria 3594
955 Ga0207707_10074687 3300025912 Bacteria 2957
956 Ga0207707_10142531 3300025912 Bacteria 2095
957 Ga0207707_10497665 3300025912 Bacteria 1040
958 Ga0207707_11155891 3300025912 Bacteria 628
959 Ga0207695_10000159 3300025913 Bacteria 201367
960 Ga0207695_10001032 3300025913 Bacteria 48974
961 Ga0207695_10087202 3300025913 Bacteria 3144
962 Ga0207695_10291325 3300025913 Bacteria 1525
963 Ga0207671_10041225 3300025914 Bacteria 3417
964 Ga0207671_10050006 3300025914 Bacteria 3095
965 Ga0207671_10057494 3300025914 Bacteria 2883
966 Ga0207671_10355102 3300025914 Bacteria 1163
967 Ga0207671_10655803 3300025914 Bacteria 836
968 Ga0207671_10967081 3300025914 Bacteria 672
969 Ga0207671_11238668 3300025914 Bacteria 583
970 Ga0207693_10001926 3300025915 Bacteria 18180
971 Ga0207693_10036016 3300025915 Bacteria 3899
972 Ga0207693_10081254 3300025915 Bacteria 2537
973 Ga0207693_10105904 3300025915 Bacteria 2205
974 Ga0207693_10121023 3300025915 Bacteria 2056
975 Ga0207693_10230505 3300025915 Bacteria 1454
976 Ga0207693_10307959 3300025915 Bacteria 1240
977 Ga0207693_10322490 3300025915 Bacteria 1209
978 Ga0207693_10375467 3300025915 Bacteria 1112
979 Ga0207693_11135878 3300025915 Bacteria 592
980 Ga0207693_11442522 3300025915 Bacteria 510
981 Ga0207663_10000218 3300025916 Bacteria 25518
982 Ga0207663_10012076 3300025916 Bacteria 4657
983 Ga0207663_10016157 3300025916 Bacteria 4131
984 Ga0207663_10048478 3300025916 Bacteria 2629
985 Ga0207663_10445669 3300025916 Bacteria 998
986 Ga0207663_10462818 3300025916 Bacteria 980
987 Ga0207663_10892854 3300025916 Bacteria 710
988 Ga0207663_10931050 3300025916 Bacteria 695
989 Ga0207663_11126962 3300025916 Bacteria 631
990 Ga0207663_11256337 3300025916 Bacteria 596
991 Ga0207663_11563215 3300025916 Bacteria 531
992 Ga0207660_10013609 3300025917 Bacteria 5334
993 Ga0207660_10176604 3300025917 Bacteria 1656
994 Ga0207660_10369533 3300025917 Bacteria 1152
995 Ga0207660_10548039 3300025917 Bacteria 940
996 Ga0207660_10603228 3300025917 Bacteria 894
997 Ga0207660_11209971 3300025917 Bacteria 615
998 Ga0207662_10019357 3300025918 Bacteria 3872
999 Ga0207662_10069366 3300025918 Bacteria 2130
1000 Ga0207662_10894376 3300025918 Bacteria 628
1001 Ga0207657_10038564 3300025919 Bacteria 4252
1002 Ga0207657_10056223 3300025919 Bacteria 3396
1003 Ga0207657_10058646 3300025919 Bacteria 3311
1004 Ga0207657_10095387 3300025919 Bacteria 2475
1005 Ga0207657_10216105 3300025919 Bacteria 1537
1006 Ga0207657_10327092 3300025919 Bacteria 1211
1007 Ga0207649_10232337 3300025920 Bacteria 1319
1008 Ga0207649_10336534 3300025920 Bacteria 1113
1009 Ga0207649_10419940 3300025920 Bacteria 1004
1010 Ga0207649_10591165 3300025920 Bacteria 853
1011 Ga0207652_10004826 3300025921 Bacteria 10919
1012 Ga0207652_10105432 3300025921 Bacteria 2494
1013 Ga0207652_10154533 3300025921 Bacteria 2055
1014 Ga0207652_10845134 3300025921 Bacteria 811
1015 Ga0207652_11124063 3300025921 Bacteria 686
1016 Ga0207652_11387169 3300025921 Bacteria 606
1017 Ga0207652_11417270 3300025921 Bacteria 598
1018 Ga0207652_11491797 3300025921 Bacteria 580
1019 Ga0207646_10386794 3300025922 Bacteria 1264
1020 Ga0207646_11061501 3300025922 Bacteria 714
1021 Ga0207646_11406035 3300025922 Bacteria 607
1022 Ga0207681_10434540 3300025923 Bacteria 1065
1023 Ga0207681_10492842 3300025923 Bacteria 1002
1024 Ga0207681_11475891 3300025923 Bacteria 570
1025 Ga0207694_10004393 3300025924 Bacteria 11013
1026 Ga0207694_10011574 3300025924 Bacteria 6656
1027 Ga0207694_10024703 3300025924 Bacteria 4564
1028 Ga0207694_10049466 3300025924 Bacteria 3254
1029 Ga0207694_10204207 3300025924 Bacteria 1608
1030 Ga0207694_10506957 3300025924 Bacteria 1011
1031 Ga0207694_11304374 3300025924 Bacteria 614
1032 Ga0207650_10258569 3300025925 Bacteria 1412
1033 Ga0207650_10274784 3300025925 Bacteria 1370
1034 Ga0207650_11499065 3300025925 Bacteria 573
1035 Ga0207659_10234550 3300025926 Bacteria 1482
1036 Ga0207659_10941610 3300025926 Bacteria 743
1037 Ga0207687_10626044 3300025927 Bacteria 909
1038 Ga0207687_10690692 3300025927 Bacteria 866
1039 Ga0207700_10014261 3300025928 Bacteria 5201
1040 Ga0207700_10027201 3300025928 Bacteria 4001
1041 Ga0207700_10071645 3300025928 Bacteria 2669
1042 Ga0207700_10153882 3300025928 Bacteria 1903
1043 Ga0207700_10200909 3300025928 Bacteria 1680
1044 Ga0207700_10797849 3300025928 Bacteria 844
1045 Ga0207700_11035441 3300025928 Bacteria 734
1046 Ga0207700_11170282 3300025928 Bacteria 687
1047 Ga0207700_11194662 3300025928 Bacteria 679
1048 Ga0207700_11493164 3300025928 Bacteria 600
1049 Ga0207700_11517297 3300025928 Bacteria 594
1050 Ga0207700_12028543 3300025928 Bacteria 502
1051 Ga0207664_10012504 3300025929 Bacteria 6073
1052 Ga0207664_10023422 3300025929 Bacteria 4626
1053 Ga0207664_10086181 3300025929 Bacteria 2565
1054 Ga0207664_10142749 3300025929 Bacteria 2027
1055 Ga0207664_10275765 3300025929 Bacteria 1474
1056 Ga0207664_10354316 3300025929 Bacteria 1299
1057 Ga0207664_10449136 3300025929 Bacteria 1150
1058 Ga0207664_10614037 3300025929 Bacteria 977
1059 Ga0207664_10880214 3300025929 Bacteria 805
1060 Ga0207664_10899014 3300025929 Bacteria 795
1061 Ga0207664_11601960 3300025929 Bacteria 573
1062 Ga0207644_11293224 3300025931 Bacteria 613
1063 Ga0207690_10013528 3300025932 Bacteria 4904
1064 Ga0207690_10424105 3300025932 Bacteria 1065
1065 Ga0207690_10627390 3300025932 Bacteria 879
1066 Ga0207690_10689997 3300025932 Bacteria 839
1067 Ga0207690_11021142 3300025932 Bacteria 688
1068 Ga0207690_11106248 3300025932 Bacteria 660
1069 Ga0207690_11742779 3300025932 Bacteria 520
1070 Ga0207706_10108527 3300025933 Bacteria 2442
1071 Ga0207706_10142549 3300025933 Bacteria 2108
1072 Ga0207706_10398128 3300025933 Bacteria 1194
1073 Ga0207706_10455649 3300025933 Bacteria 1106
1074 Ga0207686_11525038 3300025934 Bacteria 551
1075 Ga0207709_10323826 3300025935 Bacteria 1155
1076 Ga0207709_10392007 3300025935 Bacteria 1059
1077 Ga0207709_11620830 3300025935 Bacteria 538
1078 Ga0207709_11826665 3300025935 Bacteria 506
1079 Ga0207670_10103506 3300025936 Bacteria 2037
1080 Ga0207670_10361287 3300025936 Bacteria 1152
1081 Ga0207670_11578770 3300025936 Bacteria 558
1082 Ga0207669_10147675 3300025937 Bacteria 1642
1083 Ga0207669_10319592 3300025937 Bacteria 1187
1084 Ga0207669_10819625 3300025937 Bacteria 773
1085 Ga0207669_10845734 3300025937 Bacteria 761
1086 Ga0207669_11227961 3300025937 Bacteria 635
1087 Ga0207669_11866057 3300025937 Bacteria 513
1088 Ga0207704_10909843 3300025938 Bacteria 740
1089 Ga0207665_10005278 3300025939 Bacteria 8635
1090 Ga0207665_10332640 3300025939 Bacteria 1143
1091 Ga0207665_10345218 3300025939 Bacteria 1123
1092 Ga0207665_10415181 3300025939 Bacteria 1027
1093 Ga0207665_10447733 3300025939 Bacteria 990
1094 Ga0207665_10514922 3300025939 Bacteria 926
1095 Ga0207665_10633206 3300025939 Bacteria 837
1096 Ga0207665_10682547 3300025939 Bacteria 807
1097 Ga0207665_10984891 3300025939 Bacteria 670
1098 Ga0207691_10203880 3300025940 Bacteria 1720
1099 Ga0207691_10307596 3300025940 Bacteria 1361
1100 Ga0207691_10635942 3300025940 Bacteria 902
1101 Ga0207691_11093567 3300025940 Bacteria 663
1102 Ga0207691_11257235 3300025940 Bacteria 612
1103 Ga0207711_10408213 3300025941 Bacteria 1262
1104 Ga0207711_10530163 3300025941 Bacteria 1098
1105 Ga0207711_10695346 3300025941 Bacteria 948
1106 Ga0207689_10602882 3300025942 Bacteria 924
1107 Ga0207689_10739352 3300025942 Bacteria 830
1108 Ga0207661_10025741 3300025944 Bacteria 4476
1109 Ga0207661_10050770 3300025944 Bacteria 3306
1110 Ga0207661_10262238 3300025944 Bacteria 1539
1111 Ga0207661_11444937 3300025944 Bacteria 631
1112 Ga0207661_11940388 3300025944 Bacteria 535
1113 Ga0207679_10757268 3300025945 Bacteria 883
1114 Ga0207679_11157501 3300025945 Bacteria 710
1115 Ga0207679_11165321 3300025945 Bacteria 707
1116 Ga0207679_11984364 3300025945 Bacteria 530
1117 Ga0207667_10004001 3300025949 Bacteria 18104
1118 Ga0207667_10027381 3300025949 Bacteria 6205
1119 Ga0207667_10037495 3300025949 Bacteria 5180
1120 Ga0207667_10059115 3300025949 Bacteria 4017
1121 Ga0207667_10071484 3300025949 Bacteria 3607
1122 Ga0207667_10090231 3300025949 Bacteria 3167
1123 Ga0207667_10501426 3300025949 Bacteria 1231
1124 Ga0207667_10595251 3300025949 Bacteria 1115
1125 Ga0207667_10615307 3300025949 Bacteria 1094
1126 Ga0207667_10928487 3300025949 Bacteria 861
1127 Ga0207667_12051947 3300025949 Bacteria 531
1128 Ga0207651_10143854 3300025960 Bacteria 1846
1129 Ga0207651_10644027 3300025960 Bacteria 930
1130 Ga0207651_10716167 3300025960 Bacteria 883
1131 Ga0207651_10840755 3300025960 Bacteria 815
1132 Ga0207651_11324664 3300025960 Bacteria 647
1133 Ga0207712_10101401 3300025961 Bacteria 2141
1134 Ga0207712_10686493 3300025961 Bacteria 893
1135 Ga0207712_10981900 3300025961 Bacteria 749
1136 Ga0207712_12052836 3300025961 Bacteria 512
1137 Ga0207668_10135774 3300025972 Bacteria 1884
1138 Ga0207668_10340905 3300025972 Bacteria 1250
1139 Ga0207668_10391103 3300025972 Bacteria 1173
1140 Ga0207668_10532840 3300025972 Bacteria 1015
1141 Ga0207668_11075514 3300025972 Bacteria 720
1142 Ga0207668_11555575 3300025972 Bacteria 597
1143 Ga0207640_10039083 3300025981 Bacteria 3000
1144 Ga0207640_10423874 3300025981 Bacteria 1090
1145 Ga0207640_10485779 3300025981 Bacteria 1025
1146 Ga0207640_11061101 3300025981 Bacteria 715
1147 Ga0207658_10410091 3300025986 Bacteria 1193
1148 Ga0207658_11636572 3300025986 Bacteria 588
1149 Ga0207677_10129817 3300026023 Bacteria 1911
1150 Ga0207703_10419985 3300026035 Bacteria 1244
1151 Ga0207703_10694026 3300026035 Bacteria 968
1152 Ga0207703_10784239 3300026035 Bacteria 909
1153 Ga0207703_11319380 3300026035 Bacteria 694
1154 Ga0207703_11658134 3300026035 Bacteria 615
1155 Ga0207703_12081283 3300026035 Bacteria 544
1156 Ga0207639_10003883 3300026041 Bacteria 10074
1157 Ga0207639_10324865 3300026041 Bacteria 1367
1158 Ga0207639_10366724 3300026041 Bacteria 1290
1159 Ga0207639_10387188 3300026041 Bacteria 1257
1160 Ga0207639_11697912 3300026041 Bacteria 592
1161 Ga0207678_10146674 3300026067 Bacteria 2014
1162 Ga0207678_10200304 3300026067 Bacteria 1707
1163 Ga0207678_10416376 3300026067 Bacteria 1165
1164 Ga0207678_10553889 3300026067 Bacteria 1006
1165 Ga0207678_10617010 3300026067 Bacteria 951
1166 Ga0207678_10810258 3300026067 Bacteria 827
1167 Ga0207678_11345590 3300026067 Bacteria 632
1168 Ga0207678_11385523 3300026067 Bacteria 622
1169 Ga0207678_11914089 3300026067 Bacteria 517
1170 Ga0207708_10027810 3300026075 Bacteria 4282
1171 Ga0207708_12027155 3300026075 Bacteria 504
1172 Ga0207702_10000005 3300026078 Bacteria 420296
1173 Ga0207702_10136072 3300026078 Bacteria 2217
1174 Ga0207702_10274584 3300026078 Bacteria 1591
1175 Ga0207702_10336027 3300026078 Bacteria 1442
1176 Ga0207702_10515163 3300026078 Bacteria 1167
1177 Ga0207702_10715686 3300026078 Bacteria 987
1178 Ga0207702_10787309 3300026078 Bacteria 940
1179 Ga0207702_10942406 3300026078 Bacteria 856
1180 Ga0207702_11111806 3300026078 Bacteria 784
1181 Ga0207702_11184760 3300026078 Bacteria 758
1182 Ga0207641_10380797 3300026088 Bacteria 1351
1183 Ga0207641_10598774 3300026088 Bacteria 1079
1184 Ga0207641_10601997 3300026088 Bacteria 1076
1185 Ga0207641_10655094 3300026088 Bacteria 1031
1186 Ga0207641_10671759 3300026088 Bacteria 1019
1187 Ga0207641_12278891 3300026088 Bacteria 541
1188 Ga0207648_10049127 3300026089 Bacteria 3693
1189 Ga0207648_10059390 3300026089 Bacteria 3335
1190 Ga0207648_10391680 3300026089 Bacteria 1258
1191 Ga0207648_10519085 3300026089 Bacteria 1091
1192 Ga0207648_10658674 3300026089 Bacteria 968
1193 Ga0207676_10092778 3300026095 Bacteria 2484
1194 Ga0207676_10884216 3300026095 Bacteria 875
1195 Ga0207676_11155153 3300026095 Bacteria 766
1196 Ga0207676_11425259 3300026095 Bacteria 689
1197 Ga0207674_10180496 3300026116 Bacteria 2062
1198 Ga0207674_10327221 3300026116 Bacteria 1482
1199 Ga0207674_10347886 3300026116 Bacteria 1433
1200 Ga0207674_10433621 3300026116 Bacteria 1270
1201 Ga0207674_10512539 3300026116 Bacteria 1159
1202 Ga0207674_11405665 3300026116 Bacteria 667
1203 Ga0207674_12207917 3300026116 Bacteria 513
1204 Ga0207674_12233411 3300026116 Bacteria 510
1205 Ga0207675_100619211 3300026118 Bacteria 1087
1206 Ga0207675_100621523 3300026118 Bacteria 1085
1207 Ga0207675_100987417 3300026118 Bacteria 860
1208 Ga0207675_101625113 3300026118 Bacteria 666
1209 Ga0207675_102568935 3300026118 Bacteria 519
1210 Ga0207683_10560762 3300026121 Bacteria 1056
1211 Ga0207683_10588127 3300026121 Bacteria 1030
1212 Ga0207683_11023362 3300026121 Bacteria 767
1213 Ga0207683_11664973 3300026121 Bacteria 587
1214 Ga0207698_10040510 3300026142 Bacteria 3463
1215 Ga0207698_10384505 3300026142 Bacteria 1336
1216 Ga0207698_11067595 3300026142 Bacteria 820
1217 Ga0207698_11669617 3300026142 Bacteria 652
1218 Ga0207698_12279113 3300026142 Bacteria 554
1219 Ga0207698_12337365 3300026142 Bacteria 546
1220 Ga0209389_1002002 3300027296 Bacteria 15108
1221 Ga0209371_1078930 3300027312 Bacteria 571
1222 Ga0209589_1000009 3300027357 Bacteria 252104
1223 Ga0209589_1000300 3300027357 Bacteria 63625
1224 Ga0209489_100010 3300027361 Bacteria 252139
1225 Ga0209489_109706 3300027361 Bacteria 11675
1226 Ga0209700_100017 3300027363 Bacteria 252104
1227 Ga0209700_100031 3300027363 Bacteria 207349
1228 Ga0209179_1001130 3300027512 Bacteria 3120
1229 Ga0209179_1011727 3300027512 Bacteria 1560
1230 Ga0209588_1010113 3300027671 Bacteria 2831
1231 Ga0209813_10096355 3300027866 Bacteria 1001
1232 Ga0209813_10191714 3300027866 Bacteria 753
1233 Ga0207428_10083142 3300027907 Bacteria 2498
1234 Ga0207428_10370333 3300027907 Bacteria 1052
1235 Ga0207428_10543224 3300027907 Bacteria 841
1236 Ga0265357_1003145 3300028023 Bacteria 1412
1237 Ga0268266_10126819 3300028379 Bacteria 2278
1238 Ga0268266_10186618 3300028379 Bacteria 1891
1239 Ga0268266_10254086 3300028379 Bacteria 1626
1240 Ga0268266_10257384 3300028379 Bacteria 1616
1241 Ga0268266_10423460 3300028379 Bacteria 1262
1242 Ga0268266_10526536 3300028379 Bacteria 1130
1243 Ga0268266_10653010 3300028379 Bacteria 1012
1244 Ga0268266_11291432 3300028379 Bacteria 705
1245 Ga0268266_11349699 3300028379 Bacteria 688
1246 Ga0268266_11796724 3300028379 Bacteria 588
1247 Ga0268265_10112980 3300028380 Bacteria 2221
1248 Ga0268265_10861960 3300028380 Bacteria 887
1249 Ga0268265_11340583 3300028380 Bacteria 716
1250 Ga0268264_10000377 3300028381 Bacteria 65413
1251 Ga0268264_10208500 3300028381 Bacteria 1792
1252 Ga0268264_11652374 3300028381 Bacteria 651
1253 Ga0268264_11832606 3300028381 Bacteria 617
1254 Ga0268264_12089396 3300028381 Bacteria 575
1255 Ga0265337_1002429 3300028556 Bacteria 8569
1256 Ga0265326_10001795 3300028558 Bacteria 7402
1257 Ga0265326_10071100 3300028558 Bacteria 984
1258 Ga0265319_1001825 3300028563 Bacteria 12143
1259 Ga0265334_10000469 3300028573 Bacteria 20809
1260 Ga0265334_10159143 3300028573 Bacteria 794
1261 Ga0265334_10196976 3300028573 Bacteria 701
1262 Ga0265318_10040136 3300028577 Bacteria 1783
1263 Ga0265318_10169596 3300028577 Bacteria 800
1264 Ga0265323_10001237 3300028653 Bacteria 12839
1265 Ga0265322_10016831 3300028654 Bacteria 2108
1266 Ga0265336_10000535 3300028666 Bacteria 21804
1267 Ga0265336_10044030 3300028666 Bacteria 1359
1268 Ga0265336_10233733 3300028666 Bacteria 546
1269 Ga0307517_10023999 3300028786 Bacteria 7543
1270 Ga0307517_10183287 3300028786 Bacteria 1346
1271 Ga0307517_10503341 3300028786 Bacteria 616
1272 Ga0307515_10040807 3300028794 Bacteria 7326
1273 Ga0307515_10058447 3300028794 Bacteria 5553
1274 Ga0307515_10322279 3300028794 Bacteria 1210
1275 Ga0307515_10918950 3300028794 Bacteria 508
1276 Ga0265338_10000131 3300028800 Bacteria 137627
1277 Ga0265338_10080854 3300028800 Bacteria 2728
1278 Ga0265338_11075728 3300028800 Bacteria 542
1279 Ga0310981_1002564 3300029285 Bacteria 916
1280 Ga0265324_10001269 3300029957 Bacteria 14862
1281 Ga0265324_10037090 3300029957 Bacteria 1695
1282 Ga0307511_10057801 3300030521 Bacteria 3009
1283 Ga0307511_10230192 3300030521 Bacteria 918
1284 Ga0307512_10204882 3300030522 Bacteria 1060
1285 Ga0265762_1132650 3300030760 Bacteria 579
1286 Ga0265763_1011605 3300030763 Bacteria 830
1287 Ga0265770_1062880 3300030878 Bacteria 694
1288 Ga0265770_1096070 3300030878 Bacteria 597
1289 Ga0265770_1102258 3300030878 Bacteria 584
1290 Ga0265764_104092 3300030882 Bacteria 782
1291 Ga0265773_1014407 3300031018 Bacteria 717
1292 Ga0265760_10102746 3300031090 Bacteria 904
1293 Ga0265760_10109747 3300031090 Bacteria 878
1294 Ga0265330_10039722 3300031235 Bacteria 2090
1295 Ga0265330_10087871 3300031235 Bacteria 1335
1296 Ga0265330_10175016 3300031235 Bacteria 909
1297 Ga0265330_10396814 3300031235 Bacteria 584
1298 Ga0265332_10008226 3300031238 Bacteria 4690
1299 Ga0265332_10042520 3300031238 Bacteria 1964
1300 Ga0265332_10042610 3300031238 Bacteria 1962
1301 Ga0265332_10151884 3300031238 Bacteria 969
1302 Ga0265332_10475744 3300031238 Bacteria 517
1303 Ga0265328_10000041 3300031239 Bacteria 89398
1304 Ga0265328_10000129 3300031239 Bacteria 36422
1305 Ga0265328_10005203 3300031239 Bacteria 5592
1306 Ga0265328_10005372 3300031239 Bacteria 5487
1307 Ga0265328_10013913 3300031239 Bacteria 3175
1308 Ga0265328_10040462 3300031239 Bacteria 1717
1309 Ga0265328_10068668 3300031239 Bacteria 1302
1310 Ga0265328_10117756 3300031239 Bacteria 989
1311 Ga0265328_10163936 3300031239 Bacteria 838
1312 Ga0265328_10176650 3300031239 Bacteria 807
1313 Ga0265320_10017218 3300031240 Bacteria 4021
1314 Ga0265320_10368131 3300031240 Bacteria 635
1315 Ga0265325_10007856 3300031241 Bacteria 6350
1316 Ga0265325_10021599 3300031241 Bacteria 3533
1317 Ga0265325_10053770 3300031241 Bacteria 2063
1318 Ga0265325_10092675 3300031241 Bacteria 1487
1319 Ga0265325_10258483 3300031241 Bacteria 787
1320 Ga0265329_10004194 3300031242 Bacteria 6066
1321 Ga0265329_10026053 3300031242 Bacteria 1930
1322 Ga0265329_10027219 3300031242 Bacteria 1880
1323 Ga0265329_10170019 3300031242 Bacteria 711
1324 Ga0265340_10002851 3300031247 Bacteria 9840
1325 Ga0265340_10006598 3300031247 Bacteria 6374
1326 Ga0265340_10034317 3300031247 Bacteria 2524
1327 Ga0265340_10036572 3300031247 Bacteria 2432
1328 Ga0265340_10071221 3300031247 Bacteria 1648
1329 Ga0265340_10114626 3300031247 Bacteria 1243
1330 Ga0265340_10149866 3300031247 Bacteria 1063
1331 Ga0265339_10006770 3300031249 Bacteria 7478
1332 Ga0265339_10011362 3300031249 Bacteria 5484
1333 Ga0265339_10035844 3300031249 Bacteria 2779
1334 Ga0265331_10000090 3300031250 Bacteria 123628
1335 Ga0265331_10001125 3300031250 Bacteria 20459
1336 Ga0265331_10005768 3300031250 Bacteria 7418
1337 Ga0265331_10111205 3300031250 Bacteria 1256
1338 Ga0265331_10186744 3300031250 Bacteria 935
1339 Ga0265331_10513436 3300031250 Bacteria 539
1340 Ga0265327_10040029 3300031251 Bacteria 2539
1341 Ga0265327_10044157 3300031251 Bacteria 2379
1342 Ga0265327_10172448 3300031251 Bacteria 993
1343 Ga0265316_10016003 3300031344 Bacteria 6526
1344 Ga0265316_10155827 3300031344 Bacteria 1709
1345 Ga0265316_10161146 3300031344 Bacteria 1677
1346 Ga0265316_10164705 3300031344 Bacteria 1656
1347 Ga0265316_10393815 3300031344 Bacteria 998
1348 Ga0265316_10995558 3300031344 Bacteria 583
1349 Ga0307513_10365278 3300031456 Bacteria 1187
1350 Ga0307513_10449526 3300031456 Bacteria 1013
1351 Ga0307513_10500146 3300031456 Bacteria 933
1352 Ga0307513_10550671 3300031456 Bacteria 866
1353 Ga0307509_10268949 3300031507 Bacteria 1473
1354 Ga0307509_10547927 3300031507 Bacteria 835
1355 Ga0307509_10985155 3300031507 Bacteria 509
1356 Ga0307408_100114583 3300031548 Bacteria 2077
1357 Ga0307408_100252733 3300031548 Bacteria 1455
1358 Ga0307408_100903386 3300031548 Bacteria 808
1359 Ga0307408_101288261 3300031548 Bacteria 684
1360 Ga0307408_101630296 3300031548 Bacteria 613
1361 Ga0307408_101803862 3300031548 Bacteria 585
1362 Ga0265313_10019153 3300031595 Bacteria 3821
1363 Ga0265313_10051770 3300031595 Bacteria 1963
1364 Ga0265313_10082252 3300031595 Bacteria 1460
1365 Ga0265313_10095480 3300031595 Bacteria 1327
1366 Ga0265313_10277566 3300031595 Bacteria 678
1367 Ga0307508_10000378 3300031616 Bacteria 53801
1368 Ga0307508_10056100 3300031616 Bacteria 3489
1369 Ga0307508_10124266 3300031616 Bacteria 2182
1370 Ga0316575_10024185 3300031665 Bacteria 2350
1371 Ga0316575_10024618 3300031665 Bacteria 2332
1372 Ga0316575_10027099 3300031665 Bacteria 2229
1373 Ga0316575_10198274 3300031665 Bacteria 836
1374 Ga0316575_10330841 3300031665 Bacteria 647
1375 Ga0316579_10224216 3300031691 Bacteria 909
1376 Ga0316579_10499395 3300031691 Bacteria 589
1377 Ga0265314_10048379 3300031711 Bacteria 2985
1378 Ga0265314_10057543 3300031711 Bacteria 2669
1379 Ga0265314_10065689 3300031711 Bacteria 2449
1380 Ga0265314_10109972 3300031711 Bacteria 1753
1381 Ga0265314_10117426 3300031711 Bacteria 1680
1382 Ga0265314_10141709 3300031711 Bacteria 1485
1383 Ga0265314_10296116 3300031711 Bacteria 909
1384 Ga0265342_10000448 3300031712 Bacteria 44982
1385 Ga0265342_10000677 3300031712 Bacteria 35579
1386 Ga0265342_10018135 3300031712 Bacteria 4565
1387 Ga0265342_10031129 3300031712 Bacteria 3301
1388 Ga0265342_10124079 3300031712 Bacteria 1452
1389 Ga0265342_10166954 3300031712 Bacteria 1213
1390 Ga0316576_10076111 3300031727 Bacteria 2483
1391 Ga0316578_10007604 3300031728 Bacteria 5449
1392 Ga0316578_10537946 3300031728 Bacteria 687
1393 Ga0307516_10019779 3300031730 Bacteria 6965
1394 Ga0307516_10072648 3300031730 Bacteria 3298
1395 Ga0307516_10076126 3300031730 Bacteria 3209
1396 Ga0307516_10300738 3300031730 Bacteria 1280
1397 Ga0307516_10315548 3300031730 Bacteria 1235
1398 Ga0307516_10673438 3300031730 Bacteria 690
1399 Ga0307405_10100255 3300031731 Bacteria 1940
1400 Ga0307405_10131747 3300031731 Bacteria 1729
1401 Ga0307405_10309177 3300031731 Bacteria 1202
1402 Ga0307405_10938104 3300031731 Bacteria 734
1403 Ga0307405_11528009 3300031731 Bacteria 587
1404 Ga0316044_120321 3300031810 Bacteria 690
1405 Ga0307413_10098364 3300031824 Bacteria 1926
1406 Ga0307413_10287913 3300031824 Bacteria 1239
1407 Ga0307413_10372365 3300031824 Bacteria 1110
1408 Ga0307413_10848032 3300031824 Bacteria 772
1409 Ga0307413_10918903 3300031824 Bacteria 744
1410 Ga0307410_10153064 3300031852 Bacteria 1719
1411 Ga0307410_10222926 3300031852 Bacteria 1451
1412 Ga0307410_10968053 3300031852 Bacteria 732
1413 Ga0307410_11125338 3300031852 Bacteria 681
1414 Ga0307406_10278058 3300031901 Bacteria 1275
1415 Ga0307406_10309973 3300031901 Bacteria 1216
1416 Ga0307406_10368962 3300031901 Bacteria 1128
1417 Ga0307406_11504050 3300031901 Bacteria 592
1418 Ga0307407_10131301 3300031903 Bacteria 1603
1419 Ga0307407_10288833 3300031903 Bacteria 1139
1420 Ga0307407_10761292 3300031903 Bacteria 734
1421 Ga0307407_10940812 3300031903 Bacteria 665
1422 Ga0307407_11071376 3300031903 Bacteria 625
1423 Ga0307407_11561626 3300031903 Bacteria 523
1424 Ga0307412_10077758 3300031911 Bacteria 2283
1425 Ga0307412_10215875 3300031911 Bacteria 1467
1426 Ga0307412_10837438 3300031911 Bacteria 801
1427 Ga0307412_11113935 3300031911 Bacteria 703
1428 Ga0307412_11691425 3300031911 Bacteria 580
1429 Ga0307412_12039226 3300031911 Bacteria 532
1430 Ga0307409_100437907 3300031995 Bacteria 1258
1431 Ga0307409_100888853 3300031995 Bacteria 904
1432 Ga0307409_100973616 3300031995 Bacteria 865
1433 Ga0307409_101217242 3300031995 Bacteria 777
1434 Ga0307409_101685730 3300031995 Bacteria 662
1435 Ga0307409_101822438 3300031995 Bacteria 638
1436 Ga0307416_100305505 3300032002 Bacteria 1584
1437 Ga0307416_100668244 3300032002 Bacteria 1125
1438 Ga0307416_101040803 3300032002 Bacteria 922
1439 Ga0307416_103324203 3300032002 Bacteria 538
1440 Ga0307414_10042166 3300032004 Bacteria 3099
1441 Ga0307411_10165110 3300032005 Bacteria 1663
1442 Ga0307411_10533519 3300032005 Bacteria 998
1443 Ga0307411_10659061 3300032005 Bacteria 907
1444 Ga0307411_12136781 3300032005 Bacteria 524
1445 Ga0307415_100348064 3300032126 Bacteria 1246
1446 Ga0307415_100511963 3300032126 Bacteria 1051
1447 Ga0307415_101491359 3300032126 Bacteria 647
1448 Ga0307415_102420793 3300032126 Bacteria 516
1449 Ga0316583_10003862 3300032133 Bacteria 5316
1450 Ga0316583_10109690 3300032133 Bacteria 962
1451 Ga0316585_10283820 3300032137 Bacteria 549
1452 Ga0316593_10028881 3300032168 Bacteria 1790
1453 Ga0316593_10033258 3300032168 Bacteria 1687
1454 Ga0316593_10074840 3300032168 Bacteria 1175
1455 Ga0316593_10083093 3300032168 Bacteria 1120
1456 Ga0316593_10086564 3300032168 Bacteria 1099
1457 Ga0316593_10138707 3300032168 Bacteria 880
1458 Ga0316593_10196657 3300032168 Bacteria 744
1459 Ga0316593_10228491 3300032168 Bacteria 692
1460 Ga0307507_10070872 3300033179 Bacteria 3157
1461 Ga0307507_10296714 3300033179 Bacteria 995
1462 Ga0307510_10185890 3300033180 Bacteria 1633
1463 Ga0307510_10271309 3300033180 Bacteria 1172
1464 Ga0307510_10302191 3300033180 Bacteria 1062
1465 Ga0307510_10500130 3300033180 Bacteria 658
1466 Ga0315911_1000009 3300033442 Bacteria 379354
1467 Ga0316592_1018436 3300033524 Bacteria 1470
1468 Ga0316588_1089008 3300033528 Bacteria 768
1469 Ga0316587_1019184 3300033529 Bacteria 1154
1470 Ga0316596_1070873 3300033541 Bacteria 933
1471 Ga0316596_1091575 3300033541 Bacteria 820
1472 Ga0316596_1096193 3300033541 Bacteria 799
1473 Ga0316215_1002459 3300033544 Bacteria 1751
1474 Ga0316213_1002951 3300033546 Bacteria 1135
1475 Ga0316212_1020558 3300033547 Bacteria 927
1476 Ga0316212_1045300 3300033547 Bacteria 624
1477 Ga0373948_0049050 3300034817 Bacteria 903
1478 Ga0373948_0100487 3300034817 Bacteria 681
1479 Ga0373950_0006721 3300034818 Bacteria 1764
1480 Ga0373950_0052638 3300034818 Bacteria 802
1481 Ga0373959_0059099 3300034820 Bacteria 844
1482 Ga0373959_0163997 3300034820 Bacteria 569
1483 Ga0373938_0144656 3300034957 Bacteria 629
1484 Ga0373926_0003147 3300035083 Bacteria 5299
1485 Ga0373926_0005778 3300035083 Bacteria 4089
1486 Ga0373926_0050654 3300035083 Bacteria 1497
1487 Ga0373926_0079780 3300035083 Bacteria 1209
1488 Ga0373928_0165131 3300035084 Bacteria 621
1489 Ga0373928_0230110 3300035084 Bacteria 545
1490 Ga0373929_0062695 3300035085 Bacteria 874
1491 Ga0373929_0133444 3300035085 Bacteria 653
1492 Ga0373934_0012607 3300035086 Bacteria 3190
1493 Ga0373934_0012674 3300035086 Bacteria 3182
1494 Ga0373934_0048784 3300035086 Bacteria 1676
1495 Ga0373934_0241138 3300035086 Bacteria 747
1496 Ga0373940_0022602 3300035088 Bacteria 1617
1497 Ga0373940_0279904 3300035088 Bacteria 569
1498 Ga0373944_0026063 3300035089 Bacteria 1725
1499 Ga0373944_0046147 3300035089 Bacteria 1361
1500 Ga0373944_0095413 3300035089 Bacteria 999
1501 Ga0373944_0123351 3300035089 Bacteria 895
1502 Ga0373944_0223286 3300035089 Bacteria 688
1503 Ga0373949_0175063 3300035090 Bacteria 633
1504 Ga0373951_0131289 3300035091 Bacteria 689
1505 Ga0373952_0098804 3300035092 Bacteria 767
1506 Ga0373923_0000485 3300035111 Bacteria 9534
1507 Ga0373923_0038013 3300035111 Bacteria 1970
1508 Ga0373923_0108129 3300035111 Bacteria 1232
1509 Ga0373923_0115974 3300035111 Bacteria 1193
1510 Ga0373923_0294884 3300035111 Bacteria 766
1511 Ga0373932_0139101 3300035112 Bacteria 824
1512 Ga0373932_0157948 3300035112 Bacteria 783
1513 Ga0373936_0001112 3300035113 Bacteria 9638
1514 Ga0373936_0014607 3300035113 Bacteria 3006
1515 Ga0373936_0015906 3300035113 Bacteria 2887
1516 Ga0373936_0030370 3300035113 Bacteria 2130
1517 Ga0373936_0054646 3300035113 Bacteria 1620
1518 Ga0373936_0071758 3300035113 Bacteria 1428
1519 Ga0373936_0384443 3300035113 Bacteria 643
1520 Ga0373936_0453447 3300035113 Bacteria 593
1521 Ga0373936_0481914 3300035113 Bacteria 576
1522 Ga0373941_0068288 3300035115 Bacteria 1174
1523 Ga0373941_0396331 3300035115 Bacteria 570
1524 Ga0373945_0031818 3300035116 Bacteria 1866
1525 Ga0373945_0035125 3300035116 Bacteria 1790
1526 Ga0373945_0304213 3300035116 Bacteria 683
1527 Ga0373945_0374917 3300035116 Bacteria 620
1528 Ga0373953_0000811 3300035117 Bacteria 8711
1529 Ga0373953_0001370 3300035117 Bacteria 7005
1530 Ga0373954_0006766 3300035118 Bacteria 5002
1531 Ga0373954_0007130 3300035118 Bacteria 4880
1532 Ga0373954_0007908 3300035118 Bacteria 4657
1533 Ga0373954_0076122 3300035118 Bacteria 1599
1534 Ga0373954_0162684 3300035118 Bacteria 1092
1535 Ga0373956_0019825 3300035119 Bacteria 2855
1536 Ga0373956_0020440 3300035119 Bacteria 2817
1537 Ga0373957_0002274 3300035120 Bacteria 5449
1538 Ga0373957_0297962 3300035120 Bacteria 684
1539 Ga0373957_0319506 3300035120 Bacteria 660
1540 Ga0373960_0236108 3300035121 Bacteria 659
1541 Ga0373943_0003463 3300035170 Bacteria 7175
1542 Ga0373943_0006179 3300035170 Bacteria 5376
1543 Ga0373943_0008959 3300035170 Bacteria 4485
1544 Ga0373943_0010548 3300035170 Bacteria 4141
1545 Ga0373943_0017321 3300035170 Bacteria 3296
1546 Ga0373943_0024422 3300035170 Bacteria 2817
1547 Ga0373943_0539893 3300035170 Bacteria 684
1548 Ga0373943_0624221 3300035170 Bacteria 636
1549 Ga0373946_0011604 3300035171 Bacteria 3291
1550 Ga0373946_0015559 3300035171 Bacteria 2887
1551 Ga0373946_0019180 3300035171 Bacteria 2633
1552 Ga0373946_0091682 3300035171 Bacteria 1347
1553 Ga0373946_0249370 3300035171 Bacteria 865
1554 Ga0373946_0266260 3300035171 Bacteria 840
1555 Ga0373955_0000473 3300035172 Bacteria 16929
1556 Ga0373955_0005659 3300035172 Bacteria 5625
1557 Ga0373955_0289185 3300035172 Bacteria 987
1558 Ga0373955_0451197 3300035172 Bacteria 784
1559 Ga0373955_0874429 3300035172 Bacteria 553
1560 Ga0373961_0022445 3300035241 Bacteria 1689
1561 Ga0373962_0021332 3300035242 Bacteria 1708
1562 Ga0373962_0052942 3300035242 Bacteria 1174
1563 Ga0316574_0003396 3300035398 Bacteria 8203
1564 Ga0316574_0533309 3300035398 Bacteria 730
1565 Ga0373924_0134009 3300035410 Bacteria 1078
1566 Ga0373924_0192150 3300035410 Bacteria 899
1567 Ga0373931_0008176 3300035691 Bacteria 4955
1568 Ga0373931_0084607 3300035691 Bacteria 1757
1569 Ga0373931_0272009 3300035691 Bacteria 1037
1570 Ga0373931_0300966 3300035691 Bacteria 990
1571 Ga0373931_0474571 3300035691 Bacteria 803
1572 Ga0373935_0000768 3300035692 Bacteria 17055
1573 Ga0373935_0012257 3300035692 Bacteria 5156
1574 Ga0373935_0053250 3300035692 Bacteria 2574
1575 Ga0373935_0235025 3300035692 Bacteria 1278
1576 Ga0373935_0252701 3300035692 Bacteria 1234
1577 Ga0373935_1382395 3300035692 Bacteria 526
1578 Ga0373927_0004904 3300035695 Bacteria 9294
1579 Ga0373927_0014366 3300035695 Bacteria 5243
1580 Ga0373927_0017066 3300035695 Bacteria 4783
1581 Ga0373927_0040111 3300035695 Bacteria 3038
1582 Ga0373927_0140139 3300035695 Bacteria 1581
1583 Ga0373927_0154565 3300035695 Bacteria 1502
1584 Ga0373927_0188185 3300035695 Bacteria 1354
1585 Ga0373927_0294673 3300035695 Bacteria 1067
1586 Ga0373927_0337699 3300035695 Bacteria 992
1587 Ga0373927_0412988 3300035695 Bacteria 891
1588 Ga0373927_0659780 3300035695 Bacteria 691
1589 Ga0373927_0714083 3300035695 Bacteria 662
1590 Ga0373927_0981165 3300035695 Bacteria 557
1591 Ga0373933_0010736 3300035724 Bacteria 5025
1592 Ga0373933_0012634 3300035724 Bacteria 4666
1593 Ga0373933_0115193 3300035724 Bacteria 1679
1594 Ga0373933_0199811 3300035724 Bacteria 1279
1595 Ga0373933_0432063 3300035724 Bacteria 860
1596 Ga0373933_0779450 3300035724 Bacteria 629
1597 Ga0373947_0002626 3300035725 Bacteria 10785
1598 Ga0373947_0005298 3300035725 Bacteria 7541
1599 Ga0373947_0009798 3300035725 Bacteria 5497
1600 Ga0373947_0015603 3300035725 Bacteria 4364
1601 Ga0373947_0017535 3300035725 Bacteria 4119
1602 Ga0373947_0034111 3300035725 Bacteria 3009
1603 Ga0373947_0058826 3300035725 Bacteria 2329
1604 Ga0373947_0060370 3300035725 Bacteria 2302
1605 Ga0373947_0073289 3300035725 Bacteria 2104
1606 Ga0373947_0254344 3300035725 Bacteria 1162
1607 Ga0373947_0499527 3300035725 Bacteria 826
1608 Ga0373947_0667940 3300035725 Bacteria 709
1609 Ga0373947_1144157 3300035725 Bacteria 530
1610 Ga0310104_05697 3300036242 Bacteria 1063
1611 Ga0373937_0017872 3300036401 Bacteria 6327
1612 Ga0373937_0118076 3300036401 Bacteria 2470
1613 Ga0373937_0191616 3300036401 Bacteria 1921
1614 Ga0373937_0196514 3300036401 Bacteria 1896
1615 Ga0373937_0260291 3300036401 Bacteria 1636
1616 Ga0373937_0266442 3300036401 Bacteria 1616
1617 Ga0373937_0717769 3300036401 Bacteria 946
1618 Ga0373937_0750864 3300036401 Bacteria 923
1619 Ga0373937_0919589 3300036401 Bacteria 823
1620 Ga0265778_042915 3300036457 Bacteria 606
1621 Ga0310112_050106 3300036458 Bacteria 567
1622 Ga0310109_007014 3300036534 Bacteria 1480
1623 Ga0310110_029713 3300036535 Bacteria 717
1624 Ga0316582_0075521 3300036647 Bacteria 2190
1625 Ga0316582_0120148 3300036647 Bacteria 1757
1626 Ga0316582_0826934 3300036647 Bacteria 634
1627 Ga0316584_0001009 3300036712 Bacteria 16241
1628 Ga0373925_0000435 3300037068 Bacteria 42178
1629 Ga0373925_0020892 3300037068 Bacteria 4771
1630 Ga0373925_0024722 3300037068 Bacteria 4386
1631 Ga0373925_0039116 3300037068 Bacteria 3508
1632 Ga0373925_0073208 3300037068 Bacteria 2593
1633 Ga0373925_0098953 3300037068 Bacteria 2239
1634 Ga0373925_0101224 3300037068 Bacteria 2215
1635 Ga0373925_0147115 3300037068 Bacteria 1847
1636 Ga0373925_0488617 3300037068 Bacteria 1010
1637 Ga0373925_1028981 3300037068 Bacteria 678
1638 Ga0373925_1151686 3300037068 Bacteria 638
1639 Ga0395899_0013235 3300037312 Bacteria 6312
1640 Ga0395899_0081310 3300037312 Bacteria 2357
1641 Ga0395899_0418060 3300037312 Bacteria 884
1642 Ga0395899_0469439 3300037312 Bacteria 821
1643 Ga0395899_0770968 3300037312 Bacteria 597
1644 Ga0395899_0794860 3300037312 Bacteria 585
1645 Ga0395900_0022401 3300037418 Bacteria 6461
1646 Ga0395900_0022503 3300037418 Bacteria 6447
1647 Ga0395900_0049338 3300037418 Bacteria 4336
1648 Ga0395900_0287087 3300037418 Bacteria 1635
1649 Ga0395900_0361639 3300037418 Bacteria 1422
1650 Ga0395900_0448251 3300037418 Bacteria 1247
1651 Ga0395900_0701198 3300037418 Bacteria 946
1652 Ga0395900_1848863 3300037418 Bacteria 514
1653 Ga0395898_0021752 3300037466 Bacteria 6499
1654 Ga0395898_0021940 3300037466 Bacteria 6467
1655 Ga0395898_0064043 3300037466 Bacteria 3567
1656 Ga0395898_0149026 3300037466 Bacteria 2239
1657 Ga0395898_0177898 3300037466 Bacteria 2033
1658 Ga0395898_0191419 3300037466 Bacteria 1954
1659 Ga0395898_0235450 3300037466 Bacteria 1746
1660 Ga0395898_0524027 3300037466 Bacteria 1126
1661 Ga0395898_0951015 3300037466 Bacteria 796
1662 Ga0395905_0073794 3300037471 Bacteria 3198
1663 Ga0395905_0203583 3300037471 Bacteria 1855
1664 Ga0395905_0689785 3300037471 Bacteria 923
1665 Ga0395905_1277552 3300037471 Bacteria 638
1666 Ga0395905_1721621 3300037471 Bacteria 532
1667 Ga0436364_0273038 3300037853 Bacteria 1278
1668 Ga0436364_0334517 3300037853 Bacteria 1791
1669 Ga0436364_0370054 3300037853 Bacteria 566
1670 Ga0436364_0542820 3300037853 Bacteria 1472
1671 Ga0436364_0600601 3300037853 Bacteria 585
1672 Ga0436364_0619962 3300037853 Bacteria 842
1673 Ga0436364_0636770 3300037853 Bacteria 1251
1674 Ga0436364_0698057 3300037853 Bacteria 747
1675 Ga0436364_0710409 3300037853 Bacteria 977
1676 Ga0436364_0716868 3300037853 Bacteria 797
1677 Ga0436364_0743164 3300037853 Bacteria 9802
1678 Ga0436364_0938634 3300037853 Bacteria 1670
1679 Ga0436364_0948138 3300037853 Bacteria 676
1680 Ga0436364_0972053 3300037853 Bacteria 1611
1681 Ga0436364_0983690 3300037853 Bacteria 2034
1682 Ga0436364_0986541 3300037853 Bacteria 2242
1683 Ga0436364_0994171 3300037853 Bacteria 1517
1684 Ga0436364_1022582 3300037853 Bacteria 2807
1685 Ga0436364_1060704 3300037853 Bacteria 956
1686 Ga0436364_1077178 3300037853 Bacteria 1227
1687 Ga0436364_1118871 3300037853 Bacteria 826
1688 Ga0436364_1149687 3300037853 Bacteria 1252
1689 Ga0436364_1158685 3300037853 Bacteria 569
1690 Ga0436364_1172769 3300037853 Bacteria 1755
1691 Ga0436364_1352603 3300037853 Bacteria 2275
1692 Ga0395901_0045720 3300038443 Bacteria 4545
1693 Ga0395901_0134942 3300038443 Bacteria 2594
1694 Ga0395901_0207378 3300038443 Bacteria 2052
1695 Ga0395901_0280159 3300038443 Bacteria 1732
1696 Ga0395901_0415857 3300038443 Bacteria 1379
1697 Ga0395901_0511575 3300038443 Bacteria 1221
1698 Ga0395901_0574201 3300038443 Bacteria 1140
1699 Ga0395901_0688409 3300038443 Bacteria 1021
1700 Ga0395901_1487338 3300038443 Bacteria 633
1701 Ga0237819_07436 3300038705 Bacteria 1574
1702 Ga0400483_260675 3300039062 Bacteria 2087
1703 Ga0436365_0047289 3300039437 Bacteria 7014
1704 Ga0436365_0257566 3300039437 Bacteria 7397
1705 Ga0436365_0331298 3300039437 Bacteria 850
1706 Ga0436365_0408974 3300039437 Bacteria 2601
1707 Ga0436365_0410056 3300039437 Bacteria 735
1708 Ga0436365_0430354 3300039437 Bacteria 532
1709 Ga0436365_0431494 3300039437 Bacteria 583
1710 Ga0436365_0641896 3300039437 Bacteria 1148
1711 Ga0436365_0728219 3300039437 Bacteria 2125
1712 Ga0436365_0895559 3300039437 Bacteria 1236
1713 Ga0436365_1083695 3300039437 Bacteria 702
1714 Ga0436365_1136540 3300039437 Bacteria 40433
1715 Ga0436365_1158357 3300039437 Bacteria 574
1716 Ga0436365_1166159 3300039437 Bacteria 1389
1717 Ga0436365_1182044 3300039437 Bacteria 636
1718 Ga0436365_1239372 3300039437 Bacteria 1017
1719 Ga0436365_1305216 3300039437 Bacteria 1459
1720 Ga0436365_1589094 3300039437 Bacteria 877
1721 Ga0436365_1594119 3300039437 Bacteria 648
1722 Ga0436365_1650779 3300039437 Bacteria 689
1723 Ga0436365_1656991 3300039437 Bacteria 1759
1724 Ga0436365_1766134 3300039437 Bacteria 1015
1725 Ga0436365_1790160 3300039437 Bacteria 740
1726 Ga0436365_1790595 3300039437 Bacteria 820
1727 Ga0436365_1870318 3300039437 Bacteria 5247
1728 Ga0436365_1891356 3300039437 Bacteria 3332
1729 Ga0436360_0336136 3300039438 Bacteria 713
1730 Ga0436360_0400895 3300039438 Bacteria 710
1731 Ga0436360_0460985 3300039438 Bacteria 553
1732 Ga0436360_0482292 3300039438 Bacteria 1197
1733 Ga0436360_0564682 3300039438 Bacteria 5174
1734 Ga0436360_0666816 3300039438 Bacteria 1564
1735 Ga0436360_0719807 3300039438 Bacteria 1730
1736 Ga0436360_0822399 3300039438 Bacteria 2683
1737 Ga0436360_0923946 3300039438 Bacteria 670
1738 Ga0436360_1020748 3300039438 Bacteria 1265
1739 Ga0436360_1071432 3300039438 Bacteria 556
1740 Ga0436360_1123721 3300039438 Bacteria 1320
1741 Ga0436360_1300509 3300039438 Bacteria 869
1742 Ga0436360_1350003 3300039438 Bacteria 1670
1743 Ga0436360_1371633 3300039438 Bacteria 1150
1744 Ga0436361_0015967 3300039447 Bacteria 640
1745 Ga0436361_0202965 3300039447 Bacteria 835
1746 Ga0436361_0221679 3300039447 Bacteria 1059
1747 Ga0436361_0241005 3300039447 Bacteria 1840
1748 Ga0436361_0399539 3300039447 Bacteria 814
1749 Ga0436361_0401541 3300039447 Bacteria 1794
1750 Ga0436361_0415174 3300039447 Bacteria 731
1751 Ga0436361_0458072 3300039447 Bacteria 953
1752 Ga0436361_0508772 3300039447 Bacteria 3610
1753 Ga0436361_0643647 3300039447 Bacteria 2141
1754 Ga0436361_1189994 3300039447 Bacteria 527
1755 Ga0436361_1200967 3300039447 Bacteria 722
1756 Ga0436361_1202984 3300039447 Bacteria 994
1757 Ga0436361_1203078 3300039447 Bacteria 686
1758 Ga0436363_0125243 3300039450 Bacteria 680
1759 Ga0436363_0201073 3300039450 Bacteria 539
1760 Ga0436363_0291002 3300039450 Bacteria 552
1761 Ga0436363_0371622 3300039450 Bacteria 683
1762 Ga0436363_0492471 3300039450 Bacteria 696
1763 Ga0436363_0497202 3300039450 Bacteria 681
1764 Ga0436363_0515390 3300039450 Bacteria 1035
1765 Ga0436363_0768121 3300039450 Bacteria 1411
1766 Ga0436363_0880899 3300039450 Bacteria 6318
1767 Ga0436363_0899406 3300039450 Bacteria 4002
1768 Ga0436363_0902847 3300039450 Bacteria 1686
1769 Ga0436363_0949002 3300039450 Bacteria 698
1770 Ga0436363_1073273 3300039450 Bacteria 1535
1771 Ga0436363_1120218 3300039450 Bacteria 1209
1772 Ga0436363_1145207 3300039450 Bacteria 810
1773 Ga0436363_1247371 3300039450 Bacteria 783
1774 Ga0436363_1253616 3300039450 Bacteria 763
1775 Ga0436363_1516469 3300039450 Bacteria 816
1776 Ga0436363_1571548 3300039450 Bacteria 7951
1777 Ga0436363_1633821 3300039450 Bacteria 1070
1778 Ga0436363_1700898 3300039450 Bacteria 711
1779 Ga0436362_0005077 3300039453 Bacteria 886
1780 Ga0436362_0024299 3300039453 Bacteria 1055
1781 Ga0436362_0283171 3300039453 Bacteria 1246
1782 Ga0436362_0393406 3300039453 Bacteria 957
1783 Ga0436362_0512948 3300039453 Bacteria 1143
1784 Ga0436362_0555272 3300039453 Bacteria 899
1785 Ga0436362_0566388 3300039453 Bacteria 522
1786 Ga0436362_0733157 3300039453 Bacteria 4042
1787 Ga0436362_0976116 3300039453 Bacteria 8152
1788 Ga0436362_0998184 3300039453 Bacteria 1574
1789 Ga0436362_1025748 3300039453 Bacteria 1563
1790 Ga0436362_1244188 3300039453 Bacteria 2576
1791 Ga0436362_1281104 3300039453 Bacteria 911
1792 Ga0436362_1297627 3300039453 Bacteria 2039
1793 Ga0439438_099247 3300041405 Bacteria 707
1794 Ga0439447_101918 3300041407 Bacteria 659
1795 Ga0439453_0000535 3300041408 Bacteria 4221
1796 Ga0439453_0042425 3300041408 Bacteria 896
1797 Ga0439461_0014133 3300041410 Bacteria 1514
1798 Ga0439465_0020399 3300041413 Bacteria 2076
1799 Ga0439465_0056533 3300041413 Bacteria 1293
1800 Ga0439465_0235974 3300041413 Bacteria 673
1801 Ga0451787_345693 3300041441 Bacteria 681
1802 Ga0451789_0319412 3300041443 Bacteria 852
1803 Ga0451789_0887753 3300041443 Bacteria 537
1804 Ga0451790_26031 3300041444 Bacteria 563
1805 Ga0451790_40087 3300041444 Bacteria 885
1806 Ga0451794_26022 3300041446 Bacteria 1197
1807 Ga0451791_1850361 3300041451 Bacteria 535
1808 Ga0451791_1937200 3300041451 Bacteria 687
1809 Ga0451793_0398772 3300041452 Bacteria 731
1810 Ga0451793_1320110 3300041452 Bacteria 888
1811 Ga0451793_1475355 3300041452 Bacteria 1198
1812 Ga0451801_16860 3300041455 Bacteria 541
1813 Ga0451795_0539396 3300041456 Bacteria 1154
1814 Ga0451798_0448670 3300041458 Bacteria 673
1815 Ga0451798_0697543 3300041458 Bacteria 1293
1816 Ga0451802_0534870 3300041460 Bacteria 570
1817 Ga0451802_1488856 3300041460 Bacteria 903
1818 Ga0451802_1574804 3300041460 Bacteria 510
1819 Ga0451805_084706 3300041461 Bacteria 647
1820 Ga0451804_0671393 3300041463 Bacteria 564
1821 Ga0451833_1394201 3300041491 Bacteria 1094
1822 Ga0451835_1102159 3300041492 Bacteria 670
1823 Ga0451837_0014523 3300041494 Bacteria 778
1824 Ga0451837_0521850 3300041494 Bacteria 733
1825 Ga0451841_0118137 3300041498 Bacteria 1377
1826 Ga0451845_0437418 3300041501 Bacteria 525
1827 Ga0451847_0685911 3300041503 Bacteria 749
1828 Ga0451849_0809549 3300041505 Bacteria 750
1829 Ga0451849_1130204 3300041505 Bacteria 561
1830 Ga0451849_1245540 3300041505 Bacteria 518
1831 Ga0451851_0809914 3300041507 Bacteria 518
1832 Ga0451851_0861466 3300041507 Bacteria 1118
1833 Ga0451853_1064348 3300041512 Bacteria 690
1834 Ga0451853_1395730 3300041512 Bacteria 1319
1835 Ga0451853_2608027 3300041512 Bacteria 530
1836 Ga0451853_3652445 3300041512 Bacteria 521
1837 Ga0439431_0050318 3300041997 Bacteria 1079
1838 Ga0439441_035784 3300042001 Bacteria 980
1839 Ga0439443_025083 3300042003 Bacteria 959
1840 Ga0439443_026548 3300042003 Bacteria 938
1841 Ga0439443_112734 3300042003 Bacteria 529
1842 Ga0439445_0070125 3300042004 Bacteria 969
1843 Ga0439448_0059967 3300042005 Bacteria 1257
1844 Ga0439448_0365255 3300042005 Bacteria 515
1845 Ga0439449_0211260 3300042007 Bacteria 727
1846 Ga0439451_042053 3300042009 Bacteria 917
1847 Ga0439454_064447 3300042011 Bacteria 641
1848 Ga0439455_0093351 3300042012 Bacteria 827
1849 Ga0439456_056577 3300042013 Bacteria 860
1850 Ga0439463_125515 3300042016 Bacteria 664
1851 Ga0439463_210025 3300042016 Bacteria 506
1852 Ga0450914_001494 3300042118 Bacteria 1482
1853 Ga0450890_055503 3300042127 Bacteria 612
1854 Ga0450897_046466 3300042128 Bacteria 518
1855 Ga0450905_020297 3300042142 Bacteria 977
1856 Ga0439444_0003020 3300042437 Bacteria 2348
1857 Ga0439444_0010829 3300042437 Bacteria 1464
1858 Ga0439459_0017282 3300042438 Bacteria 1342
1859 Ga0439464_0036420 3300042439 Bacteria 1392
1860 Ga0439460_0016876 3300042461 Bacteria 1950
1861 Ga0439460_0035232 3300042461 Bacteria 1447
1862 Ga0439460_0041440 3300042461 Bacteria 1353
1863 Ga0439460_0352034 3300042461 Bacteria 519
1864 Ga0439440_0018311 3300042993 Bacteria 1550
1865 Ga0439440_0053352 3300042993 Bacteria 1016
1866 Ga0466969_0063849 3300044656 Bacteria 1783
1867 Ga0466969_0092886 3300044656 Bacteria 1428
1868 Ga0466969_0198074 3300044656 Bacteria 917
1869 Ga0466972_0054591 3300044658 Bacteria 1922
1870 Ga0466972_0199754 3300044658 Bacteria 936
1871 Ga0466965_0198818 3300044683 Bacteria 1062
1872 Ga0466966_0002417 3300044684 Bacteria 12201
1873 Ga0466966_0023993 3300044684 Bacteria 3992
1874 Ga0466966_0063022 3300044684 Bacteria 2337
1875 Ga0466966_0088527 3300044684 Bacteria 1924
1876 Ga0466966_0762481 3300044684 Bacteria 583
1877 Ga0466961_0017735 3300044693 Bacteria 4574
1878 Ga0466961_0113472 3300044693 Bacteria 1704
1879 Ga0466961_0130091 3300044693 Bacteria 1578
1880 Ga0466961_0469197 3300044693 Bacteria 761
1881 Ga0466961_0943574 3300044693 Bacteria 513
1882 Ga0466963_0016197 3300044694 Bacteria 4633
1883 Ga0466963_0037303 3300044694 Bacteria 3172
1884 Ga0466963_0077600 3300044694 Bacteria 2245
1885 Ga0466963_0211728 3300044694 Bacteria 1356
1886 Ga0466963_0233022 3300044694 Bacteria 1290
1887 Ga0466963_0434196 3300044694 Bacteria 926
1888 Ga0466963_0509738 3300044694 Bacteria 849
1889 Ga0466963_0903192 3300044694 Bacteria 622
1890 Ga0466964_0142241 3300044706 Bacteria 1104
1891 Ga0466964_0335214 3300044706 Bacteria 773
1892 Ga0466964_0350315 3300044706 Bacteria 758
1893 Ga0466964_0353671 3300044706 Bacteria 755
1894 Ga0453684_0089999 3300044712 Unclassified 3793
1895 Ga0453684_0640447 3300044712 Bacteria 1161
1896 Ga0466971_0044555 3300044719 Bacteria 1992
1897 Ga0466971_0175842 3300044719 Bacteria 1005
1898 Ga0466971_0181494 3300044719 Bacteria 989
1899 Ga0466971_0198244 3300044719 Bacteria 947
1900 Ga0466971_0306820 3300044719 Bacteria 763
1901 Ga0466968_0108436 3300044735 Bacteria 1246
1902 Ga0466968_0201686 3300044735 Bacteria 932
1903 Ga0466968_0221711 3300044735 Bacteria 891
1904 Ga0466970_0491083 3300044765 Bacteria 706
1905 Ga0466970_0961162 3300044765 Bacteria 503
1906 Ga0466957_0094570 3300044842 Bacteria 1877
1907 Ga0466957_0534384 3300044842 Bacteria 816
1908 Ga0466957_0536112 3300044842 Bacteria 814
1909 Ga0466957_1165396 3300044842 Bacteria 557
1910 Ga0466960_0242961 3300044901 Bacteria 997
1911 Ga0466960_0366605 3300044901 Bacteria 824
1912 Ga0466960_0813981 3300044901 Bacteria 566
1913 Ga0466959_0040085 3300045049 Bacteria 3460
1914 Ga0466959_0155060 3300045049 Bacteria 1612
1915 Ga0466959_0197068 3300045049 Bacteria 1403
1916 Ga0466959_0304188 3300045049 Bacteria 1092
1917 Ga0466959_0510555 3300045049 Bacteria 812
1918 Ga0466959_0667432 3300045049 Bacteria 697
1919 Ga0466958_0026436 3300045836 Bacteria 3430
1920 Ga0466958_0295154 3300045836 Bacteria 1040
1921 Ga0466967_0011664 3300045976 Bacteria 6675
1922 Ga0466967_0056204 3300045976 Bacteria 3469
1923 Ga0466967_0096571 3300045976 Bacteria 2696
1924 Ga0466967_0248302 3300045976 Bacteria 1699
1925 Ga0466967_0382069 3300045976 Bacteria 1367
1926 Ga0466967_0395556 3300045976 Bacteria 1344
1927 Ga0466967_0494847 3300045976 Bacteria 1199
1928 Ga0466967_1158598 3300045976 Bacteria 770
1929 Ga0466967_1728458 3300045976 Bacteria 623
1930 Ga0466967_1775054 3300045976 Bacteria 614
1931 Ga0495617_024490 3300046452 Bacteria 2037
1932 Ga0495617_108346 3300046452 Bacteria 899
1933 Ga0495617_154799 3300046452 Bacteria 728
1934 Ga0495627_063246 3300046453 Bacteria 1091
1935 Ga0495592_0000135 3300046454 Bacteria 65590
1936 Ga0495592_0047053 3300046454 Bacteria 3213
1937 Ga0495592_0076237 3300046454 Bacteria 2433
1938 Ga0495592_0241867 3300046454 Bacteria 1197
1939 Ga0495592_0412213 3300046454 Bacteria 853
1940 Ga0495603_0011370 3300046455 Bacteria 5390
1941 Ga0495603_0026662 3300046455 Bacteria 3490
1942 Ga0495603_0080755 3300046455 Bacteria 1905
1943 Ga0495603_0169597 3300046455 Bacteria 1264
1944 Ga0495603_0270001 3300046455 Bacteria 978
1945 Ga0495603_0302300 3300046455 Bacteria 919
1946 Ga0495590_0026187 3300046457 Bacteria 2048
1947 Ga0495590_0026250 3300046457 Bacteria 2045
1948 Ga0495591_043986 3300046458 Bacteria 1253
1949 Ga0495629_0007600 3300046459 Bacteria 7985
1950 Ga0495629_0026319 3300046459 Bacteria 4133
1951 Ga0495629_0031173 3300046459 Bacteria 3776
1952 Ga0495629_0051126 3300046459 Bacteria 2893
1953 Ga0495629_0090395 3300046459 Bacteria 2136
1954 Ga0495629_0563917 3300046459 Bacteria 763
1955 Ga0495638_0015537 3300046460 Bacteria 5111
1956 Ga0495638_0066832 3300046460 Bacteria 2208
1957 Ga0495638_0142838 3300046460 Bacteria 1395
1958 Ga0495638_0453245 3300046460 Bacteria 654
1959 Ga0495638_0519533 3300046460 Bacteria 597
1960 Ga0495641_0011646 3300046461 Bacteria 4989
1961 Ga0495641_0047862 3300046461 Bacteria 1962
1962 Ga0495641_0139654 3300046461 Bacteria 1082
1963 Ga0495641_0161123 3300046461 Bacteria 1003
1964 Ga0495641_0580562 3300046461 Bacteria 512
1965 Ga0495641_0607163 3300046461 Bacteria 500
1966 Ga0495651_0003008 3300046462 Bacteria 13012
1967 Ga0495651_0003129 3300046462 Bacteria 12760
1968 Ga0495651_0070116 3300046462 Bacteria 2668
1969 Ga0495651_0073111 3300046462 Bacteria 2603
1970 Ga0495651_0113472 3300046462 Bacteria 2000
1971 Ga0495653_0000120 3300046463 Bacteria 65274
1972 Ga0495653_0000149 3300046463 Bacteria 58288
1973 Ga0495653_0063779 3300046463 Bacteria 2779
1974 Ga0495653_0310876 3300046463 Bacteria 1025
1975 Ga0495650_0145180 3300046471 Bacteria 856
1976 Ga0495650_0192299 3300046471 Bacteria 712
1977 Ga0495580_0027886 3300046472 Bacteria 4107
1978 Ga0495580_0261105 3300046472 Bacteria 1184
1979 Ga0495580_0435841 3300046472 Bacteria 880
1980 Ga0495580_0592501 3300046472 Bacteria 733
1981 Ga0495582_0003714 3300046473 Bacteria 8595
1982 Ga0495582_0016883 3300046473 Bacteria 3997
1983 Ga0495582_0177291 3300046473 Bacteria 1214
1984 Ga0495605_0065783 3300046474 Bacteria 1723
1985 Ga0495605_0072253 3300046474 Bacteria 1627
1986 Ga0495605_0275861 3300046474 Bacteria 715
1987 Ga0495639_0000873 3300046475 Bacteria 13634
1988 Ga0495639_0015371 3300046475 Bacteria 3319
1989 Ga0495639_0204443 3300046475 Bacteria 967
1990 Ga0495639_0506022 3300046475 Bacteria 617
1991 Ga0495639_0706156 3300046475 Bacteria 521
1992 Ga0495662_0000285 3300046476 Bacteria 21823
1993 Ga0495662_0002801 3300046476 Bacteria 8818
1994 Ga0495662_0021621 3300046476 Bacteria 3108
1995 Ga0495662_0074022 3300046476 Bacteria 1652
1996 Ga0495662_0092503 3300046476 Bacteria 1475
1997 Ga0495662_0293495 3300046476 Bacteria 800
1998 Ga0495662_0313606 3300046476 Bacteria 771
1999 Ga0495662_0434232 3300046476 Bacteria 644
2000 Ga0495664_0000023 3300046477 Bacteria 126807
2001 Ga0495664_0018921 3300046477 Bacteria 3953
2002 Ga0495664_0109041 3300046477 Bacteria 1670
2003 Ga0495664_0110835 3300046477 Bacteria 1656
2004 Ga0495664_0419741 3300046477 Bacteria 802
2005 Ga0495584_0241032 3300046491 Bacteria 919
2006 Ga0495584_0426463 3300046491 Bacteria 674
2007 Ga0495585_0214713 3300046492 Bacteria 973
2008 Ga0495585_0312246 3300046492 Bacteria 770
2009 Ga0495594_0043181 3300046499 Bacteria 2470
2010 Ga0495594_0389593 3300046499 Bacteria 793
2011 Ga0495594_0507068 3300046499 Bacteria 685
2012 Ga0495594_0543536 3300046499 Bacteria 659
2013 Ga0495596_0059833 3300046500 Bacteria 1484
2014 Ga0495596_0060438 3300046500 Bacteria 1476
2015 Ga0495596_0098296 3300046500 Bacteria 1136
2016 Ga0495607_0008511 3300046501 Bacteria 7013
2017 Ga0495583_0016744 3300046506 Bacteria 3925
2018 Ga0495583_0042618 3300046506 Bacteria 2118
2019 Ga0495583_0189415 3300046506 Bacteria 839
2020 Ga0495583_0246805 3300046506 Bacteria 716
2021 Ga0495606_0004034 3300046507 Bacteria 14975
2022 Ga0495606_0055089 3300046507 Bacteria 2573
2023 Ga0495606_0171494 3300046507 Bacteria 1258
2024 Ga0495606_0210562 3300046507 Bacteria 1101
2025 Ga0495606_0239139 3300046507 Bacteria 1013
2026 Ga0495606_0245712 3300046507 Bacteria 995
2027 Ga0495608_0000030 3300046511 Bacteria 145828
2028 Ga0495608_0183663 3300046511 Bacteria 1322
2029 Ga0495610_0044062 3300046512 Bacteria 2218
2030 Ga0495610_0049507 3300046512 Bacteria 2057
2031 Ga0495610_0082804 3300046512 Bacteria 1470
2032 Ga0495610_0205408 3300046512 Bacteria 804
2033 Ga0495610_0336899 3300046512 Bacteria 571
2034 Ga0495616_0003845 3300046513 Bacteria 9570
2035 Ga0495616_0110076 3300046513 Bacteria 1280
2036 Ga0495616_0477327 3300046513 Bacteria 501
2037 Ga0495618_0000042 3300046514 Bacteria 96182
2038 Ga0495618_0066890 3300046514 Bacteria 2284
2039 Ga0495618_0179380 3300046514 Bacteria 1346
2040 Ga0495618_0757979 3300046514 Bacteria 567
2041 Ga0495620_0093867 3300046515 Bacteria 1201
2042 Ga0495620_0132167 3300046515 Bacteria 979
2043 Ga0495620_0142281 3300046515 Bacteria 937
2044 Ga0495620_0211242 3300046515 Bacteria 744
2045 Ga0495620_0220024 3300046515 Bacteria 727
2046 Ga0495620_0274713 3300046515 Bacteria 641
2047 Ga0495628_0000027 3300046516 Bacteria 126537
2048 Ga0495628_0028202 3300046516 Bacteria 4563
2049 Ga0495628_0089380 3300046516 Bacteria 2386
2050 Ga0495628_0468073 3300046516 Bacteria 913
2051 Ga0495628_0749326 3300046516 Bacteria 686
2052 Ga0495630_0014365 3300046517 Bacteria 5768
2053 Ga0495630_0016223 3300046517 Bacteria 5443
2054 Ga0495630_0052372 3300046517 Bacteria 3055
2055 Ga0495630_0102585 3300046517 Bacteria 2164
2056 Ga0495630_0441304 3300046517 Bacteria 997
2057 Ga0495630_0493152 3300046517 Bacteria 939
2058 Ga0495630_0518937 3300046517 Bacteria 913
2059 Ga0495630_0666829 3300046517 Bacteria 796
2060 Ga0495630_0945898 3300046517 Bacteria 656
2061 Ga0495631_0040374 3300046518 Bacteria 2067
2062 Ga0495631_0229655 3300046518 Bacteria 791
2063 Ga0495632_0046718 3300046519 Bacteria 2150
2064 Ga0495632_0173899 3300046519 Bacteria 988
2065 Ga0495632_0219705 3300046519 Bacteria 859
2066 Ga0495632_0387584 3300046519 Bacteria 611
2067 Ga0495637_0028843 3300046520 Bacteria 2475
2068 Ga0495637_0115565 3300046520 Bacteria 1036
2069 Ga0495637_0162155 3300046520 Bacteria 838
2070 Ga0495643_0036171 3300046522 Bacteria 2714
2071 Ga0495643_0076910 3300046522 Bacteria 1744
2072 Ga0495643_0099094 3300046522 Bacteria 1495
2073 Ga0495643_0119699 3300046522 Bacteria 1331
2074 Ga0495644_0178757 3300046523 Bacteria 815
2075 Ga0495648_0001935 3300046524 Bacteria 19722
2076 Ga0495648_0008251 3300046524 Bacteria 8213
2077 Ga0495648_0009207 3300046524 Bacteria 7683
2078 Ga0495648_0110031 3300046524 Bacteria 1501
2079 Ga0495648_0195568 3300046524 Bacteria 1016
2080 Ga0495648_0334994 3300046524 Bacteria 696
2081 Ga0495648_0365817 3300046524 Bacteria 654
2082 Ga0495663_0102368 3300046525 Bacteria 944
2083 Ga0495663_0261877 3300046525 Bacteria 616
2084 Ga0495666_0258267 3300046526 Bacteria 793
2085 Ga0495642_0056938 3300046528 Bacteria 1615
2086 Ga0495642_0452373 3300046528 Bacteria 567
2087 Ga0495642_0458950 3300046528 Bacteria 563
2088 Ga0495652_0000041 3300046529 Bacteria 126519
2089 Ga0495652_0026006 3300046529 Bacteria 5172
2090 Ga0495652_0507954 3300046529 Bacteria 835
2091 Ga0495652_0628371 3300046529 Bacteria 729
2092 Ga0495652_0772553 3300046529 Bacteria 641
2093 Ga0495654_0149188 3300046530 Bacteria 1035
2094 Ga0495654_0308599 3300046530 Bacteria 644
2095 Ga0495665_0102699 3300046531 Bacteria 1500
2096 Ga0495665_0139753 3300046531 Bacteria 1266
2097 Ga0495665_0217774 3300046531 Bacteria 987
2098 Ga0495665_0563194 3300046531 Bacteria 571
2099 Ga0495665_0593050 3300046531 Bacteria 554
2100 Ga0495640_0000047 3300046533 Bacteria 64381
2101 Ga0495640_0001806 3300046533 Bacteria 16965
2102 Ga0495640_0121544 3300046533 Bacteria 1697
2103 Ga0495640_0294652 3300046533 Bacteria 1008
2104 Ga0495640_0810857 3300046533 Bacteria 557
2105 Ga0495586_0115273 3300046535 Bacteria 1498
2106 Ga0495586_0223905 3300046535 Bacteria 1069
2107 Ga0495587_0000025 3300046536 Bacteria 147974
2108 Ga0495587_0001671 3300046536 Bacteria 14800
2109 Ga0495587_0166669 3300046536 Bacteria 1252
2110 Ga0495587_0241485 3300046536 Bacteria 1016
2111 Ga0495587_0258062 3300046536 Bacteria 979
2112 Ga0495587_0305682 3300046536 Bacteria 889
2113 Ga0495587_0340791 3300046536 Bacteria 836
2114 Ga0495587_0366718 3300046536 Bacteria 802
2115 Ga0495587_0472976 3300046536 Bacteria 694
2116 Ga0495598_0004295 3300046537 Bacteria 3077
2117 Ga0495598_0049563 3300046537 Bacteria 1260
2118 Ga0495598_0068950 3300046537 Bacteria 1109
2119 Ga0495609_0040821 3300046538 Bacteria 2087
2120 Ga0495609_0098220 3300046538 Bacteria 1269
2121 Ga0495609_0455419 3300046538 Bacteria 508
2122 Ga0495621_0406572 3300046539 Bacteria 578
2123 Ga0495597_0028009 3300046542 Bacteria 2580
2124 Ga0495597_0079183 3300046542 Bacteria 1407
2125 Ga0495597_0087996 3300046542 Bacteria 1321
2126 Ga0495645_0000001 3300046543 Bacteria 657910
2127 Ga0495645_0003533 3300046543 Bacteria 10576
2128 Ga0495645_0040592 3300046543 Bacteria 3394
2129 Ga0495645_0285742 3300046543 Bacteria 1083
2130 Ga0495645_0410787 3300046543 Bacteria 861
2131 Ga0495645_0617201 3300046543 Bacteria 665
2132 Ga0495622_0008764 3300046557 Bacteria 4684
2133 Ga0495622_0188226 3300046557 Bacteria 923
2134 Ga0495622_0216016 3300046557 Bacteria 850
2135 Ga0495622_0526430 3300046557 Bacteria 504
2136 Ga0495633_0130764 3300046558 Bacteria 1161
2137 Ga0495667_0000001 3300046559 Bacteria 834831
2138 Ga0495667_0006602 3300046559 Bacteria 7875
2139 Ga0495667_0082157 3300046559 Bacteria 2094
2140 Ga0495667_0101889 3300046559 Bacteria 1857
2141 Ga0495667_0159647 3300046559 Bacteria 1450
2142 Ga0495667_0175773 3300046559 Bacteria 1375
2143 Ga0495656_0354897 3300046615 Bacteria 760
2144 Ga0495656_0601499 3300046615 Bacteria 588
2145 Ga0495656_0771070 3300046615 Bacteria 519
2146 Ga0495668_0009874 3300046616 Bacteria 5822
2147 Ga0495668_0025870 3300046616 Bacteria 3333
2148 Ga0495668_0051375 3300046616 Bacteria 2282
2149 Ga0495668_0102006 3300046616 Bacteria 1569
2150 Ga0495668_0126353 3300046616 Bacteria 1400
2151 Ga0495668_0512482 3300046616 Bacteria 661
2152 Ga0495668_0548885 3300046616 Bacteria 638
2153 Ga0495668_0583672 3300046616 Bacteria 617
2154 Ga0495634_0002681 3300046642 Bacteria 14628
2155 Ga0495634_0012027 3300046642 Bacteria 6273
2156 Ga0495634_0015564 3300046642 Bacteria 5459
2157 Ga0495634_0017993 3300046642 Bacteria 5035
2158 Ga0495634_0024902 3300046642 Bacteria 4195
2159 Ga0495634_0212514 3300046642 Bacteria 1197
2160 Ga0495634_0346931 3300046642 Bacteria 889
2161 Ga0495634_0534811 3300046642 Bacteria 684
2162 Ga0495611_0089074 3300046648 Bacteria 1425
2163 Ga0495611_0190083 3300046648 Bacteria 958
2164 Ga0495611_0478174 3300046648 Bacteria 567
2165 Ga0495625_0028714 3300046660 Bacteria 4167
2166 Ga0495625_0099034 3300046660 Bacteria 2005
2167 Ga0495625_0152700 3300046660 Bacteria 1551
2168 Ga0495625_0420885 3300046660 Bacteria 831
2169 Ga0495625_0464481 3300046660 Bacteria 779
2170 Ga0495625_0776030 3300046660 Bacteria 559
2171 Ga0495625_0848229 3300046660 Bacteria 527
2172 Ga0495635_0000061 3300046663 Bacteria 66702
2173 Ga0495635_0008691 3300046663 Bacteria 7094
2174 Ga0495635_0043911 3300046663 Bacteria 3083
2175 Ga0495635_0119598 3300046663 Bacteria 1797
2176 Ga0495635_0198757 3300046663 Bacteria 1360
2177 Ga0495635_0251544 3300046663 Bacteria 1191
2178 Ga0495635_0284995 3300046663 Bacteria 1109
2179 Ga0495635_1022245 3300046663 Bacteria 525
2180 Ga0495659_0042970 3300046664 Bacteria 1619
2181 Ga0495661_0011421 3300046665 Bacteria 6028
2182 Ga0495661_0449295 3300046665 Bacteria 620
2183 Ga0495588_0011242 3300046674 Bacteria 4195
2184 Ga0495588_0078052 3300046674 Bacteria 1727
2185 Ga0495588_0087424 3300046674 Bacteria 1630
2186 Ga0495588_0212134 3300046674 Bacteria 1022
2187 Ga0495588_0625837 3300046674 Bacteria 563
2188 Ga0495657_0003632 3300046675 Bacteria 12530
2189 Ga0495657_0011421 3300046675 Bacteria 6638
2190 Ga0495657_0028476 3300046675 Bacteria 3928
2191 Ga0495657_0330552 3300046675 Bacteria 904
2192 Ga0495599_0000021 3300046678 Bacteria 127591
2193 Ga0495599_0006010 3300046678 Bacteria 7303
2194 Ga0495599_0043969 3300046678 Bacteria 2802
2195 Ga0495599_0258708 3300046678 Bacteria 1058
2196 Ga0495599_0543670 3300046678 Bacteria 681
2197 Ga0495599_0712951 3300046678 Bacteria 578
2198 Ga0495623_0001924 3300046679 Bacteria 13947
2199 Ga0495623_0032401 3300046679 Bacteria 3359
2200 Ga0495623_0058044 3300046679 Bacteria 2434
2201 Ga0495623_0137194 3300046679 Bacteria 1459
2202 Ga0495623_0157466 3300046679 Bacteria 1337
2203 Ga0495623_0241606 3300046679 Bacteria 1020
2204 Ga0495623_0330262 3300046679 Bacteria 835
2205 Ga0495623_0540080 3300046679 Bacteria 611
2206 Ga0495646_0000043 3300046680 Bacteria 65914
2207 Ga0495646_0013907 3300046680 Bacteria 5115
2208 Ga0495646_0061035 3300046680 Bacteria 2246
2209 Ga0495647_0005756 3300046681 Bacteria 4074
2210 Ga0495647_0149717 3300046681 Bacteria 1000
2211 Ga0495647_0287566 3300046681 Bacteria 738
2212 Ga0495647_0359811 3300046681 Bacteria 663
2213 Ga0495658_0001480 3300046683 Bacteria 12346
2214 Ga0495658_0100632 3300046683 Bacteria 1725
2215 Ga0495658_0104892 3300046683 Bacteria 1692
2216 Ga0495658_0134261 3300046683 Bacteria 1509
2217 Ga0495658_0156793 3300046683 Bacteria 1401
2218 Ga0495658_0198033 3300046683 Bacteria 1251
2219 Ga0495658_0217508 3300046683 Bacteria 1195
2220 Ga0495669_0022216 3300046684 Bacteria 2755
2221 Ga0495669_0490666 3300046684 Bacteria 597
2222 Ga0495613_0016831 3300046689 Bacteria 5444
2223 Ga0495613_0027017 3300046689 Bacteria 4272
2224 Ga0495613_0042004 3300046689 Bacteria 3384
2225 Ga0495613_0109172 3300046689 Bacteria 1995
2226 Ga0495613_0171729 3300046689 Bacteria 1538
2227 Ga0495613_0278319 3300046689 Bacteria 1162
2228 Ga0495613_0383288 3300046689 Bacteria 961
2229 Ga0495624_0004478 3300046690 Bacteria 10223
2230 Ga0495624_0060556 3300046690 Bacteria 2373
2231 Ga0495624_0099731 3300046690 Bacteria 1788
2232 Ga0495624_0183454 3300046690 Bacteria 1274
2233 Ga0495624_0224765 3300046690 Bacteria 1138
2234 Ga0495624_0319265 3300046690 Bacteria 935
2235 Ga0495624_0407324 3300046690 Bacteria 816
2236 Ga0495670_0018738 3300046691 Bacteria 3409
2237 Ga0495670_0095072 3300046691 Bacteria 1528
2238 Ga0495670_0534415 3300046691 Bacteria 637
2239 Ga0495671_0038068 3300046692 Bacteria 2431
2240 Ga0495671_0085571 3300046692 Bacteria 1544
2241 Ga0495671_0462351 3300046692 Bacteria 606
2242 Ga0495671_0484763 3300046692 Bacteria 590
2243 Ga0495671_0500177 3300046692 Bacteria 580
2244 Ga0495671_0567261 3300046692 Bacteria 540
2245 Ga0495649_0129198 3300046694 Bacteria 1333
2246 Ga0495649_0252029 3300046694 Bacteria 906
2247 Ga0495649_0654985 3300046694 Bacteria 516
2248 Ga0495589_0207415 3300046794 Bacteria 923
2249 Ga0495589_0243512 3300046794 Bacteria 841
2250 Ga0495589_0534740 3300046794 Bacteria 534
2251 Ga0495589_0578861 3300046794 Bacteria 511
2252 Ga0495600_0000082 3300046809 Bacteria 52098
2253 Ga0495600_0004858 3300046809 Bacteria 8070
2254 Ga0495600_0044524 3300046809 Bacteria 2895
2255 Ga0495600_0093094 3300046809 Bacteria 1965
2256 Ga0495600_0099815 3300046809 Bacteria 1892
2257 Ga0495600_0383543 3300046809 Bacteria 876
2258 Ga0495660_0003610 3300046810 Bacteria 9536
2259 Ga0495660_0264468 3300046810 Bacteria 793
2260 Ga0495660_0328297 3300046810 Bacteria 685
2261 Ga0495660_0401886 3300046810 Bacteria 600
2262 Ga0495581_0007052 3300047315 Bacteria 6513
2263 Ga0495581_0033672 3300047315 Bacteria 2966
2264 Ga0495581_0067267 3300047315 Bacteria 2072
2265 Ga0495581_0188883 3300047315 Bacteria 1205
2266 Ga0495581_0363272 3300047315 Bacteria 845
2267 Ga0495581_0513349 3300047315 Bacteria 696
2268 Ga0495581_0849076 3300047315 Bacteria 523
2269 Ga0495604_0000036 3300047317 Bacteria 126707
2270 Ga0495604_0007934 3300047317 Bacteria 8408
2271 Ga0495604_0053710 3300047317 Bacteria 3112
2272 Ga0495604_0070725 3300047317 Bacteria 2641
2273 Ga0495604_0878035 3300047317 Bacteria 561
2274 Ga0495674_0000085 3300047319 Bacteria 65389
2275 Ga0495674_0010137 3300047319 Bacteria 8927
2276 Ga0495674_0122884 3300047319 Bacteria 2192
2277 Ga0495674_0191913 3300047319 Bacteria 1697
2278 Ga0495674_0199546 3300047319 Bacteria 1660
2279 Ga0495674_0389509 3300047319 Bacteria 1126
2280 Ga0495672_0027272 3300047320 Bacteria 3631
2281 Ga0495672_0065891 3300047320 Bacteria 2069
2282 Ga0495672_0093895 3300047320 Bacteria 1641
2283 Ga0495672_0182810 3300047320 Bacteria 1060
2284 Ga0495672_0214983 3300047320 Bacteria 952
2285 Ga0495672_0218062 3300047320 Bacteria 943
2286 Ga0495672_0273951 3300047320 Bacteria 809
2287 Ga0495672_0488415 3300047320 Bacteria 549
2288 Ga0495676_0050306 3300047321 Bacteria 3343
2289 Ga0495676_0076501 3300047321 Bacteria 2555
2290 Ga0495680_0000201 3300047322 Bacteria 64686
2291 Ga0495680_0047015 3300047322 Bacteria 3398
2292 Ga0495680_0057251 3300047322 Bacteria 3015
2293 Ga0495680_0260184 3300047322 Bacteria 1227
2294 Ga0495680_0285058 3300047322 Bacteria 1163
2295 Ga0495680_0503170 3300047322 Bacteria 822
2296 Ga0495680_0758700 3300047322 Bacteria 637
2297 Ga0495683_0045716 3300047323 Bacteria 2199
2298 Ga0495683_0293066 3300047323 Bacteria 701
2299 Ga0495683_0296539 3300047323 Bacteria 695
2300 Ga0495687_016394 3300047443 Bacteria 3727
2301 Ga0495687_223617 3300047443 Bacteria 580
2302 Ga0495675_0000203 3300047444 Bacteria 43496
2303 Ga0495675_0036206 3300047444 Bacteria 3148
2304 Ga0495677_0070052 3300047445 Bacteria 1306
2305 Ga0495677_0266990 3300047445 Bacteria 670
2306 Ga0495677_0293394 3300047445 Bacteria 639
2307 Ga0495685_016652 3300047447 Bacteria 2513
2308 Ga0495685_154188 3300047447 Bacteria 745
2309 Ga0495673_0129223 3300047469 Bacteria 994
2310 Ga0495673_0141055 3300047469 Bacteria 939
2311 Ga0495673_0153252 3300047469 Bacteria 889
2312 Ga0495681_0073986 3300047470 Bacteria 1537
2313 Ga0495684_0000025 3300047471 Bacteria 127037
2314 Ga0495684_0003854 3300047471 Bacteria 11683
2315 Ga0495684_0016236 3300047471 Bacteria 5733
2316 Ga0495684_0194892 3300047471 Bacteria 1496
2317 Ga0495684_0279087 3300047471 Bacteria 1206
2318 Ga0495684_0638408 3300047471 Bacteria 714
2319 Ga0495684_1071616 3300047471 Bacteria 507
2320 Ga0495686_0077875 3300047472 Bacteria 2030
2321 Ga0495686_0095972 3300047472 Bacteria 1795
2322 Ga0495686_0120965 3300047472 Bacteria 1560
2323 Ga0495686_0154337 3300047472 Bacteria 1346
2324 Ga0495686_0169923 3300047472 Bacteria 1268
2325 Ga0495686_0180907 3300047472 Bacteria 1221
2326 Ga0495686_0191451 3300047472 Bacteria 1179
2327 Ga0495686_0270257 3300047472 Bacteria 948
2328 Ga0495593_0001971 3300047673 Bacteria 12228
2329 Ga0495593_0022799 3300047673 Bacteria 3483
2330 Ga0495593_0035110 3300047673 Bacteria 2723
2331 Ga0495593_0084279 3300047673 Bacteria 1641
2332 Ga0495593_0520846 3300047673 Bacteria 596
2333 Ga0495602_0000097 3300048088 Bacteria 82301
2334 Ga0495602_0007161 3300048088 Bacteria 11684
2335 Ga0495602_0098904 3300048088 Bacteria 2399
2336 Ga0495602_0295609 3300048088 Bacteria 1187
2337 Ga0495602_0505015 3300048088 Bacteria 845
2338 Ga0495602_0905648 3300048088 Bacteria 587
2339 Ga0495602_0961577 3300048088 Bacteria 565
2340 Ga0495602_1145540 3300048088 Bacteria 508
2341 Ga0495614_0040170 3300048089 Bacteria 2008
2342 Ga0495614_0069403 3300048089 Bacteria 1518
2343 Ga0495614_0452051 3300048089 Bacteria 608
2344 Ga0495615_0021961 3300048090 Bacteria 1445
2345 Ga0495615_0156677 3300048090 Bacteria 681
2346 Ga0495626_0157839 3300048091 Bacteria 952
2347 Ga0496100_0035790 3300048903 Bacteria 3126
2348 Ga0496100_0088497 3300048903 Bacteria 2108
2349 Ga0496100_0119697 3300048903 Bacteria 1840
2350 Ga0496100_0152162 3300048903 Bacteria 1651
2351 Ga0496100_0160992 3300048903 Bacteria 1609
2352 Ga0496100_0216991 3300048903 Bacteria 1402
2353 Ga0496100_0237583 3300048903 Bacteria 1343
2354 Ga0496100_0349508 3300048903 Bacteria 1116
2355 Ga0496100_0485437 3300048903 Bacteria 950
2356 Ga0496100_0581538 3300048903 Bacteria 868
2357 Ga0496100_0879313 3300048903 Bacteria 703
2358 Ga0496100_1082392 3300048903 Bacteria 631
2359 Ga0496101_0010556 3300048904 Bacteria 6102
2360 Ga0496101_0079348 3300048904 Bacteria 2423
2361 Ga0496101_0093448 3300048904 Bacteria 2240
2362 Ga0496101_0136869 3300048904 Bacteria 1864
2363 Ga0496101_0428488 3300048904 Bacteria 1043
2364 Ga0496101_0498891 3300048904 Bacteria 962
2365 Ga0496101_1047511 3300048904 Bacteria 641
2366 Ga0496102_0023539 3300048905 Bacteria 5472
2367 Ga0496102_0027963 3300048905 Bacteria 5039
2368 Ga0496102_0102590 3300048905 Bacteria 2659
2369 Ga0496102_0102730 3300048905 Bacteria 2657
2370 Ga0496102_0414462 3300048905 Bacteria 1265
2371 Ga0496102_0583139 3300048905 Bacteria 1041
2372 Ga0496102_0637771 3300048905 Bacteria 988
2373 Ga0496102_0770894 3300048905 Bacteria 884
2374 Ga0496102_0802534 3300048905 Bacteria 863
2375 Ga0496102_0985311 3300048905 Bacteria 763
2376 Ga0496102_1171306 3300048905 Bacteria 688
2377 Ga0496102_1391802 3300048905 Bacteria 620
2378 Ga0496103_0181185 3300048906 Bacteria 1354
2379 Ga0496103_0275409 3300048906 Bacteria 1082
2380 Ga0496103_0410830 3300048906 Bacteria 869
2381 Ga0496103_0710108 3300048906 Bacteria 637
2382 Ga0496103_0841358 3300048906 Bacteria 577
2383 Ga0496104_0001364 3300048907 Bacteria 21131
2384 Ga0496104_0044527 3300048907 Bacteria 4169
2385 Ga0496104_0044528 3300048907 Bacteria 4169
2386 Ga0496104_0052677 3300048907 Bacteria 3844
2387 Ga0496104_0072619 3300048907 Bacteria 3272
2388 Ga0496104_0127143 3300048907 Bacteria 2448
2389 Ga0496104_0184939 3300048907 Bacteria 1994
2390 Ga0496104_0185228 3300048907 Bacteria 1993
2391 Ga0496104_1490835 3300048907 Bacteria 579
2392 Ga0496104_1575931 3300048907 Bacteria 559
2393 Ga0496104_1589499 3300048907 Bacteria 556
2394 Ga0496105_0005504 3300048908 Bacteria 9611
2395 Ga0496105_0081763 3300048908 Bacteria 2668
2396 Ga0496105_0145835 3300048908 Bacteria 1946
2397 Ga0496105_0151601 3300048908 Bacteria 1905
2398 Ga0496105_0180428 3300048908 Bacteria 1729
2399 Ga0496105_0277341 3300048908 Bacteria 1352
2400 Ga0496105_0495959 3300048908 Bacteria 959
2401 Ga0496105_0733618 3300048908 Bacteria 756
2402 Ga0496106_0049371 3300048909 Bacteria 3169
2403 Ga0496106_0070652 3300048909 Bacteria 2667
2404 Ga0496106_0121368 3300048909 Bacteria 2043
2405 Ga0496106_0128174 3300048909 Bacteria 1988
2406 Ga0496106_0173107 3300048909 Bacteria 1712
2407 Ga0496106_0193854 3300048909 Bacteria 1616
2408 Ga0496106_0848323 3300048909 Bacteria 723
2409 Ga0496106_0851508 3300048909 Bacteria 721
2410 Ga0496106_0921112 3300048909 Bacteria 689
2411 Ga0496106_1038912 3300048909 Bacteria 643
2412 Ga0496107_0083656 3300048910 Bacteria 2327
2413 Ga0496107_0098790 3300048910 Bacteria 2138
2414 Ga0496107_0106154 3300048910 Bacteria 2062
2415 Ga0496107_0118596 3300048910 Bacteria 1948
2416 Ga0496107_0133717 3300048910 Bacteria 1832
2417 Ga0496107_0253130 3300048910 Bacteria 1310
2418 Ga0496107_0255510 3300048910 Bacteria 1304
2419 Ga0496107_0357609 3300048910 Bacteria 1086
2420 Ga0496107_0544210 3300048910 Bacteria 860
2421 Ga0496107_0581871 3300048910 Bacteria 828
2422 Ga0496108_0001133 3300048911 Bacteria 20819
2423 Ga0496108_0002766 3300048911 Bacteria 14044
2424 Ga0496108_0002874 3300048911 Bacteria 13813
2425 Ga0496108_0051813 3300048911 Bacteria 3438
2426 Ga0496108_0239034 3300048911 Bacteria 1580
2427 Ga0496108_0339058 3300048911 Bacteria 1311
2428 Ga0496108_0426400 3300048911 Bacteria 1158
2429 Ga0496108_0857862 3300048911 Bacteria 781
2430 Ga0496108_1375270 3300048911 Bacteria 591
2431 Ga0496108_1746145 3300048911 Bacteria 511
2432 Ga0496109_0000518 3300048912 Bacteria 32691
2433 Ga0496109_0000583 3300048912 Bacteria 30510
2434 Ga0496109_0029436 3300048912 Bacteria 4918
2435 Ga0496109_0079258 3300048912 Bacteria 3026
2436 Ga0496109_0096767 3300048912 Bacteria 2735
2437 Ga0496109_0171332 3300048912 Bacteria 2036
2438 Ga0496109_0243041 3300048912 Bacteria 1694
2439 Ga0496109_0246023 3300048912 Bacteria 1684
2440 Ga0496109_0303624 3300048912 Bacteria 1505
2441 Ga0496109_0345396 3300048912 Bacteria 1405
2442 Ga0496109_0401616 3300048912 Bacteria 1295
2443 Ga0496109_0436687 3300048912 Bacteria 1237
2444 Ga0496109_0622824 3300048912 Bacteria 1016
2445 Ga0496110_0008141 3300048913 Bacteria 8422
2446 Ga0496110_0010849 3300048913 Bacteria 7430
2447 Ga0496110_0029991 3300048913 Bacteria 4686
2448 Ga0496110_0054594 3300048913 Bacteria 3514
2449 Ga0496110_0071081 3300048913 Bacteria 3084
2450 Ga0496110_0083170 3300048913 Bacteria 2855
2451 Ga0496110_0177885 3300048913 Bacteria 1931
2452 Ga0496110_0219578 3300048913 Bacteria 1728
2453 Ga0496110_0225608 3300048913 Bacteria 1703
2454 Ga0496110_0322872 3300048913 Bacteria 1406
2455 Ga0496110_0592547 3300048913 Bacteria 1006
2456 Ga0496110_1103524 3300048913 Bacteria 701
2457 Ga0496110_1752566 3300048913 Bacteria 531
2458 Ga0496111_0009370 3300048914 Bacteria 6529
2459 Ga0496111_0023962 3300048914 Bacteria 4291
2460 Ga0496111_0035111 3300048914 Bacteria 3582
2461 Ga0496111_0302092 3300048914 Bacteria 1186
2462 Ga0496111_0342865 3300048914 Bacteria 1106
2463 Ga0496111_0517492 3300048914 Bacteria 877
2464 Ga0496111_0850312 3300048914 Bacteria 659
2465 Ga0496111_0973606 3300048914 Bacteria 609
2466 Ga0496111_1320906 3300048914 Bacteria 507
2467 Ga0496112_0000021 3300048915 Bacteria 156561
2468 Ga0496112_0000884 3300048915 Bacteria 21517
2469 Ga0496112_0046042 3300048915 Bacteria 4277
2470 Ga0496112_0056801 3300048915 Bacteria 3853
2471 Ga0496112_0059398 3300048915 Bacteria 3767
2472 Ga0496112_0065844 3300048915 Bacteria 3576
2473 Ga0496112_0104148 3300048915 Bacteria 2808
2474 Ga0496112_0141441 3300048915 Bacteria 2375
2475 Ga0496112_0177290 3300048915 Bacteria 2096
2476 Ga0496112_0197416 3300048915 Bacteria 1972
2477 Ga0496112_0407654 3300048915 Bacteria 1299
2478 Ga0496112_1027515 3300048915 Bacteria 744
2479 Ga0496112_1121497 3300048915 Bacteria 704
2480 Ga0496112_1438991 3300048915 Bacteria 603
2481 Ga0496113_0000351 3300048916 Bacteria 22021
2482 Ga0496113_0004259 3300048916 Bacteria 8765
2483 Ga0496113_0045614 3300048916 Bacteria 3251
2484 Ga0496113_0194043 3300048916 Bacteria 1613
2485 Ga0496113_0291233 3300048916 Bacteria 1306
2486 Ga0496113_0300005 3300048916 Bacteria 1286
2487 Ga0496113_0349744 3300048916 Bacteria 1185
2488 Ga0496113_0448451 3300048916 Bacteria 1037
2489 Ga0496113_0984221 3300048916 Bacteria 665
2490 Ga0496114_0033385 3300048917 Bacteria 4240
2491 Ga0496114_0113437 3300048917 Bacteria 2323
2492 Ga0496114_0202463 3300048917 Bacteria 1739
2493 Ga0496114_0236533 3300048917 Bacteria 1605
2494 Ga0496114_0241490 3300048917 Bacteria 1588
2495 Ga0496114_0321966 3300048917 Bacteria 1366
2496 Ga0496114_0327954 3300048917 Bacteria 1353
2497 Ga0496114_0403592 3300048917 Bacteria 1210
2498 Ga0496114_0465056 3300048917 Bacteria 1119
2499 Ga0496114_1310650 3300048917 Bacteria 611
2500 Ga0496114_1643310 3300048917 Bacteria 530
2501 Ga0496115_0004536 3300048918 Bacteria 10046
2502 Ga0496115_0009751 3300048918 Bacteria 7152
2503 Ga0496115_0042706 3300048918 Bacteria 3613
2504 Ga0496115_0047471 3300048918 Bacteria 3434
2505 Ga0496115_0060839 3300048918 Bacteria 3043
2506 Ga0496115_0075134 3300048918 Bacteria 2744
2507 Ga0496115_0099139 3300048918 Bacteria 2387
2508 Ga0496115_0145791 3300048918 Bacteria 1954
2509 Ga0496115_0210668 3300048918 Bacteria 1605
2510 Ga0496115_0388374 3300048918 Bacteria 1134
2511 Ga0496115_0732703 3300048918 Bacteria 774
2512 Ga0496115_0765468 3300048918 Bacteria 754
2513 Ga0496115_0833955 3300048918 Bacteria 715
2514 Ga0496115_0906189 3300048918 Bacteria 679
2515 Ga0496115_1089972 3300048918 Bacteria 606
2516 Ga0496115_1111877 3300048918 Bacteria 598
2517 Ga0496115_1453319 3300048918 Bacteria 504
2518 Ga0496116_0085071 3300048919 Bacteria 1945
2519 Ga0496116_0126100 3300048919 Bacteria 1470
2520 Ga0496116_0143324 3300048919 Bacteria 1340
2521 Ga0496116_0306142 3300048919 Bacteria 753
2522 Ga0496117_0077305 3300048920 Bacteria 2203
2523 Ga0496117_0096386 3300048920 Bacteria 1887
2524 Ga0496117_0172110 3300048920 Bacteria 1255
2525 Ga0496117_0176650 3300048920 Bacteria 1233
2526 Ga0496117_0395120 3300048920 Bacteria 699
2527 Ga0496118_0024920 3300048921 Bacteria 5148
2528 Ga0496118_0034842 3300048921 Bacteria 4099
2529 Ga0496118_0073065 3300048921 Bacteria 2459
2530 Ga0496118_0130792 3300048921 Bacteria 1612
2531 Ga0496118_0181672 3300048921 Bacteria 1270
2532 Ga0496118_0270072 3300048921 Bacteria 953
2533 Ga0496118_0276471 3300048921 Bacteria 937
2534 Ga0496119_0000372 3300048922 Bacteria 62094
2535 Ga0496119_0004353 3300048922 Bacteria 14129
2536 Ga0496119_0044370 3300048922 Bacteria 2800
2537 Ga0496119_0104005 3300048922 Bacteria 1589
2538 Ga0496119_0168772 3300048922 Bacteria 1157
2539 Ga0496119_0229145 3300048922 Bacteria 947
2540 Ga0496119_0233228 3300048922 Bacteria 935
2541 Ga0496120_0084130 3300048923 Bacteria 1716
2542 Ga0496120_0085830 3300048923 Bacteria 1693
2543 Ga0496121_0002196 3300048924 Bacteria 30506
2544 Ga0496121_0003067 3300048924 Bacteria 24202
2545 Ga0496121_0003703 3300048924 Bacteria 21450
2546 Ga0496121_0015937 3300048924 Bacteria 7805
2547 Ga0496121_0035490 3300048924 Bacteria 4468
2548 Ga0496121_0036137 3300048924 Bacteria 4407
2549 Ga0496121_0076984 3300048924 Bacteria 2658
2550 Ga0496121_0182979 3300048924 Bacteria 1510
2551 Ga0496121_0354228 3300048924 Bacteria 976
2552 Ga0496121_0355616 3300048924 Bacteria 974
2553 Ga0496121_0491220 3300048924 Bacteria 781
2554 Ga0496121_0593740 3300048924 Bacteria 685
2555 Ga0496121_0713457 3300048924 Bacteria 601
2556 Ga0496122_0041314 3300048925 Bacteria 3648
2557 Ga0496122_0041350 3300048925 Bacteria 3646
2558 Ga0496122_0059674 3300048925 Bacteria 2814
2559 Ga0496122_0118757 3300048925 Bacteria 1712
2560 Ga0496122_0161080 3300048925 Bacteria 1368
2561 Ga0496122_0229925 3300048925 Bacteria 1055
2562 Ga0496123_0008564 3300048926 Bacteria 9374
2563 Ga0496123_0017126 3300048926 Bacteria 5847
2564 Ga0496123_0024974 3300048926 Bacteria 4520
2565 Ga0496123_0183037 3300048926 Bacteria 1092
2566 Ga0496123_0191833 3300048926 Bacteria 1056
2567 Ga0496123_0294386 3300048926 Bacteria 778
2568 Ga0496123_0417924 3300048926 Bacteria 605
2569 Ga0496124_0037995 3300048927 Bacteria 4182
2570 Ga0496124_0046215 3300048927 Bacteria 3729
2571 Ga0496124_0263591 3300048927 Bacteria 1266
2572 Ga0496124_0267287 3300048927 Bacteria 1254
2573 Ga0496125_0017448 3300048928 Bacteria 6842
2574 Ga0496125_0023890 3300048928 Bacteria 5632
2575 Ga0496125_0047198 3300048928 Bacteria 3604
2576 Ga0496125_0061489 3300048928 Bacteria 3011
2577 Ga0496125_0088687 3300048928 Bacteria 2330
2578 Ga0496125_0166167 3300048928 Bacteria 1490
2579 Ga0496125_0211880 3300048928 Bacteria 1257
2580 Ga0496125_0219466 3300048928 Bacteria 1226
2581 Ga0496125_0268923 3300048928 Bacteria 1063
2582 Ga0496125_0397586 3300048928 Bacteria 806
2583 Ga0496125_0476991 3300048928 Bacteria 708
2584 Ga0496125_0675543 3300048928 Bacteria 552
2585 Ga0496125_0758794 3300048928 Bacteria 507
2586 Ga0496126_0044627 3300048929 Bacteria 4080
2587 Ga0496126_0052029 3300048929 Bacteria 3725
2588 Ga0496126_0076584 3300048929 Bacteria 2967
2589 Ga0496126_0077021 3300048929 Bacteria 2957
2590 Ga0496126_0079188 3300048929 Bacteria 2909
2591 Ga0496126_0088438 3300048929 Bacteria 2728
2592 Ga0496126_0157561 3300048929 Bacteria 1942
2593 Ga0496126_0167062 3300048929 Bacteria 1877
2594 Ga0496126_0170947 3300048929 Bacteria 1851
2595 Ga0496126_0183935 3300048929 Bacteria 1773
2596 Ga0496126_0185973 3300048929 Bacteria 1762
2597 Ga0496126_0205918 3300048929 Bacteria 1658
2598 Ga0496126_0212667 3300048929 Bacteria 1627
2599 Ga0496126_0248935 3300048929 Bacteria 1481
2600 Ga0496126_0355442 3300048929 Bacteria 1197
2601 Ga0496126_0373358 3300048929 Bacteria 1162
2602 Ga0496126_0444285 3300048929 Bacteria 1045
2603 Ga0496126_0499311 3300048929 Bacteria 972
2604 Ga0501306_004939 3300049127 Bacteria 1511
2605 Ga0501305_034396 3300049161 Bacteria 803
2606 Ga0501305_046581 3300049161 Bacteria 718
2607 Ga0501305_075968 3300049161 Bacteria 597
2608 Ga0501307_082940 3300049162 Bacteria 526
2609 Ga0495678_083750 3300049459 Bacteria 1139
2610 Ga0495678_091849 3300049459 Bacteria 1067
2611 Ga0495678_181289 3300049459 Bacteria 660
2612 Ga0495682_0007189 3300049460 Bacteria 4447
2613 Ga0495682_0373080 3300049460 Bacteria 502
2614 Ga0501311_021240 3300049527 Bacteria 884
2615 Ga0501312_002347 3300049528 Bacteria 2034
2616 Ga0501314_000558 3300049530 Bacteria 2349
2617 Ga0501317_089506 3300049533 Bacteria 543
2618 Ga0501320_033628 3300049536 Bacteria 648
2619 Ga0501321_000893 3300049537 Bacteria 2162
2620 Ga0501322_018263 3300049538 Bacteria 599
2621 Ga0501323_002733 3300049539 Bacteria 1741
2622 Ga0501335_004298 3300049551 Bacteria 1239
2623 Ga0501336_008946 3300049552 Bacteria 783
2624 Ga0501338_09103 3300049554 Bacteria 658
2625 Ga0501031_0011241 3300049568 Bacteria 5833
2626 Ga0501031_0012984 3300049568 Bacteria 5436
2627 Ga0501031_0104462 3300049568 Bacteria 1849
2628 Ga0501031_0110797 3300049568 Bacteria 1792
2629 Ga0501031_0184503 3300049568 Bacteria 1363
2630 Ga0501031_0195437 3300049568 Bacteria 1320
2631 Ga0501031_0203443 3300049568 Bacteria 1291
2632 Ga0501031_0310647 3300049568 Bacteria 1021
2633 Ga0501031_0631414 3300049568 Bacteria 689
2634 Ga0501031_0644829 3300049568 Bacteria 681
2635 Ga0501031_0783196 3300049568 Bacteria 612
2636 Ga0501031_0868684 3300049568 Bacteria 578
2637 Ga0501032_0008814 3300049569 Bacteria 7337
2638 Ga0501032_0041259 3300049569 Bacteria 3135
2639 Ga0501032_0057754 3300049569 Bacteria 2606
2640 Ga0501032_0071493 3300049569 Bacteria 2312
2641 Ga0501032_0102312 3300049569 Bacteria 1898
2642 Ga0501032_0114075 3300049569 Bacteria 1787
2643 Ga0501032_0119514 3300049569 Bacteria 1742
2644 Ga0501032_0147201 3300049569 Bacteria 1550
2645 Ga0501032_0208489 3300049569 Bacteria 1274
2646 Ga0501032_0498193 3300049569 Bacteria 779
2647 Ga0501032_0719996 3300049569 Bacteria 632
2648 Ga0501032_0757010 3300049569 Bacteria 614
2649 Ga0501032_0886087 3300049569 Bacteria 562
2650 Ga0501032_0922874 3300049569 Bacteria 549
2651 Ga0501033_0000094 3300049570 Bacteria 84669
2652 Ga0501033_0003899 3300049570 Bacteria 12129
2653 Ga0501033_0014504 3300049570 Bacteria 5982
2654 Ga0501033_0021359 3300049570 Bacteria 4883
2655 Ga0501033_0077789 3300049570 Bacteria 2434
2656 Ga0501033_0164166 3300049570 Bacteria 1597
2657 Ga0501033_0174136 3300049570 Bacteria 1545
2658 Ga0501033_0350776 3300049570 Bacteria 1034
2659 Ga0501033_0397762 3300049570 Bacteria 961
2660 Ga0501033_0929724 3300049570 Bacteria 583
2661 Ga0501034_0000021 3300049571 Bacteria 266023
2662 Ga0501034_0014685 3300049571 Bacteria 8064
2663 Ga0501034_0046023 3300049571 Bacteria 4408
2664 Ga0501034_0058496 3300049571 Bacteria 3874
2665 Ga0501034_0060811 3300049571 Bacteria 3794
2666 Ga0501034_0064071 3300049571 Bacteria 3689
2667 Ga0501034_0084273 3300049571 Bacteria 3180
2668 Ga0501034_0109871 3300049571 Bacteria 2748
2669 Ga0501034_0148760 3300049571 Bacteria 2318
2670 Ga0501034_0191684 3300049571 Bacteria 2006
2671 Ga0501034_0672583 3300049571 Bacteria 935
2672 Ga0501034_0770254 3300049571 Bacteria 857
2673 Ga0501034_0900539 3300049571 Bacteria 772
2674 Ga0501034_0931809 3300049571 Bacteria 755
2675 Ga0501034_1018586 3300049571 Bacteria 711
2676 Ga0501034_1198498 3300049571 Bacteria 638
2677 Ga0501034_1455684 3300049571 Bacteria 559
2678 Ga0501034_1515394 3300049571 Bacteria 544
2679 Ga0501034_1601856 3300049571 Bacteria 524
2680 Ga0501036_0001704 3300049572 Bacteria 17077
2681 Ga0501036_0042438 3300049572 Bacteria 3851
2682 Ga0501036_0042790 3300049572 Bacteria 3834
2683 Ga0501036_0071269 3300049572 Bacteria 2938
2684 Ga0501036_0088809 3300049572 Bacteria 2612
2685 Ga0501036_0144666 3300049572 Bacteria 2005
2686 Ga0501036_0261255 3300049572 Bacteria 1450
2687 Ga0501036_0279746 3300049572 Bacteria 1396
2688 Ga0501036_0614306 3300049572 Bacteria 901
2689 Ga0501036_0654004 3300049572 Bacteria 870
2690 Ga0501036_0778432 3300049572 Bacteria 788
2691 Ga0501036_1135559 3300049572 Bacteria 638
2692 Ga0501036_1355088 3300049572 Bacteria 577
2693 Ga0501036_1433373 3300049572 Bacteria 559
2694 Ga0501037_0000450 3300049573 Bacteria 33712
2695 Ga0501037_0001434 3300049573 Bacteria 17494
2696 Ga0501037_0038500 3300049573 Bacteria 3522
2697 Ga0501037_0057990 3300049573 Bacteria 2826
2698 Ga0501037_0067461 3300049573 Bacteria 2605
2699 Ga0501037_0069851 3300049573 Bacteria 2556
2700 Ga0501037_0176514 3300049573 Bacteria 1517
2701 Ga0501037_0201488 3300049573 Bacteria 1406
2702 Ga0501037_0213101 3300049573 Bacteria 1361
2703 Ga0501037_0323907 3300049573 Bacteria 1067
2704 Ga0501037_0400122 3300049573 Bacteria 942
2705 Ga0501037_0476031 3300049573 Bacteria 849
2706 Ga0501037_0764502 3300049573 Bacteria 640
2707 Ga0501038_0000052 3300049574 Bacteria 94841
2708 Ga0501038_0012441 3300049574 Bacteria 7775
2709 Ga0501038_0047138 3300049574 Bacteria 3734
2710 Ga0501038_0080606 3300049574 Bacteria 2743
2711 Ga0501038_0111161 3300049574 Bacteria 2270
2712 Ga0501038_0135386 3300049574 Bacteria 2019
2713 Ga0501038_0149812 3300049574 Bacteria 1902
2714 Ga0501038_0167309 3300049574 Bacteria 1782
2715 Ga0501038_0227511 3300049574 Bacteria 1486
2716 Ga0501038_0269158 3300049574 Bacteria 1344
2717 Ga0501038_0326774 3300049574 Bacteria 1199
2718 Ga0501038_0362308 3300049574 Bacteria 1127
2719 Ga0501038_0410651 3300049574 Bacteria 1046
2720 Ga0501038_0610355 3300049574 Bacteria 824
2721 Ga0501038_0686047 3300049574 Bacteria 768
2722 Ga0501038_0751558 3300049574 Bacteria 727
2723 Ga0501038_0859514 3300049574 Bacteria 671
2724 Ga0501038_0969005 3300049574 Bacteria 625
2725 Ga0501039_0000549 3300049575 Bacteria 27168
2726 Ga0501039_0020478 3300049575 Bacteria 5069
2727 Ga0501039_0021292 3300049575 Bacteria 4976
2728 Ga0501039_0082862 3300049575 Bacteria 2497
2729 Ga0501039_0169281 3300049575 Bacteria 1718
2730 Ga0501039_0275222 3300049575 Bacteria 1323
2731 Ga0501040_0066801 3300049576 Bacteria 2477
2732 Ga0501040_0071797 3300049576 Bacteria 2390
2733 Ga0501040_0390975 3300049576 Bacteria 998
2734 Ga0501040_0905237 3300049576 Bacteria 639
2735 Ga0501040_1275534 3300049576 Bacteria 533
2736 Ga0501041_0008356 3300049577 Bacteria 6089
2737 Ga0501041_0037287 3300049577 Bacteria 2946
2738 Ga0501041_0052753 3300049577 Bacteria 2479
2739 Ga0501041_0266619 3300049577 Bacteria 1077
2740 Ga0501042_0087473 3300049578 Bacteria 2235
2741 Ga0501042_0152972 3300049578 Bacteria 1663
2742 Ga0501042_0286752 3300049578 Bacteria 1189
2743 Ga0501042_0327856 3300049578 Bacteria 1106
2744 Ga0501042_0461300 3300049578 Bacteria 921
2745 Ga0501042_0559276 3300049578 Bacteria 831
2746 Ga0501042_0717109 3300049578 Bacteria 727
2747 Ga0501043_0005051 3300049579 Bacteria 10670
2748 Ga0501043_0013010 3300049579 Bacteria 6505
2749 Ga0501043_0032226 3300049579 Bacteria 4119
2750 Ga0501043_0099730 3300049579 Bacteria 2283
2751 Ga0501043_0100195 3300049579 Bacteria 2277
2752 Ga0501043_0113233 3300049579 Bacteria 2130
2753 Ga0501043_0124264 3300049579 Bacteria 2023
2754 Ga0501043_0124806 3300049579 Bacteria 2018
2755 Ga0501043_0219927 3300049579 Bacteria 1470
2756 Ga0501043_0404889 3300049579 Bacteria 1030
2757 Ga0501043_0887907 3300049579 Bacteria 640
2758 Ga0501046_0002237 3300049580 Bacteria 18256
2759 Ga0501046_0141630 3300049580 Bacteria 1819
2760 Ga0501046_0198035 3300049580 Bacteria 1495
2761 Ga0501046_0258698 3300049580 Bacteria 1279
2762 Ga0501046_0371363 3300049580 Bacteria 1036
2763 Ga0501046_0498239 3300049580 Bacteria 872
2764 Ga0501046_0781975 3300049580 Bacteria 669
2765 Ga0501047_0005487 3300049581 Bacteria 11930
2766 Ga0501047_0017348 3300049581 Bacteria 6894
2767 Ga0501047_0044775 3300049581 Bacteria 4277
2768 Ga0501047_0050813 3300049581 Bacteria 4003
2769 Ga0501047_0074273 3300049581 Bacteria 3273
2770 Ga0501047_0077925 3300049581 Bacteria 3187
2771 Ga0501047_0103854 3300049581 Bacteria 2722
2772 Ga0501047_0108871 3300049581 Bacteria 2653
2773 Ga0501047_0114057 3300049581 Bacteria 2584
2774 Ga0501047_0126939 3300049581 Bacteria 2431
2775 Ga0501047_0158759 3300049581 Bacteria 2133
2776 Ga0501047_0385475 3300049581 Bacteria 1235
2777 Ga0501047_0409881 3300049581 Bacteria 1188
2778 Ga0501047_0481806 3300049581 Bacteria 1068
2779 Ga0501048_0001862 3300049582 Bacteria 16006
2780 Ga0501048_0023502 3300049582 Bacteria 4503
2781 Ga0501048_0127521 3300049582 Bacteria 1799
2782 Ga0501048_0235364 3300049582 Bacteria 1299
2783 Ga0501048_0266445 3300049582 Bacteria 1217
2784 Ga0501048_0498498 3300049582 Bacteria 873
2785 Ga0501048_0542144 3300049582 Bacteria 834
2786 Ga0501048_0557274 3300049582 Bacteria 822
2787 Ga0501048_0598547 3300049582 Bacteria 791
2788 Ga0501048_0631428 3300049582 Bacteria 769
2789 Ga0501048_0700863 3300049582 Bacteria 727
2790 Ga0501048_1129912 3300049582 Bacteria 564
2791 Ga0501067_0001840 3300049583 Bacteria 11669
2792 Ga0501067_0006170 3300049583 Bacteria 6642
2793 Ga0501067_0125522 3300049583 Bacteria 1428
2794 Ga0501067_0321809 3300049583 Bacteria 861
2795 Ga0501067_0522488 3300049583 Bacteria 664
2796 Ga0501068_0001049 3300049584 Bacteria 14641
2797 Ga0501068_0122438 3300049584 Bacteria 1623
2798 Ga0501068_0242940 3300049584 Bacteria 1146
2799 Ga0501068_0278551 3300049584 Bacteria 1069
2800 Ga0501068_0408413 3300049584 Bacteria 876
2801 Ga0501068_0577302 3300049584 Bacteria 732
2802 Ga0501068_0980276 3300049584 Bacteria 557
2803 Ga0501068_1077660 3300049584 Bacteria 531
2804 Ga0501069_0008119 3300049585 Bacteria 5516
2805 Ga0501069_0040203 3300049585 Bacteria 2585
2806 Ga0501069_0071498 3300049585 Bacteria 1944
2807 Ga0501069_0154720 3300049585 Bacteria 1319
2808 Ga0501069_0169006 3300049585 Bacteria 1261
2809 Ga0501069_0174695 3300049585 Bacteria 1240
2810 Ga0501069_0371545 3300049585 Bacteria 844
2811 Ga0501069_0981888 3300049585 Bacteria 515
2812 Ga0501070_0025506 3300049586 Bacteria 4958
2813 Ga0501070_0033678 3300049586 Bacteria 4287
2814 Ga0501070_0298016 3300049586 Bacteria 1314
2815 Ga0501070_0370172 3300049586 Bacteria 1161
2816 Ga0501070_0394277 3300049586 Bacteria 1120
2817 Ga0501070_0403736 3300049586 Bacteria 1105
2818 Ga0501070_0816675 3300049586 Bacteria 731
2819 Ga0501070_1498450 3300049586 Bacteria 510
2820 Ga0501071_0014068 3300049587 Bacteria 5468
2821 Ga0501071_0024767 3300049587 Bacteria 4198
2822 Ga0501071_0038781 3300049587 Bacteria 3405
2823 Ga0501071_0092379 3300049587 Bacteria 2224
2824 Ga0501071_0096589 3300049587 Bacteria 2175
2825 Ga0501071_0429895 3300049587 Bacteria 1009
2826 Ga0501071_0570332 3300049587 Bacteria 870
2827 Ga0501071_1187398 3300049587 Bacteria 589
2828 Ga0501072_0002634 3300049588 Bacteria 13457
2829 Ga0501072_0008088 3300049588 Bacteria 7980
2830 Ga0501072_0031734 3300049588 Bacteria 4137
2831 Ga0501072_0060779 3300049588 Bacteria 2979
2832 Ga0501072_0392368 3300049588 Bacteria 1101
2833 Ga0501072_0620249 3300049588 Bacteria 852
2834 Ga0501072_0864300 3300049588 Bacteria 707
2835 Ga0501073_0000597 3300049589 Bacteria 25445
2836 Ga0501073_0023164 3300049589 Bacteria 4463
2837 Ga0501073_0039588 3300049589 Bacteria 3338
2838 Ga0501073_0042595 3300049589 Bacteria 3203
2839 Ga0501073_0194893 3300049589 Bacteria 1401
2840 Ga0501073_0225787 3300049589 Bacteria 1294
2841 Ga0501073_0664027 3300049589 Bacteria 719
2842 Ga0501073_0673821 3300049589 Bacteria 714
2843 Ga0501074_0000285 3300049590 Bacteria 29182
2844 Ga0501074_0015922 3300049590 Bacteria 5469
2845 Ga0501074_0026693 3300049590 Bacteria 4187
2846 Ga0501074_0052758 3300049590 Bacteria 2934
2847 Ga0501074_0328523 3300049590 Bacteria 1086
2848 Ga0501074_0590019 3300049590 Bacteria 786
2849 Ga0501074_0964873 3300049590 Bacteria 600
2850 Ga0501075_0147221 3300049591 Bacteria 1795
2851 Ga0501075_0174647 3300049591 Bacteria 1640
2852 Ga0501075_0365070 3300049591 Bacteria 1100
2853 Ga0501075_0766380 3300049591 Bacteria 734
2854 Ga0501075_0815795 3300049591 Bacteria 710
2855 Ga0501075_1370027 3300049591 Bacteria 536
2856 Ga0501076_0081388 3300049592 Bacteria 2600
2857 Ga0501076_0083103 3300049592 Bacteria 2571
2858 Ga0501076_1548053 3300049592 Bacteria 544
2859 Ga0501076_1569314 3300049592 Bacteria 540
2860 Ga0501077_0028790 3300049593 Bacteria 3531
2861 Ga0501077_0065891 3300049593 Bacteria 2297
2862 Ga0501077_0150192 3300049593 Bacteria 1478
2863 Ga0501077_0671751 3300049593 Bacteria 666
2864 Ga0501206_071618 3300049653 Bacteria 588
2865 Ga0501238_011952 3300049671 Bacteria 1171
2866 Ga0501246_040308 3300049676 Bacteria 557
2867 Ga0501079_0008121 3300049741 Bacteria 7953
2868 Ga0501079_0024576 3300049741 Bacteria 4623
2869 Ga0501079_0041571 3300049741 Bacteria 3549
2870 Ga0501079_0091837 3300049741 Bacteria 2352
2871 Ga0501079_0302378 3300049741 Bacteria 1252
2872 Ga0501080_0080992 3300049742 Bacteria 3017
2873 Ga0501080_0085085 3300049742 Bacteria 2938
2874 Ga0501080_0090495 3300049742 Bacteria 2842
2875 Ga0501080_0137367 3300049742 Bacteria 2261
2876 Ga0501080_0336362 3300049742 Bacteria 1365
2877 Ga0501080_0703471 3300049742 Bacteria 891
2878 Ga0501080_0902830 3300049742 Bacteria 770
2879 Ga0501080_0939188 3300049742 Bacteria 752
2880 Ga0501080_1014730 3300049742 Bacteria 719
2881 Ga0501081_0047513 3300049743 Bacteria 2953
2882 Ga0501081_0187881 3300049743 Bacteria 1495
2883 Ga0501081_0369450 3300049743 Bacteria 1059
2884 Ga0501081_1356655 3300049743 Bacteria 539
2885 Ga0501083_0005133 3300049744 Bacteria 9268
2886 Ga0501083_0008114 3300049744 Bacteria 7426
2887 Ga0501083_0044999 3300049744 Bacteria 2987
2888 Ga0501083_0137926 3300049744 Bacteria 1597
2889 Ga0501083_0177349 3300049744 Bacteria 1392
2890 Ga0501083_0265639 3300049744 Bacteria 1116
2891 Ga0501083_0285372 3300049744 Bacteria 1073
2892 Ga0501083_0615232 3300049744 Bacteria 707
2893 Ga0501035_0000255 3300049822 Bacteria 63841
2894 Ga0501035_0131180 3300049822 Bacteria 2184
2895 Ga0501035_0137115 3300049822 Bacteria 2129
2896 Ga0501035_0143633 3300049822 Bacteria 2073
2897 Ga0501035_0177156 3300049822 Bacteria 1838
2898 Ga0501035_0188785 3300049822 Bacteria 1772
2899 Ga0501035_0260591 3300049822 Bacteria 1470
2900 Ga0501035_0291016 3300049822 Bacteria 1378
2901 Ga0501035_0307534 3300049822 Bacteria 1334
2902 Ga0501035_0430080 3300049822 Bacteria 1095
2903 Ga0501035_0442935 3300049822 Bacteria 1075
2904 Ga0501035_0626559 3300049822 Bacteria 874
2905 Ga0501035_0778968 3300049822 Bacteria 765
2906 Ga0501035_0883215 3300049822 Bacteria 709
2907 Ga0501035_1303142 3300049822 Bacteria 560
2908 Ga0501044_0011283 3300049823 Bacteria 9683
2909 Ga0501044_0014028 3300049823 Bacteria 8651
2910 Ga0501044_0018525 3300049823 Bacteria 7459
2911 Ga0501044_0047177 3300049823 Bacteria 4456
2912 Ga0501044_0128361 3300049823 Bacteria 2531
2913 Ga0501044_0142130 3300049823 Bacteria 2388
2914 Ga0501044_0152785 3300049823 Bacteria 2290
2915 Ga0501044_0154439 3300049823 Bacteria 2275
2916 Ga0501044_0163967 3300049823 Bacteria 2197
2917 Ga0501044_0298787 3300049823 Bacteria 1539
2918 Ga0501044_0468986 3300049823 Bacteria 1163
2919 Ga0501044_0476969 3300049823 Bacteria 1151
2920 Ga0501044_0549142 3300049823 Bacteria 1052
2921 Ga0501044_0600095 3300049823 Bacteria 994
2922 Ga0501044_0627769 3300049823 Bacteria 965
2923 Ga0501044_0705229 3300049823 Bacteria 894
2924 Ga0501044_0768466 3300049823 Bacteria 844
2925 Ga0501044_0955497 3300049823 Bacteria 730
2926 Ga0501044_1129486 3300049823 Bacteria 652
2927 Ga0501045_0008019 3300049824 Bacteria 7353
2928 Ga0501045_0023964 3300049824 Bacteria 4380
2929 Ga0501045_0250556 3300049824 Bacteria 1318
2930 Ga0501045_0394198 3300049824 Bacteria 1030
2931 nmdc:mga03683_102685_c1 3300050489 Bacteria 1258
2932 nmdc:mga03683_390638_c1 3300050489 Bacteria 663
2933 nmdc:mga03683_476302_c1 3300050489 Bacteria 603
2934 nmdc:mga03683_71644_c1 3300050489 Bacteria 1483
2935 nmdc:mga03683_92382_c1 3300050489 Bacteria 1321
2936 nmdc:mga03n38_108138_c1 3300050490 Bacteria 1350
2937 nmdc:mga03n38_118300_c1 3300050490 Bacteria 1299
2938 nmdc:mga03n38_211878_c1 3300050490 Bacteria 1007
2939 nmdc:mga03n38_267328_c1 3300050490 Bacteria 908
2940 nmdc:mga03n38_284930_c1 3300050490 Bacteria 883
2941 nmdc:mga03n38_296879_c1 3300050490 Bacteria 867
2942 nmdc:mga03n38_352016_c1 3300050490 Bacteria 802
2943 nmdc:mga03n38_8514_c1 3300050490 Bacteria 3685
2944 nmdc:mga03n38_867785_c1 3300050490 Bacteria 529
2945 nmdc:mga00v17_128506_c1 3300050491 Bacteria 1618
2946 nmdc:mga00v17_299939_c1 3300050491 Bacteria 1044
2947 nmdc:mga00v17_6230_c1 3300050491 Bacteria 6326
2948 nmdc:mga00v17_714921_c1 3300050491 Bacteria 642
2949 nmdc:mga00v17_779410_c1 3300050491 Bacteria 610
2950 nmdc:mga0yw44_1128533_c1 3300050492 Bacteria 529
2951 nmdc:mga0yw44_13668_c1 3300050492 Bacteria 4283
2952 nmdc:mga0yw44_225216_c1 3300050492 Bacteria 1244
2953 nmdc:mga0yw44_315614_c1 3300050492 Bacteria 1049
2954 nmdc:mga0yw44_384589_c1 3300050492 Bacteria 948
2955 nmdc:mga0yw44_509564_c1 3300050492 Bacteria 817
2956 nmdc:mga0k408_102831_c1 3300050493 Bacteria 1685
2957 nmdc:mga0k408_123170_c1 3300050493 Bacteria 1537
2958 nmdc:mga0k408_278885_c1 3300050493 Bacteria 998
2959 nmdc:mga0k408_284200_c1 3300050493 Bacteria 988
2960 nmdc:mga0k408_700213_c1 3300050493 Bacteria 594
2961 nmdc:mga0k408_912989_c1 3300050493 Bacteria 509
2962 nmdc:mga06z11_133807_c1 3300050494 Bacteria 1395
2963 nmdc:mga06z11_449510_c1 3300050494 Bacteria 778
2964 nmdc:mga06z11_52651_c1 3300050494 Bacteria 2090
2965 nmdc:mga06z11_610604_c1 3300050494 Bacteria 664
2966 nmdc:mga06z11_794937_c1 3300050494 Bacteria 576
2967 nmdc:mga04h51_219374_c1 3300050495 Bacteria 753
2968 nmdc:mga07m45_307582_c1 3300050496 Bacteria 922
2969 nmdc:mga07m45_715472_c1 3300050496 Bacteria 576
2970 nmdc:mga07m45_78306_c1 3300050496 Bacteria 1567
2971 nmdc:mga07m45_890411_c1 3300050496 Bacteria 509
2972 nmdc:mga05p37_1362011_c1 3300050507 Bacteria 718
2973 nmdc:mga05p37_26265_c1 3300050507 Bacteria 7082
2974 nmdc:mga05p37_938088_c1 3300050507 Bacteria 928
2975 nmdc:mga09592_299910_c1 3300050508 Bacteria 1393
2976 nmdc:mga09592_665292_c1 3300050508 Bacteria 888
2977 nmdc:mga09592_826109_c1 3300050508 Bacteria 783
2978 nmdc:mga0qj67_1153049_c1 3300050509 Bacteria 604
2979 nmdc:mga0qj67_372201_c1 3300050509 Bacteria 1154
2980 nmdc:mga0qj67_459194_c1 3300050509 Bacteria 1025
2981 nmdc:mga0qj67_917553_c1 3300050509 Bacteria 689
2982 nmdc:mga06r32_1091907_c1 3300050510 Bacteria 747
2983 nmdc:mga06r32_1217725_c1 3300050510 Bacteria 699
2984 nmdc:mga06r32_177040_c1 3300050510 Bacteria 2117
2985 nmdc:mga06r32_427456_c1 3300050510 Bacteria 1305
2986 nmdc:mga08y16_1904995_c1 3300050511 Bacteria 545
2987 nmdc:mga08y16_2173011_c1 3300050511 Bacteria 502
2988 nmdc:mga08y16_242021_c1 3300050511 Bacteria 1865
2989 nmdc:mga08y16_281575_c1 3300050511 Bacteria 1715
2990 nmdc:mga08y16_415274_c1 3300050511 Bacteria 1376
2991 nmdc:mga08y16_573803_c1 3300050511 Bacteria 1140
2992 nmdc:mga0n895_1001214_c1 3300050512 Bacteria 817
2993 nmdc:mga0n895_101015_c1 3300050512 Bacteria 2894
2994 nmdc:mga0n895_165499_c1 3300050512 Bacteria 2243
2995 nmdc:mga0n895_1704615_c1 3300050512 Bacteria 593
2996 nmdc:mga0n895_368829_c1 3300050512 Bacteria 1454
2997 nmdc:mga0n895_5268_c1 3300050512 Bacteria 10768
2998 nmdc:mga0n895_547994_c1 3300050512 Bacteria 1162
2999 nmdc:mga0n895_717746_c1 3300050512 Bacteria 995
3000 nmdc:mga0n895_757963_c1 3300050512 Bacteria 963
3001 nmdc:mga0rr50_282924_c1 3300050513 Bacteria 1384
3002 nmdc:mga0rr50_407674_c1 3300050513 Bacteria 1149
3003 nmdc:mga0rr50_568708_c1 3300050513 Bacteria 966
3004 nmdc:mga0rr50_902836_c1 3300050513 Bacteria 753
3005 nmdc:mga0rr50_911004_c1 3300050513 Bacteria 750
3006 nmdc:mga0rr50_94274_c2 3300050513 Bacteria 2026
3007 nmdc:mga08x19_1311272_c1 3300050514 Bacteria 513
3008 nmdc:mga08x19_153004_c1 3300050514 Bacteria 1563
3009 nmdc:mga08x19_398054_c1 3300050514 Bacteria 966
3010 nmdc:mga08x19_48189_c1 3300050514 Bacteria 2729
3011 nmdc:mga08x19_7083_c1 3300050514 Bacteria 6655
3012 nmdc:mga0a205_1082957_c1 3300050515 Bacteria 649
3013 nmdc:mga0a205_79259_c1 3300050515 Bacteria 3173
3014 nmdc:mga0sz30_150191_c1 3300050516 Bacteria 1031
3015 nmdc:mga0sz30_206871_c1 3300050516 Bacteria 872
3016 nmdc:mga0sz30_232876_c1 3300050516 Bacteria 820
3017 nmdc:mga0sz30_31049_c1 3300050516 Bacteria 2210
3018 nmdc:mga0sz30_8120_c1 3300050516 Bacteria 3954
3019 Ga0495601_0000025 3300053077 Bacteria 127736
3020 Ga0495601_0007996 3300053077 Bacteria 6229
3021 Ga0495601_0306390 3300053077 Bacteria 1034
3022 Ga0495601_0342351 3300053077 Bacteria 973
3023 Ga0495601_0343137 3300053077 Bacteria 971
3024 Ga0495601_0431618 3300053077 Bacteria 853
3025 Ga0495601_0483162 3300053077 Bacteria 800
3026 Ga0495601_0896148 3300053077 Bacteria 560
3027 Ga0495612_0000570 3300053078 Bacteria 14844
3028 Ga0495612_0027227 3300053078 Bacteria 2298
3029 Ga0495612_0039817 3300053078 Bacteria 1913
3030 Ga0495612_0203156 3300053078 Bacteria 874
3031 Ga0495612_0218241 3300053078 Bacteria 844
3032 Ga0500635_0030341 3300053080 Bacteria 1742
3033 Ga0500635_0149087 3300053080 Bacteria 891
3034 Ga0495655_0040933 3300053083 Bacteria 1182
3035 Ga0495655_0056773 3300053083 Bacteria 1054
3036 Ga0495655_0090247 3300053083 Bacteria 891
3037 Ga0495595_0000041 3300053084 Bacteria 67592
3038 Ga0495595_0007610 3300053084 Bacteria 4434
3039 Ga0495595_0013841 3300053084 Bacteria 3413
3040 Ga0495619_0000035 3300053085 Bacteria 126262
3041 Ga0495619_0013467 3300053085 Bacteria 5152
3042 Ga0495619_0046910 3300053085 Bacteria 2842
3043 Ga0495619_0050264 3300053085 Bacteria 2751
3044 Ga0495619_0234203 3300053085 Bacteria 1272
3045 Ga0495619_0478835 3300053085 Bacteria 857
3046 Ga0495619_0498010 3300053085 Bacteria 838
3047 Ga0495619_0604370 3300053085 Bacteria 750
3048 Ga0500578_0014351 3300053086 Bacteria 5096
3049 Ga0500578_0054440 3300053086 Bacteria 2562
3050 Ga0500578_0062496 3300053086 Bacteria 2377
3051 Ga0500578_0260314 3300053086 Bacteria 1042
3052 Ga0500643_000227 3300053087 Bacteria 52101
3053 Ga0500643_005061 3300053087 Bacteria 5766
3054 Ga0500644_0096647 3300053088 Bacteria 1115
3055 Ga0500644_0201339 3300053088 Bacteria 823
3056 Ga0500644_0404448 3300053088 Bacteria 595
3057 Ga0500581_068452 3300053089 Bacteria 1789
3058 Ga0500646_0003562 3300053090 Bacteria 3987
3059 Ga0500646_0020366 3300053090 Bacteria 1762
3060 Ga0500647_0143101 3300053091 Bacteria 1120
3061 Ga0500647_0205503 3300053091 Bacteria 890
3062 Ga0500647_0238472 3300053091 Bacteria 805
3063 Ga0500583_0602990 3300053092 Bacteria 504
3064 Ga0500651_0042146 3300053093 Bacteria 2875
3065 Ga0500651_0099631 3300053093 Bacteria 1783
3066 Ga0500651_0262139 3300053093 Bacteria 1001
3067 Ga0500651_0328062 3300053093 Bacteria 872
3068 Ga0500566_0000320 3300053094 Bacteria 25974
3069 Ga0500566_0029212 3300053094 Bacteria 3221
3070 Ga0500566_0044144 3300053094 Bacteria 2567
3071 Ga0500566_0202696 3300053094 Bacteria 1000
3072 Ga0500566_0242370 3300053094 Bacteria 882
3073 Ga0500640_027849 3300053095 Bacteria 2466
3074 Ga0500640_075525 3300053095 Bacteria 1438
3075 Ga0500641_0005677 3300053096 Bacteria 4421
3076 Ga0500641_0024074 3300053096 Bacteria 2345
3077 Ga0500641_0058080 3300053096 Bacteria 1606
3078 Ga0500641_0090262 3300053096 Bacteria 1308
3079 Ga0500641_0234456 3300053096 Bacteria 774
3080 Ga0500648_122882 3300053097 Bacteria 1419
3081 Ga0500650_0001523 3300053098 Bacteria 7063
3082 Ga0500650_0112620 3300053098 Bacteria 1269
3083 Ga0500554_004588 3300053102 Bacteria 2940
3084 Ga0500554_043912 3300053102 Bacteria 1383
3085 Ga0500555_003043 3300053103 Bacteria 4793
3086 Ga0500555_036825 3300053103 Bacteria 1371
3087 Ga0500555_057125 3300053103 Bacteria 1056
3088 Ga0500556_0000009 3300053104 Bacteria 288111
3089 Ga0500556_0000125 3300053104 Bacteria 65777
3090 Ga0500556_0079758 3300053104 Bacteria 1235
3091 Ga0500557_000010 3300053105 Bacteria 118251
3092 Ga0500557_065135 3300053105 Bacteria 1188
3093 Ga0500558_190664 3300053106 Bacteria 723
3094 Ga0500562_006758 3300053108 Bacteria 2893
3095 Ga0500562_007137 3300053108 Bacteria 2820
3096 Ga0500562_045912 3300053108 Bacteria 1164
3097 Ga0500562_061571 3300053108 Bacteria 1008
3098 Ga0500569_002394 3300053109 Bacteria 3687
3099 Ga0500569_010361 3300053109 Bacteria 2194
3100 Ga0500569_053506 3300053109 Bacteria 1225
3101 Ga0500569_140358 3300053109 Bacteria 812
3102 Ga0500572_001453 3300053111 Bacteria 6482
3103 Ga0500572_001638 3300053111 Bacteria 5877
3104 Ga0500572_052634 3300053111 Bacteria 1217
3105 Ga0500572_304475 3300053111 Bacteria 512
3106 Ga0500575_191365 3300053112 Bacteria 636
3107 Ga0500582_029556 3300053114 Bacteria 1661
3108 Ga0500592_000871 3300053116 Bacteria 4919
3109 Ga0500592_021007 3300053116 Bacteria 1050
3110 Ga0500592_028982 3300053116 Bacteria 893
3111 Ga0500592_038372 3300053116 Bacteria 774
3112 Ga0500593_011975 3300053117 Bacteria 3668
3113 Ga0500594_0038620 3300053118 Bacteria 1294
3114 Ga0500594_0046677 3300053118 Bacteria 1205
3115 Ga0500594_0077290 3300053118 Bacteria 989
3116 Ga0500594_0116228 3300053118 Bacteria 836
3117 Ga0500595_004583 3300053119 Bacteria 6165
3118 Ga0500595_010713 3300053119 Bacteria 3628
3119 Ga0500595_010727 3300053119 Bacteria 3625
3120 Ga0500595_011143 3300053119 Bacteria 3533
3121 Ga0500595_055935 3300053119 Bacteria 1207
3122 Ga0500597_254653 3300053120 Bacteria 717
3123 Ga0500597_297763 3300053120 Bacteria 645
3124 Ga0500607_011275 3300053121 Bacteria 5290
3125 Ga0500607_034976 3300053121 Bacteria 2749
3126 Ga0500608_021937 3300053122 Bacteria 2956
3127 Ga0500608_029012 3300053122 Bacteria 2614
3128 Ga0500608_041660 3300053122 Bacteria 2203
3129 Ga0500608_229307 3300053122 Bacteria 742
3130 Ga0500614_009172 3300053123 Bacteria 2108
3131 Ga0500614_088289 3300053123 Bacteria 877
3132 Ga0500618_014829 3300053125 Bacteria 1981
3133 Ga0500618_023464 3300053125 Bacteria 1493
3134 Ga0500618_165787 3300053125 Bacteria 506
3135 Ga0500621_068784 3300053126 Bacteria 1428
3136 Ga0500628_016346 3300053129 Bacteria 1433
3137 Ga0500642_0000105 3300053130 Bacteria 40593
3138 Ga0500642_0018711 3300053130 Bacteria 2686
3139 Ga0500642_0146892 3300053130 Bacteria 1106
3140 Ga0500652_000301 3300053131 Bacteria 17879
3141 Ga0500652_021628 3300053131 Bacteria 2425
3142 Ga0500652_270005 3300053131 Bacteria 667
3143 Ga0500655_039263 3300053133 Bacteria 926
3144 Ga0500655_079613 3300053133 Bacteria 673
3145 Ga0500655_094223 3300053133 Bacteria 624
3146 Ga0500655_113215 3300053133 Bacteria 573
3147 Ga0500658_0011008 3300053134 Bacteria 3335
3148 Ga0500658_0333757 3300053134 Bacteria 696
3149 Ga0500658_0449903 3300053134 Bacteria 586
3150 Ga0500559_0007811 3300053136 Bacteria 4724
3151 Ga0500559_0012275 3300053136 Bacteria 3644
3152 Ga0500559_0012587 3300053136 Bacteria 3591
3153 Ga0500559_0114558 3300053136 Bacteria 1250
3154 Ga0500559_0149263 3300053136 Bacteria 1096
3155 Ga0500559_0445867 3300053136 Bacteria 599
3156 Ga0500561_0088962 3300053137 Bacteria 910
3157 Ga0500564_180087 3300053138 Bacteria 882
3158 Ga0500564_346886 3300053138 Bacteria 553
3159 Ga0500568_0014095 3300053139 Bacteria 3622
3160 Ga0500568_0016366 3300053139 Bacteria 3299
3161 Ga0500568_0020361 3300053139 Bacteria 2870
3162 Ga0500568_0030394 3300053139 Bacteria 2236
3163 Ga0500568_0106673 3300053139 Bacteria 1049
3164 Ga0500568_0353291 3300053139 Bacteria 533
3165 Ga0500573_0006745 3300053140 Bacteria 6228
3166 Ga0500573_0506862 3300053140 Bacteria 544
3167 Ga0500577_0065958 3300053142 Bacteria 1406
3168 Ga0500577_0311587 3300053142 Bacteria 687
3169 Ga0500588_0041863 3300053146 Bacteria 1384
3170 Ga0500588_0091727 3300053146 Bacteria 1033
3171 Ga0500588_0121520 3300053146 Bacteria 921
3172 Ga0500589_160690 3300053147 Bacteria 903
3173 Ga0500589_226030 3300053147 Bacteria 702
3174 Ga0500590_026032 3300053148 Bacteria 3036
3175 Ga0500590_082940 3300053148 Bacteria 1571
3176 Ga0500590_275814 3300053148 Bacteria 649
3177 Ga0500590_357666 3300053148 Bacteria 518
3178 Ga0500603_020271 3300053150 Bacteria 1622
3179 Ga0500603_027776 3300053150 Bacteria 1439
3180 Ga0500603_157674 3300053150 Bacteria 706
3181 Ga0500604_0035951 3300053151 Bacteria 1475
3182 Ga0500604_0084926 3300053151 Bacteria 1027
3183 Ga0500604_0101363 3300053151 Bacteria 949
3184 Ga0500616_0000085 3300053153 Bacteria 193192
3185 Ga0500616_0000876 3300053153 Bacteria 33191
3186 Ga0500616_0040138 3300053153 Bacteria 2519
3187 Ga0500616_0122243 3300053153 Bacteria 1242
3188 Ga0500616_0143044 3300053153 Bacteria 1115
3189 Ga0500619_000847 3300053154 Bacteria 5225
3190 Ga0500619_167085 3300053154 Bacteria 745
3191 Ga0500620_011214 3300053155 Bacteria 2394
3192 Ga0500622_0008990 3300053156 Bacteria 5552
3193 Ga0500622_0013118 3300053156 Bacteria 4473
3194 Ga0500622_0043813 3300053156 Bacteria 2319
3195 Ga0500622_0058795 3300053156 Bacteria 1964
3196 Ga0500624_002337 3300053157 Bacteria 2587
3197 Ga0500624_006673 3300053157 Bacteria 1567
3198 Ga0500627_0025499 3300053158 Bacteria 2430
3199 Ga0500627_0058137 3300053158 Bacteria 1697
3200 Ga0500627_0073662 3300053158 Bacteria 1515
3201 Ga0500627_0140738 3300053158 Bacteria 1090
3202 Ga0500627_0187133 3300053158 Bacteria 930
3203 Ga0500630_005936 3300053159 Bacteria 5975
3204 Ga0500633_0036552 3300053160 Bacteria 1624
3205 Ga0500633_0213349 3300053160 Bacteria 721
3206 Ga0500634_0037272 3300053161 Bacteria 2645
3207 Ga0500634_0061123 3300053161 Bacteria 1999
3208 Ga0500638_002268 3300053162 Bacteria 6590
3209 Ga0500638_006089 3300053162 Bacteria 4895
3210 Ga0500638_035746 3300053162 Bacteria 2408
3211 Ga0500638_085232 3300053162 Bacteria 1495
3212 Ga0500638_216873 3300053162 Bacteria 797
3213 Ga0500638_358982 3300053162 Bacteria 537
3214 Ga0500639_019780 3300053163 Bacteria 3551
3215 Ga0500639_044490 3300053163 Bacteria 2324
3216 Ga0500639_292047 3300053163 Bacteria 619
3217 Ga0500639_305092 3300053163 Bacteria 595
3218 Ga0500639_355156 3300053163 Bacteria 516
3219 Ga0500636_0004057 3300053177 Bacteria 8266
3220 Ga0500636_0009188 3300053177 Bacteria 5746
3221 Ga0500636_0026822 3300053177 Bacteria 3403
3222 Ga0500636_0032601 3300053177 Bacteria 3082
3223 Ga0500636_0067281 3300053177 Bacteria 2081
3224 Ga0500636_0145554 3300053177 Bacteria 1306
3225 Ga0500636_0354065 3300053177 Bacteria 699
3226 Ga0500637_0003070 3300053178 Bacteria 7605
3227 Ga0500637_0047889 3300053178 Bacteria 2429
3228 Ga0500637_0072771 3300053178 Bacteria 1978
3229 Ga0500637_0179856 3300053178 Bacteria 1212
3230 Ga0500637_0311374 3300053178 Bacteria 854
3231 Ga0500637_0390021 3300053178 Bacteria 727
3232 Ga0500637_0460034 3300053178 Bacteria 642
3233 Ga0500637_0531628 3300053178 Bacteria 574
3234 Ga0500649_180910 3300053722 Bacteria 712
3235 Ga0500567_156281 3300053723 Bacteria 844
3236 Ga0500570_089018 3300053724 Bacteria 1353
3237 Ga0500570_133573 3300053724 Bacteria 935
3238 Ga0500576_079040 3300053725 Bacteria 1394
3239 Ga0500611_008586 3300053727 Bacteria 1586
3240 Ga0500611_069717 3300053727 Bacteria 853
3241 Ga0500657_111843 3300053728 Bacteria 1102
3242 Ga0500625_027837 3300053729 Bacteria 2681
3243 Ga0500645_014096 3300053730 Bacteria 2553
3244 Ga0500645_020851 3300053730 Bacteria 2026
3245 Ga0500645_030396 3300053730 Bacteria 1625
3246 Ga0500645_052369 3300053730 Bacteria 1189
3247 Ga0500645_123309 3300053730 Bacteria 722
3248 Ga0500609_003899 3300053731 Bacteria 2079
3249 Ga0500609_016418 3300053731 Bacteria 1004
3250 Ga0500609_020249 3300053731 Bacteria 907
3251 Ga0500596_003892 3300053735 Bacteria 2792
3252 Ga0500596_003981 3300053735 Bacteria 2750
3253 Ga0500596_104318 3300053735 Bacteria 512
3254 Ga0500599_001304 3300053736 Bacteria 2844
3255 Ga0500601_001031 3300053737 Bacteria 3198
3256 Ga0500587_013184 3300053739 Bacteria 1043
3257 Ga0501084_0028118 3300054114 Bacteria 4698
3258 Ga0501084_0050020 3300054114 Bacteria 3499
3259 Ga0501084_0069776 3300054114 Bacteria 2943
3260 Ga0501084_0080043 3300054114 Bacteria 2739
3261 Ga0501084_0098172 3300054114 Bacteria 2459
3262 Ga0501084_0102026 3300054114 Bacteria 2409
3263 Ga0501084_0187230 3300054114 Bacteria 1747
3264 Ga0501084_0767365 3300054114 Bacteria 812
3265 Ga0501084_0869908 3300054114 Bacteria 758
3266 Ga0501084_1242070 3300054114 Bacteria 625
3267 Ga0501084_1468455 3300054114 Bacteria 571
3268 Ga0500661_017926 3300055283 Bacteria 1263
3269 Ga0500661_064297 3300055283 Bacteria 665
3270 Ga0590077_115422 3300059426 Bacteria 633
3271 Ga0587084_085673 3300059477 Bacteria 617
3272 Ga0587093_037161 3300059478 Bacteria 725
3273 Ga0587070_127406 3300059491 Bacteria 615
3274 Ga0587070_156424 3300059491 Bacteria 576
3275 Ga0587073_0016358 3300059492 Bacteria 1353
3276 Ga0587082_008563 3300059504 Bacteria 1430
3277 Ga0587085_081449 3300059506 Bacteria 652
3278 Ga0587086_111231 3300059507 Bacteria 515
3279 Ga0587092_049935 3300059512 Bacteria 755
3280 Ga0587094_090574 3300059513 Bacteria 578
3281 Ga0587101_000585 3300059623 Bacteria 2673
3282 Ga0587062_024677 3300059639 Bacteria 880
3283 Ga0587068_043248 3300059641 Bacteria 822
3284 Ga0587075_099003 3300059644 Bacteria 580
3285 Ga0587076_040353 3300059645 Bacteria 870
3286 Ga0587078_007001 3300059646 Bacteria 1237
3287 Ga0501082_0000653 3300060353 Bacteria 30577
3288 Ga0501082_0004728 3300060353 Bacteria 11876
3289 Ga0501082_0092039 3300060353 Bacteria 2619
3290 Ga0501082_0165069 3300060353 Bacteria 1924
3291 Ga0501082_0171311 3300060353 Bacteria 1887
3292 Ga0501082_0306296 3300060353 Bacteria 1383
3293 Ga0501082_0414097 3300060353 Bacteria 1177
3294 Ga0501082_0803333 3300060353 Bacteria 823
3295 Ga0501082_0902675 3300060353 Bacteria 773
3296 Ga0501082_1226205 3300060353 Bacteria 655
3297 Ga0501082_1323297 3300060353 Bacteria 629
3298 Ga0501082_1524551 3300060353 Bacteria 584
3299 Ga0466962_0050095 3300061719 Bacteria 1996
3300 Ga0466962_0107928 3300061719 Bacteria 1339
3301 Ga0466962_0150953 3300061719 Bacteria 1127
3302 Ga0466962_0291766 3300061719 Bacteria 806
3303 Ga0466962_0442991 3300061719 Bacteria 653
3304 Ga0466962_0566020 3300061719 Bacteria 578
3305 Ga0530510_0020675 3300061734 Bacteria 4680
3306 Ga0530510_0023207 3300061734 Bacteria 4419
3307 Ga0530510_0106796 3300061734 Bacteria 2049
3308 Ga0530510_0136000 3300061734 Bacteria 1809
3309 Ga0530510_0206136 3300061734 Bacteria 1461
3310 Ga0530510_1260375 3300061734 Bacteria 567

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050511 nmdc:mga08y16_2173011_c1 nmdc:mga08y16_2173011_c1_34_294 78
2 3300059478 Ga0587093_037161 Ga0587093_037161_149_412 85
3 3300042461 Ga0439460_0041440 Ga0439460_0041440_281_580 86
4 iso_pu_bacteria 8019538911 8019543682 87
5 iso_pu_bacteria 8019629233 8019635685 87
6 3300014745 Ga0157377_11247563 Ga0157377_112475632 88
7 3300048903 Ga0496100_0119697 Ga0496100_0119697_224_490 88
8 iso_pu_bacteria 2507262055 2507509778 88
9 iso_pu_bacteria 2508501009 2508543794 88
10 iso_pu_bacteria 2508501042 2508698418 88
11 iso_pu_bacteria 2508501050 2508735865 88
12 iso_pu_bacteria 2508501114 2509078189 88
13 iso_pu_bacteria 2508501128 2509149630 88
14 iso_pu_bacteria 2511231028 2511396978 88
15 iso_pu_bacteria 2513237092 2513625272 88
16 iso_pu_bacteria 2513237094 2513644589 88
17 iso_pu_bacteria 2513237095 2513646156 88
18 iso_pu_bacteria 2513237096 2513658392 88
19 iso_pu_bacteria 2513237098 2513678615 88
20 iso_pu_bacteria 2513237101 2513695937 88
21 iso_pu_bacteria 2513237102 2513701035 88
22 iso_pu_bacteria 2513237104 2513715016 88
23 iso_pu_bacteria 2513237137 2513857532 88
24 iso_pu_bacteria 2513237139 2513875856 88
25 iso_pu_bacteria 2513237141 2513894231 88
26 iso_pu_bacteria 2513237145 2513920116 88
27 iso_pu_bacteria 2513237161 2514011477 88
28 iso_pu_bacteria 2515154112 2515630010 88
29 iso_pu_bacteria 2517093001 2517103522 88
30 iso_pu_bacteria 2517572143 2517893485 88
31 iso_pu_bacteria 2524023205 2524441031 88
32 iso_pu_bacteria 2524023210 2524469973 88
33 iso_pu_bacteria 2524023228 2524537990 88
34 iso_pu_bacteria 2528768022 2528856461 88
35 iso_pu_bacteria 2545555834 2545677355 88
36 iso_pu_bacteria 2602042107 2603859867 88
37 iso_pu_bacteria 2617270735 2617349302 88
38 iso_pu_bacteria 2617270741 2617378175 88
39 iso_pu_bacteria 2643221651 2644287956 88
40 iso_pu_bacteria 2643221733 2644729055 88
41 iso_pu_bacteria 2643221734 2644735411 88
42 iso_pu_bacteria 2643221736 2644747754 88
43 iso_pu_bacteria 2667528175 2671118123 88
44 iso_pu_bacteria 2721755755 2723846169 88
45 iso_pu_bacteria 2728368998 2728747752 88
46 iso_pu_bacteria 2738541281 2738745703 88
47 iso_pu_bacteria 2738543032 2739354933 88
48 iso_pu_bacteria 2744054633 2745082446 88
49 iso_pu_bacteria 2773857925 2774868377 88
50 iso_pu_bacteria 2791355196 2793060248 88
51 iso_pu_bacteria 2791355197 2793071758 88
52 iso_pu_bacteria 2791355199 2793076661 88
53 iso_pu_bacteria 2802429603 2805917614 88
54 iso_pu_bacteria 2816332527 2818241505 88
55 iso_pu_bacteria 2818991467 2819720924 88
56 iso_pu_bacteria 2824600985 2824602117 88
57 iso_pu_bacteria 2824609381 2824610105 88
58 iso_pu_bacteria 2824617872 2824620087 88
59 iso_pu_bacteria 2824626560 2824627702 88
60 iso_pu_bacteria 2824635225 2824636729 88
61 iso_pu_bacteria 2824644064 2824645022 88
62 iso_pu_bacteria 2824653114 2824654961 88
63 iso_pu_bacteria 2824661429 2824662359 88
64 iso_pu_bacteria 2824671348 2824672608 88
65 iso_pu_bacteria 2824679649 2824680842 88
66 iso_pu_bacteria 2824687955 2824689059 88
67 iso_pu_bacteria 2824696289 2824697426 88
68 iso_pu_bacteria 2824704595 2824706676 88
69 iso_pu_bacteria 2824714736 2824715416 88
70 iso_pu_bacteria 2824723954 2824724729 88
71 iso_pu_bacteria 2824732956 2824733557 88
72 iso_pu_bacteria 2824746037 2824746932 88
73 iso_pu_bacteria 2824753945 2824759418 88
74 iso_pu_bacteria 2824763712 2824769654 88
75 iso_pu_bacteria 2824773399 2824774035 88
76 iso_pu_bacteria 2828305725 2828310150 88
77 iso_pu_bacteria 2835312727 2835318471 88
78 iso_pu_bacteria 2838122688 2838130084 88
79 iso_pu_bacteria 2841760612 2841761380 88
80 iso_pu_bacteria 2841911363 2841913383 88
81 iso_pu_bacteria 2841917233 2841919130 88
82 iso_pu_bacteria 2841941048 2841941241 88
83 iso_pu_bacteria 2841949485 2841952732 88
84 iso_pu_bacteria 2841957949 2841962245 88
85 iso_pu_bacteria 2841966195 2841967396 88
86 iso_pu_bacteria 2841974524 2841979206 88
87 iso_pu_bacteria 2841983080 2841990782 88
88 iso_pu_bacteria 2842038055 2842038622 88
89 iso_pu_bacteria 2842045827 2842048433 88
90 iso_pu_bacteria 2842698319 2842701716 88
91 iso_pu_bacteria 2844104063 2844104405 88
92 iso_pu_bacteria 2844315083 2844318020 88
93 iso_pu_bacteria 2847930680 2847934831 88
94 iso_pu_bacteria 2847939898 2847945396 88
95 iso_pu_bacteria 2849076700 2849080416 88
96 iso_pu_bacteria 2851182111 2851184452 88
97 iso_pu_bacteria 2851246043 2851247393 88
98 iso_pu_bacteria 2857509624 2857510231 88
99 iso_pu_bacteria 2857524615 2857528515 88
100 iso_pu_bacteria 2874590934 2874595113 88
101 iso_pu_bacteria 2874604998 2874610921 88
102 iso_pu_bacteria 2874612657 2874615654 88
103 iso_pu_bacteria 2874620515 2874621677 88
104 iso_pu_bacteria 2874628541 2874632689 88
105 iso_pu_bacteria 2874645413 2874650974 88
106 iso_pu_bacteria 2876761206 2876765728 88
107 iso_pu_bacteria 2876771140 2876775049 88
108 iso_pu_bacteria 2876808645 2876810435 88
109 iso_pu_bacteria 2876818435 2876823864 88
110 iso_pu_bacteria 2879074833 2879080492 88
111 iso_pu_bacteria 2879083081 2879089278 88
112 iso_pu_bacteria 2879099564 2879109340 88
113 iso_pu_bacteria 2879110137 2879110534 88
114 iso_pu_bacteria 2879127579 2879134902 88
115 iso_pu_bacteria 2879142872 2879149213 88
116 iso_pu_bacteria 2881364244 2881366225 88
117 iso_pu_bacteria 2881665667 2881671566 88
118 iso_pu_bacteria 2882456835 2882459680 88
119 iso_pu_bacteria 2884298095 2884300450 88
120 iso_pu_bacteria 2885366525 2885372818 88
121 iso_pu_bacteria 2885374607 2885380946 88
122 iso_pu_bacteria 2885383462 2885384443 88
123 iso_pu_bacteria 2885409591 2885413059 88
124 iso_pu_bacteria 2888378607 2888382817 88
125 iso_pu_bacteria 2888388044 2888394983 88
126 iso_pu_bacteria 2888419890 2888423296 88
127 iso_pu_bacteria 2889033259 2889041118 88
128 iso_pu_bacteria 2891088606 2891092913 88
129 iso_pu_bacteria 2893066018 2893070169 88
130 iso_pu_bacteria 2903727486 2903729671 88
131 iso_pu_bacteria 2903748898 2903758263 88
132 iso_pu_bacteria 2903768456 2903770860 88
133 iso_pu_bacteria 2904666416 2904668606 88
134 iso_pu_bacteria 2904690495 2904696895 88
135 iso_pu_bacteria 2904699407 2904701658 88
136 iso_pu_bacteria 2904711408 2904716672 88
137 iso_pu_bacteria 2906602504 2906605819 88
138 iso_pu_bacteria 2906610324 2906610370 88
139 iso_pu_bacteria 2906626472 2906628269 88
140 iso_pu_bacteria 2906635258 2906642785 88
141 iso_pu_bacteria 2906643746 2906644198 88
142 iso_pu_bacteria 2906660503 2906665920 88
143 iso_pu_bacteria 2908739725 2908743891 88
144 iso_pu_bacteria 2908756301 2908761471 88
145 iso_pu_bacteria 2908775508 2908778939 88
146 iso_pu_bacteria 2917699015 2917699269 88
147 iso_pu_bacteria 2919073203 2919076120 88
148 iso_pu_bacteria 2922361189 2922361965 88
149 iso_pu_bacteria 2922368715 2922375223 88
150 iso_pu_bacteria 2922386360 2922392029 88
151 iso_pu_bacteria 2922393267 2922395225 88
152 iso_pu_bacteria 2922425934 2922428991 88
153 iso_pu_bacteria 2929615660 2929615911 88
154 iso_pu_bacteria 2929624759 2929630524 88
155 iso_pu_bacteria 2932784394 2932792451 88
156 iso_pu_bacteria 2932794094 2932800403 88
157 iso_pu_bacteria 2932801729 2932804576 88
158 iso_pu_bacteria 2932809354 2932813950 88
159 iso_pu_bacteria 2932818245 2932819538 88
160 iso_pu_bacteria 2932828146 2932833756 88
161 iso_pu_bacteria 2933577622 2933578803 88
162 iso_pu_bacteria 2935608549 2935611363 88
163 iso_pu_bacteria 2935616580 2935618740 88
164 iso_pu_bacteria 2935630451 2935637746 88
165 iso_pu_bacteria 2935638405 2935644420 88
166 iso_pu_bacteria 2935648319 2935648747 88
167 iso_pu_bacteria 2935656913 2935657170 88
168 iso_pu_bacteria 2935665750 2935674158 88
169 iso_pu_bacteria 2935675223 2935678560 88
170 iso_pu_bacteria 2935684952 2935687943 88
171 iso_pu_bacteria 2935694250 2935701445 88
172 iso_pu_bacteria 2935703347 2935708277 88
173 iso_pu_bacteria 2935713505 2935714963 88
174 iso_pu_bacteria 2935722832 2935726472 88
175 iso_pu_bacteria 2935732158 2935733781 88
176 iso_pu_bacteria 2935741537 2935743160 88
177 iso_pu_bacteria 2935750917 2935754801 88
178 iso_pu_bacteria 2935760218 2935765509 88
179 iso_pu_bacteria 2935769743 2935775262 88
180 iso_pu_bacteria 2935777560 2935779538 88
181 iso_pu_bacteria 2935785616 2935791540 88
182 iso_pu_bacteria 2935793552 2935799852 88
183 iso_pu_bacteria 2935801545 2935805462 88
184 iso_pu_bacteria 2935810662 2935816756 88
185 iso_pu_bacteria 2935819856 2935820840 88
186 iso_pu_bacteria 2935827899 2935833831 88
187 iso_pu_bacteria 2935837841 2935839484 88
188 iso_pu_bacteria 2935847175 2935850900 88
189 iso_pu_bacteria 2935855204 2935857105 88
190 iso_pu_bacteria 2935864058 2935864649 88
191 iso_pu_bacteria 2935873716 2935876427 88
192 iso_pu_bacteria 2935883170 2935889770 88
193 iso_pu_bacteria 2935908558 2935913733 88
194 iso_pu_bacteria 2935916978 2935920277 88
195 iso_pu_bacteria 2935926038 2935930616 88
196 iso_pu_bacteria 2935934488 2935939411 88
197 iso_pu_bacteria 2935942939 2935946360 88
198 iso_pu_bacteria 2935951376 2935955801 88
199 iso_pu_bacteria 2935959822 2935966957 88
200 iso_pu_bacteria 2935967501 2935972489 88
201 iso_pu_bacteria 2935975950 2935981680 88
202 iso_pu_bacteria 2935984226 2935991055 88
203 iso_pu_bacteria 2935992306 2935997604 88
204 iso_pu_bacteria 2936002035 2936007122 88
205 iso_pu_bacteria 2936011229 2936011657 88
206 iso_pu_bacteria 2936019824 2936020252 88
207 iso_pu_bacteria 2936028420 2936028947 88
208 iso_pu_bacteria 2936037263 2936042982 88
209 iso_pu_bacteria 2936046547 2936046975 88
210 iso_pu_bacteria 2936055302 2936058145 88
211 iso_pu_bacteria 2940556831 2940559822 88
212 iso_pu_bacteria 2941507105 2941514419 88
213 iso_pu_bacteria 2941515067 2941522315 88
214 iso_pu_bacteria 2941523033 2941530166 88
215 iso_pu_bacteria 2941531003 2941536088 88
216 iso_pu_bacteria 2941538514 2941540173 88
217 iso_pu_bacteria 3003665799 3003667742 88
218 iso_pu_bacteria 3005474847 3005479136 88
219 iso_pu_bacteria 3005483717 3005488145 88
220 iso_pu_bacteria 3005506211 3005512707 88
221 iso_pu_bacteria 3005587118 3005590473 88
222 iso_pu_bacteria 3005594810 3005598070 88
223 iso_pu_bacteria 3005710791 3005713749 88
224 iso_pu_bacteria 3005718088 3005721260 88
225 iso_pu_bacteria 641522639 641640677 88
226 iso_pu_bacteria 643348564 643599647 88
227 iso_pu_bacteria 8002060224 8002061401 88
228 iso_pu_bacteria 8006926726 8006930058 88
229 iso_pu_bacteria 8006933436 8006942212 88
230 iso_pu_bacteria 8006964411 8006964523 88
231 iso_pu_bacteria 8006973647 8006981946 88
232 iso_pu_bacteria 8006984368 8006986858 88
233 iso_pu_bacteria 8006994254 8006996077 88
234 iso_pu_bacteria 8016511872 8016514681 88
235 iso_pu_bacteria 8016522445 8016530780 88
236 iso_pu_bacteria 8016530956 8016536071 88
237 iso_pu_bacteria 8016539877 8016540350 88
238 iso_pu_bacteria 8016557553 8016561259 88
239 iso_pu_bacteria 8016566248 8016574417 88
240 iso_pu_bacteria 8016575299 8016578514 88
241 iso_pu_bacteria 8016583857 8016591245 88
242 iso_pu_bacteria 8016595262 8016599116 88
243 iso_pu_bacteria 8016603502 8016611932 88
244 iso_pu_bacteria 8016613128 8016621872 88
245 iso_pu_bacteria 8016622563 8016627982 88
246 iso_pu_bacteria 8016630954 8016632305 88
247 iso_pu_bacteria 8017057580 8017061753 88
248 iso_pu_bacteria 8019530166 8019535796 88
249 iso_pu_bacteria 8019547302 8019555090 88
250 iso_pu_bacteria 8019555841 8019557933 88
251 iso_pu_bacteria 8019565922 8019567352 88
252 iso_pu_bacteria 8019586578 8019588880 88
253 iso_pu_bacteria 8019597564 8019602354 88
254 iso_pu_bacteria 8019608314 8019616207 88
255 iso_pu_bacteria 8019619141 8019626827 88
256 iso_pu_bacteria 8019638758 8019644000 88
257 iso_pu_bacteria 8019648815 8019656997 88
258 iso_pu_bacteria 8019659431 8019663482 88
259 iso_pu_bacteria 8019668869 8019673095 88
260 iso_pu_bacteria 8019678201 8019683044 88
261 iso_pu_bacteria 8019687851 8019688742 88
262 iso_pu_bacteria 8055742211 8055747558 88
263 iso_pu_bacteria 8056673599 8056680467 88
264 iso_pu_bacteria 8056681323 8056684522 88
265 iso_pu_bacteria 8056689827 8056691232 88
266 iso_pu_bacteria 8056967851 8056972366 88
267 iso_pu_bacteria 8057132660 8057134789 88
268 iso_pu_bacteria 8057529695 8057530437 88
269 3300048903 Ga0496100_0237583 Ga0496100_0237583_853_1191 89
270 3300005439 Ga0070711_100352833 Ga0070711_1003528332 90
271 3300006163 Ga0070715_10082849 Ga0070715_100828492 90
272 3300006163 Ga0070715_10703806 Ga0070715_107038062 90
273 3300006173 Ga0070716_101021992 Ga0070716_1010219922 90
274 3300006175 Ga0070712_100092798 Ga0070712_1000927982 90
275 3300009101 Ga0105247_11739614 Ga0105247_117396142 90
276 3300025905 Ga0207685_10156277 Ga0207685_101562771 90
277 3300025915 Ga0207693_10121023 Ga0207693_101210232 90
278 3300025916 Ga0207663_11126962 Ga0207663_111269622 90
279 3300025931 Ga0207644_11293224 Ga0207644_112932241 90
280 3300005336 Ga0070680_100870914 Ga0070680_1008709142 91
281 3300005458 Ga0070681_10118265 Ga0070681_101182652 91
282 3300005530 Ga0070679_100442289 Ga0070679_1004422893 91
283 3300005577 Ga0068857_100887492 Ga0068857_1008874922 91
284 3300005843 Ga0068860_101737981 Ga0068860_1017379812 91
285 3300009551 Ga0105238_11062363 Ga0105238_110623632 91
286 3300013297 Ga0157378_10221436 Ga0157378_102214362 91
287 3300014326 Ga0157380_11325707 Ga0157380_113257072 91
288 3300025912 Ga0207707_10142531 Ga0207707_101425312 91
289 3300025917 Ga0207660_10369533 Ga0207660_103695332 91
290 3300025918 Ga0207662_10019357 Ga0207662_100193573 91
291 3300025921 Ga0207652_10845134 Ga0207652_108451342 91
292 3300025924 Ga0207694_10506957 Ga0207694_105069572 91
293 3300026116 Ga0207674_11405665 Ga0207674_114056652 91
294 3300028381 Ga0268264_11652374 Ga0268264_116523742 91
295 3300031911 Ga0307412_11113935 Ga0307412_111139352 91
296 3300032004 Ga0307414_10042166 Ga0307414_100421662 91
297 3300037312 Ga0395899_0013235 Ga0395899_0013235_497_772 91
298 3300037418 Ga0395900_0361639 Ga0395900_0361639_350_625 91
299 3300037466 Ga0395898_0021940 Ga0395898_0021940_3051_3326 91
300 3300037471 Ga0395905_1277552 Ga0395905_1277552_121_396 91
301 3300038443 Ga0395901_0415857 Ga0395901_0415857_814_1089 91
302 3300044712 Ga0453684_0089999 Ga0453684_0089999_2862_3137 91
303 3300044712 Ga0453684_0640447 Ga0453684_0640447_342_623 91
304 3300047472 Ga0495686_0180907 Ga0495686_0180907_62_337 91
305 3300049568 Ga0501031_0104462 Ga0501031_0104462_178_495 91
306 3300049568 Ga0501031_0195437 Ga0501031_0195437_207_482 91
307 3300049568 Ga0501031_0868684 Ga0501031_0868684_183_470 91
308 3300049569 Ga0501032_0041259 Ga0501032_0041259_914_1195 91
309 3300049569 Ga0501032_0057754 Ga0501032_0057754_1033_1308 91
310 3300049569 Ga0501032_0719996 Ga0501032_0719996_50_325 91
311 3300049570 Ga0501033_0003899 Ga0501033_0003899_4281_4556 91
312 3300049570 Ga0501033_0929724 Ga0501033_0929724_178_453 91
313 3300049571 Ga0501034_0046023 Ga0501034_0046023_3329_3604 91
314 3300049571 Ga0501034_0148760 Ga0501034_0148760_1352_1627 91
315 3300049572 Ga0501036_0042438 Ga0501036_0042438_1790_2104 91
316 3300049572 Ga0501036_0042790 Ga0501036_0042790_1245_1520 91
317 3300049572 Ga0501036_0654004 Ga0501036_0654004_98_415 91
318 3300049572 Ga0501036_0778432 Ga0501036_0778432_496_771 91
319 3300049572 Ga0501036_1355088 Ga0501036_1355088_166_441 91
320 3300049572 Ga0501036_1433373 Ga0501036_1433373_135_422 91
321 3300049573 Ga0501037_0038500 Ga0501037_0038500_1972_2247 91
322 3300049573 Ga0501037_0213101 Ga0501037_0213101_68_343 91
323 3300049573 Ga0501037_0400122 Ga0501037_0400122_356_673 91
324 3300049574 Ga0501038_0149812 Ga0501038_0149812_1567_1842 91
325 3300049574 Ga0501038_0969005 Ga0501038_0969005_291_566 91
326 3300049575 Ga0501039_0169281 Ga0501039_0169281_624_911 91
327 3300049575 Ga0501039_0275222 Ga0501039_0275222_189_503 91
328 3300049576 Ga0501040_0066801 Ga0501040_0066801_398_673 91
329 3300049576 Ga0501040_0071797 Ga0501040_0071797_189_503 91
330 3300049576 Ga0501040_0390975 Ga0501040_0390975_432_749 91
331 3300049577 Ga0501041_0052753 Ga0501041_0052753_1727_2041 91
332 3300049577 Ga0501041_0266619 Ga0501041_0266619_280_597 91
333 3300049578 Ga0501042_0286752 Ga0501042_0286752_360_674 91
334 3300049578 Ga0501042_0461300 Ga0501042_0461300_499_774 91
335 3300049579 Ga0501043_0032226 Ga0501043_0032226_2542_2817 91
336 3300049579 Ga0501043_0113233 Ga0501043_0113233_1781_2056 91
337 3300049579 Ga0501043_0404889 Ga0501043_0404889_718_993 91
338 3300049579 Ga0501043_0887907 Ga0501043_0887907_124_438 91
339 3300049580 Ga0501046_0258698 Ga0501046_0258698_279_593 91
340 3300049580 Ga0501046_0371363 Ga0501046_0371363_687_962 91
341 3300049581 Ga0501047_0005487 Ga0501047_0005487_6955_7230 91
342 3300049581 Ga0501047_0074273 Ga0501047_0074273_518_793 91
343 3300049582 Ga0501048_0127521 Ga0501048_0127521_1141_1455 91
344 3300049582 Ga0501048_0498498 Ga0501048_0498498_574_849 91
345 3300049582 Ga0501048_0542144 Ga0501048_0542144_499_774 91
346 3300049582 Ga0501048_0557274 Ga0501048_0557274_10_297 91
347 3300049583 Ga0501067_0001840 Ga0501067_0001840_8066_8341 91
348 3300049583 Ga0501067_0125522 Ga0501067_0125522_649_924 91
349 3300049584 Ga0501068_0577302 Ga0501068_0577302_258_533 91
350 3300049585 Ga0501069_0071498 Ga0501069_0071498_1408_1683 91
351 3300049585 Ga0501069_0154720 Ga0501069_0154720_98_415 91
352 3300049586 Ga0501070_0394277 Ga0501070_0394277_677_952 91
353 3300049586 Ga0501070_1498450 Ga0501070_1498450_13_288 91
354 3300049587 Ga0501071_0014068 Ga0501071_0014068_3590_3865 91
355 3300049587 Ga0501071_0038781 Ga0501071_0038781_1637_1951 91
356 3300049588 Ga0501072_0392368 Ga0501072_0392368_659_934 91
357 3300049589 Ga0501073_0039588 Ga0501073_0039588_1805_2080 91
358 3300049590 Ga0501074_0052758 Ga0501074_0052758_765_1040 91
359 3300049591 Ga0501075_0174647 Ga0501075_0174647_444_719 91
360 3300049591 Ga0501075_0365070 Ga0501075_0365070_460_777 91
361 3300049591 Ga0501075_0815795 Ga0501075_0815795_135_422 91
362 3300049592 Ga0501076_1569314 Ga0501076_1569314_86_373 91
363 3300049593 Ga0501077_0028790 Ga0501077_0028790_2007_2282 91
364 3300049593 Ga0501077_0065891 Ga0501077_0065891_491_805 91
365 3300049741 Ga0501079_0024576 Ga0501079_0024576_2478_2753 91
366 3300049741 Ga0501079_0041571 Ga0501079_0041571_2002_2316 91
367 3300049742 Ga0501080_0902830 Ga0501080_0902830_58_372 91
368 3300049742 Ga0501080_1014730 Ga0501080_1014730_44_361 91
369 3300049743 Ga0501081_0187881 Ga0501081_0187881_226_540 91
370 3300049744 Ga0501083_0137926 Ga0501083_0137926_840_1115 91
371 3300049744 Ga0501083_0265639 Ga0501083_0265639_554_871 91
372 3300049744 Ga0501083_0615232 Ga0501083_0615232_235_522 91
373 3300049822 Ga0501035_0137115 Ga0501035_0137115_59_334 91
374 3300049822 Ga0501035_0143633 Ga0501035_0143633_1738_2013 91
375 3300049822 Ga0501035_0307534 Ga0501035_0307534_632_946 91
376 3300049822 Ga0501035_0430080 Ga0501035_0430080_723_1010 91
377 3300049823 Ga0501044_0047177 Ga0501044_0047177_1303_1578 91
378 3300049823 Ga0501044_0298787 Ga0501044_0298787_38_313 91
379 3300049824 Ga0501045_0008019 Ga0501045_0008019_6240_6515 91
380 3300049824 Ga0501045_0250556 Ga0501045_0250556_635_952 91
381 3300050493 nmdc:mga0k408_912989_c1 nmdc:mga0k408_912989_c1_159_482 91
382 3300054114 Ga0501084_0080043 Ga0501084_0080043_1238_1513 91
383 3300054114 Ga0501084_0098172 Ga0501084_0098172_670_984 91
384 3300054114 Ga0501084_0187230 Ga0501084_0187230_231_518 91
385 3300059507 Ga0587086_111231 Ga0587086_111231_202_477 91
386 3300059623 Ga0587101_000585 Ga0587101_000585_39_314 91
387 3300060353 Ga0501082_0000653 Ga0501082_0000653_3917_4219 91
388 3300060353 Ga0501082_0165069 Ga0501082_0165069_688_1002 91
389 3300060353 Ga0501082_0171311 Ga0501082_0171311_188_463 91
390 3300060353 Ga0501082_0902675 Ga0501082_0902675_42_329 91
391 3300061734 Ga0530510_0106796 Ga0530510_0106796_851_1126 91
392 3300061734 Ga0530510_0206136 Ga0530510_0206136_189_503 91
393 3300000531 CNBas_1000198 CNBas_10001982 92
394 3300000532 CNAas_1000763 CNAas_10007637 92
395 3300000545 CNXas_1013658 CNXas_10136582 92
396 3300000546 LJNas_1007153 LJNas_10071532 92
397 3300000549 LJQas_1002516 LJQas_10025166 92
398 3300001904 JGI24736J21556_1015172 JGI24736J21556_10151723 92
399 3300001904 JGI24736J21556_1060949 JGI24736J21556_10609492 92
400 3300001915 JGI24741J21665_1029516 JGI24741J21665_10295161 92
401 3300001976 JGI24752J21851_1060219 JGI24752J21851_10602192 92
402 3300001976 JGI24752J21851_1066629 JGI24752J21851_10666292 92
403 3300001979 JGI24740J21852_10003752 JGI24740J21852_100037522 92
404 3300001979 JGI24740J21852_10040096 JGI24740J21852_100400961 92
405 3300001979 JGI24740J21852_10059197 JGI24740J21852_100591973 92
406 3300001979 JGI24740J21852_10159078 JGI24740J21852_101590782 92
407 3300001989 JGI24739J22299_10010687 JGI24739J22299_100106873 92
408 3300001989 JGI24739J22299_10083041 JGI24739J22299_100830412 92
409 3300001989 JGI24739J22299_10210856 JGI24739J22299_102108562 92
410 3300001990 JGI24737J22298_10002998 JGI24737J22298_100029987 92
411 3300001990 JGI24737J22298_10015196 JGI24737J22298_100151963 92
412 3300001990 JGI24737J22298_10039795 JGI24737J22298_100397953 92
413 3300001991 JGI24743J22301_10055961 JGI24743J22301_100559612 92
414 3300001991 JGI24743J22301_10088746 JGI24743J22301_100887462 92
415 3300002067 JGI24735J21928_10036819 JGI24735J21928_100368192 92
416 3300002067 JGI24735J21928_10071289 JGI24735J21928_100712892 92
417 3300002067 JGI24735J21928_10080656 JGI24735J21928_100806562 92
418 3300002070 JGI24750J21931_1003618 JGI24750J21931_10036184 92
419 3300002073 JGI24745J21846_1007638 JGI24745J21846_10076382 92
420 3300002074 JGI24748J21848_1009620 JGI24748J21848_10096202 92
421 3300002075 JGI24738J21930_10008836 JGI24738J21930_100088363 92
422 3300002075 JGI24738J21930_10045902 JGI24738J21930_100459022 92
423 3300002075 JGI24738J21930_10107237 JGI24738J21930_101072371 92
424 3300002076 JGI24749J21850_1006751 JGI24749J21850_10067513 92
425 3300002076 JGI24749J21850_1045662 JGI24749J21850_10456621 92
426 3300002077 JGI24744J21845_10016250 JGI24744J21845_100162501 92
427 3300002155 JGI24033J26618_1010324 JGI24033J26618_10103242 92
428 3300002239 JGI24034J26672_10003374 JGI24034J26672_100033745 92
429 3300002239 JGI24034J26672_10008215 JGI24034J26672_100082153 92
430 3300002239 JGI24034J26672_10085257 JGI24034J26672_100852571 92
431 3300002244 JGI24742J22300_10001461 JGI24742J22300_100014616 92
432 3300003187 JGI25151J46595_10000038 JGI25151J46595_100000387 92
433 3300003203 JGI25406J46586_10002015 JGI25406J46586_100020157 92
434 3300003203 JGI25406J46586_10037973 JGI25406J46586_100379732 92
435 3300003203 JGI25406J46586_10126597 JGI25406J46586_101265972 92
436 3300003214 JGI25165J46597_1007977 JGI25165J46597_10079771 92
437 3300003214 JGI25165J46597_1010113 JGI25165J46597_10101132 92
438 3300003215 JGI25153J46596_10001601 JGI25153J46596_1000160121 92
439 3300003305 Ga0006770J48903_1084366 Ga0006770J48903_10843661 92
440 3300003354 JGI25160J50197_1015787 JGI25160J50197_10157875 92
441 3300003373 JGI25407J50210_10144840 JGI25407J50210_101448401 92
442 3300003574 Ga0007410J51695_1089125 Ga0007410J51695_10891251 92
443 3300003574 Ga0007410J51695_1104424 Ga0007410J51695_11044241 92
444 3300003578 Ga0006562J51391_1028159 Ga0006562J51391_10281592 92
445 3300003659 JGI25404J52841_10000285 JGI25404J52841_100002852 92
446 3300003659 JGI25404J52841_10018143 JGI25404J52841_100181431 92
447 3300003659 JGI25404J52841_10026754 JGI25404J52841_100267543 92
448 3300003659 JGI25404J52841_10039088 JGI25404J52841_100390881 92
449 3300003752 Ga0055539_1034370 Ga0055539_10343701 92
450 3300003752 Ga0055539_1036865 Ga0055539_10368651 92
451 3300003759 Ga0055525_1005236 Ga0055525_10052362 92
452 3300003771 Ga0055526_1040475 Ga0055526_10404753 92
453 3300003771 Ga0055526_1058946 Ga0055526_10589462 92
454 3300003771 Ga0055526_1059001 Ga0055526_10590012 92
455 3300003775 Ga0055524_1034854 Ga0055524_10348541 92
456 3300003775 Ga0055524_1043404 Ga0055524_10434043 92
457 3300003775 Ga0055524_1073859 Ga0055524_10738592 92
458 3300003781 Ga0055536_1070838 Ga0055536_10708382 92
459 3300003790 Ga0055528_1049333 Ga0055528_10493332 92
460 3300003794 Ga0055531_10017791 Ga0055531_100177914 92
461 3300003911 JGI25405J52794_10006513 JGI25405J52794_100065134 92
462 3300003911 JGI25405J52794_10016220 JGI25405J52794_100162201 92
463 3300004799 Ga0058863_11944502 Ga0058863_119445021 92
464 3300004803 Ga0058862_12836675 Ga0058862_128366752 92
465 3300005262 Ga0065165_1000631 Ga0065165_10006317 92
466 3300005262 Ga0065165_1037117 Ga0065165_10371172 92
467 3300005262 Ga0065165_1042482 Ga0065165_10424821 92
468 3300005262 Ga0065165_1048930 Ga0065165_10489302 92
469 3300005289 Ga0065704_10043305 Ga0065704_100433052 92
470 3300005290 Ga0065712_10166356 Ga0065712_101663563 92
471 3300005290 Ga0065712_10494040 Ga0065712_104940402 92
472 3300005293 Ga0065715_10210058 Ga0065715_102100582 92
473 3300005295 Ga0065707_10032468 Ga0065707_100324682 92
474 3300005327 Ga0070658_10003484 Ga0070658_100034843 92
475 3300005327 Ga0070658_10018691 Ga0070658_100186918 92
476 3300005327 Ga0070658_10059824 Ga0070658_100598245 92
477 3300005327 Ga0070658_10141482 Ga0070658_101414824 92
478 3300005327 Ga0070658_10149675 Ga0070658_101496753 92
479 3300005327 Ga0070658_10377135 Ga0070658_103771353 92
480 3300005327 Ga0070658_10449241 Ga0070658_104492412 92
481 3300005327 Ga0070658_10554365 Ga0070658_105543653 92
482 3300005327 Ga0070658_10929140 Ga0070658_109291402 92
483 3300005327 Ga0070658_11721721 Ga0070658_117217212 92
484 3300005328 Ga0070676_10091040 Ga0070676_100910402 92
485 3300005328 Ga0070676_10795038 Ga0070676_107950382 92
486 3300005328 Ga0070676_11479585 Ga0070676_114795851 92
487 3300005329 Ga0070683_100048217 Ga0070683_1000482175 92
488 3300005329 Ga0070683_100109825 Ga0070683_1001098253 92
489 3300005329 Ga0070683_100162727 Ga0070683_1001627271 92
490 3300005329 Ga0070683_100315096 Ga0070683_1003150963 92
491 3300005329 Ga0070683_100428820 Ga0070683_1004288201 92
492 3300005329 Ga0070683_100851129 Ga0070683_1008511292 92
493 3300005329 Ga0070683_102329977 Ga0070683_1023299771 92
494 3300005330 Ga0070690_100344106 Ga0070690_1003441062 92
495 3300005330 Ga0070690_100490346 Ga0070690_1004903462 92
496 3300005330 Ga0070690_100617413 Ga0070690_1006174132 92
497 3300005330 Ga0070690_100639155 Ga0070690_1006391551 92
498 3300005330 Ga0070690_100850454 Ga0070690_1008504541 92
499 3300005331 Ga0070670_100384152 Ga0070670_1003841522 92
500 3300005331 Ga0070670_100418983 Ga0070670_1004189832 92
501 3300005333 Ga0070677_10087420 Ga0070677_100874202 92
502 3300005333 Ga0070677_10448297 Ga0070677_104482972 92
503 3300005333 Ga0070677_10579788 Ga0070677_105797881 92
504 3300005334 Ga0068869_100337079 Ga0068869_1003370793 92
505 3300005334 Ga0068869_101608402 Ga0068869_1016084022 92
506 3300005335 Ga0070666_10187494 Ga0070666_101874943 92
507 3300005335 Ga0070666_10425810 Ga0070666_104258101 92
508 3300005335 Ga0070666_11232056 Ga0070666_112320562 92
509 3300005335 Ga0070666_11305010 Ga0070666_113050102 92
510 3300005335 Ga0070666_11415347 Ga0070666_114153472 92
511 3300005336 Ga0070680_100013921 Ga0070680_1000139218 92
512 3300005336 Ga0070680_100052990 Ga0070680_1000529901 92
513 3300005336 Ga0070680_100098147 Ga0070680_1000981472 92
514 3300005336 Ga0070680_100111384 Ga0070680_1001113842 92
515 3300005336 Ga0070680_100544621 Ga0070680_1005446212 92
516 3300005336 Ga0070680_100941596 Ga0070680_1009415962 92
517 3300005336 Ga0070680_101314560 Ga0070680_1013145602 92
518 3300005336 Ga0070680_101714104 Ga0070680_1017141042 92
519 3300005337 Ga0070682_100221310 Ga0070682_1002213102 92
520 3300005337 Ga0070682_100590212 Ga0070682_1005902122 92
521 3300005337 Ga0070682_100882137 Ga0070682_1008821371 92
522 3300005338 Ga0068868_100089546 Ga0068868_1000895465 92
523 3300005338 Ga0068868_100335413 Ga0068868_1003354132 92
524 3300005338 Ga0068868_101482100 Ga0068868_1014821001 92
525 3300005338 Ga0068868_101866344 Ga0068868_1018663441 92
526 3300005338 Ga0068868_101930181 Ga0068868_1019301812 92
527 3300005339 Ga0070660_100020152 Ga0070660_1000201522 92
528 3300005339 Ga0070660_100043206 Ga0070660_1000432067 92
529 3300005339 Ga0070660_100379061 Ga0070660_1003790612 92
530 3300005339 Ga0070660_100828844 Ga0070660_1008288442 92
531 3300005339 Ga0070660_100905969 Ga0070660_1009059692 92
532 3300005339 Ga0070660_100965125 Ga0070660_1009651251 92
533 3300005339 Ga0070660_101060444 Ga0070660_1010604442 92
534 3300005339 Ga0070660_101781534 Ga0070660_1017815341 92
535 3300005340 Ga0070689_101005573 Ga0070689_1010055732 92
536 3300005340 Ga0070689_101055203 Ga0070689_1010552032 92
537 3300005340 Ga0070689_101743560 Ga0070689_1017435602 92
538 3300005340 Ga0070689_102073726 Ga0070689_1020737261 92
539 3300005341 Ga0070691_10050230 Ga0070691_100502304 92
540 3300005341 Ga0070691_10112188 Ga0070691_101121882 92
541 3300005341 Ga0070691_10194944 Ga0070691_101949441 92
542 3300005341 Ga0070691_10412336 Ga0070691_104123361 92
543 3300005341 Ga0070691_11022946 Ga0070691_110229461 92
544 3300005343 Ga0070687_100606939 Ga0070687_1006069392 92
545 3300005343 Ga0070687_101056434 Ga0070687_1010564342 92
546 3300005343 Ga0070687_101542990 Ga0070687_1015429901 92
547 3300005344 Ga0070661_100273191 Ga0070661_1002731912 92
548 3300005344 Ga0070661_100617823 Ga0070661_1006178233 92
549 3300005344 Ga0070661_100851251 Ga0070661_1008512511 92
550 3300005344 Ga0070661_101388297 Ga0070661_1013882972 92
551 3300005345 Ga0070692_10315344 Ga0070692_103153442 92
552 3300005345 Ga0070692_11402456 Ga0070692_114024561 92
553 3300005347 Ga0070668_100288942 Ga0070668_1002889421 92
554 3300005347 Ga0070668_100446810 Ga0070668_1004468103 92
555 3300005347 Ga0070668_100989015 Ga0070668_1009890152 92
556 3300005347 Ga0070668_101285038 Ga0070668_1012850382 92
557 3300005353 Ga0070669_100254933 Ga0070669_1002549333 92
558 3300005353 Ga0070669_100508770 Ga0070669_1005087702 92
559 3300005353 Ga0070669_101804504 Ga0070669_1018045041 92
560 3300005354 Ga0070675_100138918 Ga0070675_1001389184 92
561 3300005354 Ga0070675_100745428 Ga0070675_1007454281 92
562 3300005354 Ga0070675_101617184 Ga0070675_1016171842 92
563 3300005354 Ga0070675_101660687 Ga0070675_1016606871 92
564 3300005354 Ga0070675_102079071 Ga0070675_1020790712 92
565 3300005355 Ga0070671_100247662 Ga0070671_1002476622 92
566 3300005356 Ga0070674_100212363 Ga0070674_1002123632 92
567 3300005356 Ga0070674_100305102 Ga0070674_1003051022 92
568 3300005356 Ga0070674_100873442 Ga0070674_1008734422 92
569 3300005356 Ga0070674_101347732 Ga0070674_1013477322 92
570 3300005356 Ga0070674_101485949 Ga0070674_1014859491 92
571 3300005356 Ga0070674_101517589 Ga0070674_1015175892 92
572 3300005364 Ga0070673_100149123 Ga0070673_1001491233 92
573 3300005364 Ga0070673_100257319 Ga0070673_1002573192 92
574 3300005364 Ga0070673_100545820 Ga0070673_1005458202 92
575 3300005364 Ga0070673_100559426 Ga0070673_1005594262 92
576 3300005364 Ga0070673_101005202 Ga0070673_1010052022 92
577 3300005364 Ga0070673_101579545 Ga0070673_1015795452 92
578 3300005365 Ga0070688_100204268 Ga0070688_1002042682 92
579 3300005365 Ga0070688_100219192 Ga0070688_1002191923 92
580 3300005365 Ga0070688_100412907 Ga0070688_1004129072 92
581 3300005365 Ga0070688_100438104 Ga0070688_1004381042 92
582 3300005365 Ga0070688_101148087 Ga0070688_1011480872 92
583 3300005365 Ga0070688_101653647 Ga0070688_1016536472 92
584 3300005366 Ga0070659_100077071 Ga0070659_1000770716 92
585 3300005366 Ga0070659_100173078 Ga0070659_1001730784 92
586 3300005366 Ga0070659_100279605 Ga0070659_1002796053 92
587 3300005366 Ga0070659_100405512 Ga0070659_1004055123 92
588 3300005366 Ga0070659_101176116 Ga0070659_1011761162 92
589 3300005366 Ga0070659_101205016 Ga0070659_1012050161 92
590 3300005366 Ga0070659_101938453 Ga0070659_1019384531 92
591 3300005367 Ga0070667_100582091 Ga0070667_1005820912 92
592 3300005367 Ga0070667_100649895 Ga0070667_1006498952 92
593 3300005367 Ga0070667_101502818 Ga0070667_1015028182 92
594 3300005406 Ga0070703_10006956 Ga0070703_100069561 92
595 3300005406 Ga0070703_10290824 Ga0070703_102908241 92
596 3300005434 Ga0070709_10020478 Ga0070709_100204784 92
597 3300005434 Ga0070709_10022452 Ga0070709_100224523 92
598 3300005434 Ga0070709_10147752 Ga0070709_101477524 92
599 3300005434 Ga0070709_10425917 Ga0070709_104259171 92
600 3300005434 Ga0070709_10641184 Ga0070709_106411842 92
601 3300005434 Ga0070709_10974319 Ga0070709_109743191 92
602 3300005434 Ga0070709_11089290 Ga0070709_110892901 92
603 3300005434 Ga0070709_11319130 Ga0070709_113191301 92
604 3300005434 Ga0070709_11594002 Ga0070709_115940021 92
605 3300005435 Ga0070714_100026711 Ga0070714_1000267116 92
606 3300005435 Ga0070714_100101173 Ga0070714_1001011736 92
607 3300005435 Ga0070714_100164548 Ga0070714_1001645482 92
608 3300005435 Ga0070714_100241439 Ga0070714_1002414393 92
609 3300005435 Ga0070714_100400871 Ga0070714_1004008712 92
610 3300005435 Ga0070714_100420033 Ga0070714_1004200333 92
611 3300005435 Ga0070714_100648189 Ga0070714_1006481892 92
612 3300005435 Ga0070714_100733224 Ga0070714_1007332242 92
613 3300005435 Ga0070714_100841621 Ga0070714_1008416211 92
614 3300005435 Ga0070714_100972381 Ga0070714_1009723812 92
615 3300005435 Ga0070714_101294377 Ga0070714_1012943771 92
616 3300005435 Ga0070714_101791224 Ga0070714_1017912241 92
617 3300005435 Ga0070714_101997586 Ga0070714_1019975862 92
618 3300005435 Ga0070714_102180766 Ga0070714_1021807661 92
619 3300005435 Ga0070714_102433937 Ga0070714_1024339371 92
620 3300005436 Ga0070713_100017903 Ga0070713_10001790313 92
621 3300005436 Ga0070713_100036694 Ga0070713_1000366943 92
622 3300005436 Ga0070713_100061311 Ga0070713_1000613114 92
623 3300005436 Ga0070713_100102071 Ga0070713_1001020716 92
624 3300005436 Ga0070713_100224386 Ga0070713_1002243864 92
625 3300005436 Ga0070713_100237764 Ga0070713_1002377643 92
626 3300005436 Ga0070713_100522757 Ga0070713_1005227572 92
627 3300005436 Ga0070713_100590365 Ga0070713_1005903651 92
628 3300005436 Ga0070713_100768387 Ga0070713_1007683872 92
629 3300005436 Ga0070713_100828385 Ga0070713_1008283852 92
630 3300005436 Ga0070713_100866824 Ga0070713_1008668241 92
631 3300005436 Ga0070713_101340900 Ga0070713_1013409001 92
632 3300005436 Ga0070713_102101011 Ga0070713_1021010112 92
633 3300005437 Ga0070710_10003270 Ga0070710_1000327017 92
634 3300005437 Ga0070710_10005644 Ga0070710_100056446 92
635 3300005437 Ga0070710_10330465 Ga0070710_103304652 92
636 3300005437 Ga0070710_10487690 Ga0070710_104876902 92
637 3300005437 Ga0070710_10615390 Ga0070710_106153902 92
638 3300005437 Ga0070710_10771296 Ga0070710_107712962 92
639 3300005437 Ga0070710_10916640 Ga0070710_109166402 92
640 3300005437 Ga0070710_11133496 Ga0070710_111334962 92
641 3300005437 Ga0070710_11327786 Ga0070710_113277861 92
642 3300005438 Ga0070701_10430256 Ga0070701_104302562 92
643 3300005438 Ga0070701_10757285 Ga0070701_107572852 92
644 3300005439 Ga0070711_100004304 Ga0070711_1000043048 92
645 3300005439 Ga0070711_100007497 Ga0070711_1000074972 92
646 3300005439 Ga0070711_100016474 Ga0070711_1000164742 92
647 3300005439 Ga0070711_100125941 Ga0070711_1001259412 92
648 3300005439 Ga0070711_100144950 Ga0070711_1001449502 92
649 3300005439 Ga0070711_100275314 Ga0070711_1002753143 92
650 3300005439 Ga0070711_100297247 Ga0070711_1002972473 92
651 3300005439 Ga0070711_100414190 Ga0070711_1004141902 92
652 3300005439 Ga0070711_100556072 Ga0070711_1005560722 92
653 3300005439 Ga0070711_100671284 Ga0070711_1006712841 92
654 3300005439 Ga0070711_101606653 Ga0070711_1016066531 92
655 3300005439 Ga0070711_102049765 Ga0070711_1020497651 92
656 3300005440 Ga0070705_101684137 Ga0070705_1016841372 92
657 3300005441 Ga0070700_100460691 Ga0070700_1004606912 92
658 3300005444 Ga0070694_101053568 Ga0070694_1010535681 92
659 3300005444 Ga0070694_101057506 Ga0070694_1010575062 92
660 3300005444 Ga0070694_101212620 Ga0070694_1012126202 92
661 3300005445 Ga0070708_100364714 Ga0070708_1003647143 92
662 3300005445 Ga0070708_100625766 Ga0070708_1006257662 92
663 3300005455 Ga0070663_100039409 Ga0070663_1000394094 92
664 3300005455 Ga0070663_100193928 Ga0070663_1001939283 92
665 3300005455 Ga0070663_100258561 Ga0070663_1002585612 92
666 3300005455 Ga0070663_100486555 Ga0070663_1004865552 92
667 3300005455 Ga0070663_101013197 Ga0070663_1010131971 92
668 3300005455 Ga0070663_101300299 Ga0070663_1013002991 92
669 3300005455 Ga0070663_101507321 Ga0070663_1015073212 92
670 3300005455 Ga0070663_101660539 Ga0070663_1016605391 92
671 3300005455 Ga0070663_101755910 Ga0070663_1017559101 92
672 3300005455 Ga0070663_101901435 Ga0070663_1019014351 92
673 3300005455 Ga0070663_102062086 Ga0070663_1020620861 92
674 3300005456 Ga0070678_100956144 Ga0070678_1009561441 92
675 3300005456 Ga0070678_101117904 Ga0070678_1011179042 92
676 3300005456 Ga0070678_101414841 Ga0070678_1014148412 92
677 3300005457 Ga0070662_100290526 Ga0070662_1002905263 92
678 3300005457 Ga0070662_100302194 Ga0070662_1003021941 92
679 3300005457 Ga0070662_100325146 Ga0070662_1003251463 92
680 3300005457 Ga0070662_101017813 Ga0070662_1010178132 92
681 3300005457 Ga0070662_101407304 Ga0070662_1014073041 92
682 3300005458 Ga0070681_10029025 Ga0070681_100290254 92
683 3300005458 Ga0070681_10066848 Ga0070681_100668485 92
684 3300005458 Ga0070681_10298378 Ga0070681_102983783 92
685 3300005458 Ga0070681_10406142 Ga0070681_104061423 92
686 3300005458 Ga0070681_10584946 Ga0070681_105849461 92
687 3300005458 Ga0070681_10717886 Ga0070681_107178862 92
688 3300005458 Ga0070681_11181589 Ga0070681_111815892 92
689 3300005459 Ga0068867_100382502 Ga0068867_1003825022 92
690 3300005459 Ga0068867_101849110 Ga0068867_1018491101 92
691 3300005459 Ga0068867_102056228 Ga0068867_1020562282 92
692 3300005459 Ga0068867_102096808 Ga0068867_1020968082 92
693 3300005459 Ga0068867_102398290 Ga0068867_1023982901 92
694 3300005466 Ga0070685_10102663 Ga0070685_101026633 92
695 3300005466 Ga0070685_10650820 Ga0070685_106508201 92
696 3300005466 Ga0070685_11006176 Ga0070685_110061762 92
697 3300005466 Ga0070685_11214007 Ga0070685_112140072 92
698 3300005467 Ga0070706_100134455 Ga0070706_1001344552 92
699 3300005467 Ga0070706_100373318 Ga0070706_1003733182 92
700 3300005467 Ga0070706_100638524 Ga0070706_1006385242 92
701 3300005468 Ga0070707_100158651 Ga0070707_1001586514 92
702 3300005468 Ga0070707_100465880 Ga0070707_1004658802 92
703 3300005468 Ga0070707_100531073 Ga0070707_1005310732 92
704 3300005468 Ga0070707_100612267 Ga0070707_1006122672 92
705 3300005468 Ga0070707_102134018 Ga0070707_1021340181 92
706 3300005471 Ga0070698_100118731 Ga0070698_1001187314 92
707 3300005471 Ga0070698_100255878 Ga0070698_1002558782 92
708 3300005471 Ga0070698_100430065 Ga0070698_1004300652 92
709 3300005471 Ga0070698_101115145 Ga0070698_1011151451 92
710 3300005518 Ga0070699_100100989 Ga0070699_1001009893 92
711 3300005518 Ga0070699_100368541 Ga0070699_1003685411 92
712 3300005530 Ga0070679_100181575 Ga0070679_1001815752 92
713 3300005530 Ga0070679_100301005 Ga0070679_1003010052 92
714 3300005530 Ga0070679_100363121 Ga0070679_1003631212 92
715 3300005530 Ga0070679_100421250 Ga0070679_1004212502 92
716 3300005530 Ga0070679_100441297 Ga0070679_1004412973 92
717 3300005530 Ga0070679_100577763 Ga0070679_1005777633 92
718 3300005530 Ga0070679_100582472 Ga0070679_1005824722 92
719 3300005530 Ga0070679_100843424 Ga0070679_1008434242 92
720 3300005530 Ga0070679_101287858 Ga0070679_1012878581 92
721 3300005530 Ga0070679_101489590 Ga0070679_1014895901 92
722 3300005535 Ga0070684_100047080 Ga0070684_1000470805 92
723 3300005535 Ga0070684_100457840 Ga0070684_1004578403 92
724 3300005535 Ga0070684_100537056 Ga0070684_1005370563 92
725 3300005535 Ga0070684_100707206 Ga0070684_1007072061 92
726 3300005536 Ga0070697_100077313 Ga0070697_1000773135 92
727 3300005536 Ga0070697_100361137 Ga0070697_1003611371 92
728 3300005536 Ga0070697_100577948 Ga0070697_1005779481 92
729 3300005536 Ga0070697_100609805 Ga0070697_1006098052 92
730 3300005536 Ga0070697_101226796 Ga0070697_1012267961 92
731 3300005539 Ga0068853_100099810 Ga0068853_1000998103 92
732 3300005539 Ga0068853_100104886 Ga0068853_1001048866 92
733 3300005539 Ga0068853_100114848 Ga0068853_1001148485 92
734 3300005539 Ga0068853_100269466 Ga0068853_1002694663 92
735 3300005539 Ga0068853_100655263 Ga0068853_1006552632 92
736 3300005543 Ga0070672_100293767 Ga0070672_1002937673 92
737 3300005543 Ga0070672_100321003 Ga0070672_1003210032 92
738 3300005543 Ga0070672_101256174 Ga0070672_1012561742 92
739 3300005543 Ga0070672_101502371 Ga0070672_1015023712 92
740 3300005544 Ga0070686_100378097 Ga0070686_1003780972 92
741 3300005544 Ga0070686_100583651 Ga0070686_1005836511 92
742 3300005545 Ga0070695_100349851 Ga0070695_1003498512 92
743 3300005545 Ga0070695_100851830 Ga0070695_1008518302 92
744 3300005545 Ga0070695_101125064 Ga0070695_1011250642 92
745 3300005546 Ga0070696_100085600 Ga0070696_1000856005 92
746 3300005546 Ga0070696_100457166 Ga0070696_1004571661 92
747 3300005546 Ga0070696_101629540 Ga0070696_1016295402 92
748 3300005547 Ga0070693_100069735 Ga0070693_1000697353 92
749 3300005547 Ga0070693_100386757 Ga0070693_1003867571 92
750 3300005547 Ga0070693_100683740 Ga0070693_1006837401 92
751 3300005547 Ga0070693_100863099 Ga0070693_1008630992 92
752 3300005548 Ga0070665_100051080 Ga0070665_1000510803 92
753 3300005548 Ga0070665_100522604 Ga0070665_1005226041 92
754 3300005548 Ga0070665_100752502 Ga0070665_1007525023 92
755 3300005548 Ga0070665_100816497 Ga0070665_1008164972 92
756 3300005548 Ga0070665_100865640 Ga0070665_1008656402 92
757 3300005548 Ga0070665_102280687 Ga0070665_1022806872 92
758 3300005563 Ga0068855_100076631 Ga0068855_1000766314 92
759 3300005563 Ga0068855_100351951 Ga0068855_1003519511 92
760 3300005563 Ga0068855_100360625 Ga0068855_1003606252 92
761 3300005563 Ga0068855_100364157 Ga0068855_1003641573 92
762 3300005563 Ga0068855_100370886 Ga0068855_1003708861 92
763 3300005563 Ga0068855_100455472 Ga0068855_1004554722 92
764 3300005563 Ga0068855_100473801 Ga0068855_1004738012 92
765 3300005563 Ga0068855_100767943 Ga0068855_1007679433 92
766 3300005563 Ga0068855_100850852 Ga0068855_1008508522 92
767 3300005563 Ga0068855_101074344 Ga0068855_1010743441 92
768 3300005563 Ga0068855_101156176 Ga0068855_1011561761 92
769 3300005563 Ga0068855_101981109 Ga0068855_1019811092 92
770 3300005564 Ga0070664_100545637 Ga0070664_1005456371 92
771 3300005564 Ga0070664_101008838 Ga0070664_1010088382 92
772 3300005564 Ga0070664_101018818 Ga0070664_1010188182 92
773 3300005564 Ga0070664_101544171 Ga0070664_1015441712 92
774 3300005577 Ga0068857_100268149 Ga0068857_1002681493 92
775 3300005577 Ga0068857_100332988 Ga0068857_1003329883 92
776 3300005577 Ga0068857_100337708 Ga0068857_1003377083 92
777 3300005577 Ga0068857_100368967 Ga0068857_1003689673 92
778 3300005577 Ga0068857_100679097 Ga0068857_1006790973 92
779 3300005577 Ga0068857_100761770 Ga0068857_1007617701 92
780 3300005577 Ga0068857_100955337 Ga0068857_1009553372 92
781 3300005578 Ga0068854_100203561 Ga0068854_1002035611 92
782 3300005578 Ga0068854_100221518 Ga0068854_1002215182 92
783 3300005578 Ga0068854_100234384 Ga0068854_1002343843 92
784 3300005578 Ga0068854_100658593 Ga0068854_1006585932 92
785 3300005578 Ga0068854_101714491 Ga0068854_1017144911 92
786 3300005578 Ga0068854_101737477 Ga0068854_1017374772 92
787 3300005578 Ga0068854_102051326 Ga0068854_1020513262 92
788 3300005578 Ga0068854_102100530 Ga0068854_1021005301 92
789 3300005614 Ga0068856_100105907 Ga0068856_1001059071 92
790 3300005614 Ga0068856_100106131 Ga0068856_1001061315 92
791 3300005614 Ga0068856_100267768 Ga0068856_1002677683 92
792 3300005614 Ga0068856_100480094 Ga0068856_1004800942 92
793 3300005614 Ga0068856_100738474 Ga0068856_1007384742 92
794 3300005614 Ga0068856_100878170 Ga0068856_1008781702 92
795 3300005614 Ga0068856_101323161 Ga0068856_1013231612 92
796 3300005614 Ga0068856_101977115 Ga0068856_1019771152 92
797 3300005614 Ga0068856_102336193 Ga0068856_1023361931 92
798 3300005615 Ga0070702_100391127 Ga0070702_1003911272 92
799 3300005615 Ga0070702_100740858 Ga0070702_1007408582 92
800 3300005615 Ga0070702_101493945 Ga0070702_1014939451 92
801 3300005616 Ga0068852_100022852 Ga0068852_1000228527 92
802 3300005616 Ga0068852_100087957 Ga0068852_1000879573 92
803 3300005616 Ga0068852_100363298 Ga0068852_1003632982 92
804 3300005616 Ga0068852_101486830 Ga0068852_1014868302 92
805 3300005616 Ga0068852_101503762 Ga0068852_1015037622 92
806 3300005616 Ga0068852_101858687 Ga0068852_1018586872 92
807 3300005617 Ga0068859_100395497 Ga0068859_1003954973 92
808 3300005617 Ga0068859_100830027 Ga0068859_1008300273 92
809 3300005617 Ga0068859_101830182 Ga0068859_1018301822 92
810 3300005618 Ga0068864_100172362 Ga0068864_1001723623 92
811 3300005618 Ga0068864_100473189 Ga0068864_1004731891 92
812 3300005618 Ga0068864_100557120 Ga0068864_1005571202 92
813 3300005618 Ga0068864_101817577 Ga0068864_1018175772 92
814 3300005618 Ga0068864_101940998 Ga0068864_1019409982 92
815 3300005618 Ga0068864_102418529 Ga0068864_1024185291 92
816 3300005618 Ga0068864_102636192 Ga0068864_1026361922 92
817 3300005718 Ga0068866_10427550 Ga0068866_104275502 92
818 3300005719 Ga0068861_100197839 Ga0068861_1001978394 92
819 3300005719 Ga0068861_100691853 Ga0068861_1006918531 92
820 3300005719 Ga0068861_100873425 Ga0068861_1008734252 92
821 3300005719 Ga0068861_101713882 Ga0068861_1017138822 92
822 3300005834 Ga0068851_10459785 Ga0068851_104597851 92
823 3300005834 Ga0068851_10964493 Ga0068851_109644932 92
824 3300005840 Ga0068870_10398977 Ga0068870_103989772 92
825 3300005840 Ga0068870_10709802 Ga0068870_107098022 92
826 3300005840 Ga0068870_11264272 Ga0068870_112642721 92
827 3300005841 Ga0068863_100207871 Ga0068863_1002078711 92
828 3300005841 Ga0068863_100946167 Ga0068863_1009461672 92
829 3300005841 Ga0068863_101843046 Ga0068863_1018430461 92
830 3300005841 Ga0068863_101861992 Ga0068863_1018619922 92
831 3300005841 Ga0068863_101915782 Ga0068863_1019157822 92
832 3300005841 Ga0068863_102115140 Ga0068863_1021151401 92
833 3300005841 Ga0068863_102207428 Ga0068863_1022074281 92
834 3300005842 Ga0068858_100181351 Ga0068858_1001813512 92
835 3300005842 Ga0068858_100462293 Ga0068858_1004622932 92
836 3300005842 Ga0068858_101661761 Ga0068858_1016617612 92
837 3300005842 Ga0068858_102072205 Ga0068858_1020722052 92
838 3300005842 Ga0068858_102205873 Ga0068858_1022058731 92
839 3300005843 Ga0068860_101780449 Ga0068860_1017804492 92
840 3300005844 Ga0068862_100796424 Ga0068862_1007964243 92
841 3300005937 Ga0081455_10004023 Ga0081455_1000402311 92
842 3300005937 Ga0081455_10011724 Ga0081455_100117243 92
843 3300005937 Ga0081455_10069834 Ga0081455_100698344 92
844 3300005937 Ga0081455_10079097 Ga0081455_100790975 92
845 3300005937 Ga0081455_10390825 Ga0081455_103908252 92
846 3300005937 Ga0081455_10514767 Ga0081455_105147672 92
847 3300005937 Ga0081455_10559034 Ga0081455_105590342 92
848 3300005981 Ga0081538_10006855 Ga0081538_100068554 92
849 3300005981 Ga0081538_10054870 Ga0081538_100548704 92
850 3300005981 Ga0081538_10091122 Ga0081538_100911223 92
851 3300005981 Ga0081538_10190369 Ga0081538_101903692 92
852 3300005983 Ga0081540_1001166 Ga0081540_100116617 92
853 3300005983 Ga0081540_1012152 Ga0081540_10121527 92
854 3300005983 Ga0081540_1017063 Ga0081540_10170636 92
855 3300005983 Ga0081540_1035895 Ga0081540_10358953 92
856 3300005983 Ga0081540_1037580 Ga0081540_10375802 92
857 3300005983 Ga0081540_1231656 Ga0081540_12316562 92
858 3300005983 Ga0081540_1349658 Ga0081540_13496581 92
859 3300005985 Ga0081539_10000273 Ga0081539_100002737 92
860 3300005985 Ga0081539_10004794 Ga0081539_1000479422 92
861 3300005985 Ga0081539_10032744 Ga0081539_100327445 92
862 3300005985 Ga0081539_10054324 Ga0081539_100543243 92
863 3300006028 Ga0070717_10027908 Ga0070717_100279083 92
864 3300006028 Ga0070717_10050273 Ga0070717_100502736 92
865 3300006028 Ga0070717_10309544 Ga0070717_103095443 92
866 3300006028 Ga0070717_10620990 Ga0070717_106209903 92
867 3300006028 Ga0070717_10851838 Ga0070717_108518383 92
868 3300006028 Ga0070717_10891657 Ga0070717_108916572 92
869 3300006028 Ga0070717_10982916 Ga0070717_109829161 92
870 3300006028 Ga0070717_11030346 Ga0070717_110303462 92
871 3300006028 Ga0070717_11042971 Ga0070717_110429712 92
872 3300006028 Ga0070717_11187140 Ga0070717_111871402 92
873 3300006028 Ga0070717_11313344 Ga0070717_113133442 92
874 3300006028 Ga0070717_11377307 Ga0070717_113773072 92
875 3300006038 Ga0075365_10006087 Ga0075365_1000608715 92
876 3300006038 Ga0075365_10128269 Ga0075365_101282692 92
877 3300006038 Ga0075365_10157292 Ga0075365_101572922 92
878 3300006038 Ga0075365_10277246 Ga0075365_102772462 92
879 3300006038 Ga0075365_10334533 Ga0075365_103345332 92
880 3300006038 Ga0075365_10430995 Ga0075365_104309952 92
881 3300006038 Ga0075365_10730261 Ga0075365_107302612 92
882 3300006038 Ga0075365_10928407 Ga0075365_109284072 92
883 3300006042 Ga0075368_10182165 Ga0075368_101821652 92
884 3300006042 Ga0075368_10193480 Ga0075368_101934801 92
885 3300006048 Ga0075363_100064107 Ga0075363_1000641072 92
886 3300006048 Ga0075363_100083702 Ga0075363_1000837022 92
887 3300006048 Ga0075363_100232956 Ga0075363_1002329562 92
888 3300006048 Ga0075363_100239693 Ga0075363_1002396932 92
889 3300006048 Ga0075363_100487883 Ga0075363_1004878832 92
890 3300006048 Ga0075363_100939918 Ga0075363_1009399182 92
891 3300006051 Ga0075364_10019516 Ga0075364_100195167 92
892 3300006051 Ga0075364_10057357 Ga0075364_100573571 92
893 3300006051 Ga0075364_10742176 Ga0075364_107421761 92
894 3300006058 Ga0075432_10121495 Ga0075432_101214953 92
895 3300006163 Ga0070715_10245927 Ga0070715_102459272 92
896 3300006163 Ga0070715_10370713 Ga0070715_103707132 92
897 3300006163 Ga0070715_10648913 Ga0070715_106489132 92
898 3300006163 Ga0070715_10916185 Ga0070715_109161852 92
899 3300006173 Ga0070716_100030514 Ga0070716_1000305143 92
900 3300006173 Ga0070716_100150188 Ga0070716_1001501883 92
901 3300006173 Ga0070716_100278294 Ga0070716_1002782942 92
902 3300006173 Ga0070716_100501290 Ga0070716_1005012901 92
903 3300006173 Ga0070716_100633369 Ga0070716_1006333692 92
904 3300006173 Ga0070716_100696576 Ga0070716_1006965762 92
905 3300006173 Ga0070716_101014974 Ga0070716_1010149742 92
906 3300006173 Ga0070716_101074139 Ga0070716_1010741392 92
907 3300006173 Ga0070716_101177735 Ga0070716_1011777352 92
908 3300006175 Ga0070712_100037138 Ga0070712_1000371385 92
909 3300006175 Ga0070712_100058938 Ga0070712_1000589385 92
910 3300006175 Ga0070712_100319323 Ga0070712_1003193231 92
911 3300006175 Ga0070712_100385614 Ga0070712_1003856143 92
912 3300006175 Ga0070712_100449310 Ga0070712_1004493102 92
913 3300006175 Ga0070712_100775527 Ga0070712_1007755272 92
914 3300006175 Ga0070712_101005710 Ga0070712_1010057101 92
915 3300006175 Ga0070712_101078864 Ga0070712_1010788642 92
916 3300006175 Ga0070712_101624795 Ga0070712_1016247952 92
917 3300006177 Ga0075362_10109178 Ga0075362_101091782 92
918 3300006177 Ga0075362_10160772 Ga0075362_101607722 92
919 3300006177 Ga0075362_10276119 Ga0075362_102761192 92
920 3300006177 Ga0075362_10628678 Ga0075362_106286781 92
921 3300006178 Ga0075367_10313958 Ga0075367_103139582 92
922 3300006186 Ga0075369_10085829 Ga0075369_100858292 92
923 3300006186 Ga0075369_10231421 Ga0075369_102314213 92
924 3300006186 Ga0075369_10261604 Ga0075369_102616042 92
925 3300006186 Ga0075369_10265409 Ga0075369_102654092 92
926 3300006186 Ga0075369_10337159 Ga0075369_103371592 92
927 3300006194 Ga0075427_10025326 Ga0075427_100253262 92
928 3300006195 Ga0075366_10244133 Ga0075366_102441332 92
929 3300006195 Ga0075366_10568269 Ga0075366_105682692 92
930 3300006195 Ga0075366_10813025 Ga0075366_108130251 92
931 3300006237 Ga0097621_100400613 Ga0097621_1004006132 92
932 3300006237 Ga0097621_100544857 Ga0097621_1005448572 92
933 3300006353 Ga0075370_10031552 Ga0075370_100315527 92
934 3300006353 Ga0075370_10032069 Ga0075370_100320692 92
935 3300006353 Ga0075370_10207200 Ga0075370_102072002 92
936 3300006353 Ga0075370_10222117 Ga0075370_102221172 92
937 3300006353 Ga0075370_10255603 Ga0075370_102556032 92
938 3300006353 Ga0075370_10350196 Ga0075370_103501962 92
939 3300006358 Ga0068871_100687347 Ga0068871_1006873473 92
940 3300006358 Ga0068871_101186708 Ga0068871_1011867082 92
941 3300006358 Ga0068871_101373614 Ga0068871_1013736142 92
942 3300006844 Ga0075428_100089056 Ga0075428_1000890565 92
943 3300006844 Ga0075428_100089192 Ga0075428_1000891922 92
944 3300006844 Ga0075428_100102636 Ga0075428_1001026365 92
945 3300006844 Ga0075428_100397384 Ga0075428_1003973842 92
946 3300006846 Ga0075430_100607453 Ga0075430_1006074532 92
947 3300006846 Ga0075430_100733403 Ga0075430_1007334032 92
948 3300006846 Ga0075430_100998212 Ga0075430_1009982122 92
949 3300006847 Ga0075431_101662886 Ga0075431_1016628862 92
950 3300006852 Ga0075433_10736599 Ga0075433_107365992 92
951 3300006871 Ga0075434_100218638 Ga0075434_1002186383 92
952 3300006871 Ga0075434_100264185 Ga0075434_1002641852 92
953 3300006871 Ga0075434_100297025 Ga0075434_1002970253 92
954 3300006871 Ga0075434_100394211 Ga0075434_1003942113 92
955 3300006871 Ga0075434_101023729 Ga0075434_1010237292 92
956 3300006871 Ga0075434_101223768 Ga0075434_1012237682 92
957 3300006871 Ga0075434_102176875 Ga0075434_1021768752 92
958 3300006871 Ga0075434_102617616 Ga0075434_1026176161 92
959 3300006880 Ga0075429_100597932 Ga0075429_1005979322 92
960 3300006880 Ga0075429_100993338 Ga0075429_1009933382 92
961 3300006880 Ga0075429_101262149 Ga0075429_1012621492 92
962 3300006880 Ga0075429_101868567 Ga0075429_1018685672 92
963 3300006881 Ga0068865_100209012 Ga0068865_1002090122 92
964 3300006881 Ga0068865_101384654 Ga0068865_1013846542 92
965 3300006914 Ga0075436_100018259 Ga0075436_1000182595 92
966 3300006914 Ga0075436_100051091 Ga0075436_1000510915 92
967 3300006914 Ga0075436_100122460 Ga0075436_1001224603 92
968 3300006914 Ga0075436_100461810 Ga0075436_1004618103 92
969 3300006914 Ga0075436_100866344 Ga0075436_1008663442 92
970 3300006914 Ga0075436_101387133 Ga0075436_1013871332 92
971 3300006914 Ga0075436_101479239 Ga0075436_1014792392 92
972 3300006931 Ga0097620_100395504 Ga0097620_1003955042 92
973 3300006931 Ga0097620_100830110 Ga0097620_1008301103 92
974 3300006931 Ga0097620_101830185 Ga0097620_1018301852 92
975 3300006941 Ga0099825_1066225 Ga0099825_10662252 92
976 3300006942 Ga0099824_1024882 Ga0099824_10248821 92
977 3300006943 Ga0099822_1017947 Ga0099822_10179473 92
978 3300006943 Ga0099822_1083415 Ga0099822_10834152 92
979 3300006948 Ga0099826_10356490 Ga0099826_103564902 92
980 3300007076 Ga0075435_100034006 Ga0075435_1000340067 92
981 3300007076 Ga0075435_100344735 Ga0075435_1003447353 92
982 3300007076 Ga0075435_100532358 Ga0075435_1005323583 92
983 3300007076 Ga0075435_100768183 Ga0075435_1007681832 92
984 3300007076 Ga0075435_101328972 Ga0075435_1013289721 92
985 3300007076 Ga0075435_101501048 Ga0075435_1015010482 92
986 3300007076 Ga0075435_101706021 Ga0075435_1017060212 92
987 3300007265 Ga0099794_10005440 Ga0099794_100054407 92
988 3300007265 Ga0099794_10049367 Ga0099794_100493674 92
989 3300007265 Ga0099794_10300161 Ga0099794_103001612 92
990 3300007788 Ga0099795_10002818 Ga0099795_100028181 92
991 3300007788 Ga0099795_10003077 Ga0099795_100030773 92
992 3300007788 Ga0099795_10067973 Ga0099795_100679732 92
993 3300007788 Ga0099795_10170243 Ga0099795_101702432 92
994 3300009036 Ga0105244_10267186 Ga0105244_102671862 92
995 3300009092 Ga0105250_10219143 Ga0105250_102191431 92
996 3300009092 Ga0105250_10548239 Ga0105250_105482392 92
997 3300009093 Ga0105240_10011051 Ga0105240_1001105110 92
998 3300009093 Ga0105240_10041079 Ga0105240_100410798 92
999 3300009093 Ga0105240_10118848 Ga0105240_101188484 92
1000 3300009093 Ga0105240_11465356 Ga0105240_114653562 92
1001 3300009093 Ga0105240_11974093 Ga0105240_119740932 92
1002 3300009093 Ga0105240_12610699 Ga0105240_126106992 92
1003 3300009093 Ga0105240_12629094 Ga0105240_126290942 92
1004 3300009094 Ga0111539_10105552 Ga0111539_101055523 92
1005 3300009094 Ga0111539_10239084 Ga0111539_102390844 92
1006 3300009094 Ga0111539_10543981 Ga0111539_105439812 92
1007 3300009094 Ga0111539_10774838 Ga0111539_107748382 92
1008 3300009094 Ga0111539_12044957 Ga0111539_120449571 92
1009 3300009094 Ga0111539_12919405 Ga0111539_129194052 92
1010 3300009098 Ga0105245_10350693 Ga0105245_103506932 92
1011 3300009098 Ga0105245_10535605 Ga0105245_105356053 92
1012 3300009098 Ga0105245_10828522 Ga0105245_108285221 92
1013 3300009098 Ga0105245_10849781 Ga0105245_108497812 92
1014 3300009098 Ga0105245_11383220 Ga0105245_113832201 92
1015 3300009098 Ga0105245_11438723 Ga0105245_114387232 92
1016 3300009101 Ga0105247_10035209 Ga0105247_100352093 92
1017 3300009101 Ga0105247_10814556 Ga0105247_108145562 92
1018 3300009101 Ga0105247_11061418 Ga0105247_110614181 92
1019 3300009101 Ga0105247_11310239 Ga0105247_113102392 92
1020 3300009147 Ga0114129_10039201 Ga0114129_100392012 92
1021 3300009147 Ga0114129_11019792 Ga0114129_110197921 92
1022 3300009147 Ga0114129_11347340 Ga0114129_113473402 92
1023 3300009147 Ga0114129_11702836 Ga0114129_117028362 92
1024 3300009147 Ga0114129_11734890 Ga0114129_117348901 92
1025 3300009147 Ga0114129_12651848 Ga0114129_126518482 92
1026 3300009147 Ga0114129_13275682 Ga0114129_132756822 92
1027 3300009148 Ga0105243_10937754 Ga0105243_109377542 92
1028 3300009148 Ga0105243_11600575 Ga0105243_116005752 92
1029 3300009174 Ga0105241_10048962 Ga0105241_100489626 92
1030 3300009174 Ga0105241_10431482 Ga0105241_104314822 92
1031 3300009174 Ga0105241_10930479 Ga0105241_109304792 92
1032 3300009174 Ga0105241_11005640 Ga0105241_110056402 92
1033 3300009174 Ga0105241_11034154 Ga0105241_110341542 92
1034 3300009176 Ga0105242_10650071 Ga0105242_106500712 92
1035 3300009176 Ga0105242_11011700 Ga0105242_110117001 92
1036 3300009176 Ga0105242_11817705 Ga0105242_118177052 92
1037 3300009176 Ga0105242_13124273 Ga0105242_131242731 92
1038 3300009177 Ga0105248_10821853 Ga0105248_108218533 92
1039 3300009177 Ga0105248_12130616 Ga0105248_121306162 92
1040 3300009177 Ga0105248_12961344 Ga0105248_129613442 92
1041 3300009545 Ga0105237_10027530 Ga0105237_100275302 92
1042 3300009545 Ga0105237_10246271 Ga0105237_102462714 92
1043 3300009545 Ga0105237_10577316 Ga0105237_105773162 92
1044 3300009545 Ga0105237_10933905 Ga0105237_109339052 92
1045 3300009545 Ga0105237_11051421 Ga0105237_110514212 92
1046 3300009545 Ga0105237_12269892 Ga0105237_122698921 92
1047 3300009545 Ga0105237_12355974 Ga0105237_123559741 92
1048 3300009545 Ga0105237_12417367 Ga0105237_124173672 92
1049 3300009545 Ga0105237_12512161 Ga0105237_125121612 92
1050 3300009551 Ga0105238_10110641 Ga0105238_101106411 92
1051 3300009551 Ga0105238_10199951 Ga0105238_101999512 92
1052 3300009551 Ga0105238_10285175 Ga0105238_102851753 92
1053 3300009551 Ga0105238_10715878 Ga0105238_107158781 92
1054 3300009551 Ga0105238_11186187 Ga0105238_111861872 92
1055 3300009551 Ga0105238_11270595 Ga0105238_112705952 92
1056 3300009551 Ga0105238_11352016 Ga0105238_113520161 92
1057 3300009551 Ga0105238_11546761 Ga0105238_115467612 92
1058 3300009551 Ga0105238_11894624 Ga0105238_118946242 92
1059 3300009551 Ga0105238_12284795 Ga0105238_122847951 92
1060 3300009551 Ga0105238_12967591 Ga0105238_129675912 92
1061 3300009553 Ga0105249_10119920 Ga0105249_101199204 92
1062 3300009553 Ga0105249_11183669 Ga0105249_111836692 92
1063 3300009553 Ga0105249_11281180 Ga0105249_112811802 92
1064 3300009553 Ga0105249_11313983 Ga0105249_113139832 92
1065 3300009553 Ga0105249_12521290 Ga0105249_125212902 92
1066 3300009553 Ga0105249_12722510 Ga0105249_127225101 92
1067 3300010159 Ga0099796_10001539 Ga0099796_100015393 92
1068 3300010159 Ga0099796_10002673 Ga0099796_100026733 92
1069 3300010375 Ga0105239_10057391 Ga0105239_100573917 92
1070 3300010375 Ga0105239_10082555 Ga0105239_100825556 92
1071 3300010375 Ga0105239_10496319 Ga0105239_104963192 92
1072 3300010375 Ga0105239_10938775 Ga0105239_109387753 92
1073 3300010375 Ga0105239_11994127 Ga0105239_119941272 92
1074 3300011119 Ga0105246_10264501 Ga0105246_102645012 92
1075 3300011119 Ga0105246_10264501 Ga0105246_102645014 92
1076 3300011119 Ga0105246_10568219 Ga0105246_105682193 92
1077 3300011119 Ga0105246_12473444 Ga0105246_124734441 92
1078 3300012475 Ga0157317_1002820 Ga0157317_10028202 92
1079 3300012482 Ga0157318_1007907 Ga0157318_10079072 92
1080 3300012483 Ga0157337_1003712 Ga0157337_10037122 92
1081 3300012490 Ga0157322_1001880 Ga0157322_10018802 92
1082 3300012491 Ga0157329_1004972 Ga0157329_10049722 92
1083 3300012495 Ga0157323_1010716 Ga0157323_10107162 92
1084 3300012495 Ga0157323_1019059 Ga0157323_10190592 92
1085 3300012498 Ga0157345_1029760 Ga0157345_10297601 92
1086 3300012503 Ga0157313_1004056 Ga0157313_10040562 92
1087 3300012505 Ga0157339_1029754 Ga0157339_10297542 92
1088 3300012506 Ga0157324_1004804 Ga0157324_10048042 92
1089 3300012507 Ga0157342_1004227 Ga0157342_10042272 92
1090 3300012508 Ga0157315_1004045 Ga0157315_10040452 92
1091 3300012510 Ga0157316_1002522 Ga0157316_10025222 92
1092 3300012513 Ga0157326_1018515 Ga0157326_10185152 92
1093 3300012513 Ga0157326_1092758 Ga0157326_10927581 92
1094 3300012515 Ga0157338_1004748 Ga0157338_10047483 92
1095 3300012515 Ga0157338_1055070 Ga0157338_10550702 92
1096 3300013100 Ga0157373_10211942 Ga0157373_102119422 92
1097 3300013100 Ga0157373_11503650 Ga0157373_115036502 92
1098 3300013102 Ga0157371_10247211 Ga0157371_102472112 92
1099 3300013102 Ga0157371_11057567 Ga0157371_110575672 92
1100 3300013102 Ga0157371_11178437 Ga0157371_111784371 92
1101 3300013104 Ga0157370_10011636 Ga0157370_1001163617 92
1102 3300013104 Ga0157370_10188789 Ga0157370_101887891 92
1103 3300013104 Ga0157370_10238859 Ga0157370_102388593 92
1104 3300013104 Ga0157370_10410968 Ga0157370_104109682 92
1105 3300013104 Ga0157370_10808302 Ga0157370_108083022 92
1106 3300013104 Ga0157370_11311886 Ga0157370_113118862 92
1107 3300013104 Ga0157370_11412938 Ga0157370_114129381 92
1108 3300013104 Ga0157370_11550298 Ga0157370_115502982 92
1109 3300013104 Ga0157370_11651225 Ga0157370_116512252 92
1110 3300013104 Ga0157370_11992654 Ga0157370_119926542 92
1111 3300013105 Ga0157369_10195577 Ga0157369_101955772 92
1112 3300013105 Ga0157369_10500252 Ga0157369_105002522 92
1113 3300013105 Ga0157369_10847295 Ga0157369_108472951 92
1114 3300013105 Ga0157369_11218747 Ga0157369_112187472 92
1115 3300013105 Ga0157369_11452762 Ga0157369_114527621 92
1116 3300013105 Ga0157369_11474745 Ga0157369_114747452 92
1117 3300013105 Ga0157369_11678955 Ga0157369_116789552 92
1118 3300013105 Ga0157369_12437235 Ga0157369_124372351 92
1119 3300013105 Ga0157369_12525952 Ga0157369_125259522 92
1120 3300013105 Ga0157369_12568694 Ga0157369_125686942 92
1121 3300013250 Ga0171462_1042 Ga0171462_104269 92
1122 3300013296 Ga0157374_10708208 Ga0157374_107082081 92
1123 3300013296 Ga0157374_12710742 Ga0157374_127107422 92
1124 3300013297 Ga0157378_10148406 Ga0157378_101484063 92
1125 3300013297 Ga0157378_10426956 Ga0157378_104269563 92
1126 3300013297 Ga0157378_10708695 Ga0157378_107086952 92
1127 3300013306 Ga0163162_10235761 Ga0163162_102357614 92
1128 3300013306 Ga0163162_10254865 Ga0163162_102548654 92
1129 3300013306 Ga0163162_10466387 Ga0163162_104663873 92
1130 3300013306 Ga0163162_10771430 Ga0163162_107714302 92
1131 3300013306 Ga0163162_11758524 Ga0163162_117585242 92
1132 3300013306 Ga0163162_11958592 Ga0163162_119585922 92
1133 3300013307 Ga0157372_10568760 Ga0157372_105687602 92
1134 3300013307 Ga0157372_10647322 Ga0157372_106473222 92
1135 3300013307 Ga0157372_10830741 Ga0157372_108307413 92
1136 3300013307 Ga0157372_10907769 Ga0157372_109077692 92
1137 3300013307 Ga0157372_11345547 Ga0157372_113455471 92
1138 3300013307 Ga0157372_11768184 Ga0157372_117681842 92
1139 3300013307 Ga0157372_13314507 Ga0157372_133145072 92
1140 3300013307 Ga0157372_13444385 Ga0157372_134443852 92
1141 3300013308 Ga0157375_10726964 Ga0157375_107269642 92
1142 3300013308 Ga0157375_11886308 Ga0157375_118863081 92
1143 3300013308 Ga0157375_13812275 Ga0157375_138122752 92
1144 3300014325 Ga0163163_10002310 Ga0163163_100023102 92
1145 3300014325 Ga0163163_10216338 Ga0163163_102163382 92
1146 3300014325 Ga0163163_10727503 Ga0163163_107275032 92
1147 3300014325 Ga0163163_10989170 Ga0163163_109891701 92
1148 3300014325 Ga0163163_11928884 Ga0163163_119288842 92
1149 3300014325 Ga0163163_12288030 Ga0163163_122880302 92
1150 3300014325 Ga0163163_12359953 Ga0163163_123599532 92
1151 3300014325 Ga0163163_12462767 Ga0163163_124627671 92
1152 3300014326 Ga0157380_10446116 Ga0157380_104461162 92
1153 3300014326 Ga0157380_10553956 Ga0157380_105539562 92
1154 3300014326 Ga0157380_11318008 Ga0157380_113180082 92
1155 3300014326 Ga0157380_12406669 Ga0157380_124066692 92
1156 3300014497 Ga0182008_10238096 Ga0182008_102380962 92
1157 3300014497 Ga0182008_10597619 Ga0182008_105976192 92
1158 3300014745 Ga0157377_10226183 Ga0157377_102261833 92
1159 3300014745 Ga0157377_10429759 Ga0157377_104297592 92
1160 3300014968 Ga0157379_10426975 Ga0157379_104269752 92
1161 3300014968 Ga0157379_10544857 Ga0157379_105448572 92
1162 3300014968 Ga0157379_10842013 Ga0157379_108420132 92
1163 3300014969 Ga0157376_10824388 Ga0157376_108243882 92
1164 3300014969 Ga0157376_11356395 Ga0157376_113563951 92
1165 3300014969 Ga0157376_12413926 Ga0157376_124139262 92
1166 3300014969 Ga0157376_12416138 Ga0157376_124161382 92
1167 3300014969 Ga0157376_12444065 Ga0157376_124440652 92
1168 3300015261 Ga0182006_1027833 Ga0182006_10278332 92
1169 3300015261 Ga0182006_1094985 Ga0182006_10949853 92
1170 3300015262 Ga0182007_10051388 Ga0182007_100513882 92
1171 3300015265 Ga0182005_1106876 Ga0182005_11068761 92
1172 3300015265 Ga0182005_1130865 Ga0182005_11308652 92
1173 3300015265 Ga0182005_1141844 Ga0182005_11418442 92
1174 3300017792 Ga0163161_10151206 Ga0163161_101512062 92
1175 3300017792 Ga0163161_10169715 Ga0163161_101697153 92
1176 3300017792 Ga0163161_10255863 Ga0163161_102558632 92
1177 3300017792 Ga0163161_11645718 Ga0163161_116457182 92
1178 3300020069 Ga0197907_10503768 Ga0197907_105037683 92
1179 3300020070 Ga0206356_10016837 Ga0206356_100168373 92
1180 3300020070 Ga0206356_11190343 Ga0206356_111903432 92
1181 3300020080 Ga0206350_11182958 Ga0206350_111829582 92
1182 3300020081 Ga0206354_10932261 Ga0206354_109322611 92
1183 3300020081 Ga0206354_11369192 Ga0206354_113691922 92
1184 3300020082 Ga0206353_11000296 Ga0206353_110002963 92
1185 3300020610 Ga0154015_1089295 Ga0154015_10892952 92
1186 3300020610 Ga0154015_1342435 Ga0154015_13424352 92
1187 3300021320 Ga0214544_1000006 Ga0214544_1000006181 92
1188 3300021321 Ga0214542_1000002 Ga0214542_1000002194 92
1189 3300021324 Ga0214545_1000002 Ga0214545_1000002525 92
1190 3300021327 Ga0214543_1000017 Ga0214543_1000017129 92
1191 3300021358 Ga0213873_10008313 Ga0213873_100083135 92
1192 3300021358 Ga0213873_10011776 Ga0213873_100117762 92
1193 3300021358 Ga0213873_10271586 Ga0213873_102715861 92
1194 3300021361 Ga0213872_10023323 Ga0213872_100233232 92
1195 3300021361 Ga0213872_10127793 Ga0213872_101277932 92
1196 3300021361 Ga0213872_10216963 Ga0213872_102169631 92
1197 3300021361 Ga0213872_10271046 Ga0213872_102710462 92
1198 3300021361 Ga0213872_10287961 Ga0213872_102879611 92
1199 3300021377 Ga0213874_10005223 Ga0213874_100052237 92
1200 3300021377 Ga0213874_10113224 Ga0213874_101132242 92
1201 3300021377 Ga0213874_10181192 Ga0213874_101811922 92
1202 3300021377 Ga0213874_10227745 Ga0213874_102277452 92
1203 3300021377 Ga0213874_10334713 Ga0213874_103347132 92
1204 3300021377 Ga0213874_10430378 Ga0213874_104303781 92
1205 3300021384 Ga0213876_10002961 Ga0213876_100029618 92
1206 3300021384 Ga0213876_10008440 Ga0213876_100084408 92
1207 3300021384 Ga0213876_10037256 Ga0213876_100372563 92
1208 3300021384 Ga0213876_10114933 Ga0213876_101149333 92
1209 3300021384 Ga0213876_10132828 Ga0213876_101328282 92
1210 3300021384 Ga0213876_10142803 Ga0213876_101428032 92
1211 3300021384 Ga0213876_10272182 Ga0213876_102721823 92
1212 3300021384 Ga0213876_10420148 Ga0213876_104201482 92
1213 3300021384 Ga0213876_10426579 Ga0213876_104265791 92
1214 3300021388 Ga0213875_10029044 Ga0213875_100290442 92
1215 3300021388 Ga0213875_10158756 Ga0213875_101587562 92
1216 3300021388 Ga0213875_10197307 Ga0213875_101973072 92
1217 3300021388 Ga0213875_10267557 Ga0213875_102675572 92
1218 3300021388 Ga0213875_10306693 Ga0213875_103066932 92
1219 3300021388 Ga0213875_10344909 Ga0213875_103449092 92
1220 3300021388 Ga0213875_10349705 Ga0213875_103497052 92
1221 3300021388 Ga0213875_10428980 Ga0213875_104289802 92
1222 3300021388 Ga0213875_10446232 Ga0213875_104462322 92
1223 3300021388 Ga0213875_10463123 Ga0213875_104631232 92
1224 3300021388 Ga0213875_10538670 Ga0213875_105386701 92
1225 3300021441 Ga0213871_10016747 Ga0213871_100167474 92
1226 3300021441 Ga0213871_10042064 Ga0213871_100420642 92
1227 3300022467 Ga0224712_10014062 Ga0224712_100140627 92
1228 3300022467 Ga0224712_10277634 Ga0224712_102776341 92
1229 3300023563 Ga0247530_109344 Ga0247530_1093442 92
1230 3300024225 Ga0224572_1066080 Ga0224572_10660802 92
1231 3300025223 Ga0207672_1001920 Ga0207672_10019203 92
1232 3300025230 Ga0209563_103013 Ga0209563_1030132 92
1233 3300025245 Ga0207425_1016877 Ga0207425_10168773 92
1234 3300025253 Ga0209677_100718 Ga0209677_1007187 92
1235 3300025253 Ga0209677_100816 Ga0209677_1008165 92
1236 3300025254 Ga0209148_1001736 Ga0209148_10017365 92
1237 3300025254 Ga0209148_1004162 Ga0209148_10041625 92
1238 3300025258 Ga0209129_1015811 Ga0209129_10158112 92
1239 3300025261 Ga0209233_1003250 Ga0209233_10032506 92
1240 3300025261 Ga0209233_1033139 Ga0209233_10331393 92
1241 3300025263 Ga0209565_1037742 Ga0209565_10377423 92
1242 3300025271 Ga0207666_1007581 Ga0207666_10075813 92
1243 3300025272 Ga0209455_1004495 Ga0209455_10044953 92
1244 3300025272 Ga0209455_1005018 Ga0209455_10050182 92
1245 3300025273 Ga0209673_1030556 Ga0209673_10305562 92
1246 3300025284 Ga0209130_1001794 Ga0209130_10017942 92
1247 3300025290 Ga0207673_1009809 Ga0207673_10098092 92
1248 3300025291 Ga0209675_1002527 Ga0209675_10025274 92
1249 3300025291 Ga0209675_1019183 Ga0209675_10191831 92
1250 3300025292 Ga0209676_1004347 Ga0209676_100434717 92
1251 3300025292 Ga0209676_1010666 Ga0209676_10106663 92
1252 3300025294 Ga0209025_1000014 Ga0209025_10000141 92
1253 3300025294 Ga0209025_1020659 Ga0209025_10206592 92
1254 3300025294 Ga0209025_1147608 Ga0209025_11476082 92
1255 3300025294 Ga0209025_1196026 Ga0209025_11960262 92
1256 3300025295 Ga0209564_1002872 Ga0209564_10028722 92
1257 3300025295 Ga0209564_1009622 Ga0209564_10096223 92
1258 3300025295 Ga0209564_1017841 Ga0209564_10178413 92
1259 3300025295 Ga0209564_1037651 Ga0209564_10376513 92
1260 3300025295 Ga0209564_1038147 Ga0209564_10381471 92
1261 3300025297 Ga0209758_1003798 Ga0209758_10037987 92
1262 3300025297 Ga0209758_1006193 Ga0209758_10061938 92
1263 3300025297 Ga0209758_1033717 Ga0209758_10337174 92
1264 3300025297 Ga0209758_1094541 Ga0209758_10945412 92
1265 3300025297 Ga0209758_1099681 Ga0209758_10996811 92
1266 3300025299 Ga0209256_1000108 Ga0209256_1000108195 92
1267 3300025299 Ga0209256_1000540 Ga0209256_100054064 92
1268 3300025299 Ga0209256_1012246 Ga0209256_10122465 92
1269 3300025302 Ga0207426_1036160 Ga0207426_10361602 92
1270 3300025303 Ga0209051_1123110 Ga0209051_11231102 92
1271 3300025304 Ga0209257_1005510 Ga0209257_10055106 92
1272 3300025304 Ga0209257_1062890 Ga0209257_10628903 92
1273 3300025315 Ga0207697_10030873 Ga0207697_100308733 92
1274 3300025315 Ga0207697_10292706 Ga0207697_102927062 92
1275 3300025321 Ga0207656_10035068 Ga0207656_100350683 92
1276 3300025321 Ga0207656_10260758 Ga0207656_102607582 92
1277 3300025711 Ga0207696_1047026 Ga0207696_10470262 92
1278 3300025885 Ga0207653_10002069 Ga0207653_100020692 92
1279 3300025893 Ga0207682_10030606 Ga0207682_100306064 92
1280 3300025893 Ga0207682_10293941 Ga0207682_102939412 92
1281 3300025898 Ga0207692_10015483 Ga0207692_100154832 92
1282 3300025898 Ga0207692_10040299 Ga0207692_100402994 92
1283 3300025898 Ga0207692_10258100 Ga0207692_102581002 92
1284 3300025898 Ga0207692_10371926 Ga0207692_103719263 92
1285 3300025898 Ga0207692_10869391 Ga0207692_108693912 92
1286 3300025898 Ga0207692_10994730 Ga0207692_109947302 92
1287 3300025899 Ga0207642_10040615 Ga0207642_100406153 92
1288 3300025899 Ga0207642_10471282 Ga0207642_104712822 92
1289 3300025900 Ga0207710_10038695 Ga0207710_100386953 92
1290 3300025900 Ga0207710_10045200 Ga0207710_100452003 92
1291 3300025901 Ga0207688_10046894 Ga0207688_100468946 92
1292 3300025901 Ga0207688_10482486 Ga0207688_104824862 92
1293 3300025903 Ga0207680_10135128 Ga0207680_101351284 92
1294 3300025903 Ga0207680_10189271 Ga0207680_101892712 92
1295 3300025903 Ga0207680_10374990 Ga0207680_103749902 92
1296 3300025904 Ga0207647_10020149 Ga0207647_100201492 92
1297 3300025904 Ga0207647_10067461 Ga0207647_100674614 92
1298 3300025904 Ga0207647_10124631 Ga0207647_101246313 92
1299 3300025904 Ga0207647_10377865 Ga0207647_103778652 92
1300 3300025904 Ga0207647_10453463 Ga0207647_104534632 92
1301 3300025905 Ga0207685_10015387 Ga0207685_100153873 92
1302 3300025905 Ga0207685_10087112 Ga0207685_100871123 92
1303 3300025905 Ga0207685_10741514 Ga0207685_107415141 92
1304 3300025905 Ga0207685_10770685 Ga0207685_107706852 92
1305 3300025905 Ga0207685_10843291 Ga0207685_108432912 92
1306 3300025906 Ga0207699_10003266 Ga0207699_100032666 92
1307 3300025906 Ga0207699_10008214 Ga0207699_100082147 92
1308 3300025906 Ga0207699_10135227 Ga0207699_101352273 92
1309 3300025906 Ga0207699_10295049 Ga0207699_102950493 92
1310 3300025906 Ga0207699_10926887 Ga0207699_109268872 92
1311 3300025906 Ga0207699_11096295 Ga0207699_110962951 92
1312 3300025906 Ga0207699_11341024 Ga0207699_113410242 92
1313 3300025907 Ga0207645_10047744 Ga0207645_100477444 92
1314 3300025907 Ga0207645_10219560 Ga0207645_102195602 92
1315 3300025907 Ga0207645_10345865 Ga0207645_103458652 92
1316 3300025907 Ga0207645_10506502 Ga0207645_105065021 92
1317 3300025908 Ga0207643_10463471 Ga0207643_104634712 92
1318 3300025908 Ga0207643_10531219 Ga0207643_105312191 92
1319 3300025909 Ga0207705_10034426 Ga0207705_100344267 92
1320 3300025909 Ga0207705_10075374 Ga0207705_100753743 92
1321 3300025909 Ga0207705_10118251 Ga0207705_101182514 92
1322 3300025909 Ga0207705_10124003 Ga0207705_101240034 92
1323 3300025909 Ga0207705_10226168 Ga0207705_102261683 92
1324 3300025909 Ga0207705_10384276 Ga0207705_103842763 92
1325 3300025910 Ga0207684_10163353 Ga0207684_101633533 92
1326 3300025910 Ga0207684_10308538 Ga0207684_103085383 92
1327 3300025910 Ga0207684_10323744 Ga0207684_103237443 92
1328 3300025911 Ga0207654_10003167 Ga0207654_100031674 92
1329 3300025911 Ga0207654_10725709 Ga0207654_107257091 92
1330 3300025912 Ga0207707_10004335 Ga0207707_1000433512 92
1331 3300025912 Ga0207707_10051244 Ga0207707_100512442 92
1332 3300025912 Ga0207707_10074687 Ga0207707_100746874 92
1333 3300025912 Ga0207707_10497665 Ga0207707_104976652 92
1334 3300025912 Ga0207707_11155891 Ga0207707_111558912 92
1335 3300025913 Ga0207695_10000159 Ga0207695_10000159183 92
1336 3300025913 Ga0207695_10001032 Ga0207695_1000103226 92
1337 3300025913 Ga0207695_10087202 Ga0207695_100872024 92
1338 3300025913 Ga0207695_10291325 Ga0207695_102913252 92
1339 3300025914 Ga0207671_10041225 Ga0207671_100412252 92
1340 3300025914 Ga0207671_10050006 Ga0207671_100500065 92
1341 3300025914 Ga0207671_10057494 Ga0207671_100574943 92
1342 3300025914 Ga0207671_10355102 Ga0207671_103551022 92
1343 3300025914 Ga0207671_10655803 Ga0207671_106558031 92
1344 3300025914 Ga0207671_10967081 Ga0207671_109670812 92
1345 3300025914 Ga0207671_11238668 Ga0207671_112386682 92
1346 3300025915 Ga0207693_10001926 Ga0207693_1000192622 92
1347 3300025915 Ga0207693_10036016 Ga0207693_100360163 92
1348 3300025915 Ga0207693_10081254 Ga0207693_100812542 92
1349 3300025915 Ga0207693_10105904 Ga0207693_101059044 92
1350 3300025915 Ga0207693_10230505 Ga0207693_102305052 92
1351 3300025915 Ga0207693_10307959 Ga0207693_103079592 92
1352 3300025915 Ga0207693_10322490 Ga0207693_103224903 92
1353 3300025915 Ga0207693_10375467 Ga0207693_103754673 92
1354 3300025915 Ga0207693_11135878 Ga0207693_111358781 92
1355 3300025915 Ga0207693_11442522 Ga0207693_114425222 92
1356 3300025916 Ga0207663_10000218 Ga0207663_1000021811 92
1357 3300025916 Ga0207663_10012076 Ga0207663_100120765 92
1358 3300025916 Ga0207663_10016157 Ga0207663_100161578 92
1359 3300025916 Ga0207663_10048478 Ga0207663_100484782 92
1360 3300025916 Ga0207663_10445669 Ga0207663_104456692 92
1361 3300025916 Ga0207663_10462818 Ga0207663_104628183 92
1362 3300025916 Ga0207663_10892854 Ga0207663_108928541 92
1363 3300025916 Ga0207663_10931050 Ga0207663_109310502 92
1364 3300025916 Ga0207663_11256337 Ga0207663_112563372 92
1365 3300025916 Ga0207663_11563215 Ga0207663_115632152 92
1366 3300025917 Ga0207660_10013609 Ga0207660_100136092 92
1367 3300025917 Ga0207660_10176604 Ga0207660_101766044 92
1368 3300025917 Ga0207660_10548039 Ga0207660_105480392 92
1369 3300025917 Ga0207660_10603228 Ga0207660_106032281 92
1370 3300025917 Ga0207660_11209971 Ga0207660_112099712 92
1371 3300025918 Ga0207662_10069366 Ga0207662_100693663 92
1372 3300025918 Ga0207662_10894376 Ga0207662_108943762 92
1373 3300025919 Ga0207657_10038564 Ga0207657_100385644 92
1374 3300025919 Ga0207657_10056223 Ga0207657_100562232 92
1375 3300025919 Ga0207657_10058646 Ga0207657_100586466 92
1376 3300025919 Ga0207657_10095387 Ga0207657_100953872 92
1377 3300025919 Ga0207657_10216105 Ga0207657_102161053 92
1378 3300025919 Ga0207657_10327092 Ga0207657_103270922 92
1379 3300025920 Ga0207649_10232337 Ga0207649_102323372 92
1380 3300025920 Ga0207649_10336534 Ga0207649_103365343 92
1381 3300025920 Ga0207649_10419940 Ga0207649_104199401 92
1382 3300025920 Ga0207649_10591165 Ga0207649_105911652 92
1383 3300025921 Ga0207652_10004826 Ga0207652_1000482612 92
1384 3300025921 Ga0207652_10105432 Ga0207652_101054323 92
1385 3300025921 Ga0207652_10154533 Ga0207652_101545332 92
1386 3300025921 Ga0207652_11124063 Ga0207652_111240632 92
1387 3300025921 Ga0207652_11387169 Ga0207652_113871692 92
1388 3300025921 Ga0207652_11417270 Ga0207652_114172702 92
1389 3300025921 Ga0207652_11491797 Ga0207652_114917972 92
1390 3300025922 Ga0207646_10386794 Ga0207646_103867942 92
1391 3300025922 Ga0207646_11061501 Ga0207646_110615011 92
1392 3300025922 Ga0207646_11406035 Ga0207646_114060352 92
1393 3300025923 Ga0207681_10434540 Ga0207681_104345402 92
1394 3300025923 Ga0207681_10492842 Ga0207681_104928422 92
1395 3300025923 Ga0207681_11475891 Ga0207681_114758912 92
1396 3300025924 Ga0207694_10004393 Ga0207694_100043935 92
1397 3300025924 Ga0207694_10011574 Ga0207694_100115745 92
1398 3300025924 Ga0207694_10024703 Ga0207694_100247034 92
1399 3300025924 Ga0207694_10049466 Ga0207694_100494662 92
1400 3300025924 Ga0207694_10204207 Ga0207694_102042072 92
1401 3300025924 Ga0207694_11304374 Ga0207694_113043742 92
1402 3300025925 Ga0207650_10258569 Ga0207650_102585692 92
1403 3300025925 Ga0207650_10274784 Ga0207650_102747843 92
1404 3300025925 Ga0207650_11499065 Ga0207650_114990651 92
1405 3300025926 Ga0207659_10234550 Ga0207659_102345503 92
1406 3300025926 Ga0207659_10941610 Ga0207659_109416102 92
1407 3300025927 Ga0207687_10626044 Ga0207687_106260441 92
1408 3300025927 Ga0207687_10690692 Ga0207687_106906923 92
1409 3300025928 Ga0207700_10014261 Ga0207700_100142615 92
1410 3300025928 Ga0207700_10027201 Ga0207700_100272017 92
1411 3300025928 Ga0207700_10071645 Ga0207700_100716453 92
1412 3300025928 Ga0207700_10153882 Ga0207700_101538823 92
1413 3300025928 Ga0207700_10200909 Ga0207700_102009093 92
1414 3300025928 Ga0207700_10797849 Ga0207700_107978492 92
1415 3300025928 Ga0207700_11035441 Ga0207700_110354412 92
1416 3300025928 Ga0207700_11170282 Ga0207700_111702822 92
1417 3300025928 Ga0207700_11194662 Ga0207700_111946621 92
1418 3300025928 Ga0207700_11493164 Ga0207700_114931642 92
1419 3300025928 Ga0207700_11517297 Ga0207700_115172971 92
1420 3300025928 Ga0207700_12028543 Ga0207700_120285432 92
1421 3300025929 Ga0207664_10012504 Ga0207664_100125047 92
1422 3300025929 Ga0207664_10023422 Ga0207664_100234227 92
1423 3300025929 Ga0207664_10086181 Ga0207664_100861814 92
1424 3300025929 Ga0207664_10142749 Ga0207664_101427492 92
1425 3300025929 Ga0207664_10275765 Ga0207664_102757653 92
1426 3300025929 Ga0207664_10354316 Ga0207664_103543162 92
1427 3300025929 Ga0207664_10449136 Ga0207664_104491363 92
1428 3300025929 Ga0207664_10614037 Ga0207664_106140372 92
1429 3300025929 Ga0207664_10880214 Ga0207664_108802141 92
1430 3300025929 Ga0207664_10899014 Ga0207664_108990142 92
1431 3300025929 Ga0207664_11601960 Ga0207664_116019602 92
1432 3300025932 Ga0207690_10013528 Ga0207690_100135287 92
1433 3300025932 Ga0207690_10424105 Ga0207690_104241051 92
1434 3300025932 Ga0207690_10627390 Ga0207690_106273902 92
1435 3300025932 Ga0207690_10689997 Ga0207690_106899972 92
1436 3300025932 Ga0207690_11021142 Ga0207690_110211422 92
1437 3300025932 Ga0207690_11106248 Ga0207690_111062482 92
1438 3300025932 Ga0207690_11742779 Ga0207690_117427792 92
1439 3300025933 Ga0207706_10108527 Ga0207706_101085274 92
1440 3300025933 Ga0207706_10142549 Ga0207706_101425492 92
1441 3300025933 Ga0207706_10398128 Ga0207706_103981283 92
1442 3300025933 Ga0207706_10455649 Ga0207706_104556492 92
1443 3300025934 Ga0207686_11525038 Ga0207686_115250382 92
1444 3300025935 Ga0207709_10323826 Ga0207709_103238262 92
1445 3300025935 Ga0207709_10392007 Ga0207709_103920073 92
1446 3300025935 Ga0207709_11620830 Ga0207709_116208302 92
1447 3300025935 Ga0207709_11826665 Ga0207709_118266651 92
1448 3300025936 Ga0207670_10103506 Ga0207670_101035063 92
1449 3300025936 Ga0207670_10361287 Ga0207670_103612872 92
1450 3300025936 Ga0207670_11578770 Ga0207670_115787702 92
1451 3300025937 Ga0207669_10147675 Ga0207669_101476752 92
1452 3300025937 Ga0207669_10319592 Ga0207669_103195922 92
1453 3300025937 Ga0207669_10819625 Ga0207669_108196251 92
1454 3300025937 Ga0207669_10845734 Ga0207669_108457342 92
1455 3300025937 Ga0207669_11227961 Ga0207669_112279612 92
1456 3300025937 Ga0207669_11866057 Ga0207669_118660572 92
1457 3300025938 Ga0207704_10909843 Ga0207704_109098432 92
1458 3300025939 Ga0207665_10005278 Ga0207665_100052787 92
1459 3300025939 Ga0207665_10332640 Ga0207665_103326403 92
1460 3300025939 Ga0207665_10345218 Ga0207665_103452183 92
1461 3300025939 Ga0207665_10415181 Ga0207665_104151812 92
1462 3300025939 Ga0207665_10447733 Ga0207665_104477332 92
1463 3300025939 Ga0207665_10514922 Ga0207665_105149222 92
1464 3300025939 Ga0207665_10633206 Ga0207665_106332061 92
1465 3300025939 Ga0207665_10682547 Ga0207665_106825472 92
1466 3300025939 Ga0207665_10984891 Ga0207665_109848912 92
1467 3300025940 Ga0207691_10203880 Ga0207691_102038802 92
1468 3300025940 Ga0207691_10307596 Ga0207691_103075962 92
1469 3300025940 Ga0207691_10635942 Ga0207691_106359422 92
1470 3300025940 Ga0207691_11093567 Ga0207691_110935672 92
1471 3300025940 Ga0207691_11257235 Ga0207691_112572352 92
1472 3300025941 Ga0207711_10408213 Ga0207711_104082133 92
1473 3300025941 Ga0207711_10530163 Ga0207711_105301632 92
1474 3300025941 Ga0207711_10695346 Ga0207711_106953461 92
1475 3300025942 Ga0207689_10602882 Ga0207689_106028822 92
1476 3300025942 Ga0207689_10739352 Ga0207689_107393522 92
1477 3300025944 Ga0207661_10025741 Ga0207661_100257414 92
1478 3300025944 Ga0207661_10050770 Ga0207661_100507704 92
1479 3300025944 Ga0207661_10262238 Ga0207661_102622382 92
1480 3300025944 Ga0207661_11444937 Ga0207661_114449372 92
1481 3300025944 Ga0207661_11940388 Ga0207661_119403882 92
1482 3300025945 Ga0207679_10757268 Ga0207679_107572682 92
1483 3300025945 Ga0207679_11157501 Ga0207679_111575011 92
1484 3300025945 Ga0207679_11165321 Ga0207679_111653212 92
1485 3300025945 Ga0207679_11984364 Ga0207679_119843641 92
1486 3300025949 Ga0207667_10004001 Ga0207667_1000400123 92
1487 3300025949 Ga0207667_10027381 Ga0207667_100273811 92
1488 3300025949 Ga0207667_10037495 Ga0207667_100374955 92
1489 3300025949 Ga0207667_10059115 Ga0207667_100591154 92
1490 3300025949 Ga0207667_10071484 Ga0207667_100714848 92
1491 3300025949 Ga0207667_10090231 Ga0207667_100902312 92
1492 3300025949 Ga0207667_10501426 Ga0207667_105014263 92
1493 3300025949 Ga0207667_10595251 Ga0207667_105952513 92
1494 3300025949 Ga0207667_10615307 Ga0207667_106153072 92
1495 3300025949 Ga0207667_10928487 Ga0207667_109284873 92
1496 3300025949 Ga0207667_12051947 Ga0207667_120519472 92
1497 3300025960 Ga0207651_10143854 Ga0207651_101438544 92
1498 3300025960 Ga0207651_10644027 Ga0207651_106440273 92
1499 3300025960 Ga0207651_10716167 Ga0207651_107161672 92
1500 3300025960 Ga0207651_10840755 Ga0207651_108407553 92
1501 3300025960 Ga0207651_11324664 Ga0207651_113246642 92
1502 3300025961 Ga0207712_10101401 Ga0207712_101014014 92
1503 3300025961 Ga0207712_10686493 Ga0207712_106864933 92
1504 3300025961 Ga0207712_10981900 Ga0207712_109819001 92
1505 3300025961 Ga0207712_12052836 Ga0207712_120528362 92
1506 3300025972 Ga0207668_10135774 Ga0207668_101357743 92
1507 3300025972 Ga0207668_10340905 Ga0207668_103409053 92
1508 3300025972 Ga0207668_10391103 Ga0207668_103911033 92
1509 3300025972 Ga0207668_10532840 Ga0207668_105328402 92
1510 3300025972 Ga0207668_11075514 Ga0207668_110755142 92
1511 3300025972 Ga0207668_11555575 Ga0207668_115555752 92
1512 3300025981 Ga0207640_10039083 Ga0207640_100390833 92
1513 3300025981 Ga0207640_10423874 Ga0207640_104238742 92
1514 3300025981 Ga0207640_10485779 Ga0207640_104857792 92
1515 3300025981 Ga0207640_11061101 Ga0207640_110611012 92
1516 3300025986 Ga0207658_10410091 Ga0207658_104100912 92
1517 3300025986 Ga0207658_11636572 Ga0207658_116365722 92
1518 3300026023 Ga0207677_10129817 Ga0207677_101298173 92
1519 3300026035 Ga0207703_10419985 Ga0207703_104199853 92
1520 3300026035 Ga0207703_10694026 Ga0207703_106940263 92
1521 3300026035 Ga0207703_10784239 Ga0207703_107842393 92
1522 3300026035 Ga0207703_11319380 Ga0207703_113193802 92
1523 3300026035 Ga0207703_11658134 Ga0207703_116581342 92
1524 3300026035 Ga0207703_12081283 Ga0207703_120812831 92
1525 3300026041 Ga0207639_10003883 Ga0207639_1000388311 92
1526 3300026041 Ga0207639_10324865 Ga0207639_103248653 92
1527 3300026041 Ga0207639_10366724 Ga0207639_103667243 92
1528 3300026041 Ga0207639_10387188 Ga0207639_103871882 92
1529 3300026041 Ga0207639_11697912 Ga0207639_116979121 92
1530 3300026067 Ga0207678_10146674 Ga0207678_101466743 92
1531 3300026067 Ga0207678_10200304 Ga0207678_102003043 92
1532 3300026067 Ga0207678_10416376 Ga0207678_104163761 92
1533 3300026067 Ga0207678_10553889 Ga0207678_105538893 92
1534 3300026067 Ga0207678_10617010 Ga0207678_106170103 92
1535 3300026067 Ga0207678_10810258 Ga0207678_108102581 92
1536 3300026067 Ga0207678_11345590 Ga0207678_113455901 92
1537 3300026067 Ga0207678_11385523 Ga0207678_113855231 92
1538 3300026067 Ga0207678_11914089 Ga0207678_119140892 92
1539 3300026075 Ga0207708_10027810 Ga0207708_100278103 92
1540 3300026075 Ga0207708_12027155 Ga0207708_120271552 92
1541 3300026078 Ga0207702_10000005 Ga0207702_10000005200 92
1542 3300026078 Ga0207702_10136072 Ga0207702_101360724 92
1543 3300026078 Ga0207702_10274584 Ga0207702_102745843 92
1544 3300026078 Ga0207702_10336027 Ga0207702_103360272 92
1545 3300026078 Ga0207702_10515163 Ga0207702_105151632 92
1546 3300026078 Ga0207702_10715686 Ga0207702_107156862 92
1547 3300026078 Ga0207702_10787309 Ga0207702_107873093 92
1548 3300026078 Ga0207702_10942406 Ga0207702_109424062 92
1549 3300026078 Ga0207702_11111806 Ga0207702_111118062 92
1550 3300026078 Ga0207702_11184760 Ga0207702_111847601 92
1551 3300026088 Ga0207641_10380797 Ga0207641_103807973 92
1552 3300026088 Ga0207641_10598774 Ga0207641_105987742 92
1553 3300026088 Ga0207641_10601997 Ga0207641_106019973 92
1554 3300026088 Ga0207641_10655094 Ga0207641_106550942 92
1555 3300026088 Ga0207641_10671759 Ga0207641_106717593 92
1556 3300026088 Ga0207641_12278891 Ga0207641_122788912 92
1557 3300026089 Ga0207648_10049127 Ga0207648_100491273 92
1558 3300026089 Ga0207648_10059390 Ga0207648_100593907 92
1559 3300026089 Ga0207648_10391680 Ga0207648_103916802 92
1560 3300026089 Ga0207648_10519085 Ga0207648_105190852 92
1561 3300026089 Ga0207648_10658674 Ga0207648_106586742 92
1562 3300026095 Ga0207676_10092778 Ga0207676_100927782 92
1563 3300026095 Ga0207676_10884216 Ga0207676_108842162 92
1564 3300026095 Ga0207676_11155153 Ga0207676_111551532 92
1565 3300026095 Ga0207676_11425259 Ga0207676_114252592 92
1566 3300026116 Ga0207674_10180496 Ga0207674_101804963 92
1567 3300026116 Ga0207674_10327221 Ga0207674_103272213 92
1568 3300026116 Ga0207674_10347886 Ga0207674_103478862 92
1569 3300026116 Ga0207674_10433621 Ga0207674_104336211 92
1570 3300026116 Ga0207674_10512539 Ga0207674_105125393 92
1571 3300026116 Ga0207674_12207917 Ga0207674_122079172 92
1572 3300026116 Ga0207674_12233411 Ga0207674_122334112 92
1573 3300026118 Ga0207675_100619211 Ga0207675_1006192112 92
1574 3300026118 Ga0207675_100621523 Ga0207675_1006215232 92
1575 3300026118 Ga0207675_100987417 Ga0207675_1009874173 92
1576 3300026118 Ga0207675_101625113 Ga0207675_1016251132 92
1577 3300026118 Ga0207675_102568935 Ga0207675_1025689352 92
1578 3300026121 Ga0207683_10560762 Ga0207683_105607623 92
1579 3300026121 Ga0207683_10588127 Ga0207683_105881271 92
1580 3300026121 Ga0207683_11023362 Ga0207683_110233622 92
1581 3300026121 Ga0207683_11664973 Ga0207683_116649732 92
1582 3300026142 Ga0207698_10040510 Ga0207698_100405103 92
1583 3300026142 Ga0207698_10384505 Ga0207698_103845053 92
1584 3300026142 Ga0207698_11067595 Ga0207698_110675952 92
1585 3300026142 Ga0207698_11669617 Ga0207698_116696172 92
1586 3300026142 Ga0207698_12279113 Ga0207698_122791132 92
1587 3300026142 Ga0207698_12337365 Ga0207698_123373652 92
1588 3300027296 Ga0209389_1002002 Ga0209389_100200221 92
1589 3300027312 Ga0209371_1078930 Ga0209371_10789302 92
1590 3300027357 Ga0209589_1000009 Ga0209589_100000933 92
1591 3300027357 Ga0209589_1000300 Ga0209589_100030023 92
1592 3300027361 Ga0209489_100010 Ga0209489_100010238 92
1593 3300027361 Ga0209489_109706 Ga0209489_1097062 92
1594 3300027363 Ga0209700_100017 Ga0209700_100017238 92
1595 3300027363 Ga0209700_100031 Ga0209700_100031168 92
1596 3300027512 Ga0209179_1001130 Ga0209179_10011303 92
1597 3300027512 Ga0209179_1011727 Ga0209179_10117273 92
1598 3300027671 Ga0209588_1010113 Ga0209588_10101133 92
1599 3300027866 Ga0209813_10096355 Ga0209813_100963553 92
1600 3300027866 Ga0209813_10191714 Ga0209813_101917142 92
1601 3300027907 Ga0207428_10083142 Ga0207428_100831426 92
1602 3300027907 Ga0207428_10370333 Ga0207428_103703333 92
1603 3300027907 Ga0207428_10543224 Ga0207428_105432242 92
1604 3300028023 Ga0265357_1003145 Ga0265357_10031452 92
1605 3300028379 Ga0268266_10126819 Ga0268266_101268191 92
1606 3300028379 Ga0268266_10186618 Ga0268266_101866183 92
1607 3300028379 Ga0268266_10254086 Ga0268266_102540862 92
1608 3300028379 Ga0268266_10257384 Ga0268266_102573843 92
1609 3300028379 Ga0268266_10423460 Ga0268266_104234602 92
1610 3300028379 Ga0268266_10526536 Ga0268266_105265362 92
1611 3300028379 Ga0268266_10653010 Ga0268266_106530102 92
1612 3300028379 Ga0268266_11291432 Ga0268266_112914322 92
1613 3300028379 Ga0268266_11349699 Ga0268266_113496992 92
1614 3300028379 Ga0268266_11796724 Ga0268266_117967242 92
1615 3300028380 Ga0268265_10112980 Ga0268265_101129804 92
1616 3300028380 Ga0268265_10861960 Ga0268265_108619601 92
1617 3300028380 Ga0268265_11340583 Ga0268265_113405832 92
1618 3300028381 Ga0268264_10000377 Ga0268264_1000037759 92
1619 3300028381 Ga0268264_10208500 Ga0268264_102085002 92
1620 3300028381 Ga0268264_11832606 Ga0268264_118326062 92
1621 3300028381 Ga0268264_12089396 Ga0268264_120893962 92
1622 3300028556 Ga0265337_1002429 Ga0265337_100242917 92
1623 3300028558 Ga0265326_10001795 Ga0265326_100017951 92
1624 3300028558 Ga0265326_10071100 Ga0265326_100711002 92
1625 3300028563 Ga0265319_1001825 Ga0265319_10018257 92
1626 3300028573 Ga0265334_10000469 Ga0265334_1000046918 92
1627 3300028573 Ga0265334_10159143 Ga0265334_101591432 92
1628 3300028573 Ga0265334_10196976 Ga0265334_101969762 92
1629 3300028577 Ga0265318_10040136 Ga0265318_100401364 92
1630 3300028577 Ga0265318_10169596 Ga0265318_101695962 92
1631 3300028653 Ga0265323_10001237 Ga0265323_100012378 92
1632 3300028654 Ga0265322_10016831 Ga0265322_100168313 92
1633 3300028666 Ga0265336_10000535 Ga0265336_1000053523 92
1634 3300028666 Ga0265336_10044030 Ga0265336_100440301 92
1635 3300028666 Ga0265336_10233733 Ga0265336_102337332 92
1636 3300028786 Ga0307517_10023999 Ga0307517_100239999 92
1637 3300028786 Ga0307517_10183287 Ga0307517_101832872 92
1638 3300028786 Ga0307517_10503341 Ga0307517_105033412 92
1639 3300028794 Ga0307515_10040807 Ga0307515_100408077 92
1640 3300028794 Ga0307515_10058447 Ga0307515_100584474 92
1641 3300028794 Ga0307515_10322279 Ga0307515_103222792 92
1642 3300028794 Ga0307515_10918950 Ga0307515_109189502 92
1643 3300028800 Ga0265338_10000131 Ga0265338_10000131109 92
1644 3300028800 Ga0265338_10080854 Ga0265338_100808544 92
1645 3300028800 Ga0265338_11075728 Ga0265338_110757281 92
1646 3300029285 Ga0310981_1002564 Ga0310981_10025642 92
1647 3300029957 Ga0265324_10001269 Ga0265324_1000126911 92
1648 3300029957 Ga0265324_10037090 Ga0265324_100370902 92
1649 3300030521 Ga0307511_10057801 Ga0307511_100578013 92
1650 3300030521 Ga0307511_10230192 Ga0307511_102301922 92
1651 3300030522 Ga0307512_10204882 Ga0307512_102048822 92
1652 3300030760 Ga0265762_1132650 Ga0265762_11326502 92
1653 3300030763 Ga0265763_1011605 Ga0265763_10116052 92
1654 3300030878 Ga0265770_1062880 Ga0265770_10628802 92
1655 3300030878 Ga0265770_1096070 Ga0265770_10960702 92
1656 3300030878 Ga0265770_1102258 Ga0265770_11022582 92
1657 3300030882 Ga0265764_104092 Ga0265764_1040922 92
1658 3300031018 Ga0265773_1014407 Ga0265773_10144072 92
1659 3300031090 Ga0265760_10102746 Ga0265760_101027462 92
1660 3300031090 Ga0265760_10109747 Ga0265760_101097472 92
1661 3300031235 Ga0265330_10039722 Ga0265330_100397224 92
1662 3300031235 Ga0265330_10087871 Ga0265330_100878711 92
1663 3300031235 Ga0265330_10175016 Ga0265330_101750162 92
1664 3300031235 Ga0265330_10396814 Ga0265330_103968142 92
1665 3300031238 Ga0265332_10008226 Ga0265332_100082262 92
1666 3300031238 Ga0265332_10042520 Ga0265332_100425201 92
1667 3300031238 Ga0265332_10042610 Ga0265332_100426102 92
1668 3300031238 Ga0265332_10151884 Ga0265332_101518842 92
1669 3300031238 Ga0265332_10475744 Ga0265332_104757441 92
1670 3300031239 Ga0265328_10000041 Ga0265328_1000004192 92
1671 3300031239 Ga0265328_10000129 Ga0265328_100001297 92
1672 3300031239 Ga0265328_10005203 Ga0265328_100052036 92
1673 3300031239 Ga0265328_10005372 Ga0265328_100053727 92
1674 3300031239 Ga0265328_10013913 Ga0265328_100139131 92
1675 3300031239 Ga0265328_10040462 Ga0265328_100404623 92
1676 3300031239 Ga0265328_10068668 Ga0265328_100686682 92
1677 3300031239 Ga0265328_10117756 Ga0265328_101177562 92
1678 3300031239 Ga0265328_10163936 Ga0265328_101639362 92
1679 3300031239 Ga0265328_10176650 Ga0265328_101766502 92
1680 3300031240 Ga0265320_10017218 Ga0265320_100172189 92
1681 3300031240 Ga0265320_10368131 Ga0265320_103681312 92
1682 3300031241 Ga0265325_10007856 Ga0265325_1000785615 92
1683 3300031241 Ga0265325_10021599 Ga0265325_100215995 92
1684 3300031241 Ga0265325_10053770 Ga0265325_100537702 92
1685 3300031241 Ga0265325_10092675 Ga0265325_100926753 92
1686 3300031241 Ga0265325_10258483 Ga0265325_102584832 92
1687 3300031242 Ga0265329_10004194 Ga0265329_100041949 92
1688 3300031242 Ga0265329_10026053 Ga0265329_100260533 92
1689 3300031242 Ga0265329_10027219 Ga0265329_100272192 92
1690 3300031242 Ga0265329_10170019 Ga0265329_101700192 92
1691 3300031247 Ga0265340_10002851 Ga0265340_100028515 92
1692 3300031247 Ga0265340_10006598 Ga0265340_1000659811 92
1693 3300031247 Ga0265340_10034317 Ga0265340_100343173 92
1694 3300031247 Ga0265340_10036572 Ga0265340_100365723 92
1695 3300031247 Ga0265340_10071221 Ga0265340_100712213 92
1696 3300031247 Ga0265340_10114626 Ga0265340_101146263 92
1697 3300031247 Ga0265340_10149866 Ga0265340_101498662 92
1698 3300031249 Ga0265339_10006770 Ga0265339_1000677017 92
1699 3300031249 Ga0265339_10011362 Ga0265339_100113623 92
1700 3300031249 Ga0265339_10035844 Ga0265339_100358444 92
1701 3300031250 Ga0265331_10000090 Ga0265331_100000907 92
1702 3300031250 Ga0265331_10001125 Ga0265331_1000112519 92
1703 3300031250 Ga0265331_10005768 Ga0265331_1000576811 92
1704 3300031250 Ga0265331_10111205 Ga0265331_101112052 92
1705 3300031250 Ga0265331_10186744 Ga0265331_101867441 92
1706 3300031250 Ga0265331_10513436 Ga0265331_105134362 92
1707 3300031251 Ga0265327_10040029 Ga0265327_100400294 92
1708 3300031251 Ga0265327_10044157 Ga0265327_100441575 92
1709 3300031251 Ga0265327_10172448 Ga0265327_101724482 92
1710 3300031344 Ga0265316_10016003 Ga0265316_100160035 92
1711 3300031344 Ga0265316_10155827 Ga0265316_101558273 92
1712 3300031344 Ga0265316_10161146 Ga0265316_101611463 92
1713 3300031344 Ga0265316_10164705 Ga0265316_101647053 92
1714 3300031344 Ga0265316_10393815 Ga0265316_103938152 92
1715 3300031344 Ga0265316_10995558 Ga0265316_109955582 92
1716 3300031456 Ga0307513_10365278 Ga0307513_103652782 92
1717 3300031456 Ga0307513_10449526 Ga0307513_104495261 92
1718 3300031456 Ga0307513_10500146 Ga0307513_105001461 92
1719 3300031456 Ga0307513_10550671 Ga0307513_105506712 92
1720 3300031507 Ga0307509_10268949 Ga0307509_102689493 92
1721 3300031507 Ga0307509_10547927 Ga0307509_105479272 92
1722 3300031507 Ga0307509_10985155 Ga0307509_109851552 92
1723 3300031548 Ga0307408_100114583 Ga0307408_1001145834 92
1724 3300031548 Ga0307408_100252733 Ga0307408_1002527332 92
1725 3300031548 Ga0307408_100903386 Ga0307408_1009033862 92
1726 3300031548 Ga0307408_101288261 Ga0307408_1012882612 92
1727 3300031548 Ga0307408_101630296 Ga0307408_1016302962 92
1728 3300031548 Ga0307408_101803862 Ga0307408_1018038622 92
1729 3300031595 Ga0265313_10019153 Ga0265313_100191533 92
1730 3300031595 Ga0265313_10051770 Ga0265313_100517702 92
1731 3300031595 Ga0265313_10082252 Ga0265313_100822521 92
1732 3300031595 Ga0265313_10095480 Ga0265313_100954802 92
1733 3300031595 Ga0265313_10277566 Ga0265313_102775661 92
1734 3300031616 Ga0307508_10000378 Ga0307508_1000037845 92
1735 3300031616 Ga0307508_10056100 Ga0307508_100561003 92
1736 3300031616 Ga0307508_10124266 Ga0307508_101242663 92
1737 3300031665 Ga0316575_10024185 Ga0316575_100241851 92
1738 3300031665 Ga0316575_10024618 Ga0316575_100246182 92
1739 3300031665 Ga0316575_10027099 Ga0316575_100270991 92
1740 3300031665 Ga0316575_10198274 Ga0316575_101982742 92
1741 3300031665 Ga0316575_10330841 Ga0316575_103308412 92
1742 3300031691 Ga0316579_10224216 Ga0316579_102242162 92
1743 3300031691 Ga0316579_10499395 Ga0316579_104993952 92
1744 3300031711 Ga0265314_10048379 Ga0265314_100483794 92
1745 3300031711 Ga0265314_10057543 Ga0265314_100575432 92
1746 3300031711 Ga0265314_10065689 Ga0265314_100656893 92
1747 3300031711 Ga0265314_10109972 Ga0265314_101099723 92
1748 3300031711 Ga0265314_10117426 Ga0265314_101174264 92
1749 3300031711 Ga0265314_10141709 Ga0265314_101417092 92
1750 3300031711 Ga0265314_10296116 Ga0265314_102961162 92
1751 3300031712 Ga0265342_10000448 Ga0265342_1000044854 92
1752 3300031712 Ga0265342_10000677 Ga0265342_1000067737 92
1753 3300031712 Ga0265342_10018135 Ga0265342_100181357 92
1754 3300031712 Ga0265342_10031129 Ga0265342_100311292 92
1755 3300031712 Ga0265342_10124079 Ga0265342_101240793 92
1756 3300031712 Ga0265342_10166954 Ga0265342_101669542 92
1757 3300031727 Ga0316576_10076111 Ga0316576_100761112 92
1758 3300031728 Ga0316578_10007604 Ga0316578_100076047 92
1759 3300031728 Ga0316578_10537946 Ga0316578_105379462 92
1760 3300031730 Ga0307516_10019779 Ga0307516_100197798 92
1761 3300031730 Ga0307516_10072648 Ga0307516_100726482 92
1762 3300031730 Ga0307516_10076126 Ga0307516_100761262 92
1763 3300031730 Ga0307516_10300738 Ga0307516_103007382 92
1764 3300031730 Ga0307516_10315548 Ga0307516_103155483 92
1765 3300031730 Ga0307516_10673438 Ga0307516_106734382 92
1766 3300031731 Ga0307405_10100255 Ga0307405_101002552 92
1767 3300031731 Ga0307405_10131747 Ga0307405_101317472 92
1768 3300031731 Ga0307405_10309177 Ga0307405_103091772 92
1769 3300031731 Ga0307405_10938104 Ga0307405_109381042 92
1770 3300031731 Ga0307405_11528009 Ga0307405_115280092 92
1771 3300031810 Ga0316044_120321 Ga0316044_1203211 92
1772 3300031824 Ga0307413_10098364 Ga0307413_100983644 92
1773 3300031824 Ga0307413_10287913 Ga0307413_102879132 92
1774 3300031824 Ga0307413_10372365 Ga0307413_103723653 92
1775 3300031824 Ga0307413_10848032 Ga0307413_108480322 92
1776 3300031824 Ga0307413_10918903 Ga0307413_109189032 92
1777 3300031852 Ga0307410_10153064 Ga0307410_101530643 92
1778 3300031852 Ga0307410_10222926 Ga0307410_102229262 92
1779 3300031852 Ga0307410_10968053 Ga0307410_109680531 92
1780 3300031852 Ga0307410_11125338 Ga0307410_111253382 92
1781 3300031901 Ga0307406_10278058 Ga0307406_102780583 92
1782 3300031901 Ga0307406_10309973 Ga0307406_103099732 92
1783 3300031901 Ga0307406_10368962 Ga0307406_103689622 92
1784 3300031901 Ga0307406_11504050 Ga0307406_115040501 92
1785 3300031903 Ga0307407_10131301 Ga0307407_101313012 92
1786 3300031903 Ga0307407_10288833 Ga0307407_102888332 92
1787 3300031903 Ga0307407_10761292 Ga0307407_107612922 92
1788 3300031903 Ga0307407_10940812 Ga0307407_109408122 92
1789 3300031903 Ga0307407_11071376 Ga0307407_110713761 92
1790 3300031903 Ga0307407_11561626 Ga0307407_115616262 92
1791 3300031911 Ga0307412_10077758 Ga0307412_100777585 92
1792 3300031911 Ga0307412_10215875 Ga0307412_102158753 92
1793 3300031911 Ga0307412_10837438 Ga0307412_108374381 92
1794 3300031911 Ga0307412_11691425 Ga0307412_116914252 92
1795 3300031911 Ga0307412_12039226 Ga0307412_120392261 92
1796 3300031995 Ga0307409_100437907 Ga0307409_1004379072 92
1797 3300031995 Ga0307409_100888853 Ga0307409_1008888532 92
1798 3300031995 Ga0307409_100973616 Ga0307409_1009736161 92
1799 3300031995 Ga0307409_101217242 Ga0307409_1012172422 92
1800 3300031995 Ga0307409_101685730 Ga0307409_1016857302 92
1801 3300031995 Ga0307409_101822438 Ga0307409_1018224381 92
1802 3300032002 Ga0307416_100305505 Ga0307416_1003055052 92
1803 3300032002 Ga0307416_100668244 Ga0307416_1006682442 92
1804 3300032002 Ga0307416_101040803 Ga0307416_1010408032 92
1805 3300032002 Ga0307416_103324203 Ga0307416_1033242032 92
1806 3300032005 Ga0307411_10165110 Ga0307411_101651102 92
1807 3300032005 Ga0307411_10533519 Ga0307411_105335193 92
1808 3300032005 Ga0307411_10659061 Ga0307411_106590612 92
1809 3300032005 Ga0307411_12136781 Ga0307411_121367812 92
1810 3300032126 Ga0307415_100348064 Ga0307415_1003480643 92
1811 3300032126 Ga0307415_100511963 Ga0307415_1005119631 92
1812 3300032126 Ga0307415_101491359 Ga0307415_1014913591 92
1813 3300032126 Ga0307415_102420793 Ga0307415_1024207931 92
1814 3300032133 Ga0316583_10003862 Ga0316583_100038623 92
1815 3300032133 Ga0316583_10109690 Ga0316583_101096902 92
1816 3300032137 Ga0316585_10283820 Ga0316585_102838202 92
1817 3300032168 Ga0316593_10028881 Ga0316593_100288813 92
1818 3300032168 Ga0316593_10033258 Ga0316593_100332584 92
1819 3300032168 Ga0316593_10074840 Ga0316593_100748402 92
1820 3300032168 Ga0316593_10083093 Ga0316593_100830932 92
1821 3300032168 Ga0316593_10086564 Ga0316593_100865642 92
1822 3300032168 Ga0316593_10138707 Ga0316593_101387072 92
1823 3300032168 Ga0316593_10196657 Ga0316593_101966571 92
1824 3300032168 Ga0316593_10228491 Ga0316593_102284911 92
1825 3300033179 Ga0307507_10070872 Ga0307507_100708723 92
1826 3300033179 Ga0307507_10296714 Ga0307507_102967142 92
1827 3300033180 Ga0307510_10185890 Ga0307510_101858901 92
1828 3300033180 Ga0307510_10271309 Ga0307510_102713093 92
1829 3300033180 Ga0307510_10302191 Ga0307510_103021912 92
1830 3300033180 Ga0307510_10500130 Ga0307510_105001302 92
1831 3300033442 Ga0315911_1000009 Ga0315911_100000998 92
1832 3300033524 Ga0316592_1018436 Ga0316592_10184363 92
1833 3300033528 Ga0316588_1089008 Ga0316588_10890082 92
1834 3300033529 Ga0316587_1019184 Ga0316587_10191843 92
1835 3300033541 Ga0316596_1070873 Ga0316596_10708732 92
1836 3300033541 Ga0316596_1091575 Ga0316596_10915752 92
1837 3300033541 Ga0316596_1096193 Ga0316596_10961932 92
1838 3300033544 Ga0316215_1002459 Ga0316215_10024592 92
1839 3300033546 Ga0316213_1002951 Ga0316213_10029512 92
1840 3300033547 Ga0316212_1020558 Ga0316212_10205583 92
1841 3300033547 Ga0316212_1045300 Ga0316212_10453002 92
1842 3300034817 Ga0373948_0049050 Ga0373948_0049050_395_673 92
1843 3300034817 Ga0373948_0100487 Ga0373948_0100487_314_592 92
1844 3300034818 Ga0373950_0006721 Ga0373950_0006721_961_1239 92
1845 3300034818 Ga0373950_0052638 Ga0373950_0052638_56_334 92
1846 3300034820 Ga0373959_0059099 Ga0373959_0059099_431_709 92
1847 3300034820 Ga0373959_0163997 Ga0373959_0163997_38_316 92
1848 3300034957 Ga0373938_0144656 Ga0373938_0144656_341_619 92
1849 3300035083 Ga0373926_0003147 Ga0373926_0003147_28_306 92
1850 3300035083 Ga0373926_0005778 Ga0373926_0005778_763_1041 92
1851 3300035083 Ga0373926_0050654 Ga0373926_0050654_588_866 92
1852 3300035083 Ga0373926_0079780 Ga0373926_0079780_885_1181 92
1853 3300035084 Ga0373928_0165131 Ga0373928_0165131_278_556 92
1854 3300035084 Ga0373928_0230110 Ga0373928_0230110_114_392 92
1855 3300035085 Ga0373929_0062695 Ga0373929_0062695_285_563 92
1856 3300035085 Ga0373929_0133444 Ga0373929_0133444_331_630 92
1857 3300035086 Ga0373934_0012607 Ga0373934_0012607_1867_2145 92
1858 3300035086 Ga0373934_0012674 Ga0373934_0012674_325_621 92
1859 3300035086 Ga0373934_0048784 Ga0373934_0048784_852_1130 92
1860 3300035086 Ga0373934_0241138 Ga0373934_0241138_119_412 92
1861 3300035088 Ga0373940_0022602 Ga0373940_0022602_1102_1380 92
1862 3300035088 Ga0373940_0279904 Ga0373940_0279904_175_453 92
1863 3300035089 Ga0373944_0026063 Ga0373944_0026063_1277_1555 92
1864 3300035089 Ga0373944_0046147 Ga0373944_0046147_184_480 92
1865 3300035089 Ga0373944_0095413 Ga0373944_0095413_13_336 92
1866 3300035089 Ga0373944_0123351 Ga0373944_0123351_25_303 92
1867 3300035089 Ga0373944_0223286 Ga0373944_0223286_317_595 92
1868 3300035090 Ga0373949_0175063 Ga0373949_0175063_197_475 92
1869 3300035091 Ga0373951_0131289 Ga0373951_0131289_188_466 92
1870 3300035092 Ga0373952_0098804 Ga0373952_0098804_28_306 92
1871 3300035111 Ga0373923_0000485 Ga0373923_0000485_6237_6533 92
1872 3300035111 Ga0373923_0038013 Ga0373923_0038013_34_312 92
1873 3300035111 Ga0373923_0108129 Ga0373923_0108129_518_796 92
1874 3300035111 Ga0373923_0115974 Ga0373923_0115974_789_1085 92
1875 3300035111 Ga0373923_0294884 Ga0373923_0294884_249_527 92
1876 3300035112 Ga0373932_0139101 Ga0373932_0139101_323_601 92
1877 3300035112 Ga0373932_0157948 Ga0373932_0157948_322_618 92
1878 3300035113 Ga0373936_0001112 Ga0373936_0001112_726_1022 92
1879 3300035113 Ga0373936_0014607 Ga0373936_0014607_831_1109 92
1880 3300035113 Ga0373936_0015906 Ga0373936_0015906_200_478 92
1881 3300035113 Ga0373936_0030370 Ga0373936_0030370_184_462 92
1882 3300035113 Ga0373936_0054646 Ga0373936_0054646_501_779 92
1883 3300035113 Ga0373936_0071758 Ga0373936_0071758_298_576 92
1884 3300035113 Ga0373936_0384443 Ga0373936_0384443_40_318 92
1885 3300035113 Ga0373936_0453447 Ga0373936_0453447_58_336 92
1886 3300035113 Ga0373936_0481914 Ga0373936_0481914_128_421 92
1887 3300035115 Ga0373941_0068288 Ga0373941_0068288_772_1050 92
1888 3300035115 Ga0373941_0396331 Ga0373941_0396331_220_531 92
1889 3300035116 Ga0373945_0031818 Ga0373945_0031818_1385_1708 92
1890 3300035116 Ga0373945_0035125 Ga0373945_0035125_97_375 92
1891 3300035116 Ga0373945_0304213 Ga0373945_0304213_152_430 92
1892 3300035116 Ga0373945_0374917 Ga0373945_0374917_116_412 92
1893 3300035117 Ga0373953_0000811 Ga0373953_0000811_6505_6801 92
1894 3300035117 Ga0373953_0001370 Ga0373953_0001370_28_306 92
1895 3300035118 Ga0373954_0006766 Ga0373954_0006766_3118_3396 92
1896 3300035118 Ga0373954_0007130 Ga0373954_0007130_3015_3311 92
1897 3300035118 Ga0373954_0007908 Ga0373954_0007908_1831_2109 92
1898 3300035118 Ga0373954_0076122 Ga0373954_0076122_1075_1368 92
1899 3300035118 Ga0373954_0162684 Ga0373954_0162684_749_1027 92
1900 3300035119 Ga0373956_0019825 Ga0373956_0019825_346_642 92
1901 3300035119 Ga0373956_0020440 Ga0373956_0020440_491_769 92
1902 3300035120 Ga0373957_0002274 Ga0373957_0002274_5098_5394 92
1903 3300035120 Ga0373957_0297962 Ga0373957_0297962_19_300 92
1904 3300035120 Ga0373957_0319506 Ga0373957_0319506_190_468 92
1905 3300035121 Ga0373960_0236108 Ga0373960_0236108_308_586 92
1906 3300035170 Ga0373943_0003463 Ga0373943_0003463_5562_5840 92
1907 3300035170 Ga0373943_0006179 Ga0373943_0006179_3215_3493 92
1908 3300035170 Ga0373943_0008959 Ga0373943_0008959_1224_1520 92
1909 3300035170 Ga0373943_0010548 Ga0373943_0010548_2084_2362 92
1910 3300035170 Ga0373943_0017321 Ga0373943_0017321_1385_1663 92
1911 3300035170 Ga0373943_0024422 Ga0373943_0024422_1056_1379 92
1912 3300035170 Ga0373943_0539893 Ga0373943_0539893_20_313 92
1913 3300035170 Ga0373943_0624221 Ga0373943_0624221_321_599 92
1914 3300035171 Ga0373946_0011604 Ga0373946_0011604_814_1110 92
1915 3300035171 Ga0373946_0015559 Ga0373946_0015559_863_1159 92
1916 3300035171 Ga0373946_0019180 Ga0373946_0019180_625_903 92
1917 3300035171 Ga0373946_0091682 Ga0373946_0091682_93_371 92
1918 3300035171 Ga0373946_0249370 Ga0373946_0249370_177_455 92
1919 3300035171 Ga0373946_0266260 Ga0373946_0266260_39_332 92
1920 3300035172 Ga0373955_0000473 Ga0373955_0000473_2649_2945 92
1921 3300035172 Ga0373955_0005659 Ga0373955_0005659_492_770 92
1922 3300035172 Ga0373955_0289185 Ga0373955_0289185_107_385 92
1923 3300035172 Ga0373955_0451197 Ga0373955_0451197_187_480 92
1924 3300035172 Ga0373955_0874429 Ga0373955_0874429_24_302 92
1925 3300035241 Ga0373961_0022445 Ga0373961_0022445_576_869 92
1926 3300035242 Ga0373962_0021332 Ga0373962_0021332_1333_1611 92
1927 3300035242 Ga0373962_0052942 Ga0373962_0052942_573_884 92
1928 3300035398 Ga0316574_0003396 Ga0316574_0003396_2133_2411 92
1929 3300035398 Ga0316574_0533309 Ga0316574_0533309_123_401 92
1930 3300035410 Ga0373924_0134009 Ga0373924_0134009_64_342 92
1931 3300035410 Ga0373924_0192150 Ga0373924_0192150_117_395 92
1932 3300035691 Ga0373931_0008176 Ga0373931_0008176_706_984 92
1933 3300035691 Ga0373931_0084607 Ga0373931_0084607_441_734 92
1934 3300035691 Ga0373931_0272009 Ga0373931_0272009_366_644 92
1935 3300035691 Ga0373931_0300966 Ga0373931_0300966_361_639 92
1936 3300035691 Ga0373931_0474571 Ga0373931_0474571_464_763 92
1937 3300035692 Ga0373935_0000768 Ga0373935_0000768_13763_14059 92
1938 3300035692 Ga0373935_0012257 Ga0373935_0012257_2301_2579 92
1939 3300035692 Ga0373935_0053250 Ga0373935_0053250_939_1217 92
1940 3300035692 Ga0373935_0235025 Ga0373935_0235025_197_475 92
1941 3300035692 Ga0373935_0252701 Ga0373935_0252701_686_982 92
1942 3300035692 Ga0373935_1382395 Ga0373935_1382395_32_310 92
1943 3300035695 Ga0373927_0004904 Ga0373927_0004904_2371_2649 92
1944 3300035695 Ga0373927_0014366 Ga0373927_0014366_4729_5007 92
1945 3300035695 Ga0373927_0017066 Ga0373927_0017066_2063_2341 92
1946 3300035695 Ga0373927_0040111 Ga0373927_0040111_2401_2697 92
1947 3300035695 Ga0373927_0140139 Ga0373927_0140139_783_1061 92
1948 3300035695 Ga0373927_0154565 Ga0373927_0154565_551_874 92
1949 3300035695 Ga0373927_0188185 Ga0373927_0188185_964_1242 92
1950 3300035695 Ga0373927_0294673 Ga0373927_0294673_37_315 92
1951 3300035695 Ga0373927_0337699 Ga0373927_0337699_328_621 92
1952 3300035695 Ga0373927_0412988 Ga0373927_0412988_20_298 92
1953 3300035695 Ga0373927_0659780 Ga0373927_0659780_127_405 92
1954 3300035695 Ga0373927_0714083 Ga0373927_0714083_192_488 92
1955 3300035695 Ga0373927_0981165 Ga0373927_0981165_41_334 92
1956 3300035724 Ga0373933_0010736 Ga0373933_0010736_3256_3534 92
1957 3300035724 Ga0373933_0012634 Ga0373933_0012634_92_370 92
1958 3300035724 Ga0373933_0115193 Ga0373933_0115193_406_702 92
1959 3300035724 Ga0373933_0199811 Ga0373933_0199811_618_896 92
1960 3300035724 Ga0373933_0432063 Ga0373933_0432063_565_846 92
1961 3300035724 Ga0373933_0779450 Ga0373933_0779450_168_446 92
1962 3300035725 Ga0373947_0002626 Ga0373947_0002626_2794_3090 92
1963 3300035725 Ga0373947_0005298 Ga0373947_0005298_547_825 92
1964 3300035725 Ga0373947_0009798 Ga0373947_0009798_4947_5225 92
1965 3300035725 Ga0373947_0015603 Ga0373947_0015603_2526_2819 92
1966 3300035725 Ga0373947_0017535 Ga0373947_0017535_2546_2824 92
1967 3300035725 Ga0373947_0034111 Ga0373947_0034111_702_980 92
1968 3300035725 Ga0373947_0058826 Ga0373947_0058826_623_946 92
1969 3300035725 Ga0373947_0060370 Ga0373947_0060370_438_731 92
1970 3300035725 Ga0373947_0073289 Ga0373947_0073289_1355_1651 92
1971 3300035725 Ga0373947_0254344 Ga0373947_0254344_676_954 92
1972 3300035725 Ga0373947_0499527 Ga0373947_0499527_487_765 92
1973 3300035725 Ga0373947_0667940 Ga0373947_0667940_338_622 92
1974 3300035725 Ga0373947_1144157 Ga0373947_1144157_209_487 92
1975 3300036242 Ga0310104_05697 Ga0310104_05697_225_503 92
1976 3300036401 Ga0373937_0017872 Ga0373937_0017872_770_1066 92
1977 3300036401 Ga0373937_0118076 Ga0373937_0118076_1122_1400 92
1978 3300036401 Ga0373937_0191616 Ga0373937_0191616_463_771 92
1979 3300036401 Ga0373937_0196514 Ga0373937_0196514_1023_1316 92
1980 3300036401 Ga0373937_0260291 Ga0373937_0260291_1074_1352 92
1981 3300036401 Ga0373937_0266442 Ga0373937_0266442_1008_1286 92
1982 3300036401 Ga0373937_0717769 Ga0373937_0717769_259_537 92
1983 3300036401 Ga0373937_0750864 Ga0373937_0750864_420_698 92
1984 3300036401 Ga0373937_0919589 Ga0373937_0919589_467_745 92
1985 3300036457 Ga0265778_042915 Ga0265778_042915_304_582 92
1986 3300036458 Ga0310112_050106 Ga0310112_050106_44_322 92
1987 3300036534 Ga0310109_007014 Ga0310109_007014_923_1201 92
1988 3300036535 Ga0310110_029713 Ga0310110_029713_44_322 92
1989 3300036647 Ga0316582_0075521 Ga0316582_0075521_1264_1542 92
1990 3300036647 Ga0316582_0120148 Ga0316582_0120148_275_553 92
1991 3300036647 Ga0316582_0826934 Ga0316582_0826934_279_557 92
1992 3300036712 Ga0316584_0001009 Ga0316584_0001009_567_845 92
1993 3300037068 Ga0373925_0000435 Ga0373925_0000435_22556_22852 92
1994 3300037068 Ga0373925_0020892 Ga0373925_0020892_3783_4106 92
1995 3300037068 Ga0373925_0024722 Ga0373925_0024722_3357_3635 92
1996 3300037068 Ga0373925_0039116 Ga0373925_0039116_955_1233 92
1997 3300037068 Ga0373925_0073208 Ga0373925_0073208_251_529 92
1998 3300037068 Ga0373925_0098953 Ga0373925_0098953_1132_1428 92
1999 3300037068 Ga0373925_0101224 Ga0373925_0101224_435_713 92
2000 3300037068 Ga0373925_0147115 Ga0373925_0147115_1402_1695 92
2001 3300037068 Ga0373925_0488617 Ga0373925_0488617_173_451 92
2002 3300037068 Ga0373925_1028981 Ga0373925_1028981_150_428 92
2003 3300037068 Ga0373925_1151686 Ga0373925_1151686_287_583 92
2004 3300037312 Ga0395899_0081310 Ga0395899_0081310_1999_2277 92
2005 3300037312 Ga0395899_0418060 Ga0395899_0418060_407_685 92
2006 3300037312 Ga0395899_0469439 Ga0395899_0469439_25_303 92
2007 3300037312 Ga0395899_0770968 Ga0395899_0770968_168_446 92
2008 3300037312 Ga0395899_0794860 Ga0395899_0794860_75_353 92
2009 3300037418 Ga0395900_0022401 Ga0395900_0022401_2017_2295 92
2010 3300037418 Ga0395900_0022503 Ga0395900_0022503_4438_4716 92
2011 3300037418 Ga0395900_0049338 Ga0395900_0049338_2959_3237 92
2012 3300037418 Ga0395900_0287087 Ga0395900_0287087_753_1031 92
2013 3300037418 Ga0395900_0448251 Ga0395900_0448251_935_1213 92
2014 3300037418 Ga0395900_0701198 Ga0395900_0701198_82_360 92
2015 3300037418 Ga0395900_1848863 Ga0395900_1848863_194_472 92
2016 3300037466 Ga0395898_0021752 Ga0395898_0021752_3066_3344 92
2017 3300037466 Ga0395898_0064043 Ga0395898_0064043_2326_2604 92
2018 3300037466 Ga0395898_0149026 Ga0395898_0149026_1729_2007 92
2019 3300037466 Ga0395898_0177898 Ga0395898_0177898_64_342 92
2020 3300037466 Ga0395898_0191419 Ga0395898_0191419_164_442 92
2021 3300037466 Ga0395898_0235450 Ga0395898_0235450_423_701 92
2022 3300037466 Ga0395898_0524027 Ga0395898_0524027_213_491 92
2023 3300037466 Ga0395898_0951015 Ga0395898_0951015_269_547 92
2024 3300037471 Ga0395905_0073794 Ga0395905_0073794_1271_1549 92
2025 3300037471 Ga0395905_0203583 Ga0395905_0203583_647_925 92
2026 3300037471 Ga0395905_0689785 Ga0395905_0689785_536_814 92
2027 3300037471 Ga0395905_1721621 Ga0395905_1721621_239_517 92
2028 3300037853 Ga0436364_0273038 Ga0436364_0273038_915_1193 92
2029 3300037853 Ga0436364_0334517 Ga0436364_0334517_255_533 92
2030 3300037853 Ga0436364_0370054 Ga0436364_0370054_66_344 92
2031 3300037853 Ga0436364_0542820 Ga0436364_0542820_483_761 92
2032 3300037853 Ga0436364_0600601 Ga0436364_0600601_163_441 92
2033 3300037853 Ga0436364_0619962 Ga0436364_0619962_328_636 92
2034 3300037853 Ga0436364_0636770 Ga0436364_0636770_938_1216 92
2035 3300037853 Ga0436364_0698057 Ga0436364_0698057_302_610 92
2036 3300037853 Ga0436364_0710409 Ga0436364_0710409_176_454 92
2037 3300037853 Ga0436364_0716868 Ga0436364_0716868_422_700 92
2038 3300037853 Ga0436364_0743164 Ga0436364_0743164_5069_5347 92
2039 3300037853 Ga0436364_0938634 Ga0436364_0938634_123_419 92
2040 3300037853 Ga0436364_0948138 Ga0436364_0948138_325_603 92
2041 3300037853 Ga0436364_0972053 Ga0436364_0972053_1008_1286 92
2042 3300037853 Ga0436364_0983690 Ga0436364_0983690_1563_1841 92
2043 3300037853 Ga0436364_0986541 Ga0436364_0986541_336_614 92
2044 3300037853 Ga0436364_0994171 Ga0436364_0994171_614_892 92
2045 3300037853 Ga0436364_1022582 Ga0436364_1022582_695_973 92
2046 3300037853 Ga0436364_1060704 Ga0436364_1060704_195_494 92
2047 3300037853 Ga0436364_1077178 Ga0436364_1077178_813_1091 92
2048 3300037853 Ga0436364_1118871 Ga0436364_1118871_70_348 92
2049 3300037853 Ga0436364_1149687 Ga0436364_1149687_107_385 92
2050 3300037853 Ga0436364_1158685 Ga0436364_1158685_230_508 92
2051 3300037853 Ga0436364_1172769 Ga0436364_1172769_71_349 92
2052 3300037853 Ga0436364_1352603 Ga0436364_1352603_392_670 92
2053 3300038443 Ga0395901_0045720 Ga0395901_0045720_3212_3490 92
2054 3300038443 Ga0395901_0134942 Ga0395901_0134942_850_1128 92
2055 3300038443 Ga0395901_0207378 Ga0395901_0207378_1171_1449 92
2056 3300038443 Ga0395901_0280159 Ga0395901_0280159_910_1188 92
2057 3300038443 Ga0395901_0511575 Ga0395901_0511575_297_575 92
2058 3300038443 Ga0395901_0574201 Ga0395901_0574201_234_512 92
2059 3300038443 Ga0395901_0688409 Ga0395901_0688409_523_801 92
2060 3300038443 Ga0395901_1487338 Ga0395901_1487338_28_306 92
2061 3300038705 Ga0237819_07436 Ga0237819_07436_552_830 92
2062 3300039062 Ga0400483_260675 Ga0400483_260675_70_348 92
2063 3300039437 Ga0436365_0047289 Ga0436365_0047289_6298_6576 92
2064 3300039437 Ga0436365_0257566 Ga0436365_0257566_888_1184 92
2065 3300039437 Ga0436365_0331298 Ga0436365_0331298_302_601 92
2066 3300039437 Ga0436365_0408974 Ga0436365_0408974_1426_1734 92
2067 3300039437 Ga0436365_0410056 Ga0436365_0410056_395_673 92
2068 3300039437 Ga0436365_0430354 Ga0436365_0430354_36_314 92
2069 3300039437 Ga0436365_0431494 Ga0436365_0431494_186_464 92
2070 3300039437 Ga0436365_0641896 Ga0436365_0641896_222_500 92
2071 3300039437 Ga0436365_0728219 Ga0436365_0728219_719_997 92
2072 3300039437 Ga0436365_0895559 Ga0436365_0895559_65_346 92
2073 3300039437 Ga0436365_1083695 Ga0436365_1083695_129_407 92
2074 3300039437 Ga0436365_1136540 Ga0436365_1136540_9998_10276 92
2075 3300039437 Ga0436365_1158357 Ga0436365_1158357_204_482 92
2076 3300039437 Ga0436365_1166159 Ga0436365_1166159_601_909 92
2077 3300039437 Ga0436365_1182044 Ga0436365_1182044_13_291 92
2078 3300039437 Ga0436365_1239372 Ga0436365_1239372_11_289 92
2079 3300039437 Ga0436365_1305216 Ga0436365_1305216_988_1266 92
2080 3300039437 Ga0436365_1589094 Ga0436365_1589094_14_292 92
2081 3300039437 Ga0436365_1594119 Ga0436365_1594119_214_492 92
2082 3300039437 Ga0436365_1650779 Ga0436365_1650779_267_545 92
2083 3300039437 Ga0436365_1656991 Ga0436365_1656991_1471_1749 92
2084 3300039437 Ga0436365_1766134 Ga0436365_1766134_442_720 92
2085 3300039437 Ga0436365_1790160 Ga0436365_1790160_198_476 92
2086 3300039437 Ga0436365_1790595 Ga0436365_1790595_136_414 92
2087 3300039437 Ga0436365_1870318 Ga0436365_1870318_656_934 92
2088 3300039437 Ga0436365_1891356 Ga0436365_1891356_243_521 92
2089 3300039438 Ga0436360_0336136 Ga0436360_0336136_318_596 92
2090 3300039438 Ga0436360_0400895 Ga0436360_0400895_30_308 92
2091 3300039438 Ga0436360_0460985 Ga0436360_0460985_173_451 92
2092 3300039438 Ga0436360_0482292 Ga0436360_0482292_489_767 92
2093 3300039438 Ga0436360_0564682 Ga0436360_0564682_2804_3082 92
2094 3300039438 Ga0436360_0666816 Ga0436360_0666816_643_921 92
2095 3300039438 Ga0436360_0719807 Ga0436360_0719807_257_565 92
2096 3300039438 Ga0436360_0822399 Ga0436360_0822399_681_959 92
2097 3300039438 Ga0436360_0923946 Ga0436360_0923946_224_502 92
2098 3300039438 Ga0436360_1020748 Ga0436360_1020748_921_1199 92
2099 3300039438 Ga0436360_1071432 Ga0436360_1071432_86_364 92
2100 3300039438 Ga0436360_1123721 Ga0436360_1123721_943_1224 92
2101 3300039438 Ga0436360_1300509 Ga0436360_1300509_49_327 92
2102 3300039438 Ga0436360_1350003 Ga0436360_1350003_860_1138 92
2103 3300039438 Ga0436360_1371633 Ga0436360_1371633_502_780 92
2104 3300039447 Ga0436361_0015967 Ga0436361_0015967_308_619 92
2105 3300039447 Ga0436361_0202965 Ga0436361_0202965_223_504 92
2106 3300039447 Ga0436361_0221679 Ga0436361_0221679_79_357 92
2107 3300039447 Ga0436361_0241005 Ga0436361_0241005_487_765 92
2108 3300039447 Ga0436361_0399539 Ga0436361_0399539_434_712 92
2109 3300039447 Ga0436361_0401541 Ga0436361_0401541_1461_1739 92
2110 3300039447 Ga0436361_0415174 Ga0436361_0415174_419_697 92
2111 3300039447 Ga0436361_0458072 Ga0436361_0458072_144_422 92
2112 3300039447 Ga0436361_0508772 Ga0436361_0508772_1080_1388 92
2113 3300039447 Ga0436361_0643647 Ga0436361_0643647_599_877 92
2114 3300039447 Ga0436361_1189994 Ga0436361_1189994_200_478 92
2115 3300039447 Ga0436361_1200967 Ga0436361_1200967_335_613 92
2116 3300039447 Ga0436361_1202984 Ga0436361_1202984_180_458 92
2117 3300039447 Ga0436361_1203078 Ga0436361_1203078_386_664 92
2118 3300039450 Ga0436363_0125243 Ga0436363_0125243_318_596 92
2119 3300039450 Ga0436363_0201073 Ga0436363_0201073_212_490 92
2120 3300039450 Ga0436363_0291002 Ga0436363_0291002_209_487 92
2121 3300039450 Ga0436363_0371622 Ga0436363_0371622_22_300 92
2122 3300039450 Ga0436363_0492471 Ga0436363_0492471_229_507 92
2123 3300039450 Ga0436363_0497202 Ga0436363_0497202_42_320 92
2124 3300039450 Ga0436363_0515390 Ga0436363_0515390_70_348 92
2125 3300039450 Ga0436363_0768121 Ga0436363_0768121_1057_1365 92
2126 3300039450 Ga0436363_0880899 Ga0436363_0880899_2011_2289 92
2127 3300039450 Ga0436363_0899406 Ga0436363_0899406_2952_3230 92
2128 3300039450 Ga0436363_0902847 Ga0436363_0902847_601_879 92
2129 3300039450 Ga0436363_0949002 Ga0436363_0949002_282_560 92
2130 3300039450 Ga0436363_1073273 Ga0436363_1073273_700_978 92
2131 3300039450 Ga0436363_1120218 Ga0436363_1120218_641_919 92
2132 3300039450 Ga0436363_1145207 Ga0436363_1145207_447_725 92
2133 3300039450 Ga0436363_1247371 Ga0436363_1247371_106_384 92
2134 3300039450 Ga0436363_1253616 Ga0436363_1253616_427_705 92
2135 3300039450 Ga0436363_1516469 Ga0436363_1516469_479_775 92
2136 3300039450 Ga0436363_1571548 Ga0436363_1571548_7331_7609 92
2137 3300039450 Ga0436363_1633821 Ga0436363_1633821_121_399 92
2138 3300039450 Ga0436363_1700898 Ga0436363_1700898_65_343 92
2139 3300039453 Ga0436362_0005077 Ga0436362_0005077_409_687 92
2140 3300039453 Ga0436362_0024299 Ga0436362_0024299_391_669 92
2141 3300039453 Ga0436362_0283171 Ga0436362_0283171_822_1100 92
2142 3300039453 Ga0436362_0393406 Ga0436362_0393406_421_699 92
2143 3300039453 Ga0436362_0512948 Ga0436362_0512948_203_481 92
2144 3300039453 Ga0436362_0555272 Ga0436362_0555272_462_740 92
2145 3300039453 Ga0436362_0566388 Ga0436362_0566388_87_365 92
2146 3300039453 Ga0436362_0733157 Ga0436362_0733157_61_339 92
2147 3300039453 Ga0436362_0976116 Ga0436362_0976116_3525_3803 92
2148 3300039453 Ga0436362_0998184 Ga0436362_0998184_610_888 92
2149 3300039453 Ga0436362_1025748 Ga0436362_1025748_1018_1296 92
2150 3300039453 Ga0436362_1244188 Ga0436362_1244188_202_480 92
2151 3300039453 Ga0436362_1281104 Ga0436362_1281104_175_474 92
2152 3300039453 Ga0436362_1297627 Ga0436362_1297627_192_470 92
2153 3300041405 Ga0439438_099247 Ga0439438_099247_120_398 92
2154 3300041407 Ga0439447_101918 Ga0439447_101918_136_414 92
2155 3300041408 Ga0439453_0000535 Ga0439453_0000535_3169_3465 92
2156 3300041408 Ga0439453_0042425 Ga0439453_0042425_392_694 92
2157 3300041410 Ga0439461_0014133 Ga0439461_0014133_935_1213 92
2158 3300041413 Ga0439465_0020399 Ga0439465_0020399_1255_1533 92
2159 3300041413 Ga0439465_0056533 Ga0439465_0056533_447_725 92
2160 3300041413 Ga0439465_0235974 Ga0439465_0235974_253_531 92
2161 3300041441 Ga0451787_345693 Ga0451787_345693_173_451 92
2162 3300041443 Ga0451789_0319412 Ga0451789_0319412_64_342 92
2163 3300041443 Ga0451789_0887753 Ga0451789_0887753_80_358 92
2164 3300041444 Ga0451790_26031 Ga0451790_26031_47_325 92
2165 3300041444 Ga0451790_40087 Ga0451790_40087_105_383 92
2166 3300041446 Ga0451794_26022 Ga0451794_26022_363_641 92
2167 3300041451 Ga0451791_1850361 Ga0451791_1850361_182_460 92
2168 3300041451 Ga0451791_1937200 Ga0451791_1937200_106_384 92
2169 3300041452 Ga0451793_0398772 Ga0451793_0398772_383_661 92
2170 3300041452 Ga0451793_1320110 Ga0451793_1320110_123_401 92
2171 3300041452 Ga0451793_1475355 Ga0451793_1475355_748_1026 92
2172 3300041455 Ga0451801_16860 Ga0451801_16860_175_453 92
2173 3300041456 Ga0451795_0539396 Ga0451795_0539396_738_1016 92
2174 3300041458 Ga0451798_0448670 Ga0451798_0448670_290_568 92
2175 3300041458 Ga0451798_0697543 Ga0451798_0697543_431_709 92
2176 3300041460 Ga0451802_0534870 Ga0451802_0534870_254_532 92
2177 3300041460 Ga0451802_1488856 Ga0451802_1488856_127_405 92
2178 3300041460 Ga0451802_1574804 Ga0451802_1574804_182_460 92
2179 3300041461 Ga0451805_084706 Ga0451805_084706_231_509 92
2180 3300041463 Ga0451804_0671393 Ga0451804_0671393_51_329 92
2181 3300041491 Ga0451833_1394201 Ga0451833_1394201_783_1061 92
2182 3300041492 Ga0451835_1102159 Ga0451835_1102159_175_507 92
2183 3300041494 Ga0451837_0014523 Ga0451837_0014523_313_591 92
2184 3300041494 Ga0451837_0521850 Ga0451837_0521850_99_377 92
2185 3300041498 Ga0451841_0118137 Ga0451841_0118137_835_1113 92
2186 3300041501 Ga0451845_0437418 Ga0451845_0437418_37_315 92
2187 3300041503 Ga0451847_0685911 Ga0451847_0685911_157_435 92
2188 3300041505 Ga0451849_0809549 Ga0451849_0809549_78_356 92
2189 3300041505 Ga0451849_1130204 Ga0451849_1130204_160_438 92
2190 3300041505 Ga0451849_1245540 Ga0451849_1245540_122_400 92
2191 3300041507 Ga0451851_0809914 Ga0451851_0809914_186_464 92
2192 3300041507 Ga0451851_0861466 Ga0451851_0861466_504_782 92
2193 3300041512 Ga0451853_1064348 Ga0451853_1064348_97_375 92
2194 3300041512 Ga0451853_1395730 Ga0451853_1395730_572_850 92
2195 3300041512 Ga0451853_2608027 Ga0451853_2608027_206_484 92
2196 3300041512 Ga0451853_3652445 Ga0451853_3652445_79_357 92
2197 3300041997 Ga0439431_0050318 Ga0439431_0050318_531_809 92
2198 3300042001 Ga0439441_035784 Ga0439441_035784_189_467 92
2199 3300042003 Ga0439443_025083 Ga0439443_025083_549_845 92
2200 3300042003 Ga0439443_026548 Ga0439443_026548_523_813 92
2201 3300042003 Ga0439443_112734 Ga0439443_112734_113_391 92
2202 3300042004 Ga0439445_0070125 Ga0439445_0070125_591_869 92
2203 3300042005 Ga0439448_0059967 Ga0439448_0059967_704_1021 92
2204 3300042005 Ga0439448_0365255 Ga0439448_0365255_82_360 92
2205 3300042007 Ga0439449_0211260 Ga0439449_0211260_15_293 92
2206 3300042009 Ga0439451_042053 Ga0439451_042053_306_602 92
2207 3300042011 Ga0439454_064447 Ga0439454_064447_192_473 92
2208 3300042012 Ga0439455_0093351 Ga0439455_0093351_49_327 92
2209 3300042013 Ga0439456_056577 Ga0439456_056577_452_730 92
2210 3300042016 Ga0439463_125515 Ga0439463_125515_32_310 92
2211 3300042016 Ga0439463_210025 Ga0439463_210025_47_364 92
2212 3300042118 Ga0450914_001494 Ga0450914_001494_1180_1458 92
2213 3300042127 Ga0450890_055503 Ga0450890_055503_172_450 92
2214 3300042128 Ga0450897_046466 Ga0450897_046466_184_480 92
2215 3300042142 Ga0450905_020297 Ga0450905_020297_629_907 92
2216 3300042437 Ga0439444_0003020 Ga0439444_0003020_816_1094 92
2217 3300042437 Ga0439444_0010829 Ga0439444_0010829_329_625 92
2218 3300042438 Ga0439459_0017282 Ga0439459_0017282_366_644 92
2219 3300042439 Ga0439464_0036420 Ga0439464_0036420_768_1064 92
2220 3300042461 Ga0439460_0016876 Ga0439460_0016876_1030_1326 92
2221 3300042461 Ga0439460_0035232 Ga0439460_0035232_240_557 92
2222 3300042461 Ga0439460_0352034 Ga0439460_0352034_66_344 92
2223 3300042993 Ga0439440_0018311 Ga0439440_0018311_1117_1413 92
2224 3300042993 Ga0439440_0053352 Ga0439440_0053352_555_833 92
2225 3300044656 Ga0466969_0063849 Ga0466969_0063849_420_698 92
2226 3300044656 Ga0466969_0092886 Ga0466969_0092886_391_669 92
2227 3300044656 Ga0466969_0198074 Ga0466969_0198074_404_682 92
2228 3300044658 Ga0466972_0054591 Ga0466972_0054591_965_1243 92
2229 3300044658 Ga0466972_0199754 Ga0466972_0199754_248_526 92
2230 3300044683 Ga0466965_0198818 Ga0466965_0198818_63_341 92
2231 3300044684 Ga0466966_0002417 Ga0466966_0002417_11818_12096 92
2232 3300044684 Ga0466966_0023993 Ga0466966_0023993_2002_2286 92
2233 3300044684 Ga0466966_0063022 Ga0466966_0063022_1207_1485 92
2234 3300044684 Ga0466966_0088527 Ga0466966_0088527_340_618 92
2235 3300044684 Ga0466966_0762481 Ga0466966_0762481_244_522 92
2236 3300044693 Ga0466961_0017735 Ga0466961_0017735_133_411 92
2237 3300044693 Ga0466961_0113472 Ga0466961_0113472_653_949 92
2238 3300044693 Ga0466961_0130091 Ga0466961_0130091_353_631 92
2239 3300044693 Ga0466961_0469197 Ga0466961_0469197_216_494 92
2240 3300044693 Ga0466961_0943574 Ga0466961_0943574_126_404 92
2241 3300044694 Ga0466963_0016197 Ga0466963_0016197_1668_1946 92
2242 3300044694 Ga0466963_0037303 Ga0466963_0037303_2189_2467 92
2243 3300044694 Ga0466963_0077600 Ga0466963_0077600_1643_1921 92
2244 3300044694 Ga0466963_0211728 Ga0466963_0211728_462_758 92
2245 3300044694 Ga0466963_0233022 Ga0466963_0233022_565_849 92
2246 3300044694 Ga0466963_0434196 Ga0466963_0434196_531_824 92
2247 3300044694 Ga0466963_0509738 Ga0466963_0509738_223_501 92
2248 3300044694 Ga0466963_0903192 Ga0466963_0903192_318_596 92
2249 3300044706 Ga0466964_0142241 Ga0466964_0142241_438_716 92
2250 3300044706 Ga0466964_0335214 Ga0466964_0335214_104_382 92
2251 3300044706 Ga0466964_0350315 Ga0466964_0350315_71_349 92
2252 3300044706 Ga0466964_0353671 Ga0466964_0353671_409_687 92
2253 3300044719 Ga0466971_0044555 Ga0466971_0044555_1448_1732 92
2254 3300044719 Ga0466971_0175842 Ga0466971_0175842_481_759 92
2255 3300044719 Ga0466971_0181494 Ga0466971_0181494_62_340 92
2256 3300044719 Ga0466971_0198244 Ga0466971_0198244_511_789 92
2257 3300044719 Ga0466971_0306820 Ga0466971_0306820_206_484 92
2258 3300044735 Ga0466968_0108436 Ga0466968_0108436_467_748 92
2259 3300044735 Ga0466968_0201686 Ga0466968_0201686_421_699 92
2260 3300044735 Ga0466968_0221711 Ga0466968_0221711_219_503 92
2261 3300044765 Ga0466970_0491083 Ga0466970_0491083_206_484 92
2262 3300044765 Ga0466970_0961162 Ga0466970_0961162_105_383 92
2263 3300044842 Ga0466957_0094570 Ga0466957_0094570_1492_1770 92
2264 3300044842 Ga0466957_0534384 Ga0466957_0534384_411_689 92
2265 3300044842 Ga0466957_0536112 Ga0466957_0536112_14_292 92
2266 3300044842 Ga0466957_1165396 Ga0466957_1165396_82_360 92
2267 3300044901 Ga0466960_0242961 Ga0466960_0242961_137_415 92
2268 3300044901 Ga0466960_0366605 Ga0466960_0366605_410_688 92
2269 3300044901 Ga0466960_0813981 Ga0466960_0813981_58_336 92
2270 3300045049 Ga0466959_0040085 Ga0466959_0040085_1160_1438 92
2271 3300045049 Ga0466959_0155060 Ga0466959_0155060_512_790 92
2272 3300045049 Ga0466959_0197068 Ga0466959_0197068_129_407 92
2273 3300045049 Ga0466959_0304188 Ga0466959_0304188_563_841 92
2274 3300045049 Ga0466959_0510555 Ga0466959_0510555_257_535 92
2275 3300045049 Ga0466959_0667432 Ga0466959_0667432_193_477 92
2276 3300045836 Ga0466958_0026436 Ga0466958_0026436_1044_1328 92
2277 3300045836 Ga0466958_0295154 Ga0466958_0295154_492_770 92
2278 3300045976 Ga0466967_0011664 Ga0466967_0011664_3564_3842 92
2279 3300045976 Ga0466967_0056204 Ga0466967_0056204_2056_2334 92
2280 3300045976 Ga0466967_0096571 Ga0466967_0096571_1105_1383 92
2281 3300045976 Ga0466967_0248302 Ga0466967_0248302_122_400 92
2282 3300045976 Ga0466967_0382069 Ga0466967_0382069_942_1220 92
2283 3300045976 Ga0466967_0395556 Ga0466967_0395556_435_722 92
2284 3300045976 Ga0466967_0494847 Ga0466967_0494847_117_395 92
2285 3300045976 Ga0466967_1158598 Ga0466967_1158598_122_400 92
2286 3300045976 Ga0466967_1728458 Ga0466967_1728458_269_547 92
2287 3300045976 Ga0466967_1775054 Ga0466967_1775054_187_465 92
2288 3300046452 Ga0495617_024490 Ga0495617_024490_1270_1548 92
2289 3300046452 Ga0495617_108346 Ga0495617_108346_417_695 92
2290 3300046452 Ga0495617_154799 Ga0495617_154799_68_346 92
2291 3300046453 Ga0495627_063246 Ga0495627_063246_476_754 92
2292 3300046454 Ga0495592_0000135 Ga0495592_0000135_2989_3285 92
2293 3300046454 Ga0495592_0047053 Ga0495592_0047053_1744_2022 92
2294 3300046454 Ga0495592_0076237 Ga0495592_0076237_1079_1357 92
2295 3300046454 Ga0495592_0241867 Ga0495592_0241867_195_503 92
2296 3300046454 Ga0495592_0412213 Ga0495592_0412213_443_721 92
2297 3300046455 Ga0495603_0011370 Ga0495603_0011370_503_781 92
2298 3300046455 Ga0495603_0026662 Ga0495603_0026662_1239_1517 92
2299 3300046455 Ga0495603_0080755 Ga0495603_0080755_60_338 92
2300 3300046455 Ga0495603_0169597 Ga0495603_0169597_958_1236 92
2301 3300046455 Ga0495603_0270001 Ga0495603_0270001_602_880 92
2302 3300046455 Ga0495603_0302300 Ga0495603_0302300_34_357 92
2303 3300046457 Ga0495590_0026187 Ga0495590_0026187_1085_1363 92
2304 3300046457 Ga0495590_0026250 Ga0495590_0026250_935_1213 92
2305 3300046458 Ga0495591_043986 Ga0495591_043986_67_345 92
2306 3300046459 Ga0495629_0007600 Ga0495629_0007600_87_383 92
2307 3300046459 Ga0495629_0026319 Ga0495629_0026319_1020_1298 92
2308 3300046459 Ga0495629_0031173 Ga0495629_0031173_1618_1896 92
2309 3300046459 Ga0495629_0051126 Ga0495629_0051126_2512_2790 92
2310 3300046459 Ga0495629_0090395 Ga0495629_0090395_1440_1736 92
2311 3300046459 Ga0495629_0563917 Ga0495629_0563917_249_527 92
2312 3300046460 Ga0495638_0015537 Ga0495638_0015537_3334_3612 92
2313 3300046460 Ga0495638_0066832 Ga0495638_0066832_617_895 92
2314 3300046460 Ga0495638_0142838 Ga0495638_0142838_968_1246 92
2315 3300046460 Ga0495638_0453245 Ga0495638_0453245_217_495 92
2316 3300046460 Ga0495638_0519533 Ga0495638_0519533_272_550 92
2317 3300046461 Ga0495641_0011646 Ga0495641_0011646_2650_2928 92
2318 3300046461 Ga0495641_0047862 Ga0495641_0047862_300_578 92
2319 3300046461 Ga0495641_0139654 Ga0495641_0139654_278_574 92
2320 3300046461 Ga0495641_0161123 Ga0495641_0161123_94_372 92
2321 3300046461 Ga0495641_0580562 Ga0495641_0580562_187_465 92
2322 3300046461 Ga0495641_0607163 Ga0495641_0607163_76_354 92
2323 3300046462 Ga0495651_0003008 Ga0495651_0003008_11979_12275 92
2324 3300046462 Ga0495651_0003129 Ga0495651_0003129_9184_9462 92
2325 3300046462 Ga0495651_0070116 Ga0495651_0070116_2172_2480 92
2326 3300046462 Ga0495651_0073111 Ga0495651_0073111_1960_2238 92
2327 3300046462 Ga0495651_0113472 Ga0495651_0113472_1081_1359 92
2328 3300046463 Ga0495653_0000120 Ga0495653_0000120_3017_3313 92
2329 3300046463 Ga0495653_0000149 Ga0495653_0000149_18203_18481 92
2330 3300046463 Ga0495653_0063779 Ga0495653_0063779_1569_1877 92
2331 3300046463 Ga0495653_0310876 Ga0495653_0310876_669_947 92
2332 3300046471 Ga0495650_0145180 Ga0495650_0145180_162_440 92
2333 3300046471 Ga0495650_0192299 Ga0495650_0192299_302_580 92
2334 3300046472 Ga0495580_0027886 Ga0495580_0027886_2787_3065 92
2335 3300046472 Ga0495580_0261105 Ga0495580_0261105_876_1154 92
2336 3300046472 Ga0495580_0435841 Ga0495580_0435841_575_853 92
2337 3300046472 Ga0495580_0592501 Ga0495580_0592501_234_557 92
2338 3300046473 Ga0495582_0003714 Ga0495582_0003714_6709_6987 92
2339 3300046473 Ga0495582_0016883 Ga0495582_0016883_3079_3357 92
2340 3300046473 Ga0495582_0177291 Ga0495582_0177291_831_1109 92
2341 3300046474 Ga0495605_0065783 Ga0495605_0065783_698_976 92
2342 3300046474 Ga0495605_0072253 Ga0495605_0072253_1271_1549 92
2343 3300046474 Ga0495605_0275861 Ga0495605_0275861_76_354 92
2344 3300046475 Ga0495639_0000873 Ga0495639_0000873_12243_12521 92
2345 3300046475 Ga0495639_0015371 Ga0495639_0015371_950_1228 92
2346 3300046475 Ga0495639_0204443 Ga0495639_0204443_439_717 92
2347 3300046475 Ga0495639_0506022 Ga0495639_0506022_201_524 92
2348 3300046475 Ga0495639_0706156 Ga0495639_0706156_40_318 92
2349 3300046476 Ga0495662_0000285 Ga0495662_0000285_7157_7435 92
2350 3300046476 Ga0495662_0002801 Ga0495662_0002801_1681_1977 92
2351 3300046476 Ga0495662_0021621 Ga0495662_0021621_1352_1675 92
2352 3300046476 Ga0495662_0074022 Ga0495662_0074022_16_294 92
2353 3300046476 Ga0495662_0092503 Ga0495662_0092503_869_1165 92
2354 3300046476 Ga0495662_0293495 Ga0495662_0293495_295_588 92
2355 3300046476 Ga0495662_0313606 Ga0495662_0313606_62_340 92
2356 3300046476 Ga0495662_0434232 Ga0495662_0434232_22_300 92
2357 3300046477 Ga0495664_0000023 Ga0495664_0000023_123495_123791 92
2358 3300046477 Ga0495664_0018921 Ga0495664_0018921_965_1243 92
2359 3300046477 Ga0495664_0109041 Ga0495664_0109041_59_337 92
2360 3300046477 Ga0495664_0110835 Ga0495664_0110835_1345_1623 92
2361 3300046477 Ga0495664_0419741 Ga0495664_0419741_460_738 92
2362 3300046491 Ga0495584_0241032 Ga0495584_0241032_576_854 92
2363 3300046491 Ga0495584_0426463 Ga0495584_0426463_353_631 92
2364 3300046492 Ga0495585_0214713 Ga0495585_0214713_637_915 92
2365 3300046492 Ga0495585_0312246 Ga0495585_0312246_99_377 92
2366 3300046499 Ga0495594_0043181 Ga0495594_0043181_2087_2365 92
2367 3300046499 Ga0495594_0389593 Ga0495594_0389593_286_609 92
2368 3300046499 Ga0495594_0507068 Ga0495594_0507068_382_660 92
2369 3300046499 Ga0495594_0543536 Ga0495594_0543536_41_319 92
2370 3300046500 Ga0495596_0059833 Ga0495596_0059833_806_1084 92
2371 3300046500 Ga0495596_0060438 Ga0495596_0060438_313_591 92
2372 3300046500 Ga0495596_0098296 Ga0495596_0098296_844_1122 92
2373 3300046501 Ga0495607_0008511 Ga0495607_0008511_2923_3201 92
2374 3300046506 Ga0495583_0016744 Ga0495583_0016744_3058_3336 92
2375 3300046506 Ga0495583_0042618 Ga0495583_0042618_1027_1305 92
2376 3300046506 Ga0495583_0189415 Ga0495583_0189415_536_814 92
2377 3300046506 Ga0495583_0246805 Ga0495583_0246805_245_523 92
2378 3300046507 Ga0495606_0004034 Ga0495606_0004034_2689_2967 92
2379 3300046507 Ga0495606_0055089 Ga0495606_0055089_1402_1680 92
2380 3300046507 Ga0495606_0171494 Ga0495606_0171494_822_1100 92
2381 3300046507 Ga0495606_0210562 Ga0495606_0210562_601_879 92
2382 3300046507 Ga0495606_0239139 Ga0495606_0239139_368_646 92
2383 3300046507 Ga0495606_0245712 Ga0495606_0245712_643_921 92
2384 3300046511 Ga0495608_0000030 Ga0495608_0000030_122940_123236 92
2385 3300046511 Ga0495608_0183663 Ga0495608_0183663_508_786 92
2386 3300046512 Ga0495610_0044062 Ga0495610_0044062_1236_1514 92
2387 3300046512 Ga0495610_0049507 Ga0495610_0049507_1537_1815 92
2388 3300046512 Ga0495610_0082804 Ga0495610_0082804_759_1037 92
2389 3300046512 Ga0495610_0205408 Ga0495610_0205408_103_381 92
2390 3300046512 Ga0495610_0336899 Ga0495610_0336899_123_401 92
2391 3300046513 Ga0495616_0003845 Ga0495616_0003845_7627_7905 92
2392 3300046513 Ga0495616_0110076 Ga0495616_0110076_181_459 92
2393 3300046513 Ga0495616_0477327 Ga0495616_0477327_161_439 92
2394 3300046514 Ga0495618_0000042 Ga0495618_0000042_3017_3313 92
2395 3300046514 Ga0495618_0066890 Ga0495618_0066890_587_865 92
2396 3300046514 Ga0495618_0179380 Ga0495618_0179380_321_629 92
2397 3300046514 Ga0495618_0757979 Ga0495618_0757979_210_539 92
2398 3300046515 Ga0495620_0093867 Ga0495620_0093867_669_947 92
2399 3300046515 Ga0495620_0132167 Ga0495620_0132167_226_504 92
2400 3300046515 Ga0495620_0142281 Ga0495620_0142281_464_742 92
2401 3300046515 Ga0495620_0211242 Ga0495620_0211242_374_652 92
2402 3300046515 Ga0495620_0220024 Ga0495620_0220024_276_557 92
2403 3300046515 Ga0495620_0274713 Ga0495620_0274713_166_444 92
2404 3300046516 Ga0495628_0000027 Ga0495628_0000027_2994_3290 92
2405 3300046516 Ga0495628_0028202 Ga0495628_0028202_1959_2237 92
2406 3300046516 Ga0495628_0089380 Ga0495628_0089380_1919_2227 92
2407 3300046516 Ga0495628_0468073 Ga0495628_0468073_66_344 92
2408 3300046516 Ga0495628_0749326 Ga0495628_0749326_236_514 92
2409 3300046517 Ga0495630_0014365 Ga0495630_0014365_4385_4681 92
2410 3300046517 Ga0495630_0016223 Ga0495630_0016223_3681_4004 92
2411 3300046517 Ga0495630_0052372 Ga0495630_0052372_814_1092 92
2412 3300046517 Ga0495630_0102585 Ga0495630_0102585_219_497 92
2413 3300046517 Ga0495630_0441304 Ga0495630_0441304_703_981 92
2414 3300046517 Ga0495630_0493152 Ga0495630_0493152_365_661 92
2415 3300046517 Ga0495630_0518937 Ga0495630_0518937_47_343 92
2416 3300046517 Ga0495630_0666829 Ga0495630_0666829_494_772 92
2417 3300046517 Ga0495630_0945898 Ga0495630_0945898_351_629 92
2418 3300046518 Ga0495631_0040374 Ga0495631_0040374_1565_1843 92
2419 3300046518 Ga0495631_0229655 Ga0495631_0229655_190_468 92
2420 3300046519 Ga0495632_0046718 Ga0495632_0046718_586_864 92
2421 3300046519 Ga0495632_0173899 Ga0495632_0173899_524_802 92
2422 3300046519 Ga0495632_0219705 Ga0495632_0219705_320_598 92
2423 3300046519 Ga0495632_0387584 Ga0495632_0387584_135_413 92
2424 3300046520 Ga0495637_0028843 Ga0495637_0028843_1277_1555 92
2425 3300046520 Ga0495637_0115565 Ga0495637_0115565_216_494 92
2426 3300046520 Ga0495637_0162155 Ga0495637_0162155_364_642 92
2427 3300046522 Ga0495643_0036171 Ga0495643_0036171_1403_1681 92
2428 3300046522 Ga0495643_0076910 Ga0495643_0076910_1017_1295 92
2429 3300046522 Ga0495643_0099094 Ga0495643_0099094_525_803 92
2430 3300046522 Ga0495643_0119699 Ga0495643_0119699_390_668 92
2431 3300046523 Ga0495644_0178757 Ga0495644_0178757_252_530 92
2432 3300046524 Ga0495648_0001935 Ga0495648_0001935_19039_19317 92
2433 3300046524 Ga0495648_0008251 Ga0495648_0008251_4673_4951 92
2434 3300046524 Ga0495648_0009207 Ga0495648_0009207_3067_3345 92
2435 3300046524 Ga0495648_0110031 Ga0495648_0110031_300_578 92
2436 3300046524 Ga0495648_0195568 Ga0495648_0195568_64_342 92
2437 3300046524 Ga0495648_0334994 Ga0495648_0334994_326_604 92
2438 3300046524 Ga0495648_0365817 Ga0495648_0365817_187_465 92
2439 3300046525 Ga0495663_0102368 Ga0495663_0102368_29_307 92
2440 3300046525 Ga0495663_0261877 Ga0495663_0261877_219_497 92
2441 3300046526 Ga0495666_0258267 Ga0495666_0258267_444_722 92
2442 3300046528 Ga0495642_0056938 Ga0495642_0056938_305_583 92
2443 3300046528 Ga0495642_0452373 Ga0495642_0452373_224_502 92
2444 3300046528 Ga0495642_0458950 Ga0495642_0458950_92_370 92
2445 3300046529 Ga0495652_0000041 Ga0495652_0000041_123207_123503 92
2446 3300046529 Ga0495652_0026006 Ga0495652_0026006_1122_1400 92
2447 3300046529 Ga0495652_0507954 Ga0495652_0507954_14_337 92
2448 3300046529 Ga0495652_0628371 Ga0495652_0628371_400_678 92
2449 3300046529 Ga0495652_0772553 Ga0495652_0772553_266_544 92
2450 3300046530 Ga0495654_0149188 Ga0495654_0149188_661_939 92
2451 3300046530 Ga0495654_0308599 Ga0495654_0308599_346_624 92
2452 3300046531 Ga0495665_0102699 Ga0495665_0102699_64_342 92
2453 3300046531 Ga0495665_0139753 Ga0495665_0139753_394_672 92
2454 3300046531 Ga0495665_0217774 Ga0495665_0217774_32_310 92
2455 3300046531 Ga0495665_0563194 Ga0495665_0563194_238_516 92
2456 3300046531 Ga0495665_0593050 Ga0495665_0593050_17_295 92
2457 3300046533 Ga0495640_0000047 Ga0495640_0000047_3017_3313 92
2458 3300046533 Ga0495640_0001806 Ga0495640_0001806_16149_16445 92
2459 3300046533 Ga0495640_0121544 Ga0495640_0121544_230_553 92
2460 3300046533 Ga0495640_0294652 Ga0495640_0294652_371_667 92
2461 3300046533 Ga0495640_0810857 Ga0495640_0810857_153_431 92
2462 3300046535 Ga0495586_0115273 Ga0495586_0115273_673_969 92
2463 3300046535 Ga0495586_0223905 Ga0495586_0223905_676_954 92
2464 3300046536 Ga0495587_0000025 Ga0495587_0000025_22594_22890 92
2465 3300046536 Ga0495587_0001671 Ga0495587_0001671_10378_10656 92
2466 3300046536 Ga0495587_0166669 Ga0495587_0166669_724_1002 92
2467 3300046536 Ga0495587_0241485 Ga0495587_0241485_577_885 92
2468 3300046536 Ga0495587_0258062 Ga0495587_0258062_304_597 92
2469 3300046536 Ga0495587_0305682 Ga0495587_0305682_88_366 92
2470 3300046536 Ga0495587_0340791 Ga0495587_0340791_203_481 92
2471 3300046536 Ga0495587_0366718 Ga0495587_0366718_145_423 92
2472 3300046536 Ga0495587_0472976 Ga0495587_0472976_396_680 92
2473 3300046537 Ga0495598_0004295 Ga0495598_0004295_321_599 92
2474 3300046537 Ga0495598_0049563 Ga0495598_0049563_359_655 92
2475 3300046537 Ga0495598_0068950 Ga0495598_0068950_314_628 92
2476 3300046538 Ga0495609_0040821 Ga0495609_0040821_141_419 92
2477 3300046538 Ga0495609_0098220 Ga0495609_0098220_511_789 92
2478 3300046538 Ga0495609_0455419 Ga0495609_0455419_135_413 92
2479 3300046539 Ga0495621_0406572 Ga0495621_0406572_263_541 92
2480 3300046542 Ga0495597_0028009 Ga0495597_0028009_1934_2212 92
2481 3300046542 Ga0495597_0079183 Ga0495597_0079183_194_472 92
2482 3300046542 Ga0495597_0087996 Ga0495597_0087996_645_923 92
2483 3300046543 Ga0495645_0000001 Ga0495645_0000001_534433_534729 92
2484 3300046543 Ga0495645_0003533 Ga0495645_0003533_171_449 92
2485 3300046543 Ga0495645_0040592 Ga0495645_0040592_3060_3338 92
2486 3300046543 Ga0495645_0285742 Ga0495645_0285742_389_697 92
2487 3300046543 Ga0495645_0410787 Ga0495645_0410787_331_609 92
2488 3300046543 Ga0495645_0617201 Ga0495645_0617201_185_463 92
2489 3300046557 Ga0495622_0008764 Ga0495622_0008764_1271_1549 92
2490 3300046557 Ga0495622_0188226 Ga0495622_0188226_550_828 92
2491 3300046557 Ga0495622_0216016 Ga0495622_0216016_449_727 92
2492 3300046557 Ga0495622_0526430 Ga0495622_0526430_161_439 92
2493 3300046558 Ga0495633_0130764 Ga0495633_0130764_345_623 92
2494 3300046559 Ga0495667_0000001 Ga0495667_0000001_830995_831291 92
2495 3300046559 Ga0495667_0006602 Ga0495667_0006602_7009_7287 92
2496 3300046559 Ga0495667_0082157 Ga0495667_0082157_244_552 92
2497 3300046559 Ga0495667_0101889 Ga0495667_0101889_1066_1359 92
2498 3300046559 Ga0495667_0159647 Ga0495667_0159647_551_829 92
2499 3300046559 Ga0495667_0175773 Ga0495667_0175773_467_745 92
2500 3300046615 Ga0495656_0354897 Ga0495656_0354897_135_413 92
2501 3300046615 Ga0495656_0601499 Ga0495656_0601499_218_496 92
2502 3300046615 Ga0495656_0771070 Ga0495656_0771070_210_488 92
2503 3300046616 Ga0495668_0009874 Ga0495668_0009874_5328_5606 92
2504 3300046616 Ga0495668_0025870 Ga0495668_0025870_644_922 92
2505 3300046616 Ga0495668_0051375 Ga0495668_0051375_47_325 92
2506 3300046616 Ga0495668_0102006 Ga0495668_0102006_518_796 92
2507 3300046616 Ga0495668_0126353 Ga0495668_0126353_640_918 92
2508 3300046616 Ga0495668_0512482 Ga0495668_0512482_370_648 92
2509 3300046616 Ga0495668_0548885 Ga0495668_0548885_197_475 92
2510 3300046616 Ga0495668_0583672 Ga0495668_0583672_149_427 92
2511 3300046642 Ga0495634_0002681 Ga0495634_0002681_11344_11640 92
2512 3300046642 Ga0495634_0012027 Ga0495634_0012027_5502_5798 92
2513 3300046642 Ga0495634_0015564 Ga0495634_0015564_1766_2044 92
2514 3300046642 Ga0495634_0017993 Ga0495634_0017993_4651_4929 92
2515 3300046642 Ga0495634_0024902 Ga0495634_0024902_2783_3106 92
2516 3300046642 Ga0495634_0212514 Ga0495634_0212514_345_623 92
2517 3300046642 Ga0495634_0346931 Ga0495634_0346931_22_300 92
2518 3300046642 Ga0495634_0534811 Ga0495634_0534811_277_570 92
2519 3300046648 Ga0495611_0089074 Ga0495611_0089074_78_356 92
2520 3300046648 Ga0495611_0190083 Ga0495611_0190083_306_584 92
2521 3300046648 Ga0495611_0478174 Ga0495611_0478174_56_334 92
2522 3300046660 Ga0495625_0028714 Ga0495625_0028714_133_411 92
2523 3300046660 Ga0495625_0099034 Ga0495625_0099034_1556_1834 92
2524 3300046660 Ga0495625_0152700 Ga0495625_0152700_372_650 92
2525 3300046660 Ga0495625_0420885 Ga0495625_0420885_361_639 92
2526 3300046660 Ga0495625_0464481 Ga0495625_0464481_184_462 92
2527 3300046660 Ga0495625_0776030 Ga0495625_0776030_267_545 92
2528 3300046660 Ga0495625_0848229 Ga0495625_0848229_217_495 92
2529 3300046663 Ga0495635_0000061 Ga0495635_0000061_3017_3313 92
2530 3300046663 Ga0495635_0008691 Ga0495635_0008691_6228_6506 92
2531 3300046663 Ga0495635_0043911 Ga0495635_0043911_270_548 92
2532 3300046663 Ga0495635_0119598 Ga0495635_0119598_141_419 92
2533 3300046663 Ga0495635_0198757 Ga0495635_0198757_1052_1348 92
2534 3300046663 Ga0495635_0251544 Ga0495635_0251544_184_492 92
2535 3300046663 Ga0495635_0284995 Ga0495635_0284995_554_847 92
2536 3300046663 Ga0495635_1022245 Ga0495635_1022245_11_289 92
2537 3300046664 Ga0495659_0042970 Ga0495659_0042970_288_566 92
2538 3300046665 Ga0495661_0011421 Ga0495661_0011421_3447_3725 92
2539 3300046665 Ga0495661_0449295 Ga0495661_0449295_11_289 92
2540 3300046674 Ga0495588_0011242 Ga0495588_0011242_2855_3133 92
2541 3300046674 Ga0495588_0078052 Ga0495588_0078052_145_423 92
2542 3300046674 Ga0495588_0087424 Ga0495588_0087424_888_1166 92
2543 3300046674 Ga0495588_0212134 Ga0495588_0212134_252_530 92
2544 3300046674 Ga0495588_0625837 Ga0495588_0625837_134_412 92
2545 3300046675 Ga0495657_0003632 Ga0495657_0003632_9219_9515 92
2546 3300046675 Ga0495657_0011421 Ga0495657_0011421_1122_1400 92
2547 3300046675 Ga0495657_0028476 Ga0495657_0028476_263_541 92
2548 3300046675 Ga0495657_0330552 Ga0495657_0330552_196_504 92
2549 3300046678 Ga0495599_0000021 Ga0495599_0000021_3541_3837 92
2550 3300046678 Ga0495599_0006010 Ga0495599_0006010_1959_2237 92
2551 3300046678 Ga0495599_0043969 Ga0495599_0043969_2455_2733 92
2552 3300046678 Ga0495599_0258708 Ga0495599_0258708_705_983 92
2553 3300046678 Ga0495599_0543670 Ga0495599_0543670_360_638 92
2554 3300046678 Ga0495599_0712951 Ga0495599_0712951_11_289 92
2555 3300046679 Ga0495623_0001924 Ga0495623_0001924_8614_8910 92
2556 3300046679 Ga0495623_0032401 Ga0495623_0032401_1251_1529 92
2557 3300046679 Ga0495623_0058044 Ga0495623_0058044_103_381 92
2558 3300046679 Ga0495623_0137194 Ga0495623_0137194_43_351 92
2559 3300046679 Ga0495623_0157466 Ga0495623_0157466_967_1245 92
2560 3300046679 Ga0495623_0241606 Ga0495623_0241606_235_513 92
2561 3300046679 Ga0495623_0330262 Ga0495623_0330262_25_303 92
2562 3300046679 Ga0495623_0540080 Ga0495623_0540080_157_435 92
2563 3300046680 Ga0495646_0000043 Ga0495646_0000043_3541_3837 92
2564 3300046680 Ga0495646_0013907 Ga0495646_0013907_715_993 92
2565 3300046680 Ga0495646_0061035 Ga0495646_0061035_1657_1935 92
2566 3300046681 Ga0495647_0005756 Ga0495647_0005756_1572_1850 92
2567 3300046681 Ga0495647_0149717 Ga0495647_0149717_166_462 92
2568 3300046681 Ga0495647_0287566 Ga0495647_0287566_65_343 92
2569 3300046681 Ga0495647_0359811 Ga0495647_0359811_128_424 92
2570 3300046683 Ga0495658_0001480 Ga0495658_0001480_9739_10017 92
2571 3300046683 Ga0495658_0100632 Ga0495658_0100632_518_814 92
2572 3300046683 Ga0495658_0104892 Ga0495658_0104892_756_1034 92
2573 3300046683 Ga0495658_0134261 Ga0495658_0134261_964_1260 92
2574 3300046683 Ga0495658_0156793 Ga0495658_0156793_949_1245 92
2575 3300046683 Ga0495658_0198033 Ga0495658_0198033_499_777 92
2576 3300046683 Ga0495658_0217508 Ga0495658_0217508_245_568 92
2577 3300046684 Ga0495669_0022216 Ga0495669_0022216_1588_1866 92
2578 3300046684 Ga0495669_0490666 Ga0495669_0490666_249_527 92
2579 3300046689 Ga0495613_0016831 Ga0495613_0016831_1580_1876 92
2580 3300046689 Ga0495613_0027017 Ga0495613_0027017_3316_3594 92
2581 3300046689 Ga0495613_0042004 Ga0495613_0042004_1088_1366 92
2582 3300046689 Ga0495613_0109172 Ga0495613_0109172_30_323 92
2583 3300046689 Ga0495613_0171729 Ga0495613_0171729_689_967 92
2584 3300046689 Ga0495613_0278319 Ga0495613_0278319_861_1139 92
2585 3300046689 Ga0495613_0383288 Ga0495613_0383288_369_647 92
2586 3300046690 Ga0495624_0004478 Ga0495624_0004478_7369_7647 92
2587 3300046690 Ga0495624_0060556 Ga0495624_0060556_2050_2328 92
2588 3300046690 Ga0495624_0099731 Ga0495624_0099731_979_1275 92
2589 3300046690 Ga0495624_0183454 Ga0495624_0183454_590_868 92
2590 3300046690 Ga0495624_0224765 Ga0495624_0224765_731_1024 92
2591 3300046690 Ga0495624_0319265 Ga0495624_0319265_308_586 92
2592 3300046690 Ga0495624_0407324 Ga0495624_0407324_226_504 92
2593 3300046691 Ga0495670_0018738 Ga0495670_0018738_807_1085 92
2594 3300046691 Ga0495670_0095072 Ga0495670_0095072_411_689 92
2595 3300046691 Ga0495670_0534415 Ga0495670_0534415_298_576 92
2596 3300046692 Ga0495671_0038068 Ga0495671_0038068_1335_1613 92
2597 3300046692 Ga0495671_0085571 Ga0495671_0085571_561_839 92
2598 3300046692 Ga0495671_0462351 Ga0495671_0462351_277_555 92
2599 3300046692 Ga0495671_0484763 Ga0495671_0484763_120_398 92
2600 3300046692 Ga0495671_0500177 Ga0495671_0500177_278_556 92
2601 3300046692 Ga0495671_0567261 Ga0495671_0567261_209_487 92
2602 3300046694 Ga0495649_0129198 Ga0495649_0129198_923_1201 92
2603 3300046694 Ga0495649_0252029 Ga0495649_0252029_596_874 92
2604 3300046694 Ga0495649_0654985 Ga0495649_0654985_33_311 92
2605 3300046794 Ga0495589_0207415 Ga0495589_0207415_137_415 92
2606 3300046794 Ga0495589_0243512 Ga0495589_0243512_85_363 92
2607 3300046794 Ga0495589_0534740 Ga0495589_0534740_228_506 92
2608 3300046794 Ga0495589_0578861 Ga0495589_0578861_29_307 92
2609 3300046809 Ga0495600_0000082 Ga0495600_0000082_48786_49082 92
2610 3300046809 Ga0495600_0004858 Ga0495600_0004858_912_1190 92
2611 3300046809 Ga0495600_0044524 Ga0495600_0044524_2542_2820 92
2612 3300046809 Ga0495600_0093094 Ga0495600_0093094_849_1127 92
2613 3300046809 Ga0495600_0099815 Ga0495600_0099815_1413_1721 92
2614 3300046809 Ga0495600_0383543 Ga0495600_0383543_14_292 92
2615 3300046810 Ga0495660_0003610 Ga0495660_0003610_7706_7984 92
2616 3300046810 Ga0495660_0264468 Ga0495660_0264468_212_490 92
2617 3300046810 Ga0495660_0328297 Ga0495660_0328297_203_481 92
2618 3300046810 Ga0495660_0401886 Ga0495660_0401886_103_381 92
2619 3300047315 Ga0495581_0007052 Ga0495581_0007052_2794_3072 92
2620 3300047315 Ga0495581_0033672 Ga0495581_0033672_671_949 92
2621 3300047315 Ga0495581_0067267 Ga0495581_0067267_1156_1434 92
2622 3300047315 Ga0495581_0188883 Ga0495581_0188883_296_574 92
2623 3300047315 Ga0495581_0363272 Ga0495581_0363272_256_552 92
2624 3300047315 Ga0495581_0513349 Ga0495581_0513349_350_628 92
2625 3300047315 Ga0495581_0849076 Ga0495581_0849076_164_460 92
2626 3300047317 Ga0495604_0000036 Ga0495604_0000036_3012_3308 92
2627 3300047317 Ga0495604_0007934 Ga0495604_0007934_1122_1400 92
2628 3300047317 Ga0495604_0053710 Ga0495604_0053710_1578_1886 92
2629 3300047317 Ga0495604_0070725 Ga0495604_0070725_1410_1688 92
2630 3300047317 Ga0495604_0878035 Ga0495604_0878035_59_337 92
2631 3300047319 Ga0495674_0000085 Ga0495674_0000085_62077_62373 92
2632 3300047319 Ga0495674_0010137 Ga0495674_0010137_3867_4145 92
2633 3300047319 Ga0495674_0122884 Ga0495674_0122884_621_917 92
2634 3300047319 Ga0495674_0191913 Ga0495674_0191913_1409_1687 92
2635 3300047319 Ga0495674_0199546 Ga0495674_0199546_809_1087 92
2636 3300047319 Ga0495674_0389509 Ga0495674_0389509_79_402 92
2637 3300047320 Ga0495672_0027272 Ga0495672_0027272_1289_1567 92
2638 3300047320 Ga0495672_0065891 Ga0495672_0065891_1187_1465 92
2639 3300047320 Ga0495672_0093895 Ga0495672_0093895_686_964 92
2640 3300047320 Ga0495672_0182810 Ga0495672_0182810_157_435 92
2641 3300047320 Ga0495672_0214983 Ga0495672_0214983_620_898 92
2642 3300047320 Ga0495672_0218062 Ga0495672_0218062_382_660 92
2643 3300047320 Ga0495672_0273951 Ga0495672_0273951_267_545 92
2644 3300047320 Ga0495672_0488415 Ga0495672_0488415_48_326 92
2645 3300047321 Ga0495676_0050306 Ga0495676_0050306_1816_2094 92
2646 3300047321 Ga0495676_0076501 Ga0495676_0076501_710_988 92
2647 3300047322 Ga0495680_0000201 Ga0495680_0000201_61374_61670 92
2648 3300047322 Ga0495680_0047015 Ga0495680_0047015_2532_2810 92
2649 3300047322 Ga0495680_0057251 Ga0495680_0057251_2295_2603 92
2650 3300047322 Ga0495680_0260184 Ga0495680_0260184_296_574 92
2651 3300047322 Ga0495680_0285058 Ga0495680_0285058_798_1076 92
2652 3300047322 Ga0495680_0503170 Ga0495680_0503170_134_412 92
2653 3300047322 Ga0495680_0758700 Ga0495680_0758700_135_413 92
2654 3300047323 Ga0495683_0045716 Ga0495683_0045716_1230_1508 92
2655 3300047323 Ga0495683_0293066 Ga0495683_0293066_236_514 92
2656 3300047323 Ga0495683_0296539 Ga0495683_0296539_356_634 92
2657 3300047443 Ga0495687_016394 Ga0495687_016394_3121_3399 92
2658 3300047443 Ga0495687_223617 Ga0495687_223617_271_549 92
2659 3300047444 Ga0495675_0000203 Ga0495675_0000203_2990_3286 92
2660 3300047444 Ga0495675_0036206 Ga0495675_0036206_1959_2237 92
2661 3300047445 Ga0495677_0070052 Ga0495677_0070052_33_311 92
2662 3300047445 Ga0495677_0266990 Ga0495677_0266990_92_370 92
2663 3300047445 Ga0495677_0293394 Ga0495677_0293394_182_460 92
2664 3300047447 Ga0495685_016652 Ga0495685_016652_847_1125 92
2665 3300047447 Ga0495685_154188 Ga0495685_154188_35_313 92
2666 3300047469 Ga0495673_0129223 Ga0495673_0129223_531_809 92
2667 3300047469 Ga0495673_0141055 Ga0495673_0141055_648_926 92
2668 3300047469 Ga0495673_0153252 Ga0495673_0153252_213_491 92
2669 3300047470 Ga0495681_0073986 Ga0495681_0073986_417_695 92
2670 3300047471 Ga0495684_0000025 Ga0495684_0000025_123725_124021 92
2671 3300047471 Ga0495684_0003854 Ga0495684_0003854_8910_9188 92
2672 3300047471 Ga0495684_0016236 Ga0495684_0016236_3690_3968 92
2673 3300047471 Ga0495684_0194892 Ga0495684_0194892_707_985 92
2674 3300047471 Ga0495684_0279087 Ga0495684_0279087_459_755 92
2675 3300047471 Ga0495684_0638408 Ga0495684_0638408_358_636 92
2676 3300047471 Ga0495684_1071616 Ga0495684_1071616_120_398 92
2677 3300047472 Ga0495686_0077875 Ga0495686_0077875_1582_1860 92
2678 3300047472 Ga0495686_0095972 Ga0495686_0095972_1177_1455 92
2679 3300047472 Ga0495686_0120965 Ga0495686_0120965_520_798 92
2680 3300047472 Ga0495686_0154337 Ga0495686_0154337_796_1074 92
2681 3300047472 Ga0495686_0169923 Ga0495686_0169923_817_1095 92
2682 3300047472 Ga0495686_0191451 Ga0495686_0191451_541_819 92
2683 3300047472 Ga0495686_0270257 Ga0495686_0270257_176_454 92
2684 3300047673 Ga0495593_0001971 Ga0495593_0001971_8196_8492 92
2685 3300047673 Ga0495593_0022799 Ga0495593_0022799_1733_2011 92
2686 3300047673 Ga0495593_0035110 Ga0495593_0035110_1859_2137 92
2687 3300047673 Ga0495593_0084279 Ga0495593_0084279_1318_1611 92
2688 3300047673 Ga0495593_0520846 Ga0495593_0520846_308_586 92
2689 3300048088 Ga0495602_0000097 Ga0495602_0000097_78273_78569 92
2690 3300048088 Ga0495602_0007161 Ga0495602_0007161_4526_4804 92
2691 3300048088 Ga0495602_0098904 Ga0495602_0098904_1588_1866 92
2692 3300048088 Ga0495602_0295609 Ga0495602_0295609_515_793 92
2693 3300048088 Ga0495602_0505015 Ga0495602_0505015_466_744 92
2694 3300048088 Ga0495602_0905648 Ga0495602_0905648_97_375 92
2695 3300048088 Ga0495602_0961577 Ga0495602_0961577_55_333 92
2696 3300048088 Ga0495602_1145540 Ga0495602_1145540_39_317 92
2697 3300048089 Ga0495614_0040170 Ga0495614_0040170_907_1185 92
2698 3300048089 Ga0495614_0069403 Ga0495614_0069403_1107_1403 92
2699 3300048089 Ga0495614_0452051 Ga0495614_0452051_236_514 92
2700 3300048090 Ga0495615_0021961 Ga0495615_0021961_499_807 92
2701 3300048090 Ga0495615_0156677 Ga0495615_0156677_92_370 92
2702 3300048091 Ga0495626_0157839 Ga0495626_0157839_427_705 92
2703 3300048903 Ga0496100_0035790 Ga0496100_0035790_680_958 92
2704 3300048903 Ga0496100_0088497 Ga0496100_0088497_85_363 92
2705 3300048903 Ga0496100_0152162 Ga0496100_0152162_1015_1293 92
2706 3300048903 Ga0496100_0160992 Ga0496100_0160992_519_797 92
2707 3300048903 Ga0496100_0216991 Ga0496100_0216991_141_419 92
2708 3300048903 Ga0496100_0349508 Ga0496100_0349508_686_964 92
2709 3300048903 Ga0496100_0485437 Ga0496100_0485437_567_845 92
2710 3300048903 Ga0496100_0581538 Ga0496100_0581538_443_721 92
2711 3300048903 Ga0496100_0879313 Ga0496100_0879313_10_288 92
2712 3300048903 Ga0496100_1082392 Ga0496100_1082392_222_500 92
2713 3300048904 Ga0496101_0010556 Ga0496101_0010556_3976_4254 92
2714 3300048904 Ga0496101_0079348 Ga0496101_0079348_153_431 92
2715 3300048904 Ga0496101_0093448 Ga0496101_0093448_1118_1396 92
2716 3300048904 Ga0496101_0136869 Ga0496101_0136869_337_615 92
2717 3300048904 Ga0496101_0428488 Ga0496101_0428488_631_909 92
2718 3300048904 Ga0496101_0498891 Ga0496101_0498891_266_574 92
2719 3300048904 Ga0496101_1047511 Ga0496101_1047511_298_576 92
2720 3300048905 Ga0496102_0023539 Ga0496102_0023539_454_732 92
2721 3300048905 Ga0496102_0027963 Ga0496102_0027963_4374_4652 92
2722 3300048905 Ga0496102_0102590 Ga0496102_0102590_2119_2397 92
2723 3300048905 Ga0496102_0102730 Ga0496102_0102730_2347_2625 92
2724 3300048905 Ga0496102_0414462 Ga0496102_0414462_630_908 92
2725 3300048905 Ga0496102_0583139 Ga0496102_0583139_575_853 92
2726 3300048905 Ga0496102_0637771 Ga0496102_0637771_393_671 92
2727 3300048905 Ga0496102_0770894 Ga0496102_0770894_292_570 92
2728 3300048905 Ga0496102_0802534 Ga0496102_0802534_99_377 92
2729 3300048905 Ga0496102_0985311 Ga0496102_0985311_361_639 92
2730 3300048905 Ga0496102_1171306 Ga0496102_1171306_95_373 92
2731 3300048905 Ga0496102_1391802 Ga0496102_1391802_262_540 92
2732 3300048906 Ga0496103_0181185 Ga0496103_0181185_953_1231 92
2733 3300048906 Ga0496103_0275409 Ga0496103_0275409_53_331 92
2734 3300048906 Ga0496103_0410830 Ga0496103_0410830_323_616 92
2735 3300048906 Ga0496103_0710108 Ga0496103_0710108_182_460 92
2736 3300048906 Ga0496103_0841358 Ga0496103_0841358_60_338 92
2737 3300048907 Ga0496104_0001364 Ga0496104_0001364_20795_21073 92
2738 3300048907 Ga0496104_0044527 Ga0496104_0044527_1114_1392 92
2739 3300048907 Ga0496104_0044528 Ga0496104_0044528_1114_1392 92
2740 3300048907 Ga0496104_0052677 Ga0496104_0052677_2678_2956 92
2741 3300048907 Ga0496104_0072619 Ga0496104_0072619_58_336 92
2742 3300048907 Ga0496104_0127143 Ga0496104_0127143_485_763 92
2743 3300048907 Ga0496104_0184939 Ga0496104_0184939_1118_1396 92
2744 3300048907 Ga0496104_0185228 Ga0496104_0185228_30_308 92
2745 3300048907 Ga0496104_1490835 Ga0496104_1490835_211_519 92
2746 3300048907 Ga0496104_1575931 Ga0496104_1575931_229_507 92
2747 3300048907 Ga0496104_1589499 Ga0496104_1589499_261_539 92
2748 3300048908 Ga0496105_0005504 Ga0496105_0005504_6216_6494 92
2749 3300048908 Ga0496105_0081763 Ga0496105_0081763_1129_1407 92
2750 3300048908 Ga0496105_0145835 Ga0496105_0145835_1061_1339 92
2751 3300048908 Ga0496105_0151601 Ga0496105_0151601_244_522 92
2752 3300048908 Ga0496105_0180428 Ga0496105_0180428_68_346 92
2753 3300048908 Ga0496105_0277341 Ga0496105_0277341_115_393 92
2754 3300048908 Ga0496105_0495959 Ga0496105_0495959_179_457 92
2755 3300048908 Ga0496105_0733618 Ga0496105_0733618_206_484 92
2756 3300048909 Ga0496106_0049371 Ga0496106_0049371_1843_2121 92
2757 3300048909 Ga0496106_0070652 Ga0496106_0070652_451_729 92
2758 3300048909 Ga0496106_0121368 Ga0496106_0121368_1641_1949 92
2759 3300048909 Ga0496106_0128174 Ga0496106_0128174_1207_1485 92
2760 3300048909 Ga0496106_0173107 Ga0496106_0173107_530_808 92
2761 3300048909 Ga0496106_0193854 Ga0496106_0193854_144_422 92
2762 3300048909 Ga0496106_0848323 Ga0496106_0848323_91_369 92
2763 3300048909 Ga0496106_0851508 Ga0496106_0851508_422_700 92
2764 3300048909 Ga0496106_0921112 Ga0496106_0921112_63_341 92
2765 3300048909 Ga0496106_1038912 Ga0496106_1038912_333_611 92
2766 3300048910 Ga0496107_0083656 Ga0496107_0083656_1398_1676 92
2767 3300048910 Ga0496107_0098790 Ga0496107_0098790_1184_1462 92
2768 3300048910 Ga0496107_0106154 Ga0496107_0106154_1726_2004 92
2769 3300048910 Ga0496107_0118596 Ga0496107_0118596_36_314 92
2770 3300048910 Ga0496107_0133717 Ga0496107_0133717_1333_1611 92
2771 3300048910 Ga0496107_0253130 Ga0496107_0253130_309_587 92
2772 3300048910 Ga0496107_0255510 Ga0496107_0255510_217_495 92
2773 3300048910 Ga0496107_0357609 Ga0496107_0357609_573_851 92
2774 3300048910 Ga0496107_0544210 Ga0496107_0544210_537_815 92
2775 3300048910 Ga0496107_0581871 Ga0496107_0581871_324_602 92
2776 3300048911 Ga0496108_0001133 Ga0496108_0001133_2379_2657 92
2777 3300048911 Ga0496108_0002766 Ga0496108_0002766_3106_3384 92
2778 3300048911 Ga0496108_0002874 Ga0496108_0002874_13503_13781 92
2779 3300048911 Ga0496108_0051813 Ga0496108_0051813_200_478 92
2780 3300048911 Ga0496108_0239034 Ga0496108_0239034_1141_1419 92
2781 3300048911 Ga0496108_0339058 Ga0496108_0339058_434_712 92
2782 3300048911 Ga0496108_0426400 Ga0496108_0426400_204_482 92
2783 3300048911 Ga0496108_0857862 Ga0496108_0857862_240_524 92
2784 3300048911 Ga0496108_1375270 Ga0496108_1375270_122_400 92
2785 3300048911 Ga0496108_1746145 Ga0496108_1746145_183_461 92
2786 3300048912 Ga0496109_0000518 Ga0496109_0000518_15781_16059 92
2787 3300048912 Ga0496109_0000583 Ga0496109_0000583_10205_10483 92
2788 3300048912 Ga0496109_0029436 Ga0496109_0029436_2588_2866 92
2789 3300048912 Ga0496109_0079258 Ga0496109_0079258_993_1271 92
2790 3300048912 Ga0496109_0096767 Ga0496109_0096767_238_516 92
2791 3300048912 Ga0496109_0171332 Ga0496109_0171332_153_431 92
2792 3300048912 Ga0496109_0243041 Ga0496109_0243041_605_883 92
2793 3300048912 Ga0496109_0246023 Ga0496109_0246023_1161_1442 92
2794 3300048912 Ga0496109_0303624 Ga0496109_0303624_655_933 92
2795 3300048912 Ga0496109_0345396 Ga0496109_0345396_682_999 92
2796 3300048912 Ga0496109_0401616 Ga0496109_0401616_826_1104 92
2797 3300048912 Ga0496109_0436687 Ga0496109_0436687_273_581 92
2798 3300048912 Ga0496109_0622824 Ga0496109_0622824_594_872 92
2799 3300048913 Ga0496110_0008141 Ga0496110_0008141_7744_8022 92
2800 3300048913 Ga0496110_0010849 Ga0496110_0010849_5509_5787 92
2801 3300048913 Ga0496110_0029991 Ga0496110_0029991_2465_2743 92
2802 3300048913 Ga0496110_0054594 Ga0496110_0054594_3180_3458 92
2803 3300048913 Ga0496110_0071081 Ga0496110_0071081_320_598 92
2804 3300048913 Ga0496110_0083170 Ga0496110_0083170_2337_2615 92
2805 3300048913 Ga0496110_0177885 Ga0496110_0177885_1605_1883 92
2806 3300048913 Ga0496110_0219578 Ga0496110_0219578_1281_1559 92
2807 3300048913 Ga0496110_0225608 Ga0496110_0225608_506_784 92
2808 3300048913 Ga0496110_0322872 Ga0496110_0322872_724_1002 92
2809 3300048913 Ga0496110_0592547 Ga0496110_0592547_24_302 92
2810 3300048913 Ga0496110_1103524 Ga0496110_1103524_219_497 92
2811 3300048913 Ga0496110_1752566 Ga0496110_1752566_138_416 92
2812 3300048914 Ga0496111_0009370 Ga0496111_0009370_1822_2100 92
2813 3300048914 Ga0496111_0023962 Ga0496111_0023962_3847_4125 92
2814 3300048914 Ga0496111_0035111 Ga0496111_0035111_739_1017 92
2815 3300048914 Ga0496111_0302092 Ga0496111_0302092_220_498 92
2816 3300048914 Ga0496111_0342865 Ga0496111_0342865_289_567 92
2817 3300048914 Ga0496111_0517492 Ga0496111_0517492_128_406 92
2818 3300048914 Ga0496111_0850312 Ga0496111_0850312_77_355 92
2819 3300048914 Ga0496111_0973606 Ga0496111_0973606_149_466 92
2820 3300048914 Ga0496111_1320906 Ga0496111_1320906_33_311 92
2821 3300048915 Ga0496112_0000021 Ga0496112_0000021_3106_3384 92
2822 3300048915 Ga0496112_0000884 Ga0496112_0000884_16016_16294 92
2823 3300048915 Ga0496112_0046042 Ga0496112_0046042_1563_1841 92
2824 3300048915 Ga0496112_0056801 Ga0496112_0056801_3391_3669 92
2825 3300048915 Ga0496112_0059398 Ga0496112_0059398_339_617 92
2826 3300048915 Ga0496112_0065844 Ga0496112_0065844_918_1196 92
2827 3300048915 Ga0496112_0104148 Ga0496112_0104148_335_613 92
2828 3300048915 Ga0496112_0141441 Ga0496112_0141441_1717_1995 92
2829 3300048915 Ga0496112_0177290 Ga0496112_0177290_666_974 92
2830 3300048915 Ga0496112_0197416 Ga0496112_0197416_1002_1280 92
2831 3300048915 Ga0496112_0407654 Ga0496112_0407654_593_871 92
2832 3300048915 Ga0496112_1027515 Ga0496112_1027515_173_451 92
2833 3300048915 Ga0496112_1121497 Ga0496112_1121497_111_389 92
2834 3300048915 Ga0496112_1438991 Ga0496112_1438991_273_551 92
2835 3300048916 Ga0496113_0000351 Ga0496113_0000351_5134_5412 92
2836 3300048916 Ga0496113_0004259 Ga0496113_0004259_3151_3429 92
2837 3300048916 Ga0496113_0045614 Ga0496113_0045614_2407_2685 92
2838 3300048916 Ga0496113_0194043 Ga0496113_0194043_568_894 92
2839 3300048916 Ga0496113_0291233 Ga0496113_0291233_385_693 92
2840 3300048916 Ga0496113_0300005 Ga0496113_0300005_505_783 92
2841 3300048916 Ga0496113_0349744 Ga0496113_0349744_527_805 92
2842 3300048916 Ga0496113_0448451 Ga0496113_0448451_459_737 92
2843 3300048916 Ga0496113_0984221 Ga0496113_0984221_296_574 92
2844 3300048917 Ga0496114_0033385 Ga0496114_0033385_2964_3242 92
2845 3300048917 Ga0496114_0113437 Ga0496114_0113437_53_331 92
2846 3300048917 Ga0496114_0202463 Ga0496114_0202463_583_861 92
2847 3300048917 Ga0496114_0236533 Ga0496114_0236533_1270_1548 92
2848 3300048917 Ga0496114_0241490 Ga0496114_0241490_291_569 92
2849 3300048917 Ga0496114_0321966 Ga0496114_0321966_590_868 92
2850 3300048917 Ga0496114_0327954 Ga0496114_0327954_987_1265 92
2851 3300048917 Ga0496114_0403592 Ga0496114_0403592_416_694 92
2852 3300048917 Ga0496114_0465056 Ga0496114_0465056_447_725 92
2853 3300048917 Ga0496114_1310650 Ga0496114_1310650_132_470 92
2854 3300048917 Ga0496114_1643310 Ga0496114_1643310_76_354 92
2855 3300048918 Ga0496115_0004536 Ga0496115_0004536_4843_5121 92
2856 3300048918 Ga0496115_0009751 Ga0496115_0009751_1427_1705 92
2857 3300048918 Ga0496115_0042706 Ga0496115_0042706_1280_1558 92
2858 3300048918 Ga0496115_0047471 Ga0496115_0047471_2462_2740 92
2859 3300048918 Ga0496115_0060839 Ga0496115_0060839_35_313 92
2860 3300048918 Ga0496115_0075134 Ga0496115_0075134_258_536 92
2861 3300048918 Ga0496115_0099139 Ga0496115_0099139_747_1025 92
2862 3300048918 Ga0496115_0145791 Ga0496115_0145791_611_889 92
2863 3300048918 Ga0496115_0210668 Ga0496115_0210668_594_872 92
2864 3300048918 Ga0496115_0388374 Ga0496115_0388374_576_884 92
2865 3300048918 Ga0496115_0732703 Ga0496115_0732703_308_586 92
2866 3300048918 Ga0496115_0765468 Ga0496115_0765468_415_693 92
2867 3300048918 Ga0496115_0833955 Ga0496115_0833955_166_444 92
2868 3300048918 Ga0496115_0906189 Ga0496115_0906189_330_608 92
2869 3300048918 Ga0496115_1089972 Ga0496115_1089972_270_548 92
2870 3300048918 Ga0496115_1111877 Ga0496115_1111877_237_515 92
2871 3300048918 Ga0496115_1453319 Ga0496115_1453319_22_300 92
2872 3300048919 Ga0496116_0085071 Ga0496116_0085071_340_618 92
2873 3300048919 Ga0496116_0126100 Ga0496116_0126100_775_1053 92
2874 3300048919 Ga0496116_0143324 Ga0496116_0143324_729_1007 92
2875 3300048919 Ga0496116_0306142 Ga0496116_0306142_47_325 92
2876 3300048920 Ga0496117_0077305 Ga0496117_0077305_15_293 92
2877 3300048920 Ga0496117_0096386 Ga0496117_0096386_595_873 92
2878 3300048920 Ga0496117_0172110 Ga0496117_0172110_32_310 92
2879 3300048920 Ga0496117_0176650 Ga0496117_0176650_313_591 92
2880 3300048920 Ga0496117_0395120 Ga0496117_0395120_45_323 92
2881 3300048921 Ga0496118_0024920 Ga0496118_0024920_1702_1980 92
2882 3300048921 Ga0496118_0034842 Ga0496118_0034842_896_1174 92
2883 3300048921 Ga0496118_0073065 Ga0496118_0073065_1278_1556 92
2884 3300048921 Ga0496118_0130792 Ga0496118_0130792_185_463 92
2885 3300048921 Ga0496118_0181672 Ga0496118_0181672_15_293 92
2886 3300048921 Ga0496118_0270072 Ga0496118_0270072_347_625 92
2887 3300048921 Ga0496118_0276471 Ga0496118_0276471_58_336 92
2888 3300048922 Ga0496119_0000372 Ga0496119_0000372_34877_35155 92
2889 3300048922 Ga0496119_0004353 Ga0496119_0004353_10710_10988 92
2890 3300048922 Ga0496119_0044370 Ga0496119_0044370_1757_2035 92
2891 3300048922 Ga0496119_0104005 Ga0496119_0104005_409_687 92
2892 3300048922 Ga0496119_0168772 Ga0496119_0168772_850_1128 92
2893 3300048922 Ga0496119_0229145 Ga0496119_0229145_287_565 92
2894 3300048922 Ga0496119_0233228 Ga0496119_0233228_69_347 92
2895 3300048923 Ga0496120_0084130 Ga0496120_0084130_368_646 92
2896 3300048923 Ga0496120_0085830 Ga0496120_0085830_928_1206 92
2897 3300048924 Ga0496121_0002196 Ga0496121_0002196_19138_19416 92
2898 3300048924 Ga0496121_0003067 Ga0496121_0003067_23392_23670 92
2899 3300048924 Ga0496121_0003703 Ga0496121_0003703_1634_1912 92
2900 3300048924 Ga0496121_0015937 Ga0496121_0015937_2325_2603 92
2901 3300048924 Ga0496121_0035490 Ga0496121_0035490_1702_1980 92
2902 3300048924 Ga0496121_0036137 Ga0496121_0036137_521_799 92
2903 3300048924 Ga0496121_0076984 Ga0496121_0076984_2108_2386 92
2904 3300048924 Ga0496121_0182979 Ga0496121_0182979_635_913 92
2905 3300048924 Ga0496121_0354228 Ga0496121_0354228_261_539 92
2906 3300048924 Ga0496121_0355616 Ga0496121_0355616_643_921 92
2907 3300048924 Ga0496121_0491220 Ga0496121_0491220_368_646 92
2908 3300048924 Ga0496121_0593740 Ga0496121_0593740_152_430 92
2909 3300048924 Ga0496121_0713457 Ga0496121_0713457_264_542 92
2910 3300048925 Ga0496122_0041314 Ga0496122_0041314_717_995 92
2911 3300048925 Ga0496122_0041350 Ga0496122_0041350_3100_3378 92
2912 3300048925 Ga0496122_0059674 Ga0496122_0059674_2219_2497 92
2913 3300048925 Ga0496122_0118757 Ga0496122_0118757_1110_1388 92
2914 3300048925 Ga0496122_0161080 Ga0496122_0161080_255_533 92
2915 3300048925 Ga0496122_0229925 Ga0496122_0229925_83_361 92
2916 3300048926 Ga0496123_0008564 Ga0496123_0008564_3518_3796 92
2917 3300048926 Ga0496123_0017126 Ga0496123_0017126_3060_3338 92
2918 3300048926 Ga0496123_0024974 Ga0496123_0024974_2722_3000 92
2919 3300048926 Ga0496123_0183037 Ga0496123_0183037_588_866 92
2920 3300048926 Ga0496123_0191833 Ga0496123_0191833_233_511 92
2921 3300048926 Ga0496123_0294386 Ga0496123_0294386_217_495 92
2922 3300048926 Ga0496123_0417924 Ga0496123_0417924_103_381 92
2923 3300048927 Ga0496124_0037995 Ga0496124_0037995_1674_1952 92
2924 3300048927 Ga0496124_0046215 Ga0496124_0046215_3036_3314 92
2925 3300048927 Ga0496124_0263591 Ga0496124_0263591_629_907 92
2926 3300048927 Ga0496124_0267287 Ga0496124_0267287_515_793 92
2927 3300048928 Ga0496125_0017448 Ga0496125_0017448_4456_4734 92
2928 3300048928 Ga0496125_0023890 Ga0496125_0023890_3979_4257 92
2929 3300048928 Ga0496125_0047198 Ga0496125_0047198_1862_2140 92
2930 3300048928 Ga0496125_0061489 Ga0496125_0061489_651_929 92
2931 3300048928 Ga0496125_0088687 Ga0496125_0088687_938_1216 92
2932 3300048928 Ga0496125_0166167 Ga0496125_0166167_1198_1476 92
2933 3300048928 Ga0496125_0211880 Ga0496125_0211880_70_348 92
2934 3300048928 Ga0496125_0219466 Ga0496125_0219466_934_1212 92
2935 3300048928 Ga0496125_0268923 Ga0496125_0268923_281_559 92
2936 3300048928 Ga0496125_0397586 Ga0496125_0397586_221_499 92
2937 3300048928 Ga0496125_0476991 Ga0496125_0476991_52_330 92
2938 3300048928 Ga0496125_0675543 Ga0496125_0675543_161_439 92
2939 3300048928 Ga0496125_0758794 Ga0496125_0758794_218_496 92
2940 3300048929 Ga0496126_0044627 Ga0496126_0044627_190_468 92
2941 3300048929 Ga0496126_0052029 Ga0496126_0052029_1359_1637 92
2942 3300048929 Ga0496126_0076584 Ga0496126_0076584_2500_2778 92
2943 3300048929 Ga0496126_0077021 Ga0496126_0077021_65_343 92
2944 3300048929 Ga0496126_0079188 Ga0496126_0079188_2191_2469 92
2945 3300048929 Ga0496126_0088438 Ga0496126_0088438_675_953 92
2946 3300048929 Ga0496126_0157561 Ga0496126_0157561_1342_1620 92
2947 3300048929 Ga0496126_0167062 Ga0496126_0167062_1542_1820 92
2948 3300048929 Ga0496126_0170947 Ga0496126_0170947_584_862 92
2949 3300048929 Ga0496126_0183935 Ga0496126_0183935_667_945 92
2950 3300048929 Ga0496126_0185973 Ga0496126_0185973_1295_1573 92
2951 3300048929 Ga0496126_0205918 Ga0496126_0205918_1144_1422 92
2952 3300048929 Ga0496126_0212667 Ga0496126_0212667_433_711 92
2953 3300048929 Ga0496126_0248935 Ga0496126_0248935_733_1011 92
2954 3300048929 Ga0496126_0355442 Ga0496126_0355442_725_1003 92
2955 3300048929 Ga0496126_0373358 Ga0496126_0373358_604_882 92
2956 3300048929 Ga0496126_0444285 Ga0496126_0444285_38_316 92
2957 3300048929 Ga0496126_0499311 Ga0496126_0499311_413_691 92
2958 3300049127 Ga0501306_004939 Ga0501306_004939_264_542 92
2959 3300049161 Ga0501305_034396 Ga0501305_034396_25_303 92
2960 3300049161 Ga0501305_046581 Ga0501305_046581_141_419 92
2961 3300049161 Ga0501305_075968 Ga0501305_075968_258_536 92
2962 3300049162 Ga0501307_082940 Ga0501307_082940_75_353 92
2963 3300049459 Ga0495678_083750 Ga0495678_083750_246_524 92
2964 3300049459 Ga0495678_091849 Ga0495678_091849_532_810 92
2965 3300049459 Ga0495678_181289 Ga0495678_181289_33_311 92
2966 3300049460 Ga0495682_0007189 Ga0495682_0007189_3674_3952 92
2967 3300049460 Ga0495682_0373080 Ga0495682_0373080_205_483 92
2968 3300049527 Ga0501311_021240 Ga0501311_021240_132_410 92
2969 3300049528 Ga0501312_002347 Ga0501312_002347_476_754 92
2970 3300049530 Ga0501314_000558 Ga0501314_000558_97_375 92
2971 3300049533 Ga0501317_089506 Ga0501317_089506_30_308 92
2972 3300049536 Ga0501320_033628 Ga0501320_033628_296_574 92
2973 3300049537 Ga0501321_000893 Ga0501321_000893_916_1194 92
2974 3300049538 Ga0501322_018263 Ga0501322_018263_269_547 92
2975 3300049539 Ga0501323_002733 Ga0501323_002733_661_939 92
2976 3300049551 Ga0501335_004298 Ga0501335_004298_788_1066 92
2977 3300049552 Ga0501336_008946 Ga0501336_008946_444_722 92
2978 3300049554 Ga0501338_09103 Ga0501338_09103_299_577 92
2979 3300049568 Ga0501031_0011241 Ga0501031_0011241_1512_1793 92
2980 3300049568 Ga0501031_0012984 Ga0501031_0012984_3171_3449 92
2981 3300049568 Ga0501031_0110797 Ga0501031_0110797_1446_1724 92
2982 3300049568 Ga0501031_0184503 Ga0501031_0184503_759_1040 92
2983 3300049568 Ga0501031_0203443 Ga0501031_0203443_537_815 92
2984 3300049568 Ga0501031_0310647 Ga0501031_0310647_469_747 92
2985 3300049568 Ga0501031_0631414 Ga0501031_0631414_240_518 92
2986 3300049568 Ga0501031_0644829 Ga0501031_0644829_351_629 92
2987 3300049568 Ga0501031_0783196 Ga0501031_0783196_16_294 92
2988 3300049569 Ga0501032_0008814 Ga0501032_0008814_3891_4169 92
2989 3300049569 Ga0501032_0071493 Ga0501032_0071493_1393_1671 92
2990 3300049569 Ga0501032_0102312 Ga0501032_0102312_1449_1727 92
2991 3300049569 Ga0501032_0114075 Ga0501032_0114075_1019_1297 92
2992 3300049569 Ga0501032_0119514 Ga0501032_0119514_714_992 92
2993 3300049569 Ga0501032_0147201 Ga0501032_0147201_615_896 92
2994 3300049569 Ga0501032_0208489 Ga0501032_0208489_318_599 92
2995 3300049569 Ga0501032_0498193 Ga0501032_0498193_98_412 92
2996 3300049569 Ga0501032_0757010 Ga0501032_0757010_125_406 92
2997 3300049569 Ga0501032_0886087 Ga0501032_0886087_52_330 92
2998 3300049569 Ga0501032_0922874 Ga0501032_0922874_127_411 92
2999 3300049570 Ga0501033_0000094 Ga0501033_0000094_81353_81631 92
3000 3300049570 Ga0501033_0014504 Ga0501033_0014504_2546_2824 92
3001 3300049570 Ga0501033_0021359 Ga0501033_0021359_1989_2270 92
3002 3300049570 Ga0501033_0077789 Ga0501033_0077789_139_417 92
3003 3300049570 Ga0501033_0164166 Ga0501033_0164166_92_370 92
3004 3300049570 Ga0501033_0174136 Ga0501033_0174136_134_412 92
3005 3300049570 Ga0501033_0350776 Ga0501033_0350776_296_574 92
3006 3300049570 Ga0501033_0397762 Ga0501033_0397762_402_683 92
3007 3300049571 Ga0501034_0000021 Ga0501034_0000021_3156_3434 92
3008 3300049571 Ga0501034_0014685 Ga0501034_0014685_7102_7380 92
3009 3300049571 Ga0501034_0058496 Ga0501034_0058496_661_939 92
3010 3300049571 Ga0501034_0060811 Ga0501034_0060811_365_646 92
3011 3300049571 Ga0501034_0064071 Ga0501034_0064071_111_389 92
3012 3300049571 Ga0501034_0084273 Ga0501034_0084273_631_909 92
3013 3300049571 Ga0501034_0109871 Ga0501034_0109871_1332_1613 92
3014 3300049571 Ga0501034_0191684 Ga0501034_0191684_1440_1718 92
3015 3300049571 Ga0501034_0672583 Ga0501034_0672583_131_409 92
3016 3300049571 Ga0501034_0770254 Ga0501034_0770254_71_352 92
3017 3300049571 Ga0501034_0900539 Ga0501034_0900539_51_329 92
3018 3300049571 Ga0501034_0931809 Ga0501034_0931809_214_501 92
3019 3300049571 Ga0501034_1018586 Ga0501034_1018586_152_430 92
3020 3300049571 Ga0501034_1198498 Ga0501034_1198498_23_334 92
3021 3300049571 Ga0501034_1455684 Ga0501034_1455684_118_396 92
3022 3300049571 Ga0501034_1515394 Ga0501034_1515394_90_368 92
3023 3300049571 Ga0501034_1601856 Ga0501034_1601856_25_303 92
3024 3300049572 Ga0501036_0001704 Ga0501036_0001704_13700_13978 92
3025 3300049572 Ga0501036_0071269 Ga0501036_0071269_1940_2218 92
3026 3300049572 Ga0501036_0088809 Ga0501036_0088809_1227_1511 92
3027 3300049572 Ga0501036_0144666 Ga0501036_0144666_1126_1404 92
3028 3300049572 Ga0501036_0261255 Ga0501036_0261255_972_1253 92
3029 3300049572 Ga0501036_0279746 Ga0501036_0279746_268_549 92
3030 3300049572 Ga0501036_0614306 Ga0501036_0614306_565_843 92
3031 3300049572 Ga0501036_1135559 Ga0501036_1135559_91_369 92
3032 3300049573 Ga0501037_0000450 Ga0501037_0000450_29271_29549 92
3033 3300049573 Ga0501037_0001434 Ga0501037_0001434_15114_15392 92
3034 3300049573 Ga0501037_0057990 Ga0501037_0057990_2011_2289 92
3035 3300049573 Ga0501037_0067461 Ga0501037_0067461_2047_2325 92
3036 3300049573 Ga0501037_0069851 Ga0501037_0069851_1647_1925 92
3037 3300049573 Ga0501037_0176514 Ga0501037_0176514_88_366 92
3038 3300049573 Ga0501037_0201488 Ga0501037_0201488_808_1089 92
3039 3300049573 Ga0501037_0323907 Ga0501037_0323907_251_538 92
3040 3300049573 Ga0501037_0476031 Ga0501037_0476031_85_363 92
3041 3300049573 Ga0501037_0764502 Ga0501037_0764502_37_315 92
3042 3300049574 Ga0501038_0000052 Ga0501038_0000052_3169_3447 92
3043 3300049574 Ga0501038_0012441 Ga0501038_0012441_7306_7584 92
3044 3300049574 Ga0501038_0047138 Ga0501038_0047138_2799_3083 92
3045 3300049574 Ga0501038_0080606 Ga0501038_0080606_510_788 92
3046 3300049574 Ga0501038_0111161 Ga0501038_0111161_215_493 92
3047 3300049574 Ga0501038_0135386 Ga0501038_0135386_985_1266 92
3048 3300049574 Ga0501038_0167309 Ga0501038_0167309_1399_1677 92
3049 3300049574 Ga0501038_0227511 Ga0501038_0227511_938_1216 92
3050 3300049574 Ga0501038_0269158 Ga0501038_0269158_477_758 92
3051 3300049574 Ga0501038_0326774 Ga0501038_0326774_381_659 92
3052 3300049574 Ga0501038_0362308 Ga0501038_0362308_211_528 92
3053 3300049574 Ga0501038_0410651 Ga0501038_0410651_461_739 92
3054 3300049574 Ga0501038_0610355 Ga0501038_0610355_112_390 92
3055 3300049574 Ga0501038_0686047 Ga0501038_0686047_346_627 92
3056 3300049574 Ga0501038_0751558 Ga0501038_0751558_58_336 92
3057 3300049574 Ga0501038_0859514 Ga0501038_0859514_247_525 92
3058 3300049575 Ga0501039_0000549 Ga0501039_0000549_3041_3319 92
3059 3300049575 Ga0501039_0020478 Ga0501039_0020478_3171_3449 92
3060 3300049575 Ga0501039_0021292 Ga0501039_0021292_3087_3368 92
3061 3300049575 Ga0501039_0082862 Ga0501039_0082862_762_1040 92
3062 3300049576 Ga0501040_0905237 Ga0501040_0905237_68_349 92
3063 3300049576 Ga0501040_1275534 Ga0501040_1275534_124_402 92
3064 3300049577 Ga0501041_0008356 Ga0501041_0008356_267_545 92
3065 3300049577 Ga0501041_0037287 Ga0501041_0037287_705_983 92
3066 3300049578 Ga0501042_0087473 Ga0501042_0087473_51_329 92
3067 3300049578 Ga0501042_0152972 Ga0501042_0152972_932_1210 92
3068 3300049578 Ga0501042_0327856 Ga0501042_0327856_176_454 92
3069 3300049578 Ga0501042_0559276 Ga0501042_0559276_41_322 92
3070 3300049578 Ga0501042_0717109 Ga0501042_0717109_431_709 92
3071 3300049579 Ga0501043_0005051 Ga0501043_0005051_7265_7543 92
3072 3300049579 Ga0501043_0013010 Ga0501043_0013010_684_962 92
3073 3300049579 Ga0501043_0099730 Ga0501043_0099730_1294_1572 92
3074 3300049579 Ga0501043_0100195 Ga0501043_0100195_752_1030 92
3075 3300049579 Ga0501043_0124264 Ga0501043_0124264_1438_1716 92
3076 3300049579 Ga0501043_0124806 Ga0501043_0124806_980_1258 92
3077 3300049579 Ga0501043_0219927 Ga0501043_0219927_1171_1452 92
3078 3300049580 Ga0501046_0002237 Ga0501046_0002237_3169_3447 92
3079 3300049580 Ga0501046_0141630 Ga0501046_0141630_247_528 92
3080 3300049580 Ga0501046_0198035 Ga0501046_0198035_152_430 92
3081 3300049580 Ga0501046_0498239 Ga0501046_0498239_490_768 92
3082 3300049580 Ga0501046_0781975 Ga0501046_0781975_229_510 92
3083 3300049581 Ga0501047_0017348 Ga0501047_0017348_3169_3447 92
3084 3300049581 Ga0501047_0044775 Ga0501047_0044775_3231_3509 92
3085 3300049581 Ga0501047_0050813 Ga0501047_0050813_3189_3470 92
3086 3300049581 Ga0501047_0077925 Ga0501047_0077925_1542_1823 92
3087 3300049581 Ga0501047_0103854 Ga0501047_0103854_2203_2481 92
3088 3300049581 Ga0501047_0108871 Ga0501047_0108871_642_920 92
3089 3300049581 Ga0501047_0114057 Ga0501047_0114057_330_608 92
3090 3300049581 Ga0501047_0126939 Ga0501047_0126939_1085_1363 92
3091 3300049581 Ga0501047_0158759 Ga0501047_0158759_547_834 92
3092 3300049581 Ga0501047_0385475 Ga0501047_0385475_744_1022 92
3093 3300049581 Ga0501047_0409881 Ga0501047_0409881_199_480 92
3094 3300049581 Ga0501047_0481806 Ga0501047_0481806_492_770 92
3095 3300049582 Ga0501048_0001862 Ga0501048_0001862_12560_12838 92
3096 3300049582 Ga0501048_0023502 Ga0501048_0023502_818_1096 92
3097 3300049582 Ga0501048_0235364 Ga0501048_0235364_949_1227 92
3098 3300049582 Ga0501048_0266445 Ga0501048_0266445_609_890 92
3099 3300049582 Ga0501048_0598547 Ga0501048_0598547_57_335 92
3100 3300049582 Ga0501048_0631428 Ga0501048_0631428_261_539 92
3101 3300049582 Ga0501048_0700863 Ga0501048_0700863_278_556 92
3102 3300049582 Ga0501048_1129912 Ga0501048_1129912_132_410 92
3103 3300049583 Ga0501067_0006170 Ga0501067_0006170_3315_3593 92
3104 3300049583 Ga0501067_0321809 Ga0501067_0321809_398_676 92
3105 3300049583 Ga0501067_0522488 Ga0501067_0522488_205_516 92
3106 3300049584 Ga0501068_0001049 Ga0501068_0001049_3638_3916 92
3107 3300049584 Ga0501068_0122438 Ga0501068_0122438_451_771 92
3108 3300049584 Ga0501068_0242940 Ga0501068_0242940_175_453 92
3109 3300049584 Ga0501068_0278551 Ga0501068_0278551_754_1047 92
3110 3300049584 Ga0501068_0408413 Ga0501068_0408413_172_453 92
3111 3300049584 Ga0501068_0980276 Ga0501068_0980276_215_493 92
3112 3300049584 Ga0501068_1077660 Ga0501068_1077660_125_406 92
3113 3300049585 Ga0501069_0008119 Ga0501069_0008119_2615_2893 92
3114 3300049585 Ga0501069_0040203 Ga0501069_0040203_280_558 92
3115 3300049585 Ga0501069_0169006 Ga0501069_0169006_327_611 92
3116 3300049585 Ga0501069_0174695 Ga0501069_0174695_748_1026 92
3117 3300049585 Ga0501069_0371545 Ga0501069_0371545_336_617 92
3118 3300049585 Ga0501069_0981888 Ga0501069_0981888_73_351 92
3119 3300049586 Ga0501070_0025506 Ga0501070_0025506_1304_1582 92
3120 3300049586 Ga0501070_0033678 Ga0501070_0033678_841_1119 92
3121 3300049586 Ga0501070_0298016 Ga0501070_0298016_933_1211 92
3122 3300049586 Ga0501070_0370172 Ga0501070_0370172_493_774 92
3123 3300049586 Ga0501070_0403736 Ga0501070_0403736_160_447 92
3124 3300049586 Ga0501070_0816675 Ga0501070_0816675_237_518 92
3125 3300049587 Ga0501071_0024767 Ga0501071_0024767_3037_3321 92
3126 3300049587 Ga0501071_0092379 Ga0501071_0092379_612_893 92
3127 3300049587 Ga0501071_0096589 Ga0501071_0096589_1357_1635 92
3128 3300049587 Ga0501071_0429895 Ga0501071_0429895_166_444 92
3129 3300049587 Ga0501071_0570332 Ga0501071_0570332_259_537 92
3130 3300049587 Ga0501071_1187398 Ga0501071_1187398_249_527 92
3131 3300049588 Ga0501072_0002634 Ga0501072_0002634_136_414 92
3132 3300049588 Ga0501072_0008088 Ga0501072_0008088_928_1239 92
3133 3300049588 Ga0501072_0031734 Ga0501072_0031734_1657_1941 92
3134 3300049588 Ga0501072_0060779 Ga0501072_0060779_1279_1557 92
3135 3300049588 Ga0501072_0620249 Ga0501072_0620249_26_304 92
3136 3300049588 Ga0501072_0864300 Ga0501072_0864300_255_572 92
3137 3300049589 Ga0501073_0000597 Ga0501073_0000597_21999_22277 92
3138 3300049589 Ga0501073_0023164 Ga0501073_0023164_2137_2415 92
3139 3300049589 Ga0501073_0042595 Ga0501073_0042595_871_1149 92
3140 3300049589 Ga0501073_0194893 Ga0501073_0194893_645_923 92
3141 3300049589 Ga0501073_0225787 Ga0501073_0225787_733_1011 92
3142 3300049589 Ga0501073_0664027 Ga0501073_0664027_238_516 92
3143 3300049589 Ga0501073_0673821 Ga0501073_0673821_245_556 92
3144 3300049590 Ga0501074_0000285 Ga0501074_0000285_1711_1989 92
3145 3300049590 Ga0501074_0015922 Ga0501074_0015922_3808_4086 92
3146 3300049590 Ga0501074_0026693 Ga0501074_0026693_3253_3531 92
3147 3300049590 Ga0501074_0328523 Ga0501074_0328523_623_904 92
3148 3300049590 Ga0501074_0590019 Ga0501074_0590019_258_536 92
3149 3300049590 Ga0501074_0964873 Ga0501074_0964873_34_312 92
3150 3300049591 Ga0501075_0147221 Ga0501075_0147221_834_1115 92
3151 3300049591 Ga0501075_0766380 Ga0501075_0766380_204_482 92
3152 3300049591 Ga0501075_1370027 Ga0501075_1370027_243_521 92
3153 3300049592 Ga0501076_0081388 Ga0501076_0081388_1128_1409 92
3154 3300049592 Ga0501076_0083103 Ga0501076_0083103_1314_1598 92
3155 3300049592 Ga0501076_1548053 Ga0501076_1548053_183_461 92
3156 3300049593 Ga0501077_0150192 Ga0501077_0150192_987_1271 92
3157 3300049593 Ga0501077_0671751 Ga0501077_0671751_195_473 92
3158 3300049653 Ga0501206_071618 Ga0501206_071618_122_400 92
3159 3300049671 Ga0501238_011952 Ga0501238_011952_322_600 92
3160 3300049676 Ga0501246_040308 Ga0501246_040308_177_455 92
3161 3300049741 Ga0501079_0008121 Ga0501079_0008121_7053_7331 92
3162 3300049741 Ga0501079_0091837 Ga0501079_0091837_1416_1700 92
3163 3300049741 Ga0501079_0302378 Ga0501079_0302378_222_503 92
3164 3300049742 Ga0501080_0080992 Ga0501080_0080992_696_974 92
3165 3300049742 Ga0501080_0085085 Ga0501080_0085085_742_1020 92
3166 3300049742 Ga0501080_0090495 Ga0501080_0090495_75_353 92
3167 3300049742 Ga0501080_0137367 Ga0501080_0137367_352_630 92
3168 3300049742 Ga0501080_0336362 Ga0501080_0336362_50_349 92
3169 3300049742 Ga0501080_0703471 Ga0501080_0703471_463_750 92
3170 3300049742 Ga0501080_0939188 Ga0501080_0939188_308_586 92
3171 3300049743 Ga0501081_0047513 Ga0501081_0047513_695_976 92
3172 3300049743 Ga0501081_0369450 Ga0501081_0369450_547_825 92
3173 3300049743 Ga0501081_1356655 Ga0501081_1356655_251_529 92
3174 3300049744 Ga0501083_0005133 Ga0501083_0005133_15_293 92
3175 3300049744 Ga0501083_0008114 Ga0501083_0008114_3059_3340 92
3176 3300049744 Ga0501083_0044999 Ga0501083_0044999_1995_2291 92
3177 3300049744 Ga0501083_0177349 Ga0501083_0177349_1039_1317 92
3178 3300049744 Ga0501083_0285372 Ga0501083_0285372_724_1035 92
3179 3300049822 Ga0501035_0000255 Ga0501035_0000255_4164_4442 92
3180 3300049822 Ga0501035_0131180 Ga0501035_0131180_1021_1299 92
3181 3300049822 Ga0501035_0177156 Ga0501035_0177156_466_744 92
3182 3300049822 Ga0501035_0188785 Ga0501035_0188785_238_516 92
3183 3300049822 Ga0501035_0260591 Ga0501035_0260591_699_986 92
3184 3300049822 Ga0501035_0291016 Ga0501035_0291016_1031_1312 92
3185 3300049822 Ga0501035_0442935 Ga0501035_0442935_87_365 92
3186 3300049822 Ga0501035_0626559 Ga0501035_0626559_355_633 92
3187 3300049822 Ga0501035_0778968 Ga0501035_0778968_191_469 92
3188 3300049822 Ga0501035_0883215 Ga0501035_0883215_111_389 92
3189 3300049822 Ga0501035_1303142 Ga0501035_1303142_152_430 92
3190 3300049823 Ga0501044_0011283 Ga0501044_0011283_6235_6513 92
3191 3300049823 Ga0501044_0014028 Ga0501044_0014028_3169_3447 92
3192 3300049823 Ga0501044_0018525 Ga0501044_0018525_6169_6447 92
3193 3300049823 Ga0501044_0128361 Ga0501044_0128361_1009_1287 92
3194 3300049823 Ga0501044_0142130 Ga0501044_0142130_1402_1680 92
3195 3300049823 Ga0501044_0152785 Ga0501044_0152785_1998_2279 92
3196 3300049823 Ga0501044_0154439 Ga0501044_0154439_325_603 92
3197 3300049823 Ga0501044_0163967 Ga0501044_0163967_692_970 92
3198 3300049823 Ga0501044_0468986 Ga0501044_0468986_799_1077 92
3199 3300049823 Ga0501044_0476969 Ga0501044_0476969_188_466 92
3200 3300049823 Ga0501044_0549142 Ga0501044_0549142_468_749 92
3201 3300049823 Ga0501044_0600095 Ga0501044_0600095_638_922 92
3202 3300049823 Ga0501044_0627769 Ga0501044_0627769_102_389 92
3203 3300049823 Ga0501044_0705229 Ga0501044_0705229_330_608 92
3204 3300049823 Ga0501044_0768466 Ga0501044_0768466_281_559 92
3205 3300049823 Ga0501044_0955497 Ga0501044_0955497_351_629 92
3206 3300049823 Ga0501044_1129486 Ga0501044_1129486_162_440 92
3207 3300049824 Ga0501045_0023964 Ga0501045_0023964_2093_2371 92
3208 3300049824 Ga0501045_0394198 Ga0501045_0394198_474_758 92
3209 3300050489 nmdc:mga03683_102685_c1 nmdc:mga03683_102685_c1_124_402 92
3210 3300050489 nmdc:mga03683_390638_c1 nmdc:mga03683_390638_c1_130_429 92
3211 3300050489 nmdc:mga03683_476302_c1 nmdc:mga03683_476302_c1_265_543 92
3212 3300050489 nmdc:mga03683_71644_c1 nmdc:mga03683_71644_c1_344_622 92
3213 3300050489 nmdc:mga03683_92382_c1 nmdc:mga03683_92382_c1_562_840 92
3214 3300050490 nmdc:mga03n38_108138_c1 nmdc:mga03n38_108138_c1_162_440 92
3215 3300050490 nmdc:mga03n38_118300_c1 nmdc:mga03n38_118300_c1_365_643 92
3216 3300050490 nmdc:mga03n38_211878_c1 nmdc:mga03n38_211878_c1_515_793 92
3217 3300050490 nmdc:mga03n38_267328_c1 nmdc:mga03n38_267328_c1_181_459 92
3218 3300050490 nmdc:mga03n38_284930_c1 nmdc:mga03n38_284930_c1_181_459 92
3219 3300050490 nmdc:mga03n38_296879_c1 nmdc:mga03n38_296879_c1_140_418 92
3220 3300050490 nmdc:mga03n38_352016_c1 nmdc:mga03n38_352016_c1_233_511 92
3221 3300050490 nmdc:mga03n38_8514_c1 nmdc:mga03n38_8514_c1_194_472 92
3222 3300050490 nmdc:mga03n38_867785_c1 nmdc:mga03n38_867785_c1_143_421 92
3223 3300050491 nmdc:mga00v17_128506_c1 nmdc:mga00v17_128506_c1_61_339 92
3224 3300050491 nmdc:mga00v17_299939_c1 nmdc:mga00v17_299939_c1_341_619 92
3225 3300050491 nmdc:mga00v17_6230_c1 nmdc:mga00v17_6230_c1_2816_3094 92
3226 3300050491 nmdc:mga00v17_714921_c1 nmdc:mga00v17_714921_c1_12_290 92
3227 3300050491 nmdc:mga00v17_779410_c1 nmdc:mga00v17_779410_c1_77_355 92
3228 3300050492 nmdc:mga0yw44_1128533_c1 nmdc:mga0yw44_1128533_c1_214_513 92
3229 3300050492 nmdc:mga0yw44_13668_c1 nmdc:mga0yw44_13668_c1_3258_3536 92
3230 3300050492 nmdc:mga0yw44_225216_c1 nmdc:mga0yw44_225216_c1_856_1134 92
3231 3300050492 nmdc:mga0yw44_315614_c1 nmdc:mga0yw44_315614_c1_757_1038 92
3232 3300050492 nmdc:mga0yw44_384589_c1 nmdc:mga0yw44_384589_c1_444_722 92
3233 3300050492 nmdc:mga0yw44_509564_c1 nmdc:mga0yw44_509564_c1_106_384 92
3234 3300050493 nmdc:mga0k408_102831_c1 nmdc:mga0k408_102831_c1_1185_1481 92
3235 3300050493 nmdc:mga0k408_123170_c1 nmdc:mga0k408_123170_c1_1017_1295 92
3236 3300050493 nmdc:mga0k408_278885_c1 nmdc:mga0k408_278885_c1_197_475 92
3237 3300050493 nmdc:mga0k408_284200_c1 nmdc:mga0k408_284200_c1_198_476 92
3238 3300050493 nmdc:mga0k408_700213_c1 nmdc:mga0k408_700213_c1_106_384 92
3239 3300050494 nmdc:mga06z11_133807_c1 nmdc:mga06z11_133807_c1_689_967 92
3240 3300050494 nmdc:mga06z11_449510_c1 nmdc:mga06z11_449510_c1_270_548 92
3241 3300050494 nmdc:mga06z11_52651_c1 nmdc:mga06z11_52651_c1_1418_1696 92
3242 3300050494 nmdc:mga06z11_610604_c1 nmdc:mga06z11_610604_c1_38_316 92
3243 3300050494 nmdc:mga06z11_794937_c1 nmdc:mga06z11_794937_c1_111_389 92
3244 3300050495 nmdc:mga04h51_219374_c1 nmdc:mga04h51_219374_c1_340_618 92
3245 3300050496 nmdc:mga07m45_307582_c1 nmdc:mga07m45_307582_c1_123_401 92
3246 3300050496 nmdc:mga07m45_715472_c1 nmdc:mga07m45_715472_c1_70_348 92
3247 3300050496 nmdc:mga07m45_78306_c1 nmdc:mga07m45_78306_c1_1129_1407 92
3248 3300050496 nmdc:mga07m45_890411_c1 nmdc:mga07m45_890411_c1_177_455 92
3249 3300050507 nmdc:mga05p37_1362011_c1 nmdc:mga05p37_1362011_c1_259_552 92
3250 3300050507 nmdc:mga05p37_26265_c1 nmdc:mga05p37_26265_c1_6566_6856 92
3251 3300050507 nmdc:mga05p37_938088_c1 nmdc:mga05p37_938088_c1_78_356 92
3252 3300050508 nmdc:mga09592_299910_c1 nmdc:mga09592_299910_c1_104_385 92
3253 3300050508 nmdc:mga09592_665292_c1 nmdc:mga09592_665292_c1_207_485 92
3254 3300050508 nmdc:mga09592_826109_c1 nmdc:mga09592_826109_c1_150_440 92
3255 3300050509 nmdc:mga0qj67_1153049_c1 nmdc:mga0qj67_1153049_c1_108_404 92
3256 3300050509 nmdc:mga0qj67_372201_c1 nmdc:mga0qj67_372201_c1_653_931 92
3257 3300050509 nmdc:mga0qj67_459194_c1 nmdc:mga0qj67_459194_c1_600_893 92
3258 3300050509 nmdc:mga0qj67_917553_c1 nmdc:mga0qj67_917553_c1_16_297 92
3259 3300050510 nmdc:mga06r32_1091907_c1 nmdc:mga06r32_1091907_c1_128_418 92
3260 3300050510 nmdc:mga06r32_1217725_c1 nmdc:mga06r32_1217725_c1_262_561 92
3261 3300050510 nmdc:mga06r32_177040_c1 nmdc:mga06r32_177040_c1_531_809 92
3262 3300050510 nmdc:mga06r32_427456_c1 nmdc:mga06r32_427456_c1_808_1104 92
3263 3300050511 nmdc:mga08y16_1904995_c1 nmdc:mga08y16_1904995_c1_98_376 92
3264 3300050511 nmdc:mga08y16_242021_c1 nmdc:mga08y16_242021_c1_253_546 92
3265 3300050511 nmdc:mga08y16_281575_c1 nmdc:mga08y16_281575_c1_531_809 92
3266 3300050511 nmdc:mga08y16_415274_c1 nmdc:mga08y16_415274_c1_802_1098 92
3267 3300050511 nmdc:mga08y16_573803_c1 nmdc:mga08y16_573803_c1_535_813 92
3268 3300050512 nmdc:mga0n895_1001214_c1 nmdc:mga0n895_1001214_c1_327_620 92
3269 3300050512 nmdc:mga0n895_101015_c1 nmdc:mga0n895_101015_c1_2474_2773 92
3270 3300050512 nmdc:mga0n895_165499_c1 nmdc:mga0n895_165499_c1_487_801 92
3271 3300050512 nmdc:mga0n895_1704615_c1 nmdc:mga0n895_1704615_c1_282_581 92
3272 3300050512 nmdc:mga0n895_368829_c1 nmdc:mga0n895_368829_c1_498_776 92
3273 3300050512 nmdc:mga0n895_5268_c1 nmdc:mga0n895_5268_c1_5000_5278 92
3274 3300050512 nmdc:mga0n895_547994_c1 nmdc:mga0n895_547994_c1_799_1125 92
3275 3300050512 nmdc:mga0n895_717746_c1 nmdc:mga0n895_717746_c1_290_568 92
3276 3300050512 nmdc:mga0n895_757963_c1 nmdc:mga0n895_757963_c1_310_603 92
3277 3300050513 nmdc:mga0rr50_282924_c1 nmdc:mga0rr50_282924_c1_775_1068 92
3278 3300050513 nmdc:mga0rr50_407674_c1 nmdc:mga0rr50_407674_c1_780_1079 92
3279 3300050513 nmdc:mga0rr50_568708_c1 nmdc:mga0rr50_568708_c1_426_704 92
3280 3300050513 nmdc:mga0rr50_902836_c1 nmdc:mga0rr50_902836_c1_353_661 92
3281 3300050513 nmdc:mga0rr50_911004_c1 nmdc:mga0rr50_911004_c1_372_650 92
3282 3300050513 nmdc:mga0rr50_94274_c2 nmdc:mga0rr50_94274_c2_931_1209 92
3283 3300050514 nmdc:mga08x19_1311272_c1 nmdc:mga08x19_1311272_c1_121_399 92
3284 3300050514 nmdc:mga08x19_153004_c1 nmdc:mga08x19_153004_c1_336_614 92
3285 3300050514 nmdc:mga08x19_398054_c1 nmdc:mga08x19_398054_c1_186_485 92
3286 3300050514 nmdc:mga08x19_48189_c1 nmdc:mga08x19_48189_c1_567_911 92
3287 3300050514 nmdc:mga08x19_7083_c1 nmdc:mga08x19_7083_c1_3484_3777 92
3288 3300050515 nmdc:mga0a205_1082957_c1 nmdc:mga0a205_1082957_c1_344_622 92
3289 3300050515 nmdc:mga0a205_79259_c1 nmdc:mga0a205_79259_c1_463_762 92
3290 3300050516 nmdc:mga0sz30_150191_c1 nmdc:mga0sz30_150191_c1_510_788 92
3291 3300050516 nmdc:mga0sz30_206871_c1 nmdc:mga0sz30_206871_c1_261_539 92
3292 3300050516 nmdc:mga0sz30_232876_c1 nmdc:mga0sz30_232876_c1_184_462 92
3293 3300050516 nmdc:mga0sz30_31049_c1 nmdc:mga0sz30_31049_c1_1285_1563 92
3294 3300050516 nmdc:mga0sz30_8120_c1 nmdc:mga0sz30_8120_c1_525_803 92
3295 3300053077 Ga0495601_0000025 Ga0495601_0000025_2995_3291 92
3296 3300053077 Ga0495601_0007996 Ga0495601_0007996_3468_3776 92
3297 3300053077 Ga0495601_0306390 Ga0495601_0306390_166_444 92
3298 3300053077 Ga0495601_0342351 Ga0495601_0342351_423_701 92
3299 3300053077 Ga0495601_0343137 Ga0495601_0343137_158_436 92
3300 3300053077 Ga0495601_0431618 Ga0495601_0431618_253_531 92
3301 3300053077 Ga0495601_0483162 Ga0495601_0483162_362_640 92
3302 3300053077 Ga0495601_0896148 Ga0495601_0896148_258_536 92
3303 3300053078 Ga0495612_0000570 Ga0495612_0000570_10555_10851 92
3304 3300053078 Ga0495612_0027227 Ga0495612_0027227_461_769 92
3305 3300053078 Ga0495612_0039817 Ga0495612_0039817_984_1307 92
3306 3300053078 Ga0495612_0203156 Ga0495612_0203156_112_390 92
3307 3300053078 Ga0495612_0218241 Ga0495612_0218241_87_365 92
3308 3300053080 Ga0500635_0030341 Ga0500635_0030341_845_1123 92
3309 3300053080 Ga0500635_0149087 Ga0500635_0149087_70_348 92
3310 3300053083 Ga0495655_0040933 Ga0495655_0040933_863_1141 92
3311 3300053083 Ga0495655_0056773 Ga0495655_0056773_228_506 92
3312 3300053083 Ga0495655_0090247 Ga0495655_0090247_515_823 92
3313 3300053084 Ga0495595_0000041 Ga0495595_0000041_63560_63856 92
3314 3300053084 Ga0495595_0007610 Ga0495595_0007610_1934_2242 92
3315 3300053084 Ga0495595_0013841 Ga0495595_0013841_2452_2730 92
3316 3300053085 Ga0495619_0000035 Ga0495619_0000035_3017_3313 92
3317 3300053085 Ga0495619_0013467 Ga0495619_0013467_2607_2915 92
3318 3300053085 Ga0495619_0046910 Ga0495619_0046910_806_1084 92
3319 3300053085 Ga0495619_0050264 Ga0495619_0050264_91_369 92
3320 3300053085 Ga0495619_0234203 Ga0495619_0234203_687_965 92
3321 3300053085 Ga0495619_0478835 Ga0495619_0478835_554_832 92
3322 3300053085 Ga0495619_0498010 Ga0495619_0498010_287_583 92
3323 3300053085 Ga0495619_0604370 Ga0495619_0604370_107_391 92
3324 3300053086 Ga0500578_0014351 Ga0500578_0014351_4734_5012 92
3325 3300053086 Ga0500578_0054440 Ga0500578_0054440_473_751 92
3326 3300053086 Ga0500578_0062496 Ga0500578_0062496_1390_1668 92
3327 3300053086 Ga0500578_0260314 Ga0500578_0260314_379_657 92
3328 3300053087 Ga0500643_000227 Ga0500643_000227_40621_40899 92
3329 3300053087 Ga0500643_005061 Ga0500643_005061_2688_2966 92
3330 3300053088 Ga0500644_0096647 Ga0500644_0096647_133_411 92
3331 3300053088 Ga0500644_0201339 Ga0500644_0201339_352_630 92
3332 3300053088 Ga0500644_0404448 Ga0500644_0404448_142_420 92
3333 3300053089 Ga0500581_068452 Ga0500581_068452_1252_1530 92
3334 3300053090 Ga0500646_0003562 Ga0500646_0003562_10_288 92
3335 3300053090 Ga0500646_0020366 Ga0500646_0020366_331_615 92
3336 3300053091 Ga0500647_0143101 Ga0500647_0143101_265_543 92
3337 3300053091 Ga0500647_0205503 Ga0500647_0205503_145_423 92
3338 3300053091 Ga0500647_0238472 Ga0500647_0238472_496_774 92
3339 3300053092 Ga0500583_0602990 Ga0500583_0602990_134_412 92
3340 3300053093 Ga0500651_0042146 Ga0500651_0042146_2305_2583 92
3341 3300053093 Ga0500651_0099631 Ga0500651_0099631_109_387 92
3342 3300053093 Ga0500651_0262139 Ga0500651_0262139_574_852 92
3343 3300053093 Ga0500651_0328062 Ga0500651_0328062_513_791 92
3344 3300053094 Ga0500566_0000320 Ga0500566_0000320_22308_22586 92
3345 3300053094 Ga0500566_0029212 Ga0500566_0029212_2303_2581 92
3346 3300053094 Ga0500566_0044144 Ga0500566_0044144_2015_2293 92
3347 3300053094 Ga0500566_0202696 Ga0500566_0202696_589_867 92
3348 3300053094 Ga0500566_0242370 Ga0500566_0242370_591_869 92
3349 3300053095 Ga0500640_027849 Ga0500640_027849_1818_2096 92
3350 3300053095 Ga0500640_075525 Ga0500640_075525_347_625 92
3351 3300053096 Ga0500641_0005677 Ga0500641_0005677_3370_3648 92
3352 3300053096 Ga0500641_0024074 Ga0500641_0024074_589_867 92
3353 3300053096 Ga0500641_0058080 Ga0500641_0058080_889_1173 92
3354 3300053096 Ga0500641_0090262 Ga0500641_0090262_568_846 92
3355 3300053096 Ga0500641_0234456 Ga0500641_0234456_247_525 92
3356 3300053097 Ga0500648_122882 Ga0500648_122882_463_741 92
3357 3300053098 Ga0500650_0001523 Ga0500650_0001523_3707_3985 92
3358 3300053098 Ga0500650_0112620 Ga0500650_0112620_162_440 92
3359 3300053102 Ga0500554_004588 Ga0500554_004588_1446_1724 92
3360 3300053102 Ga0500554_043912 Ga0500554_043912_145_423 92
3361 3300053103 Ga0500555_003043 Ga0500555_003043_3363_3641 92
3362 3300053103 Ga0500555_036825 Ga0500555_036825_369_647 92
3363 3300053103 Ga0500555_057125 Ga0500555_057125_248_526 92
3364 3300053104 Ga0500556_0000009 Ga0500556_0000009_150094_150372 92
3365 3300053104 Ga0500556_0000125 Ga0500556_0000125_62324_62602 92
3366 3300053104 Ga0500556_0079758 Ga0500556_0079758_208_486 92
3367 3300053105 Ga0500557_000010 Ga0500557_000010_49204_49482 92
3368 3300053105 Ga0500557_065135 Ga0500557_065135_674_952 92
3369 3300053106 Ga0500558_190664 Ga0500558_190664_123_401 92
3370 3300053108 Ga0500562_006758 Ga0500562_006758_2022_2300 92
3371 3300053108 Ga0500562_007137 Ga0500562_007137_1753_2031 92
3372 3300053108 Ga0500562_045912 Ga0500562_045912_245_523 92
3373 3300053108 Ga0500562_061571 Ga0500562_061571_461_739 92
3374 3300053109 Ga0500569_002394 Ga0500569_002394_2036_2314 92
3375 3300053109 Ga0500569_010361 Ga0500569_010361_1508_1786 92
3376 3300053109 Ga0500569_053506 Ga0500569_053506_790_1068 92
3377 3300053109 Ga0500569_140358 Ga0500569_140358_503_781 92
3378 3300053111 Ga0500572_001453 Ga0500572_001453_5295_5573 92
3379 3300053111 Ga0500572_001638 Ga0500572_001638_4343_4621 92
3380 3300053111 Ga0500572_052634 Ga0500572_052634_138_416 92
3381 3300053111 Ga0500572_304475 Ga0500572_304475_124_402 92
3382 3300053112 Ga0500575_191365 Ga0500575_191365_76_354 92
3383 3300053114 Ga0500582_029556 Ga0500582_029556_760_1038 92
3384 3300053116 Ga0500592_000871 Ga0500592_000871_4416_4694 92
3385 3300053116 Ga0500592_021007 Ga0500592_021007_226_504 92
3386 3300053116 Ga0500592_028982 Ga0500592_028982_250_528 92
3387 3300053116 Ga0500592_038372 Ga0500592_038372_232_510 92
3388 3300053117 Ga0500593_011975 Ga0500593_011975_917_1195 92
3389 3300053118 Ga0500594_0038620 Ga0500594_0038620_726_1004 92
3390 3300053118 Ga0500594_0046677 Ga0500594_0046677_758_1042 92
3391 3300053118 Ga0500594_0077290 Ga0500594_0077290_123_401 92
3392 3300053118 Ga0500594_0116228 Ga0500594_0116228_306_584 92
3393 3300053119 Ga0500595_004583 Ga0500595_004583_1197_1475 92
3394 3300053119 Ga0500595_010713 Ga0500595_010713_304_582 92
3395 3300053119 Ga0500595_010727 Ga0500595_010727_2725_3003 92
3396 3300053119 Ga0500595_011143 Ga0500595_011143_1405_1683 92
3397 3300053119 Ga0500595_055935 Ga0500595_055935_860_1138 92
3398 3300053120 Ga0500597_254653 Ga0500597_254653_209_487 92
3399 3300053120 Ga0500597_297763 Ga0500597_297763_53_331 92
3400 3300053121 Ga0500607_011275 Ga0500607_011275_4276_4554 92
3401 3300053121 Ga0500607_034976 Ga0500607_034976_1531_1809 92
3402 3300053122 Ga0500608_021937 Ga0500608_021937_788_1066 92
3403 3300053122 Ga0500608_029012 Ga0500608_029012_101_379 92
3404 3300053122 Ga0500608_041660 Ga0500608_041660_547_825 92
3405 3300053122 Ga0500608_229307 Ga0500608_229307_77_355 92
3406 3300053123 Ga0500614_009172 Ga0500614_009172_782_1060 92
3407 3300053123 Ga0500614_088289 Ga0500614_088289_252_530 92
3408 3300053125 Ga0500618_014829 Ga0500618_014829_1223_1501 92
3409 3300053125 Ga0500618_023464 Ga0500618_023464_1059_1337 92
3410 3300053125 Ga0500618_165787 Ga0500618_165787_193_471 92
3411 3300053126 Ga0500621_068784 Ga0500621_068784_708_986 92
3412 3300053129 Ga0500628_016346 Ga0500628_016346_507_785 92
3413 3300053130 Ga0500642_0000105 Ga0500642_0000105_3208_3486 92
3414 3300053130 Ga0500642_0018711 Ga0500642_0018711_136_414 92
3415 3300053130 Ga0500642_0146892 Ga0500642_0146892_368_646 92
3416 3300053131 Ga0500652_000301 Ga0500652_000301_15970_16248 92
3417 3300053131 Ga0500652_021628 Ga0500652_021628_2011_2289 92
3418 3300053131 Ga0500652_270005 Ga0500652_270005_163_441 92
3419 3300053133 Ga0500655_039263 Ga0500655_039263_632_910 92
3420 3300053133 Ga0500655_079613 Ga0500655_079613_263_541 92
3421 3300053133 Ga0500655_094223 Ga0500655_094223_91_375 92
3422 3300053133 Ga0500655_113215 Ga0500655_113215_276_554 92
3423 3300053134 Ga0500658_0011008 Ga0500658_0011008_1908_2186 92
3424 3300053134 Ga0500658_0333757 Ga0500658_0333757_20_298 92
3425 3300053134 Ga0500658_0449903 Ga0500658_0449903_67_345 92
3426 3300053136 Ga0500559_0007811 Ga0500559_0007811_2236_2514 92
3427 3300053136 Ga0500559_0012275 Ga0500559_0012275_1836_2114 92
3428 3300053136 Ga0500559_0012587 Ga0500559_0012587_3091_3369 92
3429 3300053136 Ga0500559_0114558 Ga0500559_0114558_109_387 92
3430 3300053136 Ga0500559_0149263 Ga0500559_0149263_614_892 92
3431 3300053136 Ga0500559_0445867 Ga0500559_0445867_204_503 92
3432 3300053137 Ga0500561_0088962 Ga0500561_0088962_202_480 92
3433 3300053138 Ga0500564_180087 Ga0500564_180087_109_387 92
3434 3300053138 Ga0500564_346886 Ga0500564_346886_162_440 92
3435 3300053139 Ga0500568_0014095 Ga0500568_0014095_3052_3330 92
3436 3300053139 Ga0500568_0016366 Ga0500568_0016366_490_768 92
3437 3300053139 Ga0500568_0020361 Ga0500568_0020361_2544_2822 92
3438 3300053139 Ga0500568_0030394 Ga0500568_0030394_101_379 92
3439 3300053139 Ga0500568_0106673 Ga0500568_0106673_130_408 92
3440 3300053139 Ga0500568_0353291 Ga0500568_0353291_103_381 92
3441 3300053140 Ga0500573_0006745 Ga0500573_0006745_2409_2687 92
3442 3300053140 Ga0500573_0506862 Ga0500573_0506862_51_329 92
3443 3300053142 Ga0500577_0065958 Ga0500577_0065958_923_1201 92
3444 3300053142 Ga0500577_0311587 Ga0500577_0311587_342_620 92
3445 3300053146 Ga0500588_0041863 Ga0500588_0041863_443_721 92
3446 3300053146 Ga0500588_0091727 Ga0500588_0091727_350_628 92
3447 3300053146 Ga0500588_0121520 Ga0500588_0121520_51_329 92
3448 3300053147 Ga0500589_160690 Ga0500589_160690_416_694 92
3449 3300053147 Ga0500589_226030 Ga0500589_226030_233_511 92
3450 3300053148 Ga0500590_026032 Ga0500590_026032_1508_1786 92
3451 3300053148 Ga0500590_082940 Ga0500590_082940_299_577 92
3452 3300053148 Ga0500590_275814 Ga0500590_275814_233_511 92
3453 3300053148 Ga0500590_357666 Ga0500590_357666_91_369 92
3454 3300053150 Ga0500603_020271 Ga0500603_020271_423_701 92
3455 3300053150 Ga0500603_027776 Ga0500603_027776_763_1041 92
3456 3300053150 Ga0500603_157674 Ga0500603_157674_36_314 92
3457 3300053151 Ga0500604_0035951 Ga0500604_0035951_621_899 92
3458 3300053151 Ga0500604_0084926 Ga0500604_0084926_16_294 92
3459 3300053151 Ga0500604_0101363 Ga0500604_0101363_642_920 92
3460 3300053153 Ga0500616_0000085 Ga0500616_0000085_133142_133420 92
3461 3300053153 Ga0500616_0000876 Ga0500616_0000876_29682_29960 92
3462 3300053153 Ga0500616_0040138 Ga0500616_0040138_1994_2272 92
3463 3300053153 Ga0500616_0122243 Ga0500616_0122243_200_478 92
3464 3300053153 Ga0500616_0143044 Ga0500616_0143044_226_504 92
3465 3300053154 Ga0500619_000847 Ga0500619_000847_172_450 92
3466 3300053154 Ga0500619_167085 Ga0500619_167085_264_542 92
3467 3300053155 Ga0500620_011214 Ga0500620_011214_1770_2048 92
3468 3300053156 Ga0500622_0008990 Ga0500622_0008990_3166_3444 92
3469 3300053156 Ga0500622_0013118 Ga0500622_0013118_1114_1392 92
3470 3300053156 Ga0500622_0043813 Ga0500622_0043813_1769_2047 92
3471 3300053156 Ga0500622_0058795 Ga0500622_0058795_315_593 92
3472 3300053157 Ga0500624_002337 Ga0500624_002337_2118_2396 92
3473 3300053157 Ga0500624_006673 Ga0500624_006673_742_1020 92
3474 3300053158 Ga0500627_0025499 Ga0500627_0025499_671_949 92
3475 3300053158 Ga0500627_0058137 Ga0500627_0058137_804_1082 92
3476 3300053158 Ga0500627_0073662 Ga0500627_0073662_494_772 92
3477 3300053158 Ga0500627_0140738 Ga0500627_0140738_107_385 92
3478 3300053158 Ga0500627_0187133 Ga0500627_0187133_607_885 92
3479 3300053159 Ga0500630_005936 Ga0500630_005936_2704_2982 92
3480 3300053160 Ga0500633_0036552 Ga0500633_0036552_695_973 92
3481 3300053160 Ga0500633_0213349 Ga0500633_0213349_186_464 92
3482 3300053161 Ga0500634_0037272 Ga0500634_0037272_650_928 92
3483 3300053161 Ga0500634_0061123 Ga0500634_0061123_342_620 92
3484 3300053162 Ga0500638_002268 Ga0500638_002268_42_320 92
3485 3300053162 Ga0500638_006089 Ga0500638_006089_615_893 92
3486 3300053162 Ga0500638_035746 Ga0500638_035746_242_520 92
3487 3300053162 Ga0500638_085232 Ga0500638_085232_973_1251 92
3488 3300053162 Ga0500638_216873 Ga0500638_216873_257_535 92
3489 3300053162 Ga0500638_358982 Ga0500638_358982_169_447 92
3490 3300053163 Ga0500639_019780 Ga0500639_019780_1814_2092 92
3491 3300053163 Ga0500639_044490 Ga0500639_044490_1623_1901 92
3492 3300053163 Ga0500639_292047 Ga0500639_292047_59_358 92
3493 3300053163 Ga0500639_305092 Ga0500639_305092_274_552 92
3494 3300053163 Ga0500639_355156 Ga0500639_355156_139_417 92
3495 3300053177 Ga0500636_0004057 Ga0500636_0004057_2436_2714 92
3496 3300053177 Ga0500636_0009188 Ga0500636_0009188_2285_2563 92
3497 3300053177 Ga0500636_0026822 Ga0500636_0026822_906_1184 92
3498 3300053177 Ga0500636_0032601 Ga0500636_0032601_431_709 92
3499 3300053177 Ga0500636_0067281 Ga0500636_0067281_564_842 92
3500 3300053177 Ga0500636_0145554 Ga0500636_0145554_263_541 92
3501 3300053177 Ga0500636_0354065 Ga0500636_0354065_375_653 92
3502 3300053178 Ga0500637_0003070 Ga0500637_0003070_4627_4905 92
3503 3300053178 Ga0500637_0047889 Ga0500637_0047889_829_1107 92
3504 3300053178 Ga0500637_0072771 Ga0500637_0072771_28_306 92
3505 3300053178 Ga0500637_0179856 Ga0500637_0179856_582_860 92
3506 3300053178 Ga0500637_0311374 Ga0500637_0311374_544_822 92
3507 3300053178 Ga0500637_0390021 Ga0500637_0390021_300_578 92
3508 3300053178 Ga0500637_0460034 Ga0500637_0460034_343_621 92
3509 3300053178 Ga0500637_0531628 Ga0500637_0531628_79_357 92
3510 3300053722 Ga0500649_180910 Ga0500649_180910_31_309 92
3511 3300053723 Ga0500567_156281 Ga0500567_156281_313_591 92
3512 3300053724 Ga0500570_089018 Ga0500570_089018_129_407 92
3513 3300053724 Ga0500570_133573 Ga0500570_133573_616_894 92
3514 3300053725 Ga0500576_079040 Ga0500576_079040_177_455 92
3515 3300053727 Ga0500611_008586 Ga0500611_008586_1255_1533 92
3516 3300053727 Ga0500611_069717 Ga0500611_069717_437_715 92
3517 3300053728 Ga0500657_111843 Ga0500657_111843_109_387 92
3518 3300053729 Ga0500625_027837 Ga0500625_027837_678_956 92
3519 3300053730 Ga0500645_014096 Ga0500645_014096_604_882 92
3520 3300053730 Ga0500645_020851 Ga0500645_020851_1082_1360 92
3521 3300053730 Ga0500645_030396 Ga0500645_030396_382_660 92
3522 3300053730 Ga0500645_052369 Ga0500645_052369_566_844 92
3523 3300053730 Ga0500645_123309 Ga0500645_123309_340_618 92
3524 3300053731 Ga0500609_003899 Ga0500609_003899_721_999 92
3525 3300053731 Ga0500609_016418 Ga0500609_016418_699_977 92
3526 3300053731 Ga0500609_020249 Ga0500609_020249_598_876 92
3527 3300053735 Ga0500596_003892 Ga0500596_003892_2294_2572 92
3528 3300053735 Ga0500596_003981 Ga0500596_003981_2021_2299 92
3529 3300053735 Ga0500596_104318 Ga0500596_104318_141_419 92
3530 3300053736 Ga0500599_001304 Ga0500599_001304_2226_2504 92
3531 3300053737 Ga0500601_001031 Ga0500601_001031_2791_3069 92
3532 3300053739 Ga0500587_013184 Ga0500587_013184_248_526 92
3533 3300054114 Ga0501084_0028118 Ga0501084_0028118_1321_1599 92
3534 3300054114 Ga0501084_0050020 Ga0501084_0050020_1213_1497 92
3535 3300054114 Ga0501084_0069776 Ga0501084_0069776_1874_2155 92
3536 3300054114 Ga0501084_0102026 Ga0501084_0102026_843_1154 92
3537 3300054114 Ga0501084_0767365 Ga0501084_0767365_196_474 92
3538 3300054114 Ga0501084_0869908 Ga0501084_0869908_266_544 92
3539 3300054114 Ga0501084_1242070 Ga0501084_1242070_24_335 92
3540 3300054114 Ga0501084_1468455 Ga0501084_1468455_227_505 92
3541 3300055283 Ga0500661_017926 Ga0500661_017926_216_494 92
3542 3300055283 Ga0500661_064297 Ga0500661_064297_145_423 92
3543 3300059426 Ga0590077_115422 Ga0590077_115422_191_469 92
3544 3300059477 Ga0587084_085673 Ga0587084_085673_283_561 92
3545 3300059491 Ga0587070_127406 Ga0587070_127406_237_515 92
3546 3300059491 Ga0587070_156424 Ga0587070_156424_275_553 92
3547 3300059492 Ga0587073_0016358 Ga0587073_0016358_90_368 92
3548 3300059504 Ga0587082_008563 Ga0587082_008563_156_434 92
3549 3300059506 Ga0587085_081449 Ga0587085_081449_223_501 92
3550 3300059512 Ga0587092_049935 Ga0587092_049935_22_300 92
3551 3300059513 Ga0587094_090574 Ga0587094_090574_211_489 92
3552 3300059639 Ga0587062_024677 Ga0587062_024677_54_332 92
3553 3300059641 Ga0587068_043248 Ga0587068_043248_414_692 92
3554 3300059644 Ga0587075_099003 Ga0587075_099003_187_465 92
3555 3300059645 Ga0587076_040353 Ga0587076_040353_524_802 92
3556 3300059646 Ga0587078_007001 Ga0587078_007001_165_443 92
3557 3300060353 Ga0501082_0004728 Ga0501082_0004728_4475_4753 92
3558 3300060353 Ga0501082_0092039 Ga0501082_0092039_80_418 92
3559 3300060353 Ga0501082_0306296 Ga0501082_0306296_516_827 92
3560 3300060353 Ga0501082_0414097 Ga0501082_0414097_845_1147 92
3561 3300060353 Ga0501082_0803333 Ga0501082_0803333_417_695 92
3562 3300060353 Ga0501082_1226205 Ga0501082_1226205_150_428 92
3563 3300060353 Ga0501082_1323297 Ga0501082_1323297_70_369 92
3564 3300060353 Ga0501082_1524551 Ga0501082_1524551_177_500 92
3565 3300061719 Ga0466962_0050095 Ga0466962_0050095_1171_1455 92
3566 3300061719 Ga0466962_0107928 Ga0466962_0107928_411_689 92
3567 3300061719 Ga0466962_0150953 Ga0466962_0150953_573_851 92
3568 3300061719 Ga0466962_0291766 Ga0466962_0291766_410_688 92
3569 3300061719 Ga0466962_0442991 Ga0466962_0442991_198_476 92
3570 3300061719 Ga0466962_0566020 Ga0466962_0566020_20_298 92
3571 3300061734 Ga0530510_0020675 Ga0530510_0020675_1036_1374 92
3572 3300061734 Ga0530510_0023207 Ga0530510_0023207_2781_3065 92
3573 3300061734 Ga0530510_0136000 Ga0530510_0136000_95_391 92
3574 3300061734 Ga0530510_1260375 Ga0530510_1260375_272_550 92

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00203

Ribosomal_S19

Ribosomal protein S19

3

83

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
8a98-assembly1.cif.gz_SW cryo-em structure of leishmania major 80s ribosome : snorna mutant 0.9431 12 78
8a3w-assembly1.cif.gz_SW cryo-em structure of leishmania major 80s ribosome : wild type 0.9362 12 78
6zmw-assembly1.cif.gz_b structure of a human 48s translational initiation complex 0.934 14 78
6zu5-assembly1.cif.gz_SP0 structure of the paranosema locustae ribosome in complex with lso2 0.9298 14 79
8c01-assembly1.cif.gz_E enp1tap_a population of yeast small ribosomal subunit precursors 0.9219 14 79
ID Description Score Start End Superfamily
af_A0A1D8PTL2_10_91_3.30.860.10 Alpha Beta;2-Layer Sandwich;30s Ribosomal Protein S19; Chain A;Ribosomal protein S19/S15 0.9085 3 78 3.30.860.10
4kj2S00 Alpha Beta;2-Layer Sandwich;30s Ribosomal Protein S19; Chain A;Ribosomal protein S19/S15 0.903 3 80 3.30.860.10
af_D3ZAK6_2_123_3.30.860.10 Alpha Beta;2-Layer Sandwich;30s Ribosomal Protein S19; Chain A;Ribosomal protein S19/S15 0.9024 14 78 3.30.860.10
2qbbS00 Alpha Beta;2-Layer Sandwich;30s Ribosomal Protein S19; Chain A;Ribosomal protein S19/S15 0.8948 3 80 3.30.860.10
af_A0A0R0GRI6_17_112_3.30.860.10 Alpha Beta;2-Layer Sandwich;30s Ribosomal Protein S19; Chain A;Ribosomal protein S19/S15 0.8864 14 83 3.30.860.10
ID Description Score Start End GO Terms
AF-A0A3C0AXH2-F1-model_v4 Small ribosomal subunit protein uS19 (30S ribosomal protein S19) 0.9178 1 76 GO:0000028
GO:0003735
GO:0005737
GO:0006412
GO:0015935
GO:0019843
AF-A0A838SIB2-F1-model_v4 Small ribosomal subunit protein uS19 (30S ribosomal protein S19) 0.9107 1 78 GO:0000028
GO:0003735
GO:0005737
GO:0006412
GO:0015935
GO:0019843
AF-A0A3C0AXH2-F1-model_v4 Small ribosomal subunit protein uS19 (30S ribosomal protein S19) 0.9064 1 76 GO:0000028
GO:0003735
GO:0005737
GO:0006412
GO:0015935
GO:0019843
AF-A0A259NR66-F1-model_v4 Small ribosomal subunit protein uS19 0.8999 1 83 GO:0000028
GO:0003735
GO:0005737
GO:0006412
GO:0015935
GO:0019843
AF-A0A838SIB2-F1-model_v4 Small ribosomal subunit protein uS19 (30S ribosomal protein S19) 0.8998 1 78 GO:0000028
GO:0003735
GO:0005737
GO:0006412
GO:0015935
GO:0019843

Feature Viewer

pLDDT pTM Quality
79.49 0.65 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map