F497345

General Info

Members Datasets Scaffolds Average Seq Length
3575 1392 7150 234

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0073950|Ga0395899_0073950_1569_2369
Length 266
Sequence MDIAGTGAIQQSDEPVTHRQGPPAGHGATHQASSATDSLPRAAGWRGIVADVSSDQRLFKDVPWGKPMMWIFLLSDTFIFGSFLISYMTVRTSTTVPWPNPSEVFALDLFGQSVPLLLIAIMTFILISSSGTMALAVNFGYRRDRRTTFWLLCATAALGATFVGMQAFEWTKLILEGVRPWGNPWGAVQFGSSFFMITGFHGTHVTIGVIFLLIVATKVRRGDLDRQRPGFLTGRRGNYEIVEILGLYWHFVDLVWVFIFAFFYLW

Samples

Sample ID Description Type Environment
1 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
7 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
8 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
9 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
10 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
11 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
12 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
13 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
14 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
15 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
16 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
17 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
18 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
19 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
20 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
21 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
22 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
23 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
24 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
25 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
26 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
27 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
28 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
29 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
30 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
31 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
32 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
33 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
34 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
35 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
36 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
37 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
38 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
39 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
40 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
41 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
42 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
43 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
44 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
45 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
46 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
47 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
48 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
49 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
50 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
51 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
52 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
53 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
54 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
55 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
56 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
57 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
58 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
59 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
60 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
61 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
62 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
63 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
64 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
65 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
66 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
67 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
68 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
69 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
70 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
71 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
72 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
73 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
74 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
75 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
76 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
77 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
78 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
79 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
80 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
81 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
82 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
83 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
84 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
85 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
86 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
87 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
88 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
89 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
90 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
91 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
92 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
93 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
94 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
95 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
96 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
97 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
98 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
99 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
100 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
101 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
102 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
103 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
104 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
105 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
106 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
107 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
108 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
109 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
110 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
111 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
112 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
113 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
114 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
115 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
116 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
117 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
118 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
119 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
120 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
121 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
122 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
123 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
124 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
125 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
126 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
127 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
128 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
129 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
130 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
131 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
132 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
133 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
134 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
135 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
136 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
137 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
138 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
139 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
140 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
141 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
142 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
143 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
144 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
145 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
146 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
147 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
148 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
149 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
150 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
151 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
152 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
153 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
154 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
155 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
156 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
157 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
158 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
159 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
160 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
161 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
162 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
163 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
164 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
165 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
166 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
167 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
168 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
169 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
170 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
171 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
172 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
173 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
174 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
175 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
176 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
177 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
178 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
179 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
180 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
181 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
182 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
183 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
184 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
185 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
186 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
187 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
188 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
189 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
190 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
191 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
192 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
193 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
194 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
195 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
196 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
197 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
198 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
199 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
200 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
201 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
202 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
203 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
204 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
205 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
206 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
207 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
208 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
209 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
210 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
211 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
212 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
213 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
214 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
215 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
216 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
217 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
218 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
219 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
220 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
221 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
222 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
223 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
224 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
225 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
226 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
227 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
228 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
229 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
230 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
231 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
232 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
233 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
234 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
235 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
236 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
237 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
238 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
239 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
240 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
241 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
242 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
243 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
244 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
245 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
246 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
247 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
248 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
306 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
307 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
308 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
311 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
312 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
313 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
314 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
315 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
316 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
318 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
319 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
320 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
321 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
322 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
323 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
324 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
325 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
326 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
327 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
328 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
329 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
330 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
331 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
332 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
333 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
334 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
335 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
336 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
337 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
338 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
339 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
341 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
342 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
343 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
344 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
345 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
346 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
347 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
348 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
349 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
350 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
351 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
352 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
353 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
354 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
355 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
356 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
357 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
358 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
359 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
360 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
361 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
362 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
363 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
364 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
365 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
366 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
367 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
368 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
369 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
370 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
371 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
372 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
373 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
374 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
375 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
376 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
377 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
378 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
379 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
380 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
381 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
382 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
383 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
384 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
385 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
386 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
387 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
388 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
389 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
390 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
391 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
392 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
393 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
394 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
395 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
396 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
397 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
398 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
399 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
400 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
401 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
402 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
403 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
404 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
405 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
406 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
407 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
408 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
409 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
410 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
411 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
412 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
413 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
414 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
415 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
416 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
417 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
418 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
419 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
420 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
421 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
422 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
423 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
424 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
425 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
426 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
427 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
428 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
429 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
430 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
431 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
432 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
433 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
434 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
435 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
436 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
437 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
438 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
439 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
440 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
441 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
442 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
443 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
444 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
445 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
446 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
447 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
448 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
449 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
450 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
451 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
452 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
453 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
454 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
455 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
456 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
457 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
458 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
459 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
460 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
461 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
462 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
463 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
464 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
465 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
466 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
467 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
468 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
469 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
470 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
471 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
472 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
473 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
474 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
475 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
476 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
477 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
478 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
479 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
480 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
481 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
482 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
483 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
484 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
485 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
486 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
487 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
488 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
489 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
490 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
491 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
492 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
493 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
494 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
495 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
496 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
497 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
498 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
499 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
500 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
501 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
502 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
503 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
504 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
505 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
506 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
507 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
508 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
509 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
510 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
511 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
512 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
513 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
514 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
515 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
516 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
517 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
518 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
519 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
520 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
521 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
522 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
523 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
524 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
525 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
526 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
527 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
528 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
529 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
530 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
531 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
532 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
533 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
534 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
535 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
536 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
537 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
538 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
539 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
540 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
541 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
542 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
543 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
544 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
545 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
546 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
547 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
548 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
549 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
550 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
551 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
552 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
553 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
554 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
555 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
556 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
557 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
558 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
559 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
560 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
561 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
562 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
563 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
564 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
565 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
566 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
567 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
568 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
569 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
570 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
571 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
572 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
573 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
574 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
575 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
576 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
577 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
578 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
579 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
580 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
581 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
582 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
583 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
584 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
585 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
586 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
587 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
588 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
589 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
590 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
591 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
592 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
593 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
594 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
595 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
596 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
597 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
598 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
599 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
600 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
601 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
602 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
603 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
604 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
605 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
606 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
607 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
608 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
609 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
610 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
611 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
612 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
613 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
614 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
615 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
616 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
617 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
618 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
619 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
620 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
621 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
622 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
623 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
624 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
625 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
626 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
627 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
628 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
629 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
630 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
631 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
632 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
633 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
634 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
635 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
636 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
637 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
638 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
639 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
640 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
641 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
642 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
643 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
644 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
645 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
646 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
647 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
648 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
649 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
650 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
651 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
652 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
653 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
654 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
655 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
656 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
657 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
658 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
659 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
660 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
661 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
662 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
663 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
664 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
665 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
666 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
667 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
668 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
669 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
670 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
671 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
672 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
673 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
674 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
675 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
676 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
677 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
678 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
679 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
680 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
681 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
682 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
683 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
684 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
685 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
686 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
687 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
688 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
689 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
690 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
691 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
692 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
693 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
694 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
695 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
696 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
697 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
698 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
699 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
700 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
701 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
702 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
703 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
704 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
705 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
706 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
707 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
708 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
709 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
710 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
711 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
712 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
713 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
714 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
715 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
716 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
717 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
718 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
719 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
720 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
721 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
722 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
723 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
724 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
725 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
726 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
727 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
728 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
729 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
730 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
731 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
732 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
733 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
734 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
735 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
736 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
737 2508501050 Microvirga lupini Lut6 Isolate Nodule
738 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
739 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
740 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
741 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
742 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
743 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
744 2511231004 Pseudomonas sp. GM102 Isolate Nodule
745 2511231006 Pseudomonas sp. GM17 Isolate Nodule
746 2511231007 Pseudomonas sp. GM18 Isolate Nodule
747 2511231008 Pseudomonas sp. GM21 Isolate Nodule
748 2511231012 Pseudomonas sp. GM33 Isolate Nodule
749 2511231014 Pseudomonas sp. GM48 Isolate Nodule
750 2511231015 Pseudomonas sp. GM49 Isolate Nodule
751 2511231016 Pseudomonas sp. GM50 Isolate Nodule
752 2511231017 Pseudomonas sp. GM55 Isolate Nodule
753 2511231018 Pseudomonas sp. GM60 Isolate Nodule
754 2511231019 Pseudomonas sp. GM67 Isolate Nodule
755 2511231020 Pseudomonas sp. GM74 Isolate Nodule
756 2511231021 Pseudomonas sp. GM78 Isolate Nodule
757 2511231022 Pseudomonas sp. GM79 Isolate Nodule
758 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
759 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
760 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
761 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
762 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
763 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
764 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
765 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
766 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
767 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
768 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
769 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
770 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
771 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
772 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
773 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
774 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
775 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
776 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
777 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
778 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
779 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
780 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
781 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
782 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
783 2516143018 Ensifer sp. BR816 Isolate Nodule
784 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
785 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
786 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
787 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
788 2519899620 Rhizobium sp. Pop5 Isolate Nodule
789 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
790 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
791 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
792 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
793 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
794 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
795 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
796 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
797 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
798 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
799 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
800 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
801 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
802 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
803 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
804 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
805 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
806 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
807 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
808 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
809 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
810 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
811 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
812 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
813 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
814 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
815 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
816 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
817 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
818 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
819 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
820 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
821 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
822 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
823 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
824 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
825 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
826 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
827 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
828 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
829 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
830 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
831 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
832 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
833 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
834 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
835 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
836 2643221557 Ensifer sp. Root558 Isolate Unclassified
837 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
838 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
839 2643221607 Rhizobium sp. Root73 Isolate Unclassified
840 2643221610 Ensifer sp. Root74 Isolate Unclassified
841 2643221618 Ensifer sp. Root231 Isolate Unclassified
842 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
843 2643221626 Ensifer sp. Root31 Isolate Unclassified
844 2643221629 Devosia sp. Root105 Isolate Unclassified
845 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
846 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
847 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
848 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
849 2643221638 Duganella sp. Root336D2 Isolate Unclassified
850 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
851 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
852 2643221645 Massilia sp. Root351 Isolate Unclassified
853 2643221655 Ensifer sp. Root1252 Isolate Unclassified
854 2643221659 Ensifer sp. Root127 Isolate Unclassified
855 2643221662 Devosia sp. Root413D1 Isolate Unclassified
856 2643221668 Ensifer sp. Root423 Isolate Unclassified
857 2643221675 Ensifer sp. Root1298 Isolate Unclassified
858 2643221680 Ensifer sp. Root1312 Isolate Unclassified
859 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
860 2643221698 Ensifer sp. Root142 Isolate Unclassified
861 2643221712 Ensifer sp. Root258 Isolate Unclassified
862 2643221718 Rhizobium sp. Root268 Isolate Unclassified
863 2643221723 Ensifer sp. Root278 Isolate Unclassified
864 2643221726 Ensifer sp. Root954 Isolate Unclassified
865 2643221733 Bosea sp. Root381 Isolate Unclassified
866 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
867 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
868 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
869 2718217882 Rhizobium sp. N741 Isolate Nodule
870 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
871 2718218009 Rhizobium sp. N561 Isolate Nodule
872 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
873 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
874 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
875 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
876 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
877 2718218363 Rhizobium sp. N113 Isolate Nodule
878 2718218365 Rhizobium sp. N731 Isolate Nodule
879 2718218366 Rhizobium sp. N621 Isolate Nodule
880 2721755514 Rhizobium sp. N6212 Isolate Nodule
881 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
882 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
883 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
884 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
885 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
886 2721755810 Rhizobium sp. N871 Isolate Nodule
887 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
888 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
889 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
890 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
891 2728369365 Rhizobium sp. N1341 Isolate Nodule
892 2728369397 Rhizobium sp. N1314 Isolate Nodule
893 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
894 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
895 2738543024 Aminobacter sp. AP02 Isolate Unclassified
896 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
897 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
898 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
899 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
900 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
901 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
902 2773857925 Microvirga vignae BR3299 Isolate Unclassified
903 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
904 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
905 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
906 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
907 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
908 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
909 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
910 2791355199
911 2791355260 Rhizobium sp. L9 Isolate Nodule
912 2791355261 Rhizobium sp. J15 Isolate Nodule
913 2791355263 Rhizobium chutanense C5 Isolate Nodule
914 2791355264 Rhizobium sp. S9 Isolate Nodule
915 2791355267 Rhizobium sp. L18 Isolate Nodule
916 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
917 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
918 2818991436 Collimonas arenae 515 Isolate Unclassified
919 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
920 2818991452 Burkholderia cepacia 561 Isolate Unclassified
921 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
922 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
923 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
924 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
925 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
926 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
927 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
928 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
929 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
930 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
931 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
932 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
933 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
934 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
935 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
936 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
937 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
938 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
939 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
940 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
941 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
942 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
943 2838048938 Rhizobium pisi 27/80 Isolate Nodule
944 2838061910 Rhizobium phaseoli L15 Isolate Nodule
945 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
946 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
947 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
948 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
949 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
950 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
951 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
952 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
953 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
954 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
955 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
956 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
957 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
958 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
959 2841760612 Bosea sp. Tri-49 Isolate Nodule
960 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
961 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
962 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
963 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
964 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
965 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
966 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
967 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
968 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
969 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
970 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
971 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
972 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
973 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
974 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
975 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
976 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
977 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
978 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
979 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
980 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
981 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
982 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
983 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
984 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
985 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
986 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
987 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
988 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
989 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
990 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
991 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
992 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
993 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
994 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
995 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
996 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
997 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
998 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
999 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
1000 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
1001 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
1002 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
1003 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
1004 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
1005 2842711865 Duganella sp. R-73148 Isolate Unclassified
1006 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
1007 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
1008 2844104063 Bosea sp. Tri-39 Isolate Nodule
1009 2844163670 Ensifer sp. 1H6 Isolate Unclassified
1010 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
1011 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
1012 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
1013 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
1014 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
1015 2851182111 Bosea sp. Tri-44 Isolate Nodule
1016 2851246043 Bosea sp. Tri-54 Isolate Nodule
1017 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
1018 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
1019 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
1020 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
1021 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
1022 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
1023 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
1024 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
1025 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
1026 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
1027 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
1028 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
1029 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
1030 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
1031 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
1032 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
1033 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
1034 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
1035 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
1036 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
1037 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
1038 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
1039 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
1040 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
1041 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
1042 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
1043 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
1044 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
1045 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
1046 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
1047 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
1048 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
1049 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
1050 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
1051 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
1052 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
1053 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
1054 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
1055 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
1056 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
1057 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
1058 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
1059 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
1060 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
1061 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
1062 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
1063 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
1064 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
1065 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
1066 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
1067 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
1068 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
1069 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
1070 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
1071 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
1072 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
1073 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
1074 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
1075 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
1076 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
1077 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
1078 2885266251 Ralstonia sp. SET104 Isolate Nodule
1079 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
1080 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
1081 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
1082 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
1083 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
1084 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
1085 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
1086 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
1087 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
1088 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
1089 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
1090 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
1091 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
1092 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
1093 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
1094 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
1095 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
1096 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
1097 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
1098 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
1099 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
1100 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
1101 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
1102 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
1103 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
1104 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
1105 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
1106 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
1107 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
1108 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
1109 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
1110 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
1111 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
1112 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
1113 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
1114 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
1115 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
1116 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
1117 2904699407
1118 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
1119 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
1120 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
1121 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
1122 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
1123 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
1124 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
1125 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
1126 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
1127 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
1128 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
1129 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
1130 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
1131 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
1132 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
1133 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
1134 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
1135 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
1136 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
1137 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
1138 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
1139 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
1140 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
1141 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
1142 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
1143 2922368715
1144 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
1145 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
1146 2922425934
1147 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
1148 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
1149 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
1150 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
1151 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
1152 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
1153 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
1154 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
1155 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
1156 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
1157 2928163908 Burkholderia sp. 567 Isolate Unclassified
1158 2928170801 Burkholderia sp. 572 Isolate Unclassified
1159 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
1160 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
1161 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
1162 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
1163 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
1164 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
1165 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
1166 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
1167 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
1168 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
1169 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
1170 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
1171 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
1172 2933599457 Rhizobium phaseoli M3 Isolate Nodule
1173 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
1174 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
1175 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
1176 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
1177 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
1178 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
1179 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
1180 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
1181 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
1182 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
1183 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
1184 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
1185 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
1186 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
1187 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
1188 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
1189 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
1190 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
1191 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
1192 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
1193 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
1194 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
1195 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
1196 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
1197 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
1198 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
1199 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
1200 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
1201 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
1202 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
1203 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
1204 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
1205 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
1206 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
1207 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
1208 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
1209 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
1210 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
1211 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
1212 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
1213 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
1214 2936381700 Rhizobium chutanense C16 Isolate Unclassified
1215 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
1216 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
1217 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
1218 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
1219 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
1220 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
1221 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
1222 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
1223 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
1224 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
1225 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
1226 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
1227 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
1228 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
1229 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
1230 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
1231 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
1232 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
1233 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
1234 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
1235 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
1236 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
1237 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
1238 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
1239 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
1240 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
1241 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
1242 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
1243 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
1244 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
1245 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
1246 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
1247 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
1248 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
1249 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
1250 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
1251 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
1252 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
1253 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
1254 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
1255 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
1256 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
1257 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
1258 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
1259 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
1260 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
1261 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
1262 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
1263 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
1264 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
1265 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
1266 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
1267 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
1268 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
1269 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
1270 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
1271 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
1272 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
1273 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
1274 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
1275 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
1276 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
1277 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
1278 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
1279 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
1280 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
1281 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
1282 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
1283 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
1284 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
1285 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
1286 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
1287 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
1288 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
1289 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
1290 2996887358 Rhizobium sp. R711 Isolate Nodule
1291 2996893221 Rhizobium sp. R635 Isolate Nodule
1292 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
1293 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
1294 3004167301 Mesorhizobium loti 582 Isolate Unclassified
1295 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
1296 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
1297 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
1298 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
1299 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
1300 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
1301 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
1302 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
1303 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
1304 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
1305 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
1306 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
1307 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
1308 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
1309 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
1310 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
1311 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
1312 641522639 Methylobacterium sp. 4-46 Isolate Nodule
1313 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
1314 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
1315 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
1316 8002060224 Methylocystis sp. Sn-Cys Isolate Unclassified
1317 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
1318 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
1319 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
1320 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
1321 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
1322 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
1323 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
1324 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
1325 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
1326 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
1327 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
1328 8005258706 Rhizobium sp. R693 Isolate Nodule
1329 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
1330 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
1331 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
1332 8005321885 Rhizobium sp. R72 Isolate Nodule
1333 8005382845 Rhizobium sp. R634 Isolate Nodule
1334 8005395548 Rhizobium sp. R339 Isolate Nodule
1335 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
1336 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
1337 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
1338 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
1339 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
1340 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
1341 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
1342 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
1343 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
1344 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
1345 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
1346 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
1347 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
1348 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
1349 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
1350 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
1351 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
1352 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
1353 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
1354 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
1355 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
1356 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
1357 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
1358 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
1359 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
1360 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
1361 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
1362 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
1363 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
1364 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
1365 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
1366 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
1367 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
1368 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
1369 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
1370 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
1371 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
1372 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
1373 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
1374 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
1375 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
1376 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
1377 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
1378 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
1379 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
1380 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
1381 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule
1382 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
1383 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
1384 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
1385 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
1386 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
1387 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
1388 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
1389 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
1390 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule
1391 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
1392 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 81.24
Metatranscriptomes 0.45
Isolates 18.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.65
Nodule 12.9
Rhizoplane 2.55
Rhizosphere 63.16
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395899_0073950 3300037312 Bacteria 2491
2 JGI24740J21852_10010437 3300001979 Bacteria 3576
3 JGI24740J21852_10024304 3300001979 Bacteria 2057
4 JGI24740J21852_10032966 3300001979 Bacteria 1650
5 JGI24739J22299_10004285 3300001989 Bacteria 5468
6 JGI24735J21928_10023633 3300002067 Bacteria 1863
7 JGI24735J21928_10067932 3300002067 Bacteria 1022
8 JGI24738J21930_10038337 3300002075 Bacteria 974
9 JGI24034J26672_10034048 3300002239 Bacteria 838
10 JGI24751J29686_10056290 3300002459 Bacteria 810
11 JGI24751J29686_10066161 3300002459 Bacteria 744
12 JGI25156J39149_1004361 3300002705 Bacteria 4335
13 JGI25162J39368_1000015 3300002737 Bacteria 316381
14 JGI25162J39368_1000125 3300002737 Bacteria 84782
15 JGI25162J39368_1000132 3300002737 Bacteria 80803
16 JGI25158J39367_1001493 3300002739 Bacteria 4083
17 JGI25158J39367_1001495 3300002739 Bacteria 4076
18 JGI25157J39369_1000504 3300002741 Bacteria 24044
19 JGI25163J39215_1000648 3300002771 Bacteria 9413
20 JGI25164J39214_1000106 3300002772 Bacteria 80803
21 JGI25152J39213_1001134 3300002773 Bacteria 12401
22 JGI25152J39213_1002330 3300002773 Bacteria 7291
23 JGI25152J39213_1004507 3300002773 Bacteria 4366
24 JGI25150J39212_1003865 3300002774 Bacteria 3438
25 JGI25159J45721_1000008 3300002987 Bacteria 172667
26 JGI25159J45721_1002753 3300002987 Bacteria 6515
27 JGI25159J45721_1003009 3300002987 Bacteria 6119
28 JGI25159J45721_1004469 3300002987 Bacteria 4636
29 JGI25159J45721_1011682 3300002987 Bacteria 2137
30 JGI25159J45721_1018189 3300002987 Bacteria 1426
31 JGI25151J46595_10000419 3300003187 Bacteria 42837
32 JGI25151J46595_10037014 3300003187 Bacteria 1834
33 JGI25406J46586_10009805 3300003203 Bacteria 4276
34 JGI25406J46586_10035310 3300003203 Bacteria 1826
35 JGI25406J46586_10094883 3300003203 Bacteria 895
36 JGI25165J46597_1000001 3300003214 Bacteria 1111887
37 JGI25165J46597_1000217 3300003214 Bacteria 80803
38 JGI25165J46597_1000495 3300003214 Bacteria 37949
39 JGI25165J46597_1003848 3300003214 Bacteria 3495
40 JGI25165J46597_1016356 3300003214 Bacteria 996
41 JGI25153J46596_10007018 3300003215 Bacteria 5609
42 JGI25153J46596_10009910 3300003215 Bacteria 4366
43 Ga0006777J48905_1116347 3300003308 Bacteria 872
44 rootH1_10019293 3300003323 Bacteria 14409
45 JGI25160J50197_1000026 3300003354 Bacteria 184693
46 JGI25160J50197_1000033 3300003354 Bacteria 172667
47 JGI25160J50197_1001034 3300003354 Bacteria 14378
48 JGI25160J50197_1002573 3300003354 Bacteria 8389
49 JGI25160J50197_1007363 3300003354 Bacteria 4318
50 JGI25160J50197_1016585 3300003354 Bacteria 2369
51 JGI25160J50197_1018595 3300003354 Bacteria 2158
52 JGI25160J50197_1024094 3300003354 Bacteria 1735
53 JGI25160J50197_1029885 3300003354 Bacteria 1430
54 JGI25161J50226_1000014 3300003374 Bacteria 191109
55 JGI25161J50226_1000135 3300003374 Bacteria 51243
56 JGI25161J50226_1000508 3300003374 Bacteria 17047
57 JGI25161J50226_1002530 3300003374 Bacteria 4636
58 JGI25161J50226_1007169 3300003374 Bacteria 1906
59 Ga0007409J51694_1049872 3300003575 Bacteria 1401
60 JGI25404J52841_10000184 3300003659 Bacteria 7288
61 JGI25404J52841_10002070 3300003659 Bacteria 3719
62 JGI25404J52841_10020574 3300003659 Bacteria 1429
63 Ga0055538_1000001 3300003751 Bacteria 1111887
64 Ga0055538_1002445 3300003751 Bacteria 2723
65 Ga0055539_1000001 3300003752 Bacteria 1111887
66 Ga0055539_1000168 3300003752 Bacteria 58108
67 Ga0055533_1000003 3300003756 Bacteria 1111887
68 Ga0055533_1001370 3300003756 Bacteria 6518
69 Ga0055532_1000475 3300003758 Bacteria 18015
70 Ga0055532_1001551 3300003758 Bacteria 6180
71 Ga0055525_1000003 3300003759 Bacteria 962094
72 Ga0055525_1000264 3300003759 Bacteria 49985
73 Ga0055527_1000085 3300003760 Bacteria 73489
74 Ga0055535_1000154 3300003761 Bacteria 73489
75 Ga0055542_1000788 3300003762 Bacteria 23675
76 Ga0055542_1001926 3300003762 Bacteria 8157
77 Ga0055542_1011499 3300003762 Bacteria 1567
78 Ga0055529_1000581 3300003763 Bacteria 29446
79 Ga0055529_1003633 3300003763 Bacteria 2503
80 Ga0055529_1009126 3300003763 Bacteria 1308
81 Ga0055529_1009759 3300003763 Bacteria 1255
82 Ga0055526_1002294 3300003771 Bacteria 13055
83 Ga0055526_1003181 3300003771 Bacteria 10620
84 Ga0055526_1007072 3300003771 Bacteria 5931
85 Ga0055526_1016754 3300003771 Bacteria 2845
86 Ga0055526_1019661 3300003771 Bacteria 2448
87 Ga0055537_1000977 3300003773 Bacteria 12958
88 Ga0055537_1014429 3300003773 Bacteria 1435
89 Ga0055537_1016084 3300003773 Bacteria 1282
90 Ga0055524_1000099 3300003775 Bacteria 107171
91 Ga0055524_1000159 3300003775 Bacteria 78586
92 Ga0055524_1002105 3300003775 Bacteria 10520
93 Ga0055524_1005894 3300003775 Bacteria 5400
94 Ga0055524_1008233 3300003775 Bacteria 4350
95 Ga0055524_1011199 3300003775 Bacteria 3523
96 Ga0055524_1018300 3300003775 Bacteria 2437
97 Ga0055524_1034321 3300003775 Bacteria 1405
98 Ga0055536_1002977 3300003781 Bacteria 9280
99 Ga0055534_1000407 3300003784 Bacteria 26405
100 Ga0055534_1016255 3300003784 Bacteria 1339
101 Ga0055528_1000062 3300003790 Bacteria 85624
102 Ga0055528_1000660 3300003790 Bacteria 25060
103 Ga0055528_1017500 3300003790 Bacteria 2481
104 Ga0055528_1019381 3300003790 Bacteria 2257
105 Ga0055530_10000034 3300003791 Bacteria 118012
106 Ga0055530_10002641 3300003791 Bacteria 11220
107 Ga0055530_10006612 3300003791 Bacteria 5128
108 Ga0055530_10010043 3300003791 Bacteria 3556
109 Ga0055530_10021654 3300003791 Bacteria 1888
110 Ga0055540_1000023 3300003792 Bacteria 201131
111 Ga0055540_1000169 3300003792 Bacteria 64875
112 Ga0055540_1001995 3300003792 Bacteria 11406
113 Ga0055540_1017652 3300003792 Bacteria 1984
114 Ga0055540_1018308 3300003792 Bacteria 1922
115 Ga0055531_10000031 3300003794 Bacteria 156686
116 Ga0055531_10003153 3300003794 Bacteria 10605
117 Ga0055531_10005461 3300003794 Bacteria 7440
118 Ga0055531_10011376 3300003794 Bacteria 4300
119 Ga0055531_10028130 3300003794 Bacteria 1947
120 Ga0055541_1000001 3300003841 Bacteria 1111887
121 Ga0055541_1004450 3300003841 Bacteria 2540
122 Ga0055543_1000079 3300004625 Bacteria 84916
123 Ga0055543_1000315 3300004625 Bacteria 33655
124 Ga0055543_1000340 3300004625 Bacteria 31969
125 Ga0055543_1002971 3300004625 Bacteria 5271
126 Ga0058859_11814239 3300004798 Bacteria 1825
127 Ga0058862_12556712 3300004803 Bacteria 1154
128 Ga0065165_1000055 3300005262 Bacteria 187003
129 Ga0065165_1000073 3300005262 Bacteria 164910
130 Ga0065165_1000513 3300005262 Bacteria 59506
131 Ga0065165_1007617 3300005262 Bacteria 5271
132 Ga0065165_1008839 3300005262 Bacteria 4628
133 Ga0065165_1014154 3300005262 Bacteria 3113
134 Ga0065714_10005539 3300005288 Bacteria 8656
135 Ga0065714_10105595 3300005288 Bacteria 1559
136 Ga0065714_10146048 3300005288 Bacteria 1137
137 Ga0065714_10175734 3300005288 Bacteria 984
138 Ga0065704_10007255 3300005289 Bacteria 5091
139 Ga0065704_10024680 3300005289 Bacteria 1174
140 Ga0065704_10127428 3300005289 Bacteria 1674
141 Ga0065712_10069338 3300005290 Bacteria 7503
142 Ga0065715_10197484 3300005293 Bacteria 1376
143 Ga0065707_10103432 3300005295 Bacteria 2748
144 Ga0065707_10233975 3300005295 Bacteria 1178
145 Ga0070658_10013511 3300005327 Bacteria 6553
146 Ga0070658_10185131 3300005327 Bacteria 1753
147 Ga0070658_10453967 3300005327 Bacteria 1104
148 Ga0070676_10024235 3300005328 Bacteria 3416
149 Ga0070676_10047516 3300005328 Bacteria 2506
150 Ga0070676_10052911 3300005328 Bacteria 2389
151 Ga0070676_10157510 3300005328 Bacteria 1459
152 Ga0070683_100112476 3300005329 Bacteria 2570
153 Ga0070683_100265143 3300005329 Bacteria 1634
154 Ga0070683_100417394 3300005329 Bacteria 1280
155 Ga0070683_100497907 3300005329 Bacteria 1164
156 Ga0070690_100001585 3300005330 Bacteria 11936
157 Ga0070690_100037311 3300005330 Bacteria 3062
158 Ga0070690_100243949 3300005330 Bacteria 1268
159 Ga0070670_100000013 3300005331 Bacteria 250768
160 Ga0070670_100012812 3300005331 Bacteria 7174
161 Ga0070670_100016610 3300005331 Bacteria 6316
162 Ga0070670_100023981 3300005331 Bacteria 5248
163 Ga0070670_100035388 3300005331 Bacteria 4299
164 Ga0070670_100221403 3300005331 Bacteria 1646
165 Ga0070670_100416391 3300005331 Bacteria 1187
166 Ga0070677_10054708 3300005333 Bacteria 1626
167 Ga0068869_100005571 3300005334 Bacteria 7924
168 Ga0068869_100007091 3300005334 Bacteria 7139
169 Ga0068869_100028424 3300005334 Bacteria 3907
170 Ga0068869_100292833 3300005334 Bacteria 1312
171 Ga0068869_100371865 3300005334 Bacteria 1170
172 Ga0070666_10005328 3300005335 Bacteria 7884
173 Ga0070666_10014714 3300005335 Bacteria 4984
174 Ga0070666_10037259 3300005335 Bacteria 3233
175 Ga0070680_100006058 3300005336 Bacteria 9154
176 Ga0070680_100008151 3300005336 Bacteria 8004
177 Ga0070680_100153828 3300005336 Bacteria 1932
178 Ga0070680_100367676 3300005336 Bacteria 1223
179 Ga0070682_100009800 3300005337 Bacteria 5424
180 Ga0070682_100016597 3300005337 Bacteria 4284
181 Ga0068868_100003060 3300005338 Bacteria 11644
182 Ga0068868_100027633 3300005338 Bacteria 4328
183 Ga0068868_100094618 3300005338 Bacteria 2410
184 Ga0070660_100000026 3300005339 Bacteria 89379
185 Ga0070660_100006027 3300005339 Bacteria 8383
186 Ga0070660_100424929 3300005339 Bacteria 1100
187 Ga0070689_100000486 3300005340 Bacteria 23472
188 Ga0070689_100118853 3300005340 Bacteria 2110
189 Ga0070689_100444800 3300005340 Bacteria 1102
190 Ga0070691_10006042 3300005341 Bacteria 5528
191 Ga0070691_10014552 3300005341 Bacteria 3611
192 Ga0070691_10191219 3300005341 Bacteria 1071
193 Ga0070687_100184633 3300005343 Bacteria 1252
194 Ga0070661_100017484 3300005344 Bacteria 5088
195 Ga0070661_100070953 3300005344 Bacteria 2563
196 Ga0070661_100186401 3300005344 Bacteria 1581
197 Ga0070661_100226132 3300005344 Bacteria 1437
198 Ga0070692_10032396 3300005345 Bacteria 2628
199 Ga0070692_10036549 3300005345 Bacteria 2493
200 Ga0070668_100003313 3300005347 Bacteria 11881
201 Ga0070668_100026512 3300005347 Bacteria 4399
202 Ga0070668_100027926 3300005347 Bacteria 4282
203 Ga0070668_100033762 3300005347 Bacteria 3898
204 Ga0070669_100009584 3300005353 Bacteria 6896
205 Ga0070669_100085373 3300005353 Bacteria 2357
206 Ga0070669_100094082 3300005353 Bacteria 2252
207 Ga0070669_100150389 3300005353 Bacteria 1802
208 Ga0070669_100207384 3300005353 Bacteria 1545
209 Ga0070675_100005481 3300005354 Bacteria 9714
210 Ga0070675_100008915 3300005354 Bacteria 7793
211 Ga0070675_100016915 3300005354 Bacteria 5792
212 Ga0070675_100029099 3300005354 Bacteria 4452
213 Ga0070675_100038513 3300005354 Bacteria 3897
214 Ga0070675_100241700 3300005354 Bacteria 1578
215 Ga0070671_100025796 3300005355 Bacteria 4826
216 Ga0070671_100029982 3300005355 Bacteria 4488
217 Ga0070671_100051326 3300005355 Bacteria 3430
218 Ga0070671_100083407 3300005355 Bacteria 2672
219 Ga0070671_100087653 3300005355 Bacteria 2605
220 Ga0070671_100108285 3300005355 Bacteria 2333
221 Ga0070671_100123368 3300005355 Bacteria 2181
222 Ga0070671_100179587 3300005355 Bacteria 1792
223 Ga0070671_100366207 3300005355 Bacteria 1231
224 Ga0070671_100627181 3300005355 Bacteria 930
225 Ga0070674_100022659 3300005356 Bacteria 4053
226 Ga0070674_100046149 3300005356 Bacteria 2980
227 Ga0070674_100046368 3300005356 Bacteria 2973
228 Ga0070674_100063040 3300005356 Bacteria 2593
229 Ga0070674_100071273 3300005356 Bacteria 2457
230 Ga0070674_100091052 3300005356 Bacteria 2201
231 Ga0070673_100001302 3300005364 Bacteria 14531
232 Ga0070673_100007798 3300005364 Bacteria 7086
233 Ga0070673_100040390 3300005364 Bacteria 3579
234 Ga0070673_100095247 3300005364 Bacteria 2442
235 Ga0070673_100120155 3300005364 Bacteria 2191
236 Ga0070673_100666735 3300005364 Bacteria 953
237 Ga0070688_100005818 3300005365 Bacteria 6526
238 Ga0070688_100130696 3300005365 Bacteria 1693
239 Ga0070688_100138569 3300005365 Bacteria 1650
240 Ga0070659_100000054 3300005366 Bacteria 89379
241 Ga0070659_100041261 3300005366 Bacteria 3606
242 Ga0070659_100099179 3300005366 Bacteria 2343
243 Ga0070659_100128402 3300005366 Bacteria 2057
244 Ga0070659_100139064 3300005366 Bacteria 1976
245 Ga0070659_100179362 3300005366 Bacteria 1738
246 Ga0070659_100225714 3300005366 Bacteria 1547
247 Ga0070667_100000233 3300005367 Bacteria 63545
248 Ga0070667_100003362 3300005367 Bacteria 13654
249 Ga0070667_100141563 3300005367 Bacteria 2107
250 Ga0070667_100202201 3300005367 Bacteria 1763
251 Ga0070667_100207130 3300005367 Bacteria 1742
252 Ga0070667_100234681 3300005367 Bacteria 1636
253 Ga0070667_100293076 3300005367 Bacteria 1464
254 Ga0070667_100575159 3300005367 Bacteria 1037
255 Ga0070703_10123763 3300005406 Bacteria 941
256 Ga0070709_10018594 3300005434 Bacteria 4004
257 Ga0070709_10034031 3300005434 Bacteria 3087
258 Ga0070709_10067055 3300005434 Bacteria 2304
259 Ga0070709_10137459 3300005434 Bacteria 1675
260 Ga0070714_100030880 3300005435 Bacteria 4464
261 Ga0070714_100046843 3300005435 Bacteria 3670
262 Ga0070714_100155735 3300005435 Bacteria 2062
263 Ga0070714_100362579 3300005435 Bacteria 1363
264 Ga0070713_100007098 3300005436 Bacteria 7831
265 Ga0070713_100099903 3300005436 Bacteria 2511
266 Ga0070713_100108240 3300005436 Bacteria 2419
267 Ga0070713_100145633 3300005436 Bacteria 2102
268 Ga0070710_10003806 3300005437 Bacteria 7137
269 Ga0070710_10004027 3300005437 Bacteria 6969
270 Ga0070710_10064775 3300005437 Bacteria 2091
271 Ga0070701_10008482 3300005438 Bacteria 4448
272 Ga0070711_100005558 3300005439 Bacteria 7549
273 Ga0070711_100007109 3300005439 Bacteria 6791
274 Ga0070711_100085829 3300005439 Bacteria 2255
275 Ga0070711_100270934 3300005439 Bacteria 1339
276 Ga0070705_100032862 3300005440 Bacteria 2886
277 Ga0070705_100209075 3300005440 Bacteria 1344
278 Ga0070700_100022510 3300005441 Bacteria 3675
279 Ga0070700_100105644 3300005441 Bacteria 1862
280 Ga0070700_100312976 3300005441 Bacteria 1150
281 Ga0070700_100680435 3300005441 Bacteria 815
282 Ga0070694_100033376 3300005444 Bacteria 3387
283 Ga0070694_100174993 3300005444 Bacteria 1583
284 Ga0070694_100213054 3300005444 Bacteria 1446
285 Ga0070708_100000519 3300005445 Bacteria 28944
286 Ga0070708_100039742 3300005445 Bacteria 4118
287 Ga0070708_100178261 3300005445 Bacteria 1986
288 Ga0070708_100438092 3300005445 Bacteria 1233
289 Ga0070708_100541376 3300005445 Bacteria 1098
290 Ga0070708_100826659 3300005445 Bacteria 871
291 Ga0070663_100000934 3300005455 Bacteria 15889
292 Ga0070663_100006590 3300005455 Bacteria 6999
293 Ga0070663_100012831 3300005455 Bacteria 5316
294 Ga0070663_100066217 3300005455 Bacteria 2617
295 Ga0070663_100128920 3300005455 Bacteria 1919
296 Ga0070663_100167763 3300005455 Bacteria 1694
297 Ga0070678_100029341 3300005456 Bacteria 3765
298 Ga0070678_100044334 3300005456 Bacteria 3176
299 Ga0070678_100242791 3300005456 Bacteria 1507
300 Ga0070678_100386862 3300005456 Bacteria 1212
301 Ga0070662_100003166 3300005457 Bacteria 10230
302 Ga0070662_100126270 3300005457 Bacteria 1967
303 Ga0070662_100223581 3300005457 Bacteria 1503
304 Ga0070662_100454874 3300005457 Bacteria 1063
305 Ga0070681_10024150 3300005458 Bacteria 6120
306 Ga0070681_10043648 3300005458 Bacteria 4490
307 Ga0070681_10089558 3300005458 Bacteria 3029
308 Ga0070681_10174879 3300005458 Bacteria 2069
309 Ga0068867_100004515 3300005459 Bacteria 9783
310 Ga0068867_100143013 3300005459 Bacteria 1871
311 Ga0068867_100178109 3300005459 Bacteria 1689
312 Ga0068867_100568435 3300005459 Bacteria 984
313 Ga0070685_10009074 3300005466 Bacteria 5132
314 Ga0070685_10051372 3300005466 Bacteria 2383
315 Ga0070706_100004958 3300005467 Bacteria 12743
316 Ga0070706_100027930 3300005467 Bacteria 5190
317 Ga0070706_100040404 3300005467 Bacteria 4305
318 Ga0070706_100192877 3300005467 Bacteria 1903
319 Ga0070706_100297606 3300005467 Bacteria 1506
320 Ga0070706_100474002 3300005467 Bacteria 1164
321 Ga0070707_100031403 3300005468 Bacteria 5060
322 Ga0070707_100210462 3300005468 Bacteria 1895
323 Ga0070707_100451034 3300005468 Bacteria 1247
324 Ga0070698_100049272 3300005471 Bacteria 4300
325 Ga0070698_100101354 3300005471 Bacteria 2850
326 Ga0070698_100139778 3300005471 Bacteria 2374
327 Ga0070698_100278415 3300005471 Bacteria 1604
328 Ga0070698_100465161 3300005471 Bacteria 1201
329 Ga0070699_100088921 3300005518 Bacteria 2698
330 Ga0070699_100717085 3300005518 Bacteria 914
331 Ga0070679_100004126 3300005530 Bacteria 13392
332 Ga0070679_100020888 3300005530 Bacteria 6387
333 Ga0070679_100055517 3300005530 Bacteria 3943
334 Ga0070679_100097707 3300005530 Bacteria 2924
335 Ga0070679_100100615 3300005530 Bacteria 2876
336 Ga0070679_100131397 3300005530 Bacteria 2485
337 Ga0070684_100005879 3300005535 Bacteria 9448
338 Ga0070684_100020407 3300005535 Bacteria 5498
339 Ga0070684_100030174 3300005535 Bacteria 4604
340 Ga0070684_100036763 3300005535 Bacteria 4196
341 Ga0070684_100101158 3300005535 Bacteria 2575
342 Ga0070684_100293825 3300005535 Bacteria 1490
343 Ga0070697_100037770 3300005536 Bacteria 3901
344 Ga0070697_100039746 3300005536 Bacteria 3804
345 Ga0070697_100089914 3300005536 Bacteria 2537
346 Ga0070697_100127673 3300005536 Bacteria 2131
347 Ga0068853_100020766 3300005539 Bacteria 5463
348 Ga0068853_100021864 3300005539 Bacteria 5335
349 Ga0068853_100027138 3300005539 Bacteria 4811
350 Ga0068853_100066009 3300005539 Bacteria 3141
351 Ga0070672_100008399 3300005543 Bacteria 7059
352 Ga0070672_100031979 3300005543 Bacteria 3967
353 Ga0070672_100186210 3300005543 Bacteria 1731
354 Ga0070686_100000614 3300005544 Bacteria 20905
355 Ga0070686_100027639 3300005544 Bacteria 3435
356 Ga0070686_100045752 3300005544 Bacteria 2758
357 Ga0070686_100193900 3300005544 Bacteria 1452
358 Ga0070695_100007955 3300005545 Bacteria 6279
359 Ga0070695_100496565 3300005545 Bacteria 943
360 Ga0070696_100007912 3300005546 Bacteria 7097
361 Ga0070696_100041745 3300005546 Bacteria 3169
362 Ga0070696_100057901 3300005546 Bacteria 2705
363 Ga0070696_100146819 3300005546 Bacteria 1728
364 Ga0070693_100017942 3300005547 Bacteria 3689
365 Ga0070693_100043375 3300005547 Bacteria 2540
366 Ga0070693_100156256 3300005547 Bacteria 1449
367 Ga0070665_100004066 3300005548 Bacteria 15393
368 Ga0070665_100015354 3300005548 Bacteria 7692
369 Ga0070665_100059585 3300005548 Bacteria 3827
370 Ga0070665_100074040 3300005548 Bacteria 3411
371 Ga0070665_100076593 3300005548 Bacteria 3351
372 Ga0070665_100091477 3300005548 Bacteria 3047
373 Ga0070665_100158370 3300005548 Bacteria 2266
374 Ga0070665_100226909 3300005548 Bacteria 1868
375 Ga0070665_100251422 3300005548 Bacteria 1768
376 Ga0070665_100323375 3300005548 Bacteria 1547
377 Ga0070665_100433449 3300005548 Bacteria 1324
378 Ga0070665_100599391 3300005548 Bacteria 1115
379 Ga0070704_100098724 3300005549 Bacteria 2195
380 Ga0068855_100029788 3300005563 Bacteria 6526
381 Ga0068855_100082367 3300005563 Bacteria 3729
382 Ga0068855_100133273 3300005563 Bacteria 2836
383 Ga0068855_100153877 3300005563 Bacteria 2614
384 Ga0068855_100163194 3300005563 Bacteria 2527
385 Ga0068855_100174665 3300005563 Bacteria 2432
386 Ga0068855_100326177 3300005563 Bacteria 1696
387 Ga0068855_100591276 3300005563 Bacteria 1198
388 Ga0070664_100001003 3300005564 Bacteria 22156
389 Ga0070664_100075412 3300005564 Bacteria 2896
390 Ga0070664_100080947 3300005564 Bacteria 2798
391 Ga0070664_100493702 3300005564 Bacteria 1128
392 Ga0068857_100000878 3300005577 Bacteria 22684
393 Ga0068857_100042019 3300005577 Bacteria 4054
394 Ga0068857_100046330 3300005577 Bacteria 3859
395 Ga0068857_100204345 3300005577 Bacteria 1801
396 Ga0068857_100273837 3300005577 Bacteria 1552
397 Ga0068857_100299772 3300005577 Bacteria 1481
398 Ga0068854_100389307 3300005578 Bacteria 1151
399 Ga0068856_100011136 3300005614 Bacteria 8731
400 Ga0068856_100041754 3300005614 Bacteria 4509
401 Ga0068856_100081215 3300005614 Bacteria 3216
402 Ga0068856_100109636 3300005614 Bacteria 2757
403 Ga0068856_100215588 3300005614 Bacteria 1935
404 Ga0068856_100425090 3300005614 Bacteria 1349
405 Ga0070702_100060959 3300005615 Bacteria 2195
406 Ga0070702_100162117 3300005615 Bacteria 1446
407 Ga0068852_100005102 3300005616 Bacteria 9350
408 Ga0068852_100021683 3300005616 Bacteria 5137
409 Ga0068852_100030010 3300005616 Bacteria 4472
410 Ga0068852_100045251 3300005616 Bacteria 3743
411 Ga0068852_100180693 3300005616 Bacteria 1984
412 Ga0068852_100315150 3300005616 Bacteria 1518
413 Ga0068852_100356389 3300005616 Bacteria 1430
414 Ga0068852_100426413 3300005616 Bacteria 1309
415 Ga0068859_100000800 3300005617 Bacteria 31891
416 Ga0068859_100015731 3300005617 Bacteria 7603
417 Ga0068859_100041971 3300005617 Bacteria 4595
418 Ga0068859_100084267 3300005617 Bacteria 3224
419 Ga0068859_100146258 3300005617 Bacteria 2438
420 Ga0068859_100204459 3300005617 Bacteria 2060
421 Ga0068859_100355096 3300005617 Bacteria 1561
422 Ga0068859_100413683 3300005617 Bacteria 1444
423 Ga0068859_101020736 3300005617 Bacteria 909
424 Ga0068859_101079920 3300005617 Bacteria 883
425 Ga0068864_100000142 3300005618 Bacteria 69641
426 Ga0068864_100004679 3300005618 Bacteria 11231
427 Ga0068864_100006821 3300005618 Bacteria 9354
428 Ga0068864_100014776 3300005618 Bacteria 6487
429 Ga0068864_100026256 3300005618 Bacteria 4911
430 Ga0068864_100094887 3300005618 Bacteria 2637
431 Ga0068864_100105187 3300005618 Bacteria 2508
432 Ga0068864_100106636 3300005618 Bacteria 2491
433 Ga0068864_100210123 3300005618 Bacteria 1791
434 Ga0068864_100434726 3300005618 Bacteria 1253
435 Ga0068866_10113653 3300005718 Bacteria 1515
436 Ga0068861_100021834 3300005719 Bacteria 4604
437 Ga0068861_100031951 3300005719 Bacteria 3872
438 Ga0068861_100082034 3300005719 Bacteria 2526
439 Ga0068861_100135041 3300005719 Bacteria 2006
440 Ga0068861_100764708 3300005719 Bacteria 903
441 Ga0068851_10012797 3300005834 Bacteria 3963
442 Ga0068851_10193400 3300005834 Bacteria 1132
443 Ga0068870_10060969 3300005840 Bacteria 2026
444 Ga0068870_10173072 3300005840 Bacteria 1290
445 Ga0068870_10180929 3300005840 Bacteria 1265
446 Ga0068863_100000220 3300005841 Bacteria 60987
447 Ga0068863_100005419 3300005841 Bacteria 12569
448 Ga0068863_100007101 3300005841 Bacteria 10983
449 Ga0068863_100018121 3300005841 Bacteria 6742
450 Ga0068863_100018292 3300005841 Bacteria 6709
451 Ga0068863_100146501 3300005841 Bacteria 2258
452 Ga0068863_100252869 3300005841 Bacteria 1702
453 Ga0068863_100284705 3300005841 Bacteria 1602
454 Ga0068863_100480326 3300005841 Bacteria 1222
455 Ga0068863_100988554 3300005841 Bacteria 844
456 Ga0068858_100003282 3300005842 Bacteria 16114
457 Ga0068858_100072516 3300005842 Bacteria 3195
458 Ga0068858_100149047 3300005842 Bacteria 2198
459 Ga0068858_100227025 3300005842 Bacteria 1769
460 Ga0068858_100537962 3300005842 Bacteria 1131
461 Ga0068858_100582162 3300005842 Bacteria 1085
462 Ga0068860_100000421 3300005843 Bacteria 54601
463 Ga0068860_100002509 3300005843 Bacteria 19266
464 Ga0068860_100027297 3300005843 Bacteria 5500
465 Ga0068860_100030026 3300005843 Bacteria 5227
466 Ga0068860_100049785 3300005843 Bacteria 3989
467 Ga0068860_100070217 3300005843 Bacteria 3330
468 Ga0068860_100231506 3300005843 Bacteria 1796
469 Ga0068860_100417201 3300005843 Bacteria 1330
470 Ga0068860_100489963 3300005843 Bacteria 1226
471 Ga0068862_100003605 3300005844 Bacteria 13256
472 Ga0068862_100008355 3300005844 Bacteria 8567
473 Ga0068862_100013633 3300005844 Bacteria 6732
474 Ga0068862_100036838 3300005844 Bacteria 4146
475 Ga0068862_100040183 3300005844 Bacteria 3976
476 Ga0068862_100060178 3300005844 Bacteria 3262
477 Ga0068862_100114498 3300005844 Bacteria 2370
478 Ga0068862_100217033 3300005844 Bacteria 1730
479 Ga0081455_10003564 3300005937 Bacteria 17863
480 Ga0081455_10006934 3300005937 Bacteria 12048
481 Ga0081455_10011421 3300005937 Bacteria 8926
482 Ga0081455_10020400 3300005937 Bacteria 6240
483 Ga0081455_10028061 3300005937 Bacteria 5147
484 Ga0081455_10165785 3300005937 Bacteria 1688
485 Ga0081455_10292683 3300005937 Bacteria 1172
486 Ga0081538_10003894 3300005981 Bacteria 13942
487 Ga0081538_10006867 3300005981 Bacteria 9911
488 Ga0081538_10007292 3300005981 Bacteria 9583
489 Ga0081538_10037877 3300005981 Bacteria 3119
490 Ga0081540_1002667 3300005983 Bacteria 14515
491 Ga0081540_1002792 3300005983 Bacteria 14160
492 Ga0081540_1006168 3300005983 Bacteria 8792
493 Ga0081540_1007391 3300005983 Bacteria 7834
494 Ga0081540_1008663 3300005983 Bacteria 7086
495 Ga0081540_1009142 3300005983 Bacteria 6839
496 Ga0081540_1010656 3300005983 Bacteria 6202
497 Ga0081540_1016145 3300005983 Bacteria 4688
498 Ga0081540_1019390 3300005983 Bacteria 4135
499 Ga0081540_1020227 3300005983 Bacteria 4013
500 Ga0081540_1027571 3300005983 Bacteria 3214
501 Ga0081540_1128945 3300005983 Bacteria 1036
502 Ga0081539_10001498 3300005985 Bacteria 39469
503 Ga0081539_10005634 3300005985 Bacteria 12591
504 Ga0081539_10007640 3300005985 Bacteria 9741
505 Ga0081539_10048894 3300005985 Bacteria 2403
506 Ga0081539_10088597 3300005985 Bacteria 1605
507 Ga0070717_10009138 3300006028 Bacteria 7446
508 Ga0070717_10032952 3300006028 Bacteria 4177
509 Ga0075365_10008842 3300006038 Bacteria 5747
510 Ga0075365_10010225 3300006038 Bacteria 5452
511 Ga0075365_10052246 3300006038 Bacteria 2702
512 Ga0075365_10060756 3300006038 Bacteria 2522
513 Ga0075365_10066846 3300006038 Bacteria 2412
514 Ga0075365_10075161 3300006038 Bacteria 2280
515 Ga0075365_10094453 3300006038 Bacteria 2041
516 Ga0075365_10142540 3300006038 Bacteria 1664
517 Ga0075365_10166989 3300006038 Bacteria 1535
518 Ga0075365_10279990 3300006038 Bacteria 1173
519 Ga0075365_10298880 3300006038 Bacteria 1133
520 Ga0075368_10001535 3300006042 Bacteria 7393
521 Ga0075368_10017936 3300006042 Bacteria 2654
522 Ga0075368_10062170 3300006042 Bacteria 1496
523 Ga0075368_10066520 3300006042 Bacteria 1449
524 Ga0075363_100042091 3300006048 Bacteria 2412
525 Ga0075363_100048458 3300006048 Bacteria 2259
526 Ga0075363_100055498 3300006048 Bacteria 2122
527 Ga0075363_100068089 3300006048 Bacteria 1930
528 Ga0075364_10003655 3300006051 Bacteria 8774
529 Ga0075364_10050121 3300006051 Bacteria 2725
530 Ga0075364_10107903 3300006051 Bacteria 1856
531 Ga0075364_10129379 3300006051 Bacteria 1694
532 Ga0075364_10132372 3300006051 Bacteria 1674
533 Ga0075364_10360275 3300006051 Bacteria 991
534 Ga0075364_10499921 3300006051 Bacteria 831
535 Ga0075432_10029627 3300006058 Bacteria 1890
536 Ga0075432_10040333 3300006058 Bacteria 1629
537 Ga0070715_10000344 3300006163 Bacteria 11597
538 Ga0070715_10134774 3300006163 Bacteria 1193
539 Ga0070716_100019459 3300006173 Bacteria 3549
540 Ga0070716_100077270 3300006173 Bacteria 1975
541 Ga0070716_100135540 3300006173 Bacteria 1563
542 Ga0070712_100004625 3300006175 Bacteria 8506
543 Ga0070712_100087120 3300006175 Bacteria 2277
544 Ga0070712_100112802 3300006175 Bacteria 2032
545 Ga0075362_10002110 3300006177 Bacteria 6566
546 Ga0075362_10008885 3300006177 Bacteria 3862
547 Ga0075362_10015330 3300006177 Bacteria 3115
548 Ga0075362_10021208 3300006177 Bacteria 2723
549 Ga0075362_10031909 3300006177 Bacteria 2283
550 Ga0075362_10063391 3300006177 Bacteria 1676
551 Ga0075362_10140811 3300006177 Bacteria 1152
552 Ga0075367_10001171 3300006178 Bacteria 10976
553 Ga0075367_10014596 3300006178 Bacteria 4253
554 Ga0075367_10019131 3300006178 Bacteria 3792
555 Ga0075367_10023320 3300006178 Bacteria 3481
556 Ga0075367_10036137 3300006178 Bacteria 2863
557 Ga0075367_10050201 3300006178 Bacteria 2462
558 Ga0075367_10084113 3300006178 Bacteria 1928
559 Ga0075367_10093183 3300006178 Bacteria 1835
560 Ga0075367_10103561 3300006178 Bacteria 1742
561 Ga0075367_10284207 3300006178 Bacteria 1040
562 Ga0075369_10008749 3300006186 Bacteria 3909
563 Ga0075369_10012764 3300006186 Bacteria 3320
564 Ga0075369_10066710 3300006186 Bacteria 1579
565 Ga0075369_10143537 3300006186 Bacteria 1089
566 Ga0075366_10002895 3300006195 Bacteria 8910
567 Ga0075366_10010221 3300006195 Bacteria 5265
568 Ga0075366_10176174 3300006195 Bacteria 1298
569 Ga0075366_10240477 3300006195 Bacteria 1103
570 Ga0097621_100007290 3300006237 Bacteria 7900
571 Ga0097621_100057662 3300006237 Bacteria 3177
572 Ga0097621_100074238 3300006237 Bacteria 2817
573 Ga0097621_100104470 3300006237 Bacteria 2387
574 Ga0097621_100112493 3300006237 Bacteria 2302
575 Ga0097621_100542545 3300006237 Bacteria 1058
576 Ga0075370_10001596 3300006353 Bacteria 9990
577 Ga0075370_10002463 3300006353 Bacteria 8586
578 Ga0075370_10003699 3300006353 Bacteria 7326
579 Ga0075370_10009011 3300006353 Bacteria 5160
580 Ga0075370_10021725 3300006353 Bacteria 3516
581 Ga0075370_10043357 3300006353 Bacteria 2543
582 Ga0068871_100011916 3300006358 Bacteria 6400
583 Ga0068871_100015227 3300006358 Bacteria 5751
584 Ga0068871_100052042 3300006358 Bacteria 3315
585 Ga0068871_100076665 3300006358 Bacteria 2761
586 Ga0068871_100080184 3300006358 Bacteria 2702
587 Ga0068871_100138815 3300006358 Bacteria 2065
588 Ga0075428_100074486 3300006844 Bacteria 3708
589 Ga0075428_100100640 3300006844 Bacteria 3151
590 Ga0075428_100111834 3300006844 Bacteria 2975
591 Ga0075428_101022271 3300006844 Bacteria 874
592 Ga0075430_100033044 3300006846 Bacteria 4392
593 Ga0075430_100051629 3300006846 Bacteria 3465
594 Ga0075430_100076429 3300006846 Bacteria 2807
595 Ga0075431_100000624 3300006847 Bacteria 29901
596 Ga0075433_10000772 3300006852 Bacteria 22032
597 Ga0075434_100000891 3300006871 Bacteria 23915
598 Ga0075434_100129292 3300006871 Bacteria 2544
599 Ga0075434_100254051 3300006871 Bacteria 1777
600 Ga0075434_100358192 3300006871 Bacteria 1480
601 Ga0075434_100614608 3300006871 Bacteria 1106
602 Ga0075429_100007172 3300006880 Bacteria 9673
603 Ga0075429_100009104 3300006880 Bacteria 8623
604 Ga0075429_100042584 3300006880 Bacteria 3951
605 Ga0075429_100204204 3300006880 Bacteria 1731
606 Ga0075429_100331475 3300006880 Bacteria 1332
607 Ga0068865_100027629 3300006881 Bacteria 3749
608 Ga0068865_100028473 3300006881 Bacteria 3699
609 Ga0068865_100323395 3300006881 Bacteria 1241
610 Ga0075436_100026728 3300006914 Bacteria 3974
611 Ga0075436_100033292 3300006914 Bacteria 3552
612 Ga0075436_100047903 3300006914 Bacteria 2948
613 Ga0075436_100083194 3300006914 Bacteria 2221
614 Ga0075436_100085911 3300006914 Bacteria 2185
615 Ga0075436_100547935 3300006914 Bacteria 849
616 Ga0097620_100000800 3300006931 Bacteria 31891
617 Ga0097620_100015731 3300006931 Bacteria 7603
618 Ga0097620_100041971 3300006931 Bacteria 4595
619 Ga0097620_100084260 3300006931 Bacteria 3224
620 Ga0097620_100146270 3300006931 Bacteria 2438
621 Ga0097620_100204468 3300006931 Bacteria 2060
622 Ga0097620_100355100 3300006931 Bacteria 1561
623 Ga0097620_100413658 3300006931 Bacteria 1444
624 Ga0097620_101020772 3300006931 Bacteria 909
625 Ga0097620_101079916 3300006931 Bacteria 883
626 Ga0079104_1000068 3300006946 Bacteria 154984
627 Ga0079104_1000071 3300006946 Bacteria 153790
628 Ga0099826_10000002 3300006948 Bacteria 1125830
629 Ga0099826_10000011 3300006948 Bacteria 287659
630 Ga0075435_100003277 3300007076 Bacteria 10966
631 Ga0075435_100018966 3300007076 Bacteria 5242
632 Ga0075435_100513788 3300007076 Bacteria 1036
633 Ga0099794_10011698 3300007265 Bacteria 3765
634 Ga0099794_10015660 3300007265 Bacteria 3352
635 Ga0099794_10039980 3300007265 Bacteria 2228
636 Ga0099794_10047139 3300007265 Bacteria 2066
637 Ga0099794_10068909 3300007265 Bacteria 1730
638 Ga0099794_10118205 3300007265 Bacteria 1332
639 Ga0099795_10034242 3300007788 Bacteria 1768
640 Ga0099795_10085059 3300007788 Bacteria 1217
641 Ga0105251_10000660 3300009011 Bacteria 31734
642 Ga0105251_10016211 3300009011 Bacteria 4036
643 Ga0105251_10033412 3300009011 Bacteria 2554
644 Ga0105251_10039324 3300009011 Bacteria 2312
645 Ga0105251_10106453 3300009011 Bacteria 1280
646 Ga0105251_10167518 3300009011 Bacteria 990
647 Ga0105244_10005347 3300009036 Bacteria 8546
648 Ga0105250_10024040 3300009092 Bacteria 2455
649 Ga0105250_10072671 3300009092 Bacteria 1391
650 Ga0105240_10000012 3300009093 Bacteria 496639
651 Ga0105240_10004505 3300009093 Bacteria 21177
652 Ga0105240_10004758 3300009093 Bacteria 20498
653 Ga0105240_10014043 3300009093 Bacteria 10954
654 Ga0105240_10152921 3300009093 Bacteria 2747
655 Ga0105240_10219203 3300009093 Bacteria 2218
656 Ga0105240_10294429 3300009093 Bacteria 1859
657 Ga0105240_10560545 3300009093 Bacteria 1263
658 Ga0111539_10000520 3300009094 Bacteria 48692
659 Ga0111539_10003392 3300009094 Bacteria 20991
660 Ga0111539_10004538 3300009094 Bacteria 18157
661 Ga0111539_10154755 3300009094 Bacteria 2683
662 Ga0111539_10421078 3300009094 Bacteria 1555
663 Ga0111539_10697485 3300009094 Bacteria 1182
664 Ga0111539_10889061 3300009094 Bacteria 1036
665 Ga0105245_10010680 3300009098 Bacteria 7989
666 Ga0105245_10039217 3300009098 Bacteria 4216
667 Ga0105245_10092888 3300009098 Bacteria 2780
668 Ga0105245_10133823 3300009098 Bacteria 2328
669 Ga0105245_10194458 3300009098 Bacteria 1945
670 Ga0105245_10294739 3300009098 Bacteria 1590
671 Ga0105245_10353378 3300009098 Bacteria 1457
672 Ga0105245_10560492 3300009098 Bacteria 1165
673 Ga0105247_10004988 3300009101 Bacteria 8435
674 Ga0105247_10030494 3300009101 Bacteria 3269
675 Ga0105247_10047833 3300009101 Bacteria 2627
676 Ga0105247_10131456 3300009101 Bacteria 1632
677 Ga0105247_10161858 3300009101 Bacteria 1482
678 Ga0114129_10020308 3300009147 Bacteria 9450
679 Ga0114129_10058263 3300009147 Bacteria 5403
680 Ga0114129_10152069 3300009147 Bacteria 3166
681 Ga0114129_10218687 3300009147 Bacteria 2571
682 Ga0114129_10332770 3300009147 Bacteria 2016
683 Ga0114129_10688131 3300009147 Bacteria 1315
684 Ga0114129_10713689 3300009147 Bacteria 1287
685 Ga0114129_11003519 3300009147 Bacteria 1051
686 Ga0114129_11006953 3300009147 Bacteria 1049
687 Ga0114129_11253159 3300009147 Bacteria 921
688 Ga0105243_10019520 3300009148 Bacteria 5139
689 Ga0105243_10051317 3300009148 Bacteria 3262
690 Ga0105243_10076336 3300009148 Bacteria 2722
691 Ga0105243_10077571 3300009148 Bacteria 2702
692 Ga0105243_10223767 3300009148 Bacteria 1665
693 Ga0105243_10356358 3300009148 Bacteria 1345
694 Ga0105241_10031806 3300009174 Bacteria 3952
695 Ga0105241_10308105 3300009174 Bacteria 1361
696 Ga0105241_10817084 3300009174 Bacteria 860
697 Ga0105242_10051245 3300009176 Bacteria 3363
698 Ga0105242_10184237 3300009176 Bacteria 1844
699 Ga0105242_10238842 3300009176 Bacteria 1632
700 Ga0105242_10435530 3300009176 Bacteria 1232
701 Ga0105242_10497658 3300009176 Bacteria 1159
702 Ga0105242_10525415 3300009176 Bacteria 1130
703 Ga0105242_10708589 3300009176 Bacteria 986
704 Ga0105242_10825526 3300009176 Bacteria 920
705 Ga0105242_10910310 3300009176 Bacteria 880
706 Ga0105248_10000694 3300009177 Bacteria 38046
707 Ga0105248_10001296 3300009177 Bacteria 27826
708 Ga0105248_10004337 3300009177 Bacteria 15684
709 Ga0105248_10017418 3300009177 Bacteria 7921
710 Ga0105248_10074491 3300009177 Bacteria 3816
711 Ga0105248_10080910 3300009177 Bacteria 3652
712 Ga0105248_10099718 3300009177 Bacteria 3273
713 Ga0105248_10252794 3300009177 Bacteria 1984
714 Ga0105248_10398558 3300009177 Bacteria 1550
715 Ga0105237_10001938 3300009545 Bacteria 26374
716 Ga0105237_10004557 3300009545 Bacteria 16011
717 Ga0105237_10008632 3300009545 Bacteria 11016
718 Ga0105237_10016990 3300009545 Bacteria 7550
719 Ga0105237_10033190 3300009545 Bacteria 5229
720 Ga0105237_10091859 3300009545 Bacteria 3025
721 Ga0105237_10127812 3300009545 Bacteria 2535
722 Ga0105237_10170857 3300009545 Bacteria 2174
723 Ga0105237_10179243 3300009545 Bacteria 2119
724 Ga0105237_10186749 3300009545 Bacteria 2073
725 Ga0105237_10299509 3300009545 Bacteria 1611
726 Ga0105238_10001033 3300009551 Bacteria 28272
727 Ga0105238_10001851 3300009551 Bacteria 21208
728 Ga0105238_10011939 3300009551 Bacteria 8753
729 Ga0105238_10013209 3300009551 Bacteria 8333
730 Ga0105238_10019059 3300009551 Bacteria 6990
731 Ga0105238_10031142 3300009551 Bacteria 5430
732 Ga0105238_10052610 3300009551 Bacteria 4094
733 Ga0105238_10164044 3300009551 Bacteria 2197
734 Ga0105238_10166911 3300009551 Bacteria 2177
735 Ga0105238_10795760 3300009551 Bacteria 961
736 Ga0105249_10000072 3300009553 Bacteria 146435
737 Ga0105249_10000422 3300009553 Bacteria 40318
738 Ga0105249_10060242 3300009553 Bacteria 3481
739 Ga0105249_10076890 3300009553 Bacteria 3095
740 Ga0105249_10155192 3300009553 Bacteria 2207
741 Ga0105249_10172032 3300009553 Bacteria 2101
742 Ga0105249_10284433 3300009553 Bacteria 1653
743 Ga0105249_10345108 3300009553 Bacteria 1507
744 Ga0105249_10372944 3300009553 Bacteria 1451
745 Ga0105148_100123 3300009978 Bacteria 11843
746 Ga0105033_106106 3300009986 Bacteria 1041
747 Ga0099796_10102196 3300010159 Bacteria 1080
748 Ga0105239_10001549 3300010375 Bacteria 30378
749 Ga0105239_10003708 3300010375 Bacteria 18600
750 Ga0105239_10006999 3300010375 Bacteria 12979
751 Ga0105239_10008095 3300010375 Bacteria 11999
752 Ga0105239_10009580 3300010375 Bacteria 10897
753 Ga0105239_10009841 3300010375 Bacteria 10740
754 Ga0105239_10015936 3300010375 Bacteria 8317
755 Ga0105239_10049420 3300010375 Bacteria 4612
756 Ga0105239_10208814 3300010375 Bacteria 2188
757 Ga0105239_10280846 3300010375 Bacteria 1874
758 Ga0105239_10301988 3300010375 Bacteria 1803
759 Ga0105246_10002169 3300011119 Bacteria 11849
760 Ga0105246_10253142 3300011119 Bacteria 1399
761 Ga0105246_10338657 3300011119 Bacteria 1228
762 Ga0105246_10462946 3300011119 Bacteria 1068
763 Ga0105246_10590327 3300011119 Bacteria 958
764 Ga0157326_1005286 3300012513 Bacteria 1362
765 Ga0157338_1004667 3300012515 Bacteria 1196
766 Ga0157373_10001947 3300013100 Bacteria 15673
767 Ga0157373_10009729 3300013100 Bacteria 7094
768 Ga0157373_10043061 3300013100 Bacteria 3225
769 Ga0157373_10503217 3300013100 Bacteria 875
770 Ga0157371_10000281 3300013102 Bacteria 68624
771 Ga0157370_10000758 3300013104 Bacteria 40311
772 Ga0157370_10003818 3300013104 Bacteria 17571
773 Ga0157370_10018565 3300013104 Bacteria 6991
774 Ga0157370_10076676 3300013104 Bacteria 3149
775 Ga0157370_10134764 3300013104 Bacteria 2302
776 Ga0157370_10259109 3300013104 Bacteria 1607
777 Ga0157370_10413522 3300013104 Bacteria 1241
778 Ga0157369_10016214 3300013105 Bacteria 8386
779 Ga0157369_10016964 3300013105 Bacteria 8183
780 Ga0157369_10024565 3300013105 Bacteria 6700
781 Ga0157369_10062042 3300013105 Bacteria 4029
782 Ga0157369_10137939 3300013105 Bacteria 2581
783 Ga0157369_10273477 3300013105 Bacteria 1760
784 Ga0157369_10604222 3300013105 Bacteria 1132
785 Ga0171463_1007 3300013249 Bacteria 301198
786 Ga0157374_10004057 3300013296 Bacteria 12300
787 Ga0157374_10046486 3300013296 Bacteria 4020
788 Ga0157374_10152153 3300013296 Bacteria 2250
789 Ga0157374_10381418 3300013296 Bacteria 1404
790 Ga0157374_10407843 3300013296 Bacteria 1356
791 Ga0157374_10874981 3300013296 Bacteria 916
792 Ga0157378_10006674 3300013297 Bacteria 10082
793 Ga0157378_10045538 3300013297 Bacteria 3898
794 Ga0157378_10101445 3300013297 Bacteria 2628
795 Ga0157378_10102404 3300013297 Bacteria 2615
796 Ga0157378_10109215 3300013297 Bacteria 2533
797 Ga0157378_10110261 3300013297 Bacteria 2522
798 Ga0163162_10016637 3300013306 Bacteria 7188
799 Ga0163162_10021320 3300013306 Bacteria 6379
800 Ga0163162_10029014 3300013306 Bacteria 5475
801 Ga0163162_10049302 3300013306 Bacteria 4220
802 Ga0163162_10063796 3300013306 Bacteria 3728
803 Ga0163162_10131787 3300013306 Bacteria 2608
804 Ga0163162_10175750 3300013306 Bacteria 2267
805 Ga0163162_10309489 3300013306 Bacteria 1712
806 Ga0163162_10321047 3300013306 Bacteria 1681
807 Ga0163162_10393846 3300013306 Bacteria 1518
808 Ga0163162_10399422 3300013306 Bacteria 1507
809 Ga0163162_10562446 3300013306 Bacteria 1268
810 Ga0157372_10004406 3300013307 Bacteria 15014
811 Ga0157372_10053498 3300013307 Bacteria 4500
812 Ga0157372_11167518 3300013307 Bacteria 890
813 Ga0157375_10013529 3300013308 Bacteria 7264
814 Ga0157375_10014936 3300013308 Bacteria 6943
815 Ga0157375_10069081 3300013308 Bacteria 3538
816 Ga0157375_10080667 3300013308 Bacteria 3293
817 Ga0157375_10083336 3300013308 Bacteria 3242
818 Ga0157375_10173065 3300013308 Bacteria 2307
819 Ga0157375_10406734 3300013308 Bacteria 1527
820 Ga0157375_10490362 3300013308 Bacteria 1393
821 Ga0157375_10862573 3300013308 Bacteria 1051
822 Ga0157375_11218101 3300013308 Bacteria 883
823 Ga0163163_10001632 3300014325 Bacteria 18868
824 Ga0163163_10002519 3300014325 Bacteria 15508
825 Ga0163163_10057729 3300014325 Bacteria 3838
826 Ga0163163_10107222 3300014325 Bacteria 2820
827 Ga0163163_10242087 3300014325 Bacteria 1854
828 Ga0163163_10346613 3300014325 Bacteria 1541
829 Ga0163163_10392888 3300014325 Bacteria 1445
830 Ga0163163_10620127 3300014325 Bacteria 1145
831 Ga0157380_10005754 3300014326 Bacteria 8675
832 Ga0157380_10011551 3300014326 Bacteria 6382
833 Ga0157380_10021745 3300014326 Bacteria 4817
834 Ga0157380_10081370 3300014326 Bacteria 2649
835 Ga0157380_10201757 3300014326 Bacteria 1765
836 Ga0157380_10518073 3300014326 Bacteria 1162
837 Ga0182008_10009235 3300014497 Bacteria 5331
838 Ga0182008_10015180 3300014497 Bacteria 4023
839 Ga0182008_10018126 3300014497 Bacteria 3647
840 Ga0182008_10040083 3300014497 Bacteria 2340
841 Ga0182008_10057401 3300014497 Bacteria 1922
842 Ga0157377_10007749 3300014745 Bacteria 5202
843 Ga0157377_10122687 3300014745 Bacteria 1577
844 Ga0157377_10427455 3300014745 Bacteria 909
845 Ga0157379_10001714 3300014968 Bacteria 18145
846 Ga0157379_10003508 3300014968 Bacteria 13279
847 Ga0157379_10020827 3300014968 Bacteria 5804
848 Ga0157379_10023488 3300014968 Bacteria 5473
849 Ga0157379_10030392 3300014968 Bacteria 4808
850 Ga0157379_10110343 3300014968 Bacteria 2470
851 Ga0157379_10201212 3300014968 Bacteria 1801
852 Ga0157379_10264934 3300014968 Bacteria 1562
853 Ga0157376_10012925 3300014969 Bacteria 6213
854 Ga0157376_10025170 3300014969 Bacteria 4684
855 Ga0157376_10377135 3300014969 Bacteria 1365
856 Ga0157376_10749176 3300014969 Bacteria 986
857 Ga0157376_11021805 3300014969 Bacteria 850
858 Ga0182006_1000757 3300015261 Bacteria 22069
859 Ga0182006_1034530 3300015261 Bacteria 2022
860 Ga0182007_10001344 3300015262 Bacteria 13263
861 Ga0182007_10001622 3300015262 Bacteria 11922
862 Ga0182007_10076443 3300015262 Bacteria 1098
863 Ga0182005_1000525 3300015265 Bacteria 19487
864 Ga0182005_1002502 3300015265 Bacteria 6526
865 Ga0182005_1014364 3300015265 Bacteria 2215
866 Ga0182005_1065658 3300015265 Bacteria 993
867 Ga0183362_10004 3300015683 Bacteria 569303
868 Ga0183363_1153 3300015690 Bacteria 17205
869 Ga0163161_10050964 3300017792 Bacteria 2997
870 Ga0163161_10244960 3300017792 Bacteria 1395
871 Ga0214544_1000002 3300021320 Bacteria 753857
872 Ga0214542_1000001 3300021321 Bacteria 1018696
873 Ga0214545_1000001 3300021324 Bacteria 1092817
874 Ga0214543_1000001 3300021327 Bacteria 776921
875 Ga0213872_10000518 3300021361 Bacteria 30402
876 Ga0213872_10005444 3300021361 Bacteria 6549
877 Ga0213872_10146833 3300021361 Bacteria 1032
878 Ga0213871_10067367 3300021441 Bacteria 1006
879 Ga0224712_10000233 3300022467 Bacteria 10080
880 Ga0224712_10001202 3300022467 Bacteria 5813
881 Ga0224712_10001870 3300022467 Bacteria 5055
882 Ga0224712_10067892 3300022467 Bacteria 1440
883 Ga0209760_100047 3300025207 Bacteria 107520
884 Ga0209760_108054 3300025207 Bacteria 780
885 Ga0209436_100059 3300025208 Bacteria 60623
886 Ga0209436_101427 3300025208 Bacteria 8393
887 Ga0209436_104658 3300025208 Bacteria 3339
888 Ga0209436_111587 3300025208 Bacteria 1541
889 Ga0209436_113890 3300025208 Bacteria 1301
890 Ga0209784_100004 3300025224 Bacteria 1378156
891 Ga0209784_100024 3300025224 Bacteria 394613
892 Ga0209566_100004 3300025225 Bacteria 1531866
893 Ga0209566_100018 3300025225 Bacteria 448638
894 Ga0209566_100724 3300025225 Bacteria 18730
895 Ga0209674_100006 3300025226 Bacteria 1531866
896 Ga0209674_100046 3300025226 Bacteria 357920
897 Ga0209674_101530 3300025226 Bacteria 5950
898 Ga0209672_100040 3300025228 Bacteria 278858
899 Ga0209147_100037 3300025229 Bacteria 326977
900 Ga0209147_100048 3300025229 Bacteria 278858
901 Ga0209563_100009 3300025230 Bacteria 1378156
902 Ga0209563_100039 3300025230 Bacteria 409717
903 Ga0209563_100090 3300025230 Bacteria 169322
904 Ga0207427_100029 3300025231 Bacteria 376678
905 Ga0207427_102311 3300025231 Bacteria 5267
906 Ga0209437_100004 3300025233 Bacteria 1378156
907 Ga0209437_100009 3300025233 Bacteria 915954
908 Ga0209437_100022 3300025233 Bacteria 625694
909 Ga0209258_100070 3300025242 Bacteria 278858
910 Ga0207425_1000001 3300025245 Bacteria 2525432
911 Ga0207425_1002122 3300025245 Bacteria 7289
912 Ga0207425_1003481 3300025245 Bacteria 5015
913 Ga0207425_1013748 3300025245 Bacteria 1858
914 Ga0209646_1000148 3300025246 Bacteria 101083
915 Ga0209646_1006777 3300025246 Bacteria 1906
916 Ga0209646_1007597 3300025246 Bacteria 1763
917 Ga0209646_1011532 3300025246 Bacteria 1367
918 Ga0209026_1000024 3300025250 Bacteria 355839
919 Ga0209677_100005 3300025253 Bacteria 1378156
920 Ga0209677_100024 3300025253 Bacteria 406035
921 Ga0209677_102058 3300025253 Bacteria 7950
922 Ga0209677_105071 3300025253 Bacteria 3561
923 Ga0209677_112153 3300025253 Bacteria 1296
924 Ga0209148_1000050 3300025254 Bacteria 413178
925 Ga0209148_1000311 3300025254 Bacteria 69457
926 Ga0209148_1000689 3300025254 Bacteria 27804
927 Ga0209759_1002587 3300025256 Bacteria 7823
928 Ga0209759_1017592 3300025256 Bacteria 1757
929 Ga0209129_1000001 3300025258 Bacteria 1452436
930 Ga0209129_1001284 3300025258 Bacteria 14344
931 Ga0209129_1002137 3300025258 Bacteria 10024
932 Ga0209129_1003531 3300025258 Bacteria 6749
933 Ga0209129_1004963 3300025258 Bacteria 4929
934 Ga0209129_1014726 3300025258 Bacteria 1650
935 Ga0209233_1000005 3300025261 Bacteria 1531866
936 Ga0209233_1000031 3300025261 Bacteria 624646
937 Ga0209233_1000032 3300025261 Bacteria 623596
938 Ga0209233_1000161 3300025261 Bacteria 158607
939 Ga0209233_1002879 3300025261 Bacteria 6153
940 Ga0209233_1004223 3300025261 Bacteria 4922
941 Ga0209233_1013320 3300025261 Bacteria 2351
942 Ga0209565_1000167 3300025263 Bacteria 85246
943 Ga0209565_1000506 3300025263 Bacteria 28337
944 Ga0209565_1002339 3300025263 Bacteria 6926
945 Ga0209565_1005322 3300025263 Bacteria 3757
946 Ga0209565_1013952 3300025263 Bacteria 1863
947 Ga0209565_1014319 3300025263 Bacteria 1826
948 Ga0209565_1030578 3300025263 Bacteria 1051
949 Ga0209455_1000183 3300025272 Bacteria 99952
950 Ga0209455_1000351 3300025272 Bacteria 43193
951 Ga0209455_1000483 3300025272 Bacteria 29472
952 Ga0209455_1000549 3300025272 Bacteria 25580
953 Ga0209455_1009579 3300025272 Bacteria 2532
954 Ga0209673_1000051 3300025273 Bacteria 282161
955 Ga0209673_1000351 3300025273 Bacteria 84009
956 Ga0209673_1000522 3300025273 Bacteria 62876
957 Ga0209673_1001992 3300025273 Bacteria 15810
958 Ga0209673_1004076 3300025273 Bacteria 8057
959 Ga0209673_1006656 3300025273 Bacteria 5519
960 Ga0209130_1000004 3300025284 Bacteria 633436
961 Ga0209130_1000017 3300025284 Bacteria 388431
962 Ga0209130_1000091 3300025284 Bacteria 149502
963 Ga0209130_1000219 3300025284 Bacteria 74906
964 Ga0209130_1000565 3300025284 Bacteria 36601
965 Ga0209130_1005513 3300025284 Bacteria 4361
966 Ga0209675_1000027 3300025291 Bacteria 282175
967 Ga0209675_1001526 3300025291 Bacteria 13222
968 Ga0209675_1002032 3300025291 Bacteria 10809
969 Ga0209675_1014230 3300025291 Bacteria 2433
970 Ga0209675_1050630 3300025291 Bacteria 859
971 Ga0209676_1000032 3300025292 Bacteria 469558
972 Ga0209676_1002673 3300025292 Bacteria 12084
973 Ga0209676_1003015 3300025292 Bacteria 10952
974 Ga0209025_1000099 3300025294 Bacteria 231353
975 Ga0209025_1000153 3300025294 Bacteria 170548
976 Ga0209025_1000828 3300025294 Bacteria 49257
977 Ga0209025_1003821 3300025294 Bacteria 13747
978 Ga0209025_1028384 3300025294 Bacteria 2744
979 Ga0209025_1030189 3300025294 Bacteria 2601
980 Ga0209025_1031166 3300025294 Bacteria 2530
981 Ga0209025_1048922 3300025294 Bacteria 1708
982 Ga0209564_1000094 3300025295 Bacteria 243176
983 Ga0209564_1000362 3300025295 Bacteria 84376
984 Ga0209564_1000370 3300025295 Bacteria 83874
985 Ga0209564_1000372 3300025295 Bacteria 83053
986 Ga0209564_1005207 3300025295 Bacteria 7526
987 Ga0209564_1006917 3300025295 Bacteria 5968
988 Ga0209564_1027899 3300025295 Bacteria 1820
989 Ga0209758_1000073 3300025297 Bacteria 276262
990 Ga0209758_1000770 3300025297 Bacteria 46037
991 Ga0209758_1000983 3300025297 Bacteria 38351
992 Ga0209758_1001597 3300025297 Bacteria 25919
993 Ga0209758_1002834 3300025297 Bacteria 16851
994 Ga0209758_1009519 3300025297 Bacteria 6017
995 Ga0209758_1025302 3300025297 Bacteria 2609
996 Ga0209050_1000025 3300025298 Bacteria 528225
997 Ga0209050_1000046 3300025298 Bacteria 386466
998 Ga0209050_1000782 3300025298 Bacteria 45306
999 Ga0209050_1001654 3300025298 Bacteria 22679
1000 Ga0209050_1002669 3300025298 Bacteria 14559
1001 Ga0209050_1003720 3300025298 Bacteria 10975
1002 Ga0209050_1005042 3300025298 Bacteria 8554
1003 Ga0209256_1000044 3300025299 Bacteria 337264
1004 Ga0209256_1000051 3300025299 Bacteria 307241
1005 Ga0209256_1000257 3300025299 Bacteria 94317
1006 Ga0209256_1000265 3300025299 Bacteria 92716
1007 Ga0209256_1000349 3300025299 Bacteria 75062
1008 Ga0209256_1000401 3300025299 Bacteria 68618
1009 Ga0209256_1000467 3300025299 Bacteria 60978
1010 Ga0209256_1005032 3300025299 Bacteria 7889
1011 Ga0209256_1005739 3300025299 Bacteria 6956
1012 Ga0209256_1006154 3300025299 Bacteria 6491
1013 Ga0209256_1011544 3300025299 Bacteria 3513
1014 Ga0209256_1024210 3300025299 Bacteria 1792
1015 Ga0209256_1056444 3300025299 Bacteria 929
1016 Ga0207426_1000003 3300025302 Bacteria 1063212
1017 Ga0207426_1000006 3300025302 Bacteria 1025969
1018 Ga0207426_1000065 3300025302 Bacteria 353625
1019 Ga0207426_1000075 3300025302 Bacteria 321337
1020 Ga0207426_1000387 3300025302 Bacteria 75536
1021 Ga0207426_1001109 3300025302 Bacteria 24735
1022 Ga0207426_1001540 3300025302 Bacteria 18739
1023 Ga0209051_1000025 3300025303 Bacteria 415397
1024 Ga0209051_1000039 3300025303 Bacteria 319632
1025 Ga0209051_1000047 3300025303 Bacteria 293227
1026 Ga0209051_1000079 3300025303 Bacteria 201183
1027 Ga0209051_1000418 3300025303 Bacteria 58817
1028 Ga0209051_1003452 3300025303 Bacteria 10357
1029 Ga0209051_1003587 3300025303 Bacteria 10095
1030 Ga0209051_1008212 3300025303 Bacteria 5563
1031 Ga0209051_1016244 3300025303 Bacteria 3382
1032 Ga0209051_1031189 3300025303 Bacteria 2055
1033 Ga0209051_1065377 3300025303 Bacteria 1122
1034 Ga0209257_1000016 3300025304 Bacteria 908015
1035 Ga0209257_1000039 3300025304 Bacteria 591694
1036 Ga0209257_1000068 3300025304 Bacteria 341291
1037 Ga0209257_1000183 3300025304 Bacteria 156618
1038 Ga0209257_1009889 3300025304 Bacteria 4977
1039 Ga0209257_1016227 3300025304 Bacteria 3028
1040 Ga0207697_10029675 3300025315 Bacteria 2239
1041 Ga0207656_10010305 3300025321 Bacteria 3498
1042 Ga0207656_10177812 3300025321 Bacteria 1020
1043 Ga0207656_10194131 3300025321 Bacteria 979
1044 Ga0207655_1001842 3300025728 Bacteria 18335
1045 Ga0207655_1006055 3300025728 Bacteria 8082
1046 Ga0207655_1011081 3300025728 Bacteria 5404
1047 Ga0207655_1027269 3300025728 Bacteria 2724
1048 Ga0207713_1010112 3300025735 Bacteria 5248
1049 Ga0207713_1039951 3300025735 Bacteria 1974
1050 Ga0207713_1072831 3300025735 Bacteria 1263
1051 Ga0207653_10002361 3300025885 Bacteria 6017
1052 Ga0207682_10026461 3300025893 Bacteria 2306
1053 Ga0207682_10043796 3300025893 Bacteria 1833
1054 Ga0207692_10000670 3300025898 Bacteria 12066
1055 Ga0207692_10002135 3300025898 Bacteria 7550
1056 Ga0207642_10344608 3300025899 Bacteria 877
1057 Ga0207710_10014376 3300025900 Bacteria 3337
1058 Ga0207710_10019559 3300025900 Bacteria 2889
1059 Ga0207710_10032805 3300025900 Bacteria 2276
1060 Ga0207710_10035090 3300025900 Bacteria 2206
1061 Ga0207710_10131632 3300025900 Bacteria 1202
1062 Ga0207688_10015608 3300025901 Bacteria 4118
1063 Ga0207688_10048415 3300025901 Bacteria 2375
1064 Ga0207688_10077534 3300025901 Bacteria 1894
1065 Ga0207680_10013415 3300025903 Bacteria 4208
1066 Ga0207680_10027837 3300025903 Bacteria 3154
1067 Ga0207647_10007948 3300025904 Bacteria 7625
1068 Ga0207647_10010522 3300025904 Bacteria 6530
1069 Ga0207647_10034320 3300025904 Bacteria 3240
1070 Ga0207685_10101122 3300025905 Bacteria 1233
1071 Ga0207685_10125583 3300025905 Bacteria 1132
1072 Ga0207699_10001071 3300025906 Bacteria 12937
1073 Ga0207699_10001673 3300025906 Bacteria 10501
1074 Ga0207645_10147021 3300025907 Bacteria 1537
1075 Ga0207645_10247814 3300025907 Bacteria 1178
1076 Ga0207643_10007787 3300025908 Bacteria 5753
1077 Ga0207643_10172979 3300025908 Bacteria 1304
1078 Ga0207643_10196813 3300025908 Bacteria 1226
1079 Ga0207705_10105536 3300025909 Bacteria 2077
1080 Ga0207705_10148077 3300025909 Bacteria 1757
1081 Ga0207705_10243246 3300025909 Bacteria 1371
1082 Ga0207705_10274363 3300025909 Bacteria 1290
1083 Ga0207705_10345601 3300025909 Bacteria 1145
1084 Ga0207705_10503104 3300025909 Bacteria 941
1085 Ga0207705_10516243 3300025909 Bacteria 928
1086 Ga0207684_10004126 3300025910 Bacteria 13829
1087 Ga0207684_10005128 3300025910 Bacteria 12201
1088 Ga0207684_10019121 3300025910 Bacteria 5859
1089 Ga0207684_10090594 3300025910 Bacteria 2606
1090 Ga0207654_10012434 3300025911 Bacteria 4361
1091 Ga0207654_10032756 3300025911 Bacteria 2875
1092 Ga0207654_10074027 3300025911 Bacteria 2032
1093 Ga0207654_10306942 3300025911 Bacteria 1081
1094 Ga0207707_10007364 3300025912 Bacteria 9583
1095 Ga0207707_10012064 3300025912 Bacteria 7516
1096 Ga0207707_10062460 3300025912 Bacteria 3241
1097 Ga0207707_10076309 3300025912 Bacteria 2925
1098 Ga0207695_10000097 3300025913 Bacteria 262517
1099 Ga0207695_10087770 3300025913 Bacteria 3133
1100 Ga0207695_10189999 3300025913 Bacteria 1971
1101 Ga0207671_10000289 3300025914 Bacteria 74385
1102 Ga0207671_10009421 3300025914 Bacteria 8166
1103 Ga0207671_10013183 3300025914 Bacteria 6598
1104 Ga0207671_10026951 3300025914 Bacteria 4300
1105 Ga0207671_10043314 3300025914 Bacteria 3329
1106 Ga0207693_10115338 3300025915 Bacteria 2109
1107 Ga0207663_10001416 3300025916 Bacteria 11129
1108 Ga0207663_10004294 3300025916 Bacteria 7076
1109 Ga0207663_10005704 3300025916 Bacteria 6299
1110 Ga0207663_10070938 3300025916 Bacteria 2246
1111 Ga0207663_10099050 3300025916 Bacteria 1953
1112 Ga0207663_10189051 3300025916 Bacteria 1477
1113 Ga0207660_10003393 3300025917 Bacteria 10382
1114 Ga0207660_10055450 3300025917 Bacteria 2832
1115 Ga0207660_10094588 3300025917 Bacteria 2221
1116 Ga0207660_10125121 3300025917 Bacteria 1951
1117 Ga0207662_10191174 3300025918 Bacteria 1321
1118 Ga0207657_10000155 3300025919 Bacteria 70060
1119 Ga0207657_10005499 3300025919 Bacteria 13230
1120 Ga0207657_10012946 3300025919 Bacteria 8202
1121 Ga0207657_10034421 3300025919 Bacteria 4555
1122 Ga0207657_10087906 3300025919 Bacteria 2599
1123 Ga0207657_10254064 3300025919 Bacteria 1400
1124 Ga0207649_10453179 3300025920 Bacteria 969
1125 Ga0207652_10003525 3300025921 Bacteria 12905
1126 Ga0207652_10058466 3300025921 Bacteria 3322
1127 Ga0207652_10103027 3300025921 Bacteria 2523
1128 Ga0207652_10225136 3300025921 Bacteria 1690
1129 Ga0207652_10277445 3300025921 Bacteria 1512
1130 Ga0207646_10009547 3300025922 Bacteria 9580
1131 Ga0207646_10101937 3300025922 Bacteria 2573
1132 Ga0207681_10059033 3300025923 Bacteria 2629
1133 Ga0207681_10098654 3300025923 Bacteria 2102
1134 Ga0207681_10120291 3300025923 Bacteria 1925
1135 Ga0207681_10131810 3300025923 Bacteria 1849
1136 Ga0207681_10163901 3300025923 Bacteria 1678
1137 Ga0207681_10332781 3300025923 Bacteria 1211
1138 Ga0207694_10006772 3300025924 Bacteria 8701
1139 Ga0207694_10021236 3300025924 Bacteria 4918
1140 Ga0207694_10052146 3300025924 Bacteria 3171
1141 Ga0207694_10070471 3300025924 Bacteria 2731
1142 Ga0207694_10081625 3300025924 Bacteria 2540
1143 Ga0207694_10112604 3300025924 Bacteria 2165
1144 Ga0207694_10345719 3300025924 Bacteria 1230
1145 Ga0207650_10021229 3300025925 Bacteria 4591
1146 Ga0207650_10060286 3300025925 Bacteria 2832
1147 Ga0207650_10110141 3300025925 Bacteria 2130
1148 Ga0207659_10007943 3300025926 Bacteria 6561
1149 Ga0207659_10017421 3300025926 Bacteria 4694
1150 Ga0207659_10028047 3300025926 Bacteria 3820
1151 Ga0207659_10064785 3300025926 Bacteria 2646
1152 Ga0207659_10338203 3300025926 Bacteria 1246
1153 Ga0207687_10014427 3300025927 Bacteria 5170
1154 Ga0207687_10033459 3300025927 Bacteria 3487
1155 Ga0207687_10067935 3300025927 Bacteria 2537
1156 Ga0207687_10198623 3300025927 Bacteria 1566
1157 Ga0207687_10299403 3300025927 Bacteria 1295
1158 Ga0207687_10538702 3300025927 Bacteria 978
1159 Ga0207700_10037721 3300025928 Bacteria 3502
1160 Ga0207700_10043703 3300025928 Bacteria 3293
1161 Ga0207700_10783809 3300025928 Bacteria 852
1162 Ga0207664_10014742 3300025929 Bacteria 5656
1163 Ga0207664_10025256 3300025929 Bacteria 4473
1164 Ga0207664_10156933 3300025929 Bacteria 1938
1165 Ga0207664_10182542 3300025929 Bacteria 1802
1166 Ga0207664_10213927 3300025929 Bacteria 1669
1167 Ga0207644_10067016 3300025931 Bacteria 2615
1168 Ga0207644_10071079 3300025931 Bacteria 2545
1169 Ga0207644_10095341 3300025931 Bacteria 2225
1170 Ga0207644_10131856 3300025931 Bacteria 1914
1171 Ga0207644_10164953 3300025931 Bacteria 1725
1172 Ga0207644_10222891 3300025931 Bacteria 1495
1173 Ga0207644_10303479 3300025931 Bacteria 1287
1174 Ga0207644_10353017 3300025931 Bacteria 1194
1175 Ga0207690_10000016 3300025932 Bacteria 256657
1176 Ga0207690_10043249 3300025932 Bacteria 2963
1177 Ga0207690_10101491 3300025932 Bacteria 2055
1178 Ga0207690_10166354 3300025932 Bacteria 1648
1179 Ga0207690_10202883 3300025932 Bacteria 1507
1180 Ga0207690_10389725 3300025932 Bacteria 1109
1181 Ga0207690_10392541 3300025932 Bacteria 1105
1182 Ga0207690_10407862 3300025932 Bacteria 1085
1183 Ga0207706_10010244 3300025933 Bacteria 8572
1184 Ga0207706_10031079 3300025933 Bacteria 4759
1185 Ga0207706_10055884 3300025933 Bacteria 3480
1186 Ga0207706_10134855 3300025933 Bacteria 2172
1187 Ga0207706_10248429 3300025933 Bacteria 1554
1188 Ga0207686_10388674 3300025934 Bacteria 1060
1189 Ga0207686_10470818 3300025934 Bacteria 970
1190 Ga0207709_10192545 3300025935 Bacteria 1450
1191 Ga0207709_10365662 3300025935 Bacteria 1093
1192 Ga0207670_10005962 3300025936 Bacteria 6728
1193 Ga0207670_10191842 3300025936 Bacteria 1546
1194 Ga0207670_10451246 3300025936 Bacteria 1037
1195 Ga0207669_10014715 3300025937 Bacteria 3928
1196 Ga0207669_10061996 3300025937 Bacteria 2301
1197 Ga0207669_10110898 3300025937 Bacteria 1838
1198 Ga0207669_10144707 3300025937 Bacteria 1656
1199 Ga0207669_10402028 3300025937 Bacteria 1073
1200 Ga0207704_10072532 3300025938 Bacteria 2189
1201 Ga0207704_10315275 3300025938 Bacteria 1204
1202 Ga0207704_10561511 3300025938 Bacteria 929
1203 Ga0207665_10006290 3300025939 Bacteria 7876
1204 Ga0207665_10010762 3300025939 Bacteria 6006
1205 Ga0207665_10055187 3300025939 Bacteria 2680
1206 Ga0207665_10089693 3300025939 Bacteria 2130
1207 Ga0207691_10002059 3300025940 Bacteria 19656
1208 Ga0207691_10037781 3300025940 Bacteria 4470
1209 Ga0207691_10062558 3300025940 Bacteria 3376
1210 Ga0207691_10072106 3300025940 Bacteria 3116
1211 Ga0207691_10096617 3300025940 Bacteria 2641
1212 Ga0207691_10170671 3300025940 Bacteria 1905
1213 Ga0207711_10000895 3300025941 Bacteria 28682
1214 Ga0207711_10004656 3300025941 Bacteria 11650
1215 Ga0207711_10008469 3300025941 Bacteria 8604
1216 Ga0207711_10029507 3300025941 Bacteria 4627
1217 Ga0207711_10081967 3300025941 Bacteria 2820
1218 Ga0207711_10110908 3300025941 Bacteria 2440
1219 Ga0207711_10228974 3300025941 Bacteria 1702
1220 Ga0207711_10249682 3300025941 Bacteria 1629
1221 Ga0207711_10541320 3300025941 Bacteria 1086
1222 Ga0207689_10007870 3300025942 Bacteria 9312
1223 Ga0207689_10031032 3300025942 Bacteria 4452
1224 Ga0207689_10067917 3300025942 Bacteria 2929
1225 Ga0207689_10323279 3300025942 Bacteria 1280
1226 Ga0207689_10445033 3300025942 Bacteria 1082
1227 Ga0207661_10013228 3300025944 Bacteria 6025
1228 Ga0207661_10027967 3300025944 Bacteria 4314
1229 Ga0207661_10046528 3300025944 Bacteria 3440
1230 Ga0207661_10146305 3300025944 Bacteria 2039
1231 Ga0207661_10399641 3300025944 Bacteria 1246
1232 Ga0207661_10415301 3300025944 Bacteria 1222
1233 Ga0207661_10647801 3300025944 Bacteria 971
1234 Ga0207679_10003944 3300025945 Bacteria 9216
1235 Ga0207679_10005110 3300025945 Bacteria 8206
1236 Ga0207679_10009475 3300025945 Bacteria 6240
1237 Ga0207679_10100378 3300025945 Bacteria 2262
1238 Ga0207679_10467659 3300025945 Bacteria 1121
1239 Ga0207679_10616421 3300025945 Bacteria 979
1240 Ga0207667_10011485 3300025949 Bacteria 10287
1241 Ga0207667_10014677 3300025949 Bacteria 8919
1242 Ga0207667_10023627 3300025949 Bacteria 6766
1243 Ga0207667_10103342 3300025949 Bacteria 2939
1244 Ga0207667_10186196 3300025949 Bacteria 2131
1245 Ga0207667_10233898 3300025949 Bacteria 1881
1246 Ga0207667_10296827 3300025949 Bacteria 1651
1247 Ga0207651_10006206 3300025960 Bacteria 6224
1248 Ga0207651_10060520 3300025960 Bacteria 2629
1249 Ga0207651_10073900 3300025960 Bacteria 2426
1250 Ga0207651_10121289 3300025960 Bacteria 1983
1251 Ga0207651_10584876 3300025960 Bacteria 974
1252 Ga0207712_10000055 3300025961 Bacteria 146438
1253 Ga0207712_10006090 3300025961 Bacteria 7610
1254 Ga0207712_10007926 3300025961 Bacteria 6710
1255 Ga0207712_10012350 3300025961 Bacteria 5457
1256 Ga0207712_10046519 3300025961 Bacteria 3009
1257 Ga0207712_10125911 3300025961 Bacteria 1945
1258 Ga0207712_10239435 3300025961 Bacteria 1461
1259 Ga0207712_10345521 3300025961 Bacteria 1235
1260 Ga0207712_10462241 3300025961 Bacteria 1078
1261 Ga0207668_10000183 3300025972 Bacteria 42578
1262 Ga0207668_10362834 3300025972 Bacteria 1214
1263 Ga0207668_10686215 3300025972 Bacteria 899
1264 Ga0207640_10197968 3300025981 Bacteria 1520
1265 Ga0207640_10350625 3300025981 Bacteria 1186
1266 Ga0207658_10000875 3300025986 Bacteria 25122
1267 Ga0207658_10046420 3300025986 Bacteria 3172
1268 Ga0207658_10519582 3300025986 Bacteria 1062
1269 Ga0207677_10014387 3300026023 Bacteria 4619
1270 Ga0207677_10031537 3300026023 Bacteria 3395
1271 Ga0207677_10066822 3300026023 Bacteria 2516
1272 Ga0207677_10129867 3300026023 Bacteria 1911
1273 Ga0207677_10228682 3300026023 Bacteria 1497
1274 Ga0207677_10425699 3300026023 Bacteria 1132
1275 Ga0207703_10003104 3300026035 Bacteria 14035
1276 Ga0207703_10012761 3300026035 Bacteria 6551
1277 Ga0207703_10135055 3300026035 Bacteria 2135
1278 Ga0207703_10136851 3300026035 Bacteria 2121
1279 Ga0207703_10176371 3300026035 Bacteria 1883
1280 Ga0207703_10318401 3300026035 Bacteria 1424
1281 Ga0207703_10325451 3300026035 Bacteria 1409
1282 Ga0207703_10796455 3300026035 Bacteria 902
1283 Ga0207703_10888794 3300026035 Bacteria 853
1284 Ga0207703_10932961 3300026035 Bacteria 832
1285 Ga0207639_10206693 3300026041 Bacteria 1687
1286 Ga0207639_10280651 3300026041 Bacteria 1465
1287 Ga0207639_10283211 3300026041 Bacteria 1459
1288 Ga0207678_10002024 3300026067 Bacteria 18413
1289 Ga0207678_10002790 3300026067 Bacteria 15845
1290 Ga0207678_10006965 3300026067 Bacteria 10035
1291 Ga0207678_10032328 3300026067 Bacteria 4559
1292 Ga0207678_10050675 3300026067 Bacteria 3586
1293 Ga0207678_10076585 3300026067 Bacteria 2865
1294 Ga0207678_10253515 3300026067 Bacteria 1507
1295 Ga0207708_10021858 3300026075 Bacteria 4827
1296 Ga0207708_10029046 3300026075 Bacteria 4189
1297 Ga0207708_10128033 3300026075 Bacteria 1983
1298 Ga0207702_10012957 3300026078 Bacteria 6936
1299 Ga0207702_10057012 3300026078 Bacteria 3319
1300 Ga0207702_10081341 3300026078 Bacteria 2813
1301 Ga0207702_10157748 3300026078 Bacteria 2070
1302 Ga0207702_10164314 3300026078 Bacteria 2029
1303 Ga0207702_10193667 3300026078 Bacteria 1880
1304 Ga0207702_10394766 3300026078 Bacteria 1333
1305 Ga0207641_10000578 3300026088 Bacteria 40331
1306 Ga0207641_10004073 3300026088 Bacteria 12746
1307 Ga0207641_10017424 3300026088 Bacteria 5880
1308 Ga0207641_10019155 3300026088 Bacteria 5613
1309 Ga0207641_10069256 3300026088 Bacteria 3028
1310 Ga0207641_10126157 3300026088 Bacteria 2291
1311 Ga0207641_10146973 3300026088 Bacteria 2132
1312 Ga0207641_10229736 3300026088 Bacteria 1724
1313 Ga0207641_10669134 3300026088 Bacteria 1021
1314 Ga0207641_10692950 3300026088 Bacteria 1003
1315 Ga0207641_10980188 3300026088 Bacteria 841
1316 Ga0207648_10002166 3300026089 Bacteria 21346
1317 Ga0207648_10008252 3300026089 Bacteria 10109
1318 Ga0207648_10023229 3300026089 Bacteria 5561
1319 Ga0207648_10055624 3300026089 Bacteria 3454
1320 Ga0207648_10072250 3300026089 Bacteria 3007
1321 Ga0207648_10097358 3300026089 Bacteria 2575
1322 Ga0207648_10183478 3300026089 Bacteria 1852
1323 Ga0207648_10202652 3300026089 Bacteria 1760
1324 Ga0207648_10570237 3300026089 Bacteria 1041
1325 Ga0207676_10000073 3300026095 Bacteria 101510
1326 Ga0207676_10001562 3300026095 Bacteria 16890
1327 Ga0207676_10003095 3300026095 Bacteria 11865
1328 Ga0207676_10007877 3300026095 Bacteria 7577
1329 Ga0207676_10035417 3300026095 Bacteria 3788
1330 Ga0207676_10088569 3300026095 Bacteria 2534
1331 Ga0207676_10308616 3300026095 Bacteria 1447
1332 Ga0207676_10381432 3300026095 Bacteria 1312
1333 Ga0207676_10512045 3300026095 Bacteria 1141
1334 Ga0207676_10587822 3300026095 Bacteria 1068
1335 Ga0207674_10002499 3300026116 Bacteria 23190
1336 Ga0207674_10028670 3300026116 Bacteria 5872
1337 Ga0207674_10037955 3300026116 Bacteria 5004
1338 Ga0207674_10052615 3300026116 Bacteria 4153
1339 Ga0207674_10053405 3300026116 Bacteria 4119
1340 Ga0207674_10073221 3300026116 Bacteria 3439
1341 Ga0207674_10075973 3300026116 Bacteria 3368
1342 Ga0207674_10085922 3300026116 Bacteria 3140
1343 Ga0207674_11119899 3300026116 Bacteria 757
1344 Ga0207675_100007680 3300026118 Bacteria 10175
1345 Ga0207675_100027051 3300026118 Bacteria 5340
1346 Ga0207675_100035751 3300026118 Bacteria 4633
1347 Ga0207675_100049695 3300026118 Bacteria 3913
1348 Ga0207675_100052547 3300026118 Bacteria 3802
1349 Ga0207675_100089771 3300026118 Bacteria 2888
1350 Ga0207675_100223136 3300026118 Bacteria 1816
1351 Ga0207683_10004441 3300026121 Bacteria 12116
1352 Ga0207683_10012070 3300026121 Bacteria 7377
1353 Ga0207683_10050351 3300026121 Bacteria 3648
1354 Ga0207683_10074144 3300026121 Bacteria 3011
1355 Ga0207683_10233203 3300026121 Bacteria 1679
1356 Ga0207698_10043253 3300026142 Bacteria 3373
1357 Ga0207698_10063652 3300026142 Bacteria 2887
1358 Ga0207698_10083569 3300026142 Bacteria 2584
1359 Ga0207698_10125536 3300026142 Bacteria 2181
1360 Ga0207698_10386156 3300026142 Bacteria 1334
1361 Ga0209281_1000098 3300027111 Bacteria 226641
1362 Ga0209281_1000135 3300027111 Bacteria 183462
1363 Ga0209281_1000168 3300027111 Bacteria 155116
1364 Ga0209389_1000100 3300027296 Bacteria 79023
1365 Ga0209389_1000107 3300027296 Bacteria 74129
1366 Ga0209371_1000717 3300027312 Bacteria 28002
1367 Ga0209371_1010800 3300027312 Bacteria 2771
1368 Ga0209589_1000092 3300027357 Bacteria 89530
1369 Ga0209969_1011427 3300027360 Bacteria 1275
1370 Ga0209489_100006 3300027361 Bacteria 475698
1371 Ga0209489_110323 3300027361 Bacteria 10641
1372 Ga0209700_100005 3300027363 Bacteria 573969
1373 Ga0209981_1005111 3300027378 Bacteria 1736
1374 Ga0209996_1010440 3300027395 Bacteria 1233
1375 Ga0209996_1013328 3300027395 Bacteria 1110
1376 Ga0209984_1029758 3300027424 Bacteria 770
1377 Ga0209179_1008051 3300027512 Bacteria 1763
1378 Ga0209179_1025209 3300027512 Bacteria 1185
1379 Ga0209968_1003794 3300027526 Bacteria 2267
1380 Ga0209982_1007738 3300027552 Bacteria 1569
1381 Ga0209970_1006138 3300027614 Bacteria 1972
1382 Ga0210002_1004102 3300027617 Bacteria 2159
1383 Ga0209983_1015889 3300027665 Bacteria 1552
1384 Ga0209983_1020482 3300027665 Bacteria 1379
1385 Ga0209282_1000001 3300027666 Bacteria 2450367
1386 Ga0209282_1000050 3300027666 Bacteria 109312
1387 Ga0209282_1055877 3300027666 Bacteria 2230
1388 Ga0209588_1007408 3300027671 Bacteria 3227
1389 Ga0209588_1008591 3300027671 Bacteria 3031
1390 Ga0209588_1017377 3300027671 Bacteria 2230
1391 Ga0209588_1021588 3300027671 Bacteria 2024
1392 Ga0209813_10015383 3300027866 Bacteria 2072
1393 Ga0209813_10017346 3300027866 Bacteria 1976
1394 Ga0209974_10085079 3300027876 Bacteria 1092
1395 Ga0209974_10100509 3300027876 Bacteria 1010
1396 Ga0207428_10000206 3300027907 Bacteria 82022
1397 Ga0207428_10004916 3300027907 Bacteria 12599
1398 Ga0207428_10015046 3300027907 Bacteria 6703
1399 Ga0207428_10022322 3300027907 Bacteria 5344
1400 Ga0207428_10038813 3300027907 Bacteria 3869
1401 Ga0207428_10435589 3300027907 Bacteria 957
1402 Ga0207428_10451735 3300027907 Bacteria 937
1403 Ga0268266_10000903 3300028379 Bacteria 38384
1404 Ga0268266_10012572 3300028379 Bacteria 7316
1405 Ga0268266_10017592 3300028379 Bacteria 6096
1406 Ga0268266_10024502 3300028379 Bacteria 5131
1407 Ga0268266_10024967 3300028379 Bacteria 5086
1408 Ga0268266_10033368 3300028379 Bacteria 4376
1409 Ga0268266_10050775 3300028379 Bacteria 3558
1410 Ga0268266_10080036 3300028379 Bacteria 2846
1411 Ga0268266_10094524 3300028379 Bacteria 2624
1412 Ga0268266_10109320 3300028379 Bacteria 2448
1413 Ga0268266_10191575 3300028379 Bacteria 1867
1414 Ga0268266_10258996 3300028379 Bacteria 1612
1415 Ga0268266_10416901 3300028379 Bacteria 1272
1416 Ga0268266_10426856 3300028379 Bacteria 1257
1417 Ga0268266_10999217 3300028379 Bacteria 810
1418 Ga0268265_10000366 3300028380 Bacteria 48922
1419 Ga0268265_10004088 3300028380 Bacteria 10254
1420 Ga0268265_10004279 3300028380 Bacteria 9961
1421 Ga0268265_10005646 3300028380 Bacteria 8548
1422 Ga0268265_10021488 3300028380 Bacteria 4522
1423 Ga0268265_10032398 3300028380 Bacteria 3787
1424 Ga0268265_10120571 3300028380 Bacteria 2160
1425 Ga0268264_10000068 3300028381 Bacteria 275708
1426 Ga0268264_10000555 3300028381 Bacteria 46158
1427 Ga0268264_10054569 3300028381 Bacteria 3337
1428 Ga0268264_10070461 3300028381 Bacteria 2960
1429 Ga0268264_10075029 3300028381 Bacteria 2874
1430 Ga0268264_10110191 3300028381 Bacteria 2410
1431 Ga0268264_10365130 3300028381 Bacteria 1378
1432 Ga0268264_10537897 3300028381 Bacteria 1144
1433 Ga0307517_10000062 3300028786 Bacteria 145054
1434 Ga0307517_10001270 3300028786 Bacteria 42382
1435 Ga0307517_10140610 3300028786 Bacteria 1696
1436 Ga0307517_10172001 3300028786 Bacteria 1421
1437 Ga0307517_10359894 3300028786 Bacteria 786
1438 Ga0307515_10000043 3300028794 Bacteria 304612
1439 Ga0307515_10000066 3300028794 Bacteria 244076
1440 Ga0307515_10002166 3300028794 Bacteria 43111
1441 Ga0307515_10002598 3300028794 Bacteria 38928
1442 Ga0307515_10172393 3300028794 Bacteria 2150
1443 Ga0307515_10328167 3300028794 Bacteria 1191
1444 Ga0307515_10372082 3300028794 Bacteria 1065
1445 Ga0265338_10261203 3300028800 Bacteria 1273
1446 Ga0268256_1001412 3300030500 Bacteria 14570
1447 Ga0268256_1004589 3300030500 Bacteria 5679
1448 Ga0307511_10049682 3300030521 Bacteria 3389
1449 Ga0307511_10086923 3300030521 Bacteria 2149
1450 Ga0265328_10000053 3300031239 Bacteria 75262
1451 Ga0265328_10010498 3300031239 Bacteria 3725
1452 Ga0265328_10032629 3300031239 Bacteria 1932
1453 Ga0265329_10004721 3300031242 Bacteria 5612
1454 Ga0265331_10000026 3300031250 Bacteria 223760
1455 Ga0265331_10000964 3300031250 Bacteria 22889
1456 Ga0265331_10001610 3300031250 Bacteria 16482
1457 Ga0265327_10008003 3300031251 Bacteria 7981
1458 Ga0265327_10020140 3300031251 Bacteria 4076
1459 Ga0265327_10091299 3300031251 Bacteria 1484
1460 Ga0265316_10000907 3300031344 Bacteria 32323
1461 Ga0265316_10028559 3300031344 Bacteria 4600
1462 Ga0265316_10163786 3300031344 Bacteria 1662
1463 Ga0307513_10102950 3300031456 Bacteria 2873
1464 Ga0307513_10255047 3300031456 Bacteria 1548
1465 Ga0307509_10005522 3300031507 Bacteria 17548
1466 Ga0307509_10425173 3300031507 Bacteria 1028
1467 Ga0307408_100002861 3300031548 Bacteria 11958
1468 Ga0307408_100012426 3300031548 Bacteria 5640
1469 Ga0307408_100012720 3300031548 Bacteria 5580
1470 Ga0307408_100042899 3300031548 Bacteria 3216
1471 Ga0307408_100054112 3300031548 Bacteria 2901
1472 Ga0307408_100058519 3300031548 Bacteria 2802
1473 Ga0307408_100066057 3300031548 Bacteria 2655
1474 Ga0307408_100246776 3300031548 Bacteria 1470
1475 Ga0307508_10002693 3300031616 Bacteria 18591
1476 Ga0307508_10072835 3300031616 Bacteria 3010
1477 Ga0307508_10097395 3300031616 Bacteria 2533
1478 Ga0307508_10228386 3300031616 Bacteria 1460
1479 Ga0316576_10008242 3300031727 Bacteria 6629
1480 Ga0316578_10235885 3300031728 Bacteria 1098
1481 Ga0307516_10005056 3300031730 Bacteria 15964
1482 Ga0307516_10020437 3300031730 Bacteria 6840
1483 Ga0307516_10023734 3300031730 Bacteria 6276
1484 Ga0307516_10045117 3300031730 Bacteria 4356
1485 Ga0307516_10164140 3300031730 Bacteria 1968
1486 Ga0307516_10548085 3300031730 Bacteria 810
1487 Ga0307405_10002305 3300031731 Bacteria 8371
1488 Ga0307405_10011374 3300031731 Bacteria 4660
1489 Ga0307405_10074864 3300031731 Bacteria 2191
1490 Ga0307405_10128676 3300031731 Bacteria 1746
1491 Ga0307405_10241863 3300031731 Bacteria 1337
1492 Ga0307405_10258671 3300031731 Bacteria 1299
1493 Ga0307405_10330547 3300031731 Bacteria 1168
1494 Ga0307405_10583268 3300031731 Bacteria 910
1495 Ga0307413_10091767 3300031824 Bacteria 1980
1496 Ga0307413_10171445 3300031824 Bacteria 1536
1497 Ga0307413_10384034 3300031824 Bacteria 1095
1498 Ga0307413_10484692 3300031824 Bacteria 989
1499 Ga0307413_10645891 3300031824 Bacteria 872
1500 Ga0307410_10024714 3300031852 Bacteria 3758
1501 Ga0307410_10045245 3300031852 Bacteria 2929
1502 Ga0307410_10085081 3300031852 Bacteria 2231
1503 Ga0307410_10105915 3300031852 Bacteria 2025
1504 Ga0307410_10736590 3300031852 Bacteria 833
1505 Ga0307406_10020468 3300031901 Bacteria 3896
1506 Ga0307406_10065411 3300031901 Bacteria 2363
1507 Ga0307406_10068540 3300031901 Bacteria 2316
1508 Ga0307406_10114259 3300031901 Bacteria 1864
1509 Ga0307406_10133256 3300031901 Bacteria 1748
1510 Ga0307406_10321438 3300031901 Bacteria 1197
1511 Ga0307407_10015676 3300031903 Bacteria 3755
1512 Ga0307407_10029276 3300031903 Bacteria 2956
1513 Ga0307407_10075555 3300031903 Bacteria 2020
1514 Ga0307407_10249434 3300031903 Bacteria 1215
1515 Ga0307412_10000302 3300031911 Bacteria 31383
1516 Ga0307412_10008473 3300031911 Bacteria 5872
1517 Ga0307412_10013193 3300031911 Bacteria 4837
1518 Ga0307412_10067907 3300031911 Bacteria 2422
1519 Ga0307412_10099677 3300031911 Bacteria 2052
1520 Ga0307412_10141988 3300031911 Bacteria 1760
1521 Ga0307412_10253360 3300031911 Bacteria 1368
1522 Ga0307412_10356653 3300031911 Bacteria 1176
1523 Ga0307409_100008074 3300031995 Bacteria 6354
1524 Ga0307409_100020978 3300031995 Bacteria 4468
1525 Ga0307409_100223107 3300031995 Bacteria 1703
1526 Ga0307409_100591694 3300031995 Bacteria 1095
1527 Ga0307409_100716442 3300031995 Bacteria 1001
1528 Ga0307409_101021146 3300031995 Bacteria 846
1529 Ga0307416_100009769 3300032002 Bacteria 6305
1530 Ga0307416_100009975 3300032002 Bacteria 6250
1531 Ga0307416_100055616 3300032002 Bacteria 3188
1532 Ga0307416_100110714 3300032002 Bacteria 2419
1533 Ga0307416_100123710 3300032002 Bacteria 2312
1534 Ga0307416_100221438 3300032002 Bacteria 1815
1535 Ga0307416_100288003 3300032002 Bacteria 1624
1536 Ga0307416_100330674 3300032002 Bacteria 1531
1537 Ga0307416_100380224 3300032002 Bacteria 1442
1538 Ga0307416_100585068 3300032002 Bacteria 1194
1539 Ga0307416_100839975 3300032002 Bacteria 1016
1540 Ga0307414_10000206 3300032004 Bacteria 39642
1541 Ga0307414_10022759 3300032004 Bacteria 3960
1542 Ga0307414_10110403 3300032004 Bacteria 2092
1543 Ga0307414_10216227 3300032004 Bacteria 1570
1544 Ga0307414_10495720 3300032004 Bacteria 1080
1545 Ga0307411_10019375 3300032005 Bacteria 3930
1546 Ga0307411_10046242 3300032005 Bacteria 2804
1547 Ga0307411_10103206 3300032005 Bacteria 2022
1548 Ga0307411_10142996 3300032005 Bacteria 1766
1549 Ga0307411_10225359 3300032005 Bacteria 1457
1550 Ga0307415_100003211 3300032126 Bacteria 8294
1551 Ga0307415_100138775 3300032126 Bacteria 1853
1552 Ga0307415_100200319 3300032126 Bacteria 1584
1553 Ga0307415_100291016 3300032126 Bacteria 1348
1554 Ga0307415_100492569 3300032126 Bacteria 1070
1555 Ga0307507_10007150 3300033179 Bacteria 16482
1556 Ga0307507_10075020 3300033179 Bacteria 3029
1557 Ga0307510_10001303 3300033180 Bacteria 27224
1558 Ga0307510_10014005 3300033180 Bacteria 9493
1559 Ga0307510_10172817 3300033180 Bacteria 1736
1560 Ga0307510_10271744 3300033180 Bacteria 1171
1561 Ga0315911_1000009 3300033442 Bacteria 379354
1562 Ga0373926_0042305 3300035083 Bacteria 1629
1563 Ga0373926_0134037 3300035083 Bacteria 939
1564 Ga0373926_0179151 3300035083 Bacteria 812
1565 Ga0373929_0069330 3300035085 Bacteria 841
1566 Ga0373944_0058049 3300035089 Bacteria 1235
1567 Ga0373936_0162000 3300035113 Bacteria 975
1568 Ga0373941_0128067 3300035115 Bacteria 912
1569 Ga0373945_0140089 3300035116 Bacteria 975
1570 Ga0373954_0097339 3300035118 Bacteria 1418
1571 Ga0373957_0079555 3300035120 Bacteria 1292
1572 Ga0373943_0003222 3300035170 Bacteria 7407
1573 Ga0373943_0008936 3300035170 Bacteria 4489
1574 Ga0373943_0094638 3300035170 Bacteria 1553
1575 Ga0373943_0175433 3300035170 Bacteria 1175
1576 Ga0373946_0004653 3300035171 Bacteria 4924
1577 Ga0373946_0032417 3300035171 Bacteria 2098
1578 Ga0373946_0294967 3300035171 Bacteria 800
1579 Ga0373955_0018062 3300035172 Bacteria 3500
1580 Ga0373955_0030305 3300035172 Bacteria 2823
1581 Ga0373955_0200030 3300035172 Bacteria 1189
1582 Ga0373961_0016728 3300035241 Bacteria 1893
1583 Ga0316574_0011998 3300035398 Bacteria 4944
1584 Ga0373931_0392509 3300035691 Bacteria 877
1585 Ga0373935_0028621 3300035692 Bacteria 3444
1586 Ga0373935_0044978 3300035692 Bacteria 2784
1587 Ga0373935_0115993 3300035692 Bacteria 1783
1588 Ga0373935_0192602 3300035692 Bacteria 1405
1589 Ga0373927_0005644 3300035695 Bacteria 8601
1590 Ga0373927_0012739 3300035695 Bacteria 5593
1591 Ga0373927_0020294 3300035695 Bacteria 4358
1592 Ga0373927_0027713 3300035695 Bacteria 3698
1593 Ga0373927_0028596 3300035695 Bacteria 3636
1594 Ga0373927_0028627 3300035695 Bacteria 3634
1595 Ga0373927_0042274 3300035695 Bacteria 2953
1596 Ga0373927_0163130 3300035695 Bacteria 1460
1597 Ga0373927_0167276 3300035695 Bacteria 1441
1598 Ga0373933_0036595 3300035724 Bacteria 2874
1599 Ga0373933_0050782 3300035724 Bacteria 2477
1600 Ga0373947_0003799 3300035725 Bacteria 8905
1601 Ga0373947_0003989 3300035725 Bacteria 8667
1602 Ga0373947_0027175 3300035725 Bacteria 3348
1603 Ga0373947_0080375 3300035725 Bacteria 2016
1604 Ga0373947_0126522 3300035725 Bacteria 1628
1605 Ga0373947_0311511 3300035725 Bacteria 1051
1606 Ga0373937_0024454 3300036401 Bacteria 5449
1607 Ga0373937_0075196 3300036401 Bacteria 3118
1608 Ga0373937_0090609 3300036401 Bacteria 2832
1609 Ga0373937_0157733 3300036401 Bacteria 2127
1610 Ga0373937_0790115 3300036401 Bacteria 897
1611 Ga0316582_0242414 3300036647 Bacteria 1235
1612 Ga0316584_0109122 3300036712 Bacteria 2071
1613 Ga0373925_0007689 3300037068 Bacteria 7850
1614 Ga0373925_0010250 3300037068 Bacteria 6799
1615 Ga0373925_0043795 3300037068 Bacteria 3323
1616 Ga0373925_0084048 3300037068 Bacteria 2425
1617 Ga0373925_0215386 3300037068 Bacteria 1531
1618 Ga0373925_0308472 3300037068 Bacteria 1279
1619 Ga0373925_0705778 3300037068 Bacteria 832
1620 Ga0395899_0014066 3300037312 Bacteria 6108
1621 Ga0395899_0106957 3300037312 Bacteria 2014
1622 Ga0395899_0138768 3300037312 Bacteria 1731
1623 Ga0395899_0162185 3300037312 Bacteria 1578
1624 Ga0395900_0009281 3300037418 Bacteria 10088
1625 Ga0395900_0022114 3300037418 Bacteria 6505
1626 Ga0395900_0029037 3300037418 Bacteria 5672
1627 Ga0395900_0077532 3300037418 Bacteria 3414
1628 Ga0395900_0121539 3300037418 Bacteria 2679
1629 Ga0395900_0318510 3300037418 Bacteria 1536
1630 Ga0395900_0400950 3300037418 Bacteria 1336
1631 Ga0395898_0003443 3300037466 Bacteria 17693
1632 Ga0395898_0018962 3300037466 Bacteria 7010
1633 Ga0395898_0033916 3300037466 Bacteria 5091
1634 Ga0395898_0041030 3300037466 Bacteria 4573
1635 Ga0395898_0081008 3300037466 Bacteria 3131
1636 Ga0395898_0298021 3300037466 Bacteria 1538
1637 Ga0395898_0350039 3300037466 Bacteria 1409
1638 Ga0395898_0593868 3300037466 Bacteria 1050
1639 Ga0395905_0000043 3300037471 Bacteria 247469
1640 Ga0395905_0000137 3300037471 Bacteria 120800
1641 Ga0395905_0001830 3300037471 Bacteria 24569
1642 Ga0395905_0003792 3300037471 Bacteria 15989
1643 Ga0395905_0004910 3300037471 Bacteria 13772
1644 Ga0395905_0005011 3300037471 Bacteria 13641
1645 Ga0395905_0010999 3300037471 Bacteria 8756
1646 Ga0395905_0019116 3300037471 Bacteria 6498
1647 Ga0395905_0041193 3300037471 Bacteria 4334
1648 Ga0395905_0071083 3300037471 Bacteria 3262
1649 Ga0395905_0134531 3300037471 Bacteria 2325
1650 Ga0395905_0224679 3300037471 Bacteria 1757
1651 Ga0395905_0247775 3300037471 Bacteria 1664
1652 Ga0395905_0314531 3300037471 Bacteria 1455
1653 Ga0395905_0351400 3300037471 Bacteria 1366
1654 Ga0436364_0429582 3300037853 Bacteria 3039
1655 Ga0395901_0007717 3300038443 Bacteria 10852
1656 Ga0395901_0036715 3300038443 Bacteria 5065
1657 Ga0395901_0040908 3300038443 Bacteria 4801
1658 Ga0395901_0100650 3300038443 Bacteria 3032
1659 Ga0395901_0300499 3300038443 Bacteria 1664
1660 Ga0395901_0449658 3300038443 Bacteria 1318
1661 Ga0395901_0549383 3300038443 Bacteria 1171
1662 Ga0242420_005082 3300038996 Bacteria 2021
1663 Ga0436365_1455024 3300039437 Bacteria 1356
1664 Ga0436365_1886126 3300039437 Bacteria 1974
1665 Ga0436360_1366726 3300039438 Bacteria 2269
1666 Ga0436361_0060433 3300039447 Bacteria 16066
1667 Ga0436361_0595316 3300039447 Bacteria 75842
1668 Ga0436361_0853954 3300039447 Bacteria 1542
1669 Ga0436361_0998063 3300039447 Bacteria 37334
1670 Ga0436361_1009582 3300039447 Bacteria 3528
1671 Ga0436363_0957632 3300039450 Bacteria 5702
1672 Ga0439436_0019658 3300041404 Bacteria 2014
1673 Ga0439436_0047133 3300041404 Bacteria 1223
1674 Ga0439438_000260 3300041405 Bacteria 23600
1675 Ga0439438_001046 3300041405 Bacteria 12317
1676 Ga0439438_003032 3300041405 Bacteria 6920
1677 Ga0439438_004977 3300041405 Bacteria 4963
1678 Ga0439438_011566 3300041405 Bacteria 2743
1679 Ga0439439_0124005 3300041406 Bacteria 722
1680 Ga0439447_000142 3300041407 Bacteria 24528
1681 Ga0439447_000618 3300041407 Bacteria 13243
1682 Ga0439447_001165 3300041407 Bacteria 9587
1683 Ga0439447_002000 3300041407 Bacteria 7489
1684 Ga0439447_002117 3300041407 Bacteria 7297
1685 Ga0439447_029429 3300041407 Bacteria 1390
1686 Ga0439461_0008364 3300041410 Bacteria 1851
1687 Ga0439466_0000165 3300041411 Bacteria 26440
1688 Ga0439466_0001150 3300041411 Bacteria 10288
1689 Ga0439466_0001929 3300041411 Bacteria 8141
1690 Ga0439466_0002202 3300041411 Bacteria 7628
1691 Ga0439466_0004550 3300041411 Bacteria 5327
1692 Ga0439466_0034431 3300041411 Bacteria 1717
1693 Ga0439465_0003554 3300041413 Bacteria 5081
1694 Ga0439465_0013402 3300041413 Bacteria 2557
1695 Ga0439465_0059525 3300041413 Bacteria 1264
1696 Ga0439465_0074163 3300041413 Bacteria 1145
1697 Ga0439465_0131724 3300041413 Bacteria 883
1698 Ga0451853_1946290 3300041512 Bacteria 1160
1699 Ga0439431_0021146 3300041997 Bacteria 1560
1700 Ga0439441_007656 3300042001 Bacteria 1748
1701 Ga0439442_039469 3300042002 Bacteria 990
1702 Ga0439432_002801 3300042006 Bacteria 6500
1703 Ga0439432_002903 3300042006 Bacteria 6384
1704 Ga0439432_005178 3300042006 Bacteria 4711
1705 Ga0439432_011392 3300042006 Bacteria 3065
1706 Ga0439432_013663 3300042006 Bacteria 2758
1707 Ga0439432_014072 3300042006 Bacteria 2710
1708 Ga0439432_034185 3300042006 Bacteria 1633
1709 Ga0439432_089320 3300042006 Bacteria 928
1710 Ga0439449_0015799 3300042007 Bacteria 2838
1711 Ga0439451_000064 3300042009 Bacteria 19723
1712 Ga0439451_000770 3300042009 Bacteria 6107
1713 Ga0439451_003674 3300042009 Bacteria 3107
1714 Ga0439451_004382 3300042009 Bacteria 2867
1715 Ga0439452_000777 3300042010 Bacteria 15131
1716 Ga0439452_001492 3300042010 Bacteria 9499
1717 Ga0439452_005072 3300042010 Bacteria 4297
1718 Ga0439452_008193 3300042010 Bacteria 3159
1719 Ga0439452_010723 3300042010 Bacteria 2653
1720 Ga0439452_020499 3300042010 Bacteria 1733
1721 Ga0439452_025015 3300042010 Bacteria 1519
1722 Ga0439454_020880 3300042011 Bacteria 964
1723 Ga0439456_001012 3300042013 Bacteria 5593
1724 Ga0439456_001910 3300042013 Bacteria 4201
1725 Ga0439456_003441 3300042013 Bacteria 3207
1726 Ga0439456_004502 3300042013 Bacteria 2820
1727 Ga0439456_005173 3300042013 Bacteria 2648
1728 Ga0439456_009851 3300042013 Bacteria 1972
1729 Ga0439462_0005633 3300042015 Bacteria 3091
1730 Ga0439463_000053 3300042016 Bacteria 24356
1731 Ga0439463_001967 3300042016 Bacteria 5343
1732 Ga0439463_064047 3300042016 Bacteria 940
1733 Ga0450911_000969 3300042115 Bacteria 7483
1734 Ga0450919_000048 3300042121 Bacteria 10487
1735 Ga0450921_003465 3300042123 Bacteria 1112
1736 Ga0450922_000198 3300042124 Bacteria 6373
1737 Ga0450922_001343 3300042124 Bacteria 2427
1738 Ga0450923_000302 3300042125 Bacteria 5001
1739 Ga0450923_000640 3300042125 Bacteria 4049
1740 Ga0450923_024433 3300042125 Bacteria 1198
1741 Ga0450890_000068 3300042127 Bacteria 18424
1742 Ga0450890_002924 3300042127 Bacteria 2300
1743 Ga0450890_010029 3300042127 Bacteria 1217
1744 Ga0450891_008845 3300042129 Bacteria 926
1745 Ga0450894_008485 3300042131 Bacteria 1330
1746 Ga0450894_025754 3300042131 Bacteria 806
1747 Ga0450898_003315 3300042134 Bacteria 2307
1748 Ga0450898_012295 3300042134 Bacteria 1413
1749 Ga0450898_023901 3300042134 Bacteria 1089
1750 Ga0450902_012637 3300042137 Bacteria 1353
1751 Ga0450903_000951 3300042138 Bacteria 5556
1752 Ga0450903_001219 3300042138 Bacteria 4840
1753 Ga0450903_001821 3300042138 Bacteria 3888
1754 Ga0450903_004815 3300042138 Bacteria 2280
1755 Ga0450906_000120 3300042145 Bacteria 13631
1756 Ga0450906_014033 3300042145 Bacteria 1470
1757 Ga0450907_000041 3300042146 Bacteria 56455
1758 Ga0450907_028011 3300042146 Bacteria 955
1759 Ga0450910_003946 3300042147 Bacteria 1992
1760 Ga0450910_010753 3300042147 Bacteria 1307
1761 Ga0450910_011623 3300042147 Bacteria 1264
1762 Ga0439446_0000180 3300042156 Bacteria 11118
1763 Ga0439446_0001133 3300042156 Bacteria 5909
1764 Ga0439446_0005173 3300042156 Bacteria 3345
1765 Ga0439446_0015312 3300042156 Bacteria 2126
1766 Ga0439458_0016151 3300042157 Bacteria 1697
1767 Ga0439458_0016794 3300042157 Bacteria 1666
1768 Ga0439458_0065343 3300042157 Bacteria 913
1769 Ga0450908_000565 3300042184 Bacteria 7113
1770 Ga0450908_002148 3300042184 Bacteria 3861
1771 Ga0450908_014635 3300042184 Bacteria 1408
1772 Ga0450909_000056 3300042185 Bacteria 9677
1773 Ga0450909_002385 3300042185 Bacteria 2656
1774 Ga0439434_0000029 3300042435 Bacteria 35254
1775 Ga0439434_0064726 3300042435 Bacteria 1147
1776 Ga0439434_0078214 3300042435 Bacteria 1047
1777 Ga0439435_0022238 3300042436 Bacteria 1653
1778 Ga0439444_0007202 3300042437 Bacteria 1702
1779 Ga0439444_0079850 3300042437 Bacteria 714
1780 Ga0439464_0015024 3300042439 Bacteria 2087
1781 Ga0439464_0122258 3300042439 Bacteria 802
1782 Ga0439460_0000261 3300042461 Bacteria 10858
1783 Ga0439460_0000599 3300042461 Bacteria 7941
1784 Ga0439460_0001047 3300042461 Bacteria 6426
1785 Ga0439460_0029911 3300042461 Bacteria 1545
1786 Ga0450918_000771 3300042531 Bacteria 6789
1787 Ga0450918_002265 3300042531 Bacteria 3648
1788 Ga0450918_002383 3300042531 Bacteria 3552
1789 Ga0450893_0010027 3300042532 Bacteria 1552
1790 Ga0450893_0022149 3300042532 Bacteria 1100
1791 Ga0450901_006145 3300042533 Bacteria 1233
1792 Ga0451577_0065557 3300042876 Bacteria 3239
1793 Ga0451577_0433180 3300042876 Bacteria 1194
1794 Ga0439440_0001338 3300042993 Bacteria 4479
1795 Ga0439440_0020124 3300042993 Bacteria 1494
1796 Ga0466972_0001120 3300044658 Bacteria 12835
1797 Ga0466972_0011127 3300044658 Bacteria 4516
1798 Ga0466972_0014900 3300044658 Bacteria 3890
1799 Ga0466972_0034802 3300044658 Bacteria 2466
1800 Ga0466972_0039643 3300044658 Bacteria 2298
1801 Ga0453683_0021525 3300044673 Bacteria 4116
1802 Ga0466965_0004130 3300044683 Bacteria 6455
1803 Ga0466965_0022296 3300044683 Bacteria 3054
1804 Ga0466965_0025548 3300044683 Bacteria 2859
1805 Ga0466961_0000837 3300044693 Bacteria 19202
1806 Ga0466964_0018333 3300044706 Bacteria 2685
1807 Ga0466964_0029876 3300044706 Bacteria 2154
1808 Ga0466964_0089537 3300044706 Bacteria 1337
1809 Ga0453684_0513363 3300044712 Bacteria 1325
1810 Ga0466968_0003653 3300044735 Bacteria 5704
1811 Ga0466968_0014467 3300044735 Bacteria 3119
1812 Ga0466968_0031237 3300044735 Bacteria 2209
1813 Ga0466968_0034736 3300044735 Bacteria 2106
1814 Ga0466968_0038429 3300044735 Bacteria 2011
1815 Ga0466960_0060670 3300044901 Bacteria 1854
1816 Ga0466960_0064618 3300044901 Bacteria 1805
1817 Ga0466959_0004842 3300045049 Bacteria 9099
1818 Ga0466959_0118371 3300045049 Bacteria 1885
1819 Ga0451576_0004677 3300045051 Bacteria 17627
1820 Ga0451576_0057263 3300045051 Bacteria 4074
1821 Ga0451576_0105831 3300045051 Bacteria 2927
1822 Ga0495617_000221 3300046452 Bacteria 34624
1823 Ga0495617_000410 3300046452 Bacteria 23594
1824 Ga0495617_001311 3300046452 Bacteria 11069
1825 Ga0495617_029521 3300046452 Bacteria 1843
1826 Ga0495617_050795 3300046452 Bacteria 1379
1827 Ga0495627_011403 3300046453 Bacteria 3192
1828 Ga0495627_058777 3300046453 Bacteria 1141
1829 Ga0495592_0018584 3300046454 Bacteria 5289
1830 Ga0495603_0000494 3300046455 Bacteria 21813
1831 Ga0495603_0204703 3300046455 Bacteria 1140
1832 Ga0495603_0265083 3300046455 Bacteria 988
1833 Ga0495590_0000022 3300046457 Bacteria 205122
1834 Ga0495590_0005871 3300046457 Bacteria 4820
1835 Ga0495590_0010290 3300046457 Bacteria 3523
1836 Ga0495590_0011818 3300046457 Bacteria 3255
1837 Ga0495590_0067418 3300046457 Bacteria 1254
1838 Ga0495591_001375 3300046458 Bacteria 15243
1839 Ga0495591_017113 3300046458 Bacteria 2500
1840 Ga0495591_019675 3300046458 Bacteria 2252
1841 Ga0495591_045456 3300046458 Bacteria 1224
1842 Ga0495629_0001268 3300046459 Bacteria 19845
1843 Ga0495629_0031695 3300046459 Bacteria 3742
1844 Ga0495629_0100605 3300046459 Bacteria 2017
1845 Ga0495629_0109490 3300046459 Bacteria 1926
1846 Ga0495638_0000229 3300046460 Bacteria 76824
1847 Ga0495638_0000274 3300046460 Bacteria 69822
1848 Ga0495638_0000709 3300046460 Bacteria 35919
1849 Ga0495638_0000966 3300046460 Bacteria 29115
1850 Ga0495638_0001163 3300046460 Bacteria 25322
1851 Ga0495638_0002629 3300046460 Bacteria 14459
1852 Ga0495638_0004432 3300046460 Bacteria 10632
1853 Ga0495638_0007819 3300046460 Bacteria 7633
1854 Ga0495638_0011225 3300046460 Bacteria 6182
1855 Ga0495638_0020754 3300046460 Bacteria 4337
1856 Ga0495638_0050022 3300046460 Bacteria 2611
1857 Ga0495638_0050387 3300046460 Bacteria 2600
1858 Ga0495638_0073207 3300046460 Bacteria 2092
1859 Ga0495638_0083336 3300046460 Bacteria 1937
1860 Ga0495638_0164672 3300046460 Bacteria 1276
1861 Ga0495641_0028632 3300046461 Bacteria 2694
1862 Ga0495651_0001592 3300046462 Bacteria 17551
1863 Ga0495651_0003787 3300046462 Bacteria 11571
1864 Ga0495651_0086911 3300046462 Bacteria 2351
1865 Ga0495651_0097158 3300046462 Bacteria 2200
1866 Ga0495653_0001109 3300046463 Bacteria 20752
1867 Ga0495653_0052803 3300046463 Bacteria 3114
1868 Ga0495653_0058772 3300046463 Bacteria 2922
1869 Ga0495653_0077320 3300046463 Bacteria 2471
1870 Ga0495653_0109117 3300046463 Bacteria 1992
1871 Ga0495650_0001935 3300046471 Bacteria 18335
1872 Ga0495650_0002311 3300046471 Bacteria 15807
1873 Ga0495650_0005109 3300046471 Bacteria 8673
1874 Ga0495580_0004421 3300046472 Bacteria 11810
1875 Ga0495580_0110107 3300046472 Bacteria 1913
1876 Ga0495580_0153945 3300046472 Bacteria 1592
1877 Ga0495580_0468462 3300046472 Bacteria 844
1878 Ga0495582_0000438 3300046473 Bacteria 22737
1879 Ga0495582_0011570 3300046473 Bacteria 4862
1880 Ga0495582_0033326 3300046473 Bacteria 2831
1881 Ga0495582_0146425 3300046473 Bacteria 1340
1882 Ga0495582_0252133 3300046473 Bacteria 1012
1883 Ga0495605_0000458 3300046474 Bacteria 36672
1884 Ga0495605_0000800 3300046474 Bacteria 22495
1885 Ga0495605_0001066 3300046474 Bacteria 18298
1886 Ga0495605_0001962 3300046474 Bacteria 13046
1887 Ga0495605_0002116 3300046474 Bacteria 12436
1888 Ga0495605_0002355 3300046474 Bacteria 11759
1889 Ga0495605_0004594 3300046474 Bacteria 8079
1890 Ga0495605_0020857 3300046474 Bacteria 3477
1891 Ga0495605_0056893 3300046474 Bacteria 1885
1892 Ga0495605_0123004 3300046474 Bacteria 1175
1893 Ga0495605_0157378 3300046474 Bacteria 1010
1894 Ga0495605_0230818 3300046474 Bacteria 797
1895 Ga0495639_0000324 3300046475 Bacteria 22948
1896 Ga0495639_0003808 3300046475 Bacteria 6477
1897 Ga0495639_0007031 3300046475 Bacteria 4838
1898 Ga0495639_0050943 3300046475 Bacteria 1882
1899 Ga0495662_0002124 3300046476 Bacteria 9942
1900 Ga0495662_0068222 3300046476 Bacteria 1722
1901 Ga0495664_0004377 3300046477 Bacteria 7725
1902 Ga0495664_0018795 3300046477 Bacteria 3965
1903 Ga0495584_0000385 3300046491 Bacteria 30442
1904 Ga0495584_0001423 3300046491 Bacteria 14408
1905 Ga0495584_0004237 3300046491 Bacteria 7736
1906 Ga0495584_0008517 3300046491 Bacteria 5310
1907 Ga0495584_0026446 3300046491 Bacteria 2939
1908 Ga0495584_0028678 3300046491 Bacteria 2821
1909 Ga0495584_0046507 3300046491 Bacteria 2189
1910 Ga0495584_0070657 3300046491 Bacteria 1754
1911 Ga0495584_0102738 3300046491 Bacteria 1445
1912 Ga0495585_0003261 3300046492 Bacteria 11053
1913 Ga0495585_0009663 3300046492 Bacteria 5774
1914 Ga0495585_0013083 3300046492 Bacteria 4865
1915 Ga0495585_0057662 3300046492 Bacteria 2143
1916 Ga0495585_0077846 3300046492 Bacteria 1800
1917 Ga0495585_0124172 3300046492 Bacteria 1363
1918 Ga0495585_0150566 3300046492 Bacteria 1213
1919 Ga0495585_0153252 3300046492 Bacteria 1200
1920 Ga0495585_0192891 3300046492 Bacteria 1041
1921 Ga0495594_0001620 3300046499 Bacteria 11709
1922 Ga0495594_0008110 3300046499 Bacteria 5402
1923 Ga0495594_0056930 3300046499 Bacteria 2158
1924 Ga0495594_0061457 3300046499 Bacteria 2079
1925 Ga0495594_0085230 3300046499 Bacteria 1767
1926 Ga0495596_0004110 3300046500 Bacteria 7165
1927 Ga0495596_0014598 3300046500 Bacteria 3308
1928 Ga0495607_0002361 3300046501 Bacteria 15425
1929 Ga0495607_0003960 3300046501 Bacteria 11141
1930 Ga0495607_0004377 3300046501 Bacteria 10407
1931 Ga0495607_0004932 3300046501 Bacteria 9695
1932 Ga0495607_0004993 3300046501 Bacteria 9623
1933 Ga0495607_0005142 3300046501 Bacteria 9450
1934 Ga0495607_0023295 3300046501 Bacteria 3876
1935 Ga0495607_0035097 3300046501 Bacteria 3037
1936 Ga0495607_0043218 3300046501 Bacteria 2666
1937 Ga0495607_0048515 3300046501 Bacteria 2482
1938 Ga0495607_0057456 3300046501 Bacteria 2229
1939 Ga0495607_0110277 3300046501 Bacteria 1460
1940 Ga0495607_0116844 3300046501 Bacteria 1406
1941 Ga0495607_0238079 3300046501 Bacteria 882
1942 Ga0495583_0000035 3300046506 Bacteria 246849
1943 Ga0495583_0000239 3300046506 Bacteria 91038
1944 Ga0495583_0000373 3300046506 Bacteria 69685
1945 Ga0495583_0004667 3300046506 Bacteria 9659
1946 Ga0495583_0006914 3300046506 Bacteria 7292
1947 Ga0495583_0011899 3300046506 Bacteria 4965
1948 Ga0495583_0016308 3300046506 Bacteria 4001
1949 Ga0495583_0024056 3300046506 Bacteria 3068
1950 Ga0495583_0057820 3300046506 Bacteria 1743
1951 Ga0495606_0007258 3300046507 Bacteria 9986
1952 Ga0495606_0007352 3300046507 Bacteria 9886
1953 Ga0495606_0017470 3300046507 Bacteria 5422
1954 Ga0495606_0093858 3300046507 Bacteria 1840
1955 Ga0495608_0006903 3300046511 Bacteria 8042
1956 Ga0495608_0093821 3300046511 Bacteria 1939
1957 Ga0495608_0120097 3300046511 Bacteria 1686
1958 Ga0495610_0000259 3300046512 Bacteria 55671
1959 Ga0495610_0007569 3300046512 Bacteria 7192
1960 Ga0495610_0007605 3300046512 Bacteria 7175
1961 Ga0495610_0007851 3300046512 Bacteria 7020
1962 Ga0495610_0016071 3300046512 Bacteria 4326
1963 Ga0495610_0018844 3300046512 Bacteria 3880
1964 Ga0495610_0141442 3300046512 Bacteria 1035
1965 Ga0495616_0002213 3300046513 Bacteria 13004
1966 Ga0495616_0019459 3300046513 Bacteria 3705
1967 Ga0495616_0023991 3300046513 Bacteria 3276
1968 Ga0495616_0030198 3300046513 Bacteria 2850
1969 Ga0495616_0031769 3300046513 Bacteria 2762
1970 Ga0495616_0032201 3300046513 Bacteria 2741
1971 Ga0495616_0036680 3300046513 Bacteria 2528
1972 Ga0495616_0051266 3300046513 Bacteria 2059
1973 Ga0495616_0052392 3300046513 Bacteria 2032
1974 Ga0495618_0017817 3300046514 Bacteria 4358
1975 Ga0495618_0018417 3300046514 Bacteria 4288
1976 Ga0495618_0040434 3300046514 Bacteria 2935
1977 Ga0495620_0005009 3300046515 Bacteria 7424
1978 Ga0495620_0006851 3300046515 Bacteria 6229
1979 Ga0495620_0017840 3300046515 Bacteria 3529
1980 Ga0495620_0027136 3300046515 Bacteria 2684
1981 Ga0495620_0047661 3300046515 Bacteria 1843
1982 Ga0495620_0066141 3300046515 Bacteria 1490
1983 Ga0495620_0083447 3300046515 Bacteria 1290
1984 Ga0495620_0131799 3300046515 Bacteria 981
1985 Ga0495628_0003023 3300046516 Bacteria 15076
1986 Ga0495628_0010092 3300046516 Bacteria 8033
1987 Ga0495628_0231381 3300046516 Bacteria 1385
1988 Ga0495628_0257774 3300046516 Bacteria 1300
1989 Ga0495630_0036826 3300046517 Bacteria 3657
1990 Ga0495630_0067417 3300046517 Bacteria 2690
1991 Ga0495630_0120350 3300046517 Bacteria 1991
1992 Ga0495631_0011013 3300046518 Bacteria 4464
1993 Ga0495631_0011575 3300046518 Bacteria 4335
1994 Ga0495631_0091111 3300046518 Bacteria 1313
1995 Ga0495631_0136504 3300046518 Bacteria 1053
1996 Ga0495632_0000341 3300046519 Bacteria 44339
1997 Ga0495632_0000598 3300046519 Bacteria 33447
1998 Ga0495632_0011122 3300046519 Bacteria 5271
1999 Ga0495632_0011555 3300046519 Bacteria 5147
2000 Ga0495632_0017274 3300046519 Bacteria 3987
2001 Ga0495632_0062046 3300046519 Bacteria 1812
2002 Ga0495632_0079714 3300046519 Bacteria 1563
2003 Ga0495632_0126326 3300046519 Bacteria 1192
2004 Ga0495637_0002322 3300046520 Bacteria 10524
2005 Ga0495637_0004848 3300046520 Bacteria 6925
2006 Ga0495637_0005373 3300046520 Bacteria 6543
2007 Ga0495637_0005440 3300046520 Bacteria 6488
2008 Ga0495637_0006912 3300046520 Bacteria 5663
2009 Ga0495637_0028584 3300046520 Bacteria 2489
2010 Ga0495637_0034570 3300046520 Bacteria 2212
2011 Ga0495643_0000318 3300046522 Bacteria 66545
2012 Ga0495643_0000771 3300046522 Bacteria 35779
2013 Ga0495643_0003467 3300046522 Bacteria 11520
2014 Ga0495643_0003626 3300046522 Bacteria 11219
2015 Ga0495643_0009745 3300046522 Bacteria 5941
2016 Ga0495643_0026274 3300046522 Bacteria 3286
2017 Ga0495643_0039953 3300046522 Bacteria 2563
2018 Ga0495643_0041262 3300046522 Bacteria 2516
2019 Ga0495643_0110907 3300046522 Bacteria 1395
2020 Ga0495644_0000241 3300046523 Bacteria 25705
2021 Ga0495644_0016846 3300046523 Bacteria 2796
2022 Ga0495644_0039305 3300046523 Bacteria 1783
2023 Ga0495644_0051533 3300046523 Bacteria 1545
2024 Ga0495644_0061056 3300046523 Bacteria 1416
2025 Ga0495648_0000004 3300046524 Bacteria 373639
2026 Ga0495648_0000195 3300046524 Bacteria 69940
2027 Ga0495648_0000541 3300046524 Bacteria 40809
2028 Ga0495648_0004283 3300046524 Bacteria 12230
2029 Ga0495648_0006148 3300046524 Bacteria 9841
2030 Ga0495648_0007143 3300046524 Bacteria 8979
2031 Ga0495648_0009169 3300046524 Bacteria 7711
2032 Ga0495648_0019366 3300046524 Bacteria 4787
2033 Ga0495648_0026003 3300046524 Bacteria 3951
2034 Ga0495648_0029675 3300046524 Bacteria 3627
2035 Ga0495648_0035622 3300046524 Bacteria 3224
2036 Ga0495648_0037268 3300046524 Bacteria 3126
2037 Ga0495648_0054406 3300046524 Bacteria 2418
2038 Ga0495648_0067434 3300046524 Bacteria 2092
2039 Ga0495648_0100330 3300046524 Bacteria 1599
2040 Ga0495648_0238346 3300046524 Bacteria 886
2041 Ga0495663_0001423 3300046525 Bacteria 7552
2042 Ga0495663_0008215 3300046525 Bacteria 2888
2043 Ga0495666_0009302 3300046526 Bacteria 4913
2044 Ga0495666_0016715 3300046526 Bacteria 3652
2045 Ga0495666_0017043 3300046526 Bacteria 3616
2046 Ga0495666_0020502 3300046526 Bacteria 3274
2047 Ga0495642_0000037 3300046528 Bacteria 79709
2048 Ga0495642_0000101 3300046528 Bacteria 48249
2049 Ga0495642_0000116 3300046528 Bacteria 45478
2050 Ga0495642_0003718 3300046528 Bacteria 5984
2051 Ga0495642_0003930 3300046528 Bacteria 5814
2052 Ga0495642_0015421 3300046528 Bacteria 2971
2053 Ga0495642_0079787 3300046528 Bacteria 1376
2054 Ga0495642_0190823 3300046528 Bacteria 892
2055 Ga0495652_0003794 3300046529 Bacteria 14754
2056 Ga0495652_0027444 3300046529 Bacteria 5016
2057 Ga0495652_0036962 3300046529 Bacteria 4240
2058 Ga0495652_0048403 3300046529 Bacteria 3643
2059 Ga0495652_0072485 3300046529 Bacteria 2870
2060 Ga0495654_0000498 3300046530 Bacteria 32130
2061 Ga0495654_0000657 3300046530 Bacteria 27264
2062 Ga0495654_0003609 3300046530 Bacteria 9413
2063 Ga0495654_0013886 3300046530 Bacteria 4298
2064 Ga0495654_0019063 3300046530 Bacteria 3590
2065 Ga0495654_0049550 3300046530 Bacteria 2057
2066 Ga0495654_0067919 3300046530 Bacteria 1696
2067 Ga0495654_0075919 3300046530 Bacteria 1584
2068 Ga0495654_0091348 3300046530 Bacteria 1412
2069 Ga0495654_0115323 3300046530 Bacteria 1221
2070 Ga0495654_0120427 3300046530 Bacteria 1188
2071 Ga0495665_0018499 3300046531 Bacteria 3743
2072 Ga0495665_0118158 3300046531 Bacteria 1389
2073 Ga0495640_0019619 3300046533 Bacteria 4987
2074 Ga0495640_0048473 3300046533 Bacteria 2935
2075 Ga0495586_0005657 3300046535 Bacteria 6682
2076 Ga0495587_0000297 3300046536 Bacteria 35462
2077 Ga0495587_0001541 3300046536 Bacteria 15305
2078 Ga0495587_0005350 3300046536 Bacteria 8395
2079 Ga0495587_0012614 3300046536 Bacteria 5315
2080 Ga0495598_0000455 3300046537 Bacteria 7448
2081 Ga0495598_0042065 3300046537 Bacteria 1339
2082 Ga0495609_0000739 3300046538 Bacteria 24830
2083 Ga0495609_0001370 3300046538 Bacteria 16365
2084 Ga0495609_0001436 3300046538 Bacteria 15862
2085 Ga0495609_0002734 3300046538 Bacteria 10618
2086 Ga0495609_0003636 3300046538 Bacteria 8745
2087 Ga0495609_0010727 3300046538 Bacteria 4383
2088 Ga0495609_0030245 3300046538 Bacteria 2464
2089 Ga0495609_0087138 3300046538 Bacteria 1360
2090 Ga0495609_0098512 3300046538 Bacteria 1267
2091 Ga0495621_0004814 3300046539 Bacteria 3828
2092 Ga0495621_0111722 3300046539 Bacteria 1049
2093 Ga0495621_0137003 3300046539 Bacteria 956
2094 Ga0495597_0000147 3300046542 Bacteria 62147
2095 Ga0495597_0000161 3300046542 Bacteria 59525
2096 Ga0495597_0000832 3300046542 Bacteria 24275
2097 Ga0495597_0004353 3300046542 Bacteria 7806
2098 Ga0495597_0006700 3300046542 Bacteria 5929
2099 Ga0495597_0008750 3300046542 Bacteria 5058
2100 Ga0495597_0021542 3300046542 Bacteria 2995
2101 Ga0495597_0022440 3300046542 Bacteria 2928
2102 Ga0495597_0150268 3300046542 Bacteria 956
2103 Ga0495645_0030133 3300046543 Bacteria 3951
2104 Ga0495645_0075190 3300046543 Bacteria 2431
2105 Ga0495645_0095310 3300046543 Bacteria 2122
2106 Ga0495622_0000155 3300046557 Bacteria 58297
2107 Ga0495622_0000545 3300046557 Bacteria 22623
2108 Ga0495622_0001915 3300046557 Bacteria 10237
2109 Ga0495622_0002366 3300046557 Bacteria 9172
2110 Ga0495622_0008600 3300046557 Bacteria 4735
2111 Ga0495622_0029126 3300046557 Bacteria 2580
2112 Ga0495622_0036611 3300046557 Bacteria 2287
2113 Ga0495622_0039844 3300046557 Bacteria 2188
2114 Ga0495622_0260332 3300046557 Bacteria 761
2115 Ga0495633_0000068 3300046558 Bacteria 136733
2116 Ga0495633_0009900 3300046558 Bacteria 5234
2117 Ga0495633_0036723 3300046558 Bacteria 2346
2118 Ga0495633_0073669 3300046558 Bacteria 1592
2119 Ga0495633_0075780 3300046558 Bacteria 1566
2120 Ga0495633_0236069 3300046558 Bacteria 835
2121 Ga0495667_0025478 3300046559 Bacteria 3985
2122 Ga0495667_0032523 3300046559 Bacteria 3495
2123 Ga0495656_0002385 3300046615 Bacteria 6228
2124 Ga0495656_0040980 3300046615 Bacteria 1932
2125 Ga0495656_0348748 3300046615 Bacteria 767
2126 Ga0495668_0000093 3300046616 Bacteria 142565
2127 Ga0495668_0002276 3300046616 Bacteria 16139
2128 Ga0495668_0006229 3300046616 Bacteria 7875
2129 Ga0495668_0007245 3300046616 Bacteria 7117
2130 Ga0495668_0010021 3300046616 Bacteria 5770
2131 Ga0495668_0077103 3300046616 Bacteria 1830
2132 Ga0495668_0193656 3300046616 Bacteria 1113
2133 Ga0495634_0001010 3300046642 Bacteria 26441
2134 Ga0495634_0004672 3300046642 Bacteria 10656
2135 Ga0495634_0010343 3300046642 Bacteria 6836
2136 Ga0495634_0129213 3300046642 Bacteria 1612
2137 Ga0495611_0006444 3300046648 Bacteria 5005
2138 Ga0495611_0057986 3300046648 Bacteria 1755
2139 Ga0495611_0095142 3300046648 Bacteria 1378
2140 Ga0495611_0104817 3300046648 Bacteria 1315
2141 Ga0495625_0000257 3300046660 Bacteria 82608
2142 Ga0495625_0000322 3300046660 Bacteria 72914
2143 Ga0495625_0002292 3300046660 Bacteria 20955
2144 Ga0495625_0004901 3300046660 Bacteria 12466
2145 Ga0495625_0005239 3300046660 Bacteria 11933
2146 Ga0495625_0017229 3300046660 Bacteria 5657
2147 Ga0495625_0019246 3300046660 Bacteria 5302
2148 Ga0495625_0034185 3300046660 Bacteria 3753
2149 Ga0495625_0103805 3300046660 Bacteria 1949
2150 Ga0495625_0106996 3300046660 Bacteria 1914
2151 Ga0495625_0115459 3300046660 Bacteria 1832
2152 Ga0495625_0129624 3300046660 Bacteria 1709
2153 Ga0495625_0132503 3300046660 Bacteria 1687
2154 Ga0495625_0161787 3300046660 Bacteria 1499
2155 Ga0495625_0172035 3300046660 Bacteria 1446
2156 Ga0495625_0271235 3300046660 Bacteria 1095
2157 Ga0495635_0000627 3300046663 Bacteria 22745
2158 Ga0495635_0001044 3300046663 Bacteria 18359
2159 Ga0495635_0019223 3300046663 Bacteria 4765
2160 Ga0495635_0088404 3300046663 Bacteria 2120
2161 Ga0495635_0314057 3300046663 Bacteria 1049
2162 Ga0495659_0000137 3300046664 Bacteria 32374
2163 Ga0495659_0001999 3300046664 Bacteria 6701
2164 Ga0495659_0007691 3300046664 Bacteria 3416
2165 Ga0495659_0017460 3300046664 Bacteria 2378
2166 Ga0495659_0022644 3300046664 Bacteria 2128
2167 Ga0495661_0008384 3300046665 Bacteria 7151
2168 Ga0495661_0020592 3300046665 Bacteria 4304
2169 Ga0495661_0031884 3300046665 Bacteria 3337
2170 Ga0495661_0085750 3300046665 Bacteria 1804
2171 Ga0495661_0090384 3300046665 Bacteria 1743
2172 Ga0495661_0099134 3300046665 Bacteria 1643
2173 Ga0495661_0109961 3300046665 Bacteria 1537
2174 Ga0495661_0115657 3300046665 Bacteria 1489
2175 Ga0495661_0120399 3300046665 Bacteria 1450
2176 Ga0495588_0000459 3300046674 Bacteria 20480
2177 Ga0495588_0005783 3300046674 Bacteria 5528
2178 Ga0495588_0008455 3300046674 Bacteria 4726
2179 Ga0495588_0011241 3300046674 Bacteria 4195
2180 Ga0495588_0065281 3300046674 Bacteria 1888
2181 Ga0495588_0082953 3300046674 Bacteria 1674
2182 Ga0495588_0110333 3300046674 Bacteria 1449
2183 Ga0495657_0012774 3300046675 Bacteria 6227
2184 Ga0495599_0001025 3300046678 Bacteria 15709
2185 Ga0495599_0005149 3300046678 Bacteria 7791
2186 Ga0495599_0019202 3300046678 Bacteria 4262
2187 Ga0495599_0028265 3300046678 Bacteria 3515
2188 Ga0495623_0000495 3300046679 Bacteria 26101
2189 Ga0495623_0014458 3300046679 Bacteria 5108
2190 Ga0495623_0023566 3300046679 Bacteria 3972
2191 Ga0495623_0137482 3300046679 Bacteria 1457
2192 Ga0495623_0344724 3300046679 Bacteria 813
2193 Ga0495646_0000079 3300046680 Bacteria 46003
2194 Ga0495646_0006783 3300046680 Bacteria 7266
2195 Ga0495646_0037062 3300046680 Bacteria 3018
2196 Ga0495646_0038417 3300046680 Bacteria 2956
2197 Ga0495646_0051165 3300046680 Bacteria 2501
2198 Ga0495647_0006089 3300046681 Bacteria 3977
2199 Ga0495658_0006716 3300046683 Bacteria 5657
2200 Ga0495658_0014776 3300046683 Bacteria 3994
2201 Ga0495658_0156820 3300046683 Bacteria 1401
2202 Ga0495658_0237626 3300046683 Bacteria 1144
2203 Ga0495669_0002062 3300046684 Bacteria 8233
2204 Ga0495669_0007762 3300046684 Bacteria 4505
2205 Ga0495669_0038687 3300046684 Bacteria 2112
2206 Ga0495613_0026346 3300046689 Bacteria 4332
2207 Ga0495613_0033253 3300046689 Bacteria 3832
2208 Ga0495613_0038859 3300046689 Bacteria 3528
2209 Ga0495624_0002994 3300046690 Bacteria 12638
2210 Ga0495624_0030236 3300046690 Bacteria 3529
2211 Ga0495624_0030706 3300046690 Bacteria 3498
2212 Ga0495624_0097625 3300046690 Bacteria 1810
2213 Ga0495624_0157434 3300046690 Bacteria 1388
2214 Ga0495670_0000288 3300046691 Bacteria 23718
2215 Ga0495670_0002138 3300046691 Bacteria 9770
2216 Ga0495670_0010201 3300046691 Bacteria 4620
2217 Ga0495670_0014820 3300046691 Bacteria 3837
2218 Ga0495670_0031349 3300046691 Bacteria 2641
2219 Ga0495670_0056836 3300046691 Bacteria 1963
2220 Ga0495670_0077183 3300046691 Bacteria 1693
2221 Ga0495670_0206065 3300046691 Bacteria 1042
2222 Ga0495671_0000125 3300046692 Bacteria 70115
2223 Ga0495671_0000168 3300046692 Bacteria 57864
2224 Ga0495671_0000699 3300046692 Bacteria 24310
2225 Ga0495671_0005180 3300046692 Bacteria 7670
2226 Ga0495671_0011851 3300046692 Bacteria 4779
2227 Ga0495671_0026118 3300046692 Bacteria 3029
2228 Ga0495671_0029473 3300046692 Bacteria 2818
2229 Ga0495671_0042241 3300046692 Bacteria 2292
2230 Ga0495671_0071038 3300046692 Bacteria 1710
2231 Ga0495671_0081268 3300046692 Bacteria 1588
2232 Ga0495671_0088042 3300046692 Bacteria 1521
2233 Ga0495671_0126160 3300046692 Bacteria 1248
2234 Ga0495649_0001058 3300046694 Bacteria 21531
2235 Ga0495649_0001144 3300046694 Bacteria 20665
2236 Ga0495649_0003310 3300046694 Bacteria 10951
2237 Ga0495649_0004148 3300046694 Bacteria 9517
2238 Ga0495649_0004156 3300046694 Bacteria 9505
2239 Ga0495649_0007156 3300046694 Bacteria 6852
2240 Ga0495649_0011249 3300046694 Bacteria 5257
2241 Ga0495649_0014782 3300046694 Bacteria 4461
2242 Ga0495649_0019757 3300046694 Bacteria 3783
2243 Ga0495649_0020589 3300046694 Bacteria 3699
2244 Ga0495649_0038346 3300046694 Bacteria 2629
2245 Ga0495649_0080128 3300046694 Bacteria 1746
2246 Ga0495649_0083885 3300046694 Bacteria 1702
2247 Ga0495649_0096917 3300046694 Bacteria 1569
2248 Ga0495649_0219781 3300046694 Bacteria 983
2249 Ga0495589_0000305 3300046794 Bacteria 39215
2250 Ga0495589_0002686 3300046794 Bacteria 9835
2251 Ga0495589_0023845 3300046794 Bacteria 3113
2252 Ga0495589_0030346 3300046794 Bacteria 2722
2253 Ga0495589_0035793 3300046794 Bacteria 2488
2254 Ga0495589_0073286 3300046794 Bacteria 1671
2255 Ga0495589_0184699 3300046794 Bacteria 988
2256 Ga0495600_0007077 3300046809 Bacteria 6856
2257 Ga0495600_0014007 3300046809 Bacteria 5052
2258 Ga0495600_0103878 3300046809 Bacteria 1851
2259 Ga0495600_0269760 3300046809 Bacteria 1079
2260 Ga0495660_0005263 3300046810 Bacteria 7758
2261 Ga0495660_0012111 3300046810 Bacteria 5003
2262 Ga0495660_0022216 3300046810 Bacteria 3625
2263 Ga0495660_0029221 3300046810 Bacteria 3111
2264 Ga0495660_0042022 3300046810 Bacteria 2527
2265 Ga0495660_0045360 3300046810 Bacteria 2414
2266 Ga0495660_0061171 3300046810 Bacteria 2021
2267 Ga0495660_0074144 3300046810 Bacteria 1798
2268 Ga0495660_0079112 3300046810 Bacteria 1727
2269 Ga0495660_0120097 3300046810 Bacteria 1331
2270 Ga0495660_0128779 3300046810 Bacteria 1272
2271 Ga0495581_0000360 3300047315 Bacteria 22826
2272 Ga0495581_0001332 3300047315 Bacteria 13639
2273 Ga0495581_0017266 3300047315 Bacteria 4193
2274 Ga0495581_0397354 3300047315 Bacteria 804
2275 Ga0495604_0002071 3300047317 Bacteria 16186
2276 Ga0495604_0008401 3300047317 Bacteria 8161
2277 Ga0495604_0016309 3300047317 Bacteria 5937
2278 Ga0495604_0039718 3300047317 Bacteria 3697
2279 Ga0495604_0078148 3300047317 Bacteria 2484
2280 Ga0495604_0082538 3300047317 Bacteria 2403
2281 Ga0495636_0002769 3300047318 Bacteria 6761
2282 Ga0495636_0007634 3300047318 Bacteria 4253
2283 Ga0495636_0009139 3300047318 Bacteria 3898
2284 Ga0495636_0026245 3300047318 Bacteria 2368
2285 Ga0495636_0052146 3300047318 Bacteria 1715
2286 Ga0495636_0082608 3300047318 Bacteria 1385
2287 Ga0495636_0284639 3300047318 Bacteria 771
2288 Ga0495674_0000633 3300047319 Bacteria 32831
2289 Ga0495674_0006909 3300047319 Bacteria 10855
2290 Ga0495674_0026346 3300047319 Bacteria 5319
2291 Ga0495674_0117406 3300047319 Bacteria 2250
2292 Ga0495674_0124326 3300047319 Bacteria 2178
2293 Ga0495674_0276176 3300047319 Bacteria 1378
2294 Ga0495672_0000550 3300047320 Bacteria 42605
2295 Ga0495672_0002301 3300047320 Bacteria 17722
2296 Ga0495672_0002328 3300047320 Bacteria 17613
2297 Ga0495672_0005036 3300047320 Bacteria 10568
2298 Ga0495672_0005065 3300047320 Bacteria 10531
2299 Ga0495672_0005088 3300047320 Bacteria 10504
2300 Ga0495672_0006036 3300047320 Bacteria 9465
2301 Ga0495672_0010391 3300047320 Bacteria 6636
2302 Ga0495672_0033526 3300047320 Bacteria 3180
2303 Ga0495672_0040381 3300047320 Bacteria 2830
2304 Ga0495672_0049182 3300047320 Bacteria 2496
2305 Ga0495672_0080207 3300047320 Bacteria 1821
2306 Ga0495672_0096577 3300047320 Bacteria 1611
2307 Ga0495672_0104989 3300047320 Bacteria 1525
2308 Ga0495672_0107810 3300047320 Bacteria 1499
2309 Ga0495676_0060365 3300047321 Bacteria 2972
2310 Ga0495676_0132934 3300047321 Bacteria 1793
2311 Ga0495680_0000249 3300047322 Bacteria 59690
2312 Ga0495680_0004905 3300047322 Bacteria 12674
2313 Ga0495680_0026189 3300047322 Bacteria 4812
2314 Ga0495680_0055500 3300047322 Bacteria 3072
2315 Ga0495680_0066552 3300047322 Bacteria 2757
2316 Ga0495680_0098252 3300047322 Bacteria 2185
2317 Ga0495680_0543610 3300047322 Bacteria 784
2318 Ga0495683_0001613 3300047323 Bacteria 14509
2319 Ga0495683_0002687 3300047323 Bacteria 10611
2320 Ga0495683_0005163 3300047323 Bacteria 7273
2321 Ga0495683_0006164 3300047323 Bacteria 6573
2322 Ga0495683_0052117 3300047323 Bacteria 2043
2323 Ga0495683_0099229 3300047323 Bacteria 1402
2324 Ga0495683_0100302 3300047323 Bacteria 1392
2325 Ga0495683_0165328 3300047323 Bacteria 1020
2326 Ga0495687_000148 3300047443 Bacteria 106947
2327 Ga0495687_000202 3300047443 Bacteria 84886
2328 Ga0495687_000222 3300047443 Bacteria 80818
2329 Ga0495687_000399 3300047443 Bacteria 54034
2330 Ga0495687_001094 3300047443 Bacteria 26496
2331 Ga0495687_004867 3300047443 Bacteria 8818
2332 Ga0495687_010476 3300047443 Bacteria 5082
2333 Ga0495687_011008 3300047443 Bacteria 4901
2334 Ga0495687_012425 3300047443 Bacteria 4503
2335 Ga0495687_100571 3300047443 Bacteria 1085
2336 Ga0495675_0049478 3300047444 Bacteria 2672
2337 Ga0495677_0000197 3300047445 Bacteria 27861
2338 Ga0495677_0007897 3300047445 Bacteria 3957
2339 Ga0495677_0015610 3300047445 Bacteria 2758
2340 Ga0495677_0028178 3300047445 Bacteria 2039
2341 Ga0495677_0036744 3300047445 Bacteria 1789
2342 Ga0495679_009103 3300047446 Bacteria 3998
2343 Ga0495679_021629 3300047446 Bacteria 2216
2344 Ga0495685_000077 3300047447 Bacteria 37238
2345 Ga0495685_015963 3300047447 Bacteria 2565
2346 Ga0495685_018639 3300047447 Bacteria 2383
2347 Ga0495685_038319 3300047447 Bacteria 1642
2348 Ga0495685_045512 3300047447 Bacteria 1494
2349 Ga0495685_108757 3300047447 Bacteria 913
2350 Ga0495673_0000074 3300047469 Bacteria 210788
2351 Ga0495673_0000275 3300047469 Bacteria 70004
2352 Ga0495673_0001175 3300047469 Bacteria 22139
2353 Ga0495673_0001287 3300047469 Bacteria 20462
2354 Ga0495673_0001850 3300047469 Bacteria 15884
2355 Ga0495673_0017424 3300047469 Bacteria 3649
2356 Ga0495673_0023990 3300047469 Bacteria 2956
2357 Ga0495673_0056928 3300047469 Bacteria 1689
2358 Ga0495673_0078348 3300047469 Bacteria 1374
2359 Ga0495673_0108461 3300047469 Bacteria 1113
2360 Ga0495673_0142675 3300047469 Bacteria 932
2361 Ga0495673_0160794 3300047469 Bacteria 862
2362 Ga0495681_0000199 3300047470 Bacteria 50259
2363 Ga0495681_0000393 3300047470 Bacteria 33978
2364 Ga0495681_0000775 3300047470 Bacteria 24609
2365 Ga0495681_0002259 3300047470 Bacteria 13849
2366 Ga0495681_0027532 3300047470 Bacteria 2938
2367 Ga0495681_0028344 3300047470 Bacteria 2882
2368 Ga0495684_0045471 3300047471 Bacteria 3360
2369 Ga0495684_0127356 3300047471 Bacteria 1915
2370 Ga0495686_0001066 3300047472 Bacteria 32643
2371 Ga0495686_0001944 3300047472 Bacteria 20572
2372 Ga0495686_0008643 3300047472 Bacteria 7438
2373 Ga0495686_0027251 3300047472 Bacteria 3732
2374 Ga0495686_0035966 3300047472 Bacteria 3180
2375 Ga0495686_0045987 3300047472 Bacteria 2761
2376 Ga0495686_0126523 3300047472 Bacteria 1519
2377 Ga0495593_0000528 3300047673 Bacteria 21651
2378 Ga0495593_0011211 3300047673 Bacteria 5154
2379 Ga0495593_0053789 3300047673 Bacteria 2123
2380 Ga0495602_0007320 3300048088 Bacteria 11557
2381 Ga0495602_0039597 3300048088 Bacteria 4338
2382 Ga0495602_0263047 3300048088 Bacteria 1279
2383 Ga0495614_0038453 3300048089 Bacteria 2053
2384 Ga0495626_0000072 3300048091 Bacteria 134289
2385 Ga0495626_0000351 3300048091 Bacteria 48029
2386 Ga0495626_0000938 3300048091 Bacteria 25371
2387 Ga0495626_0001059 3300048091 Bacteria 23528
2388 Ga0495626_0018829 3300048091 Bacteria 3459
2389 Ga0495626_0022371 3300048091 Bacteria 3123
2390 Ga0495626_0080139 3300048091 Bacteria 1452
2391 Ga0495626_0101624 3300048091 Bacteria 1253
2392 Ga0496100_0106669 3300048903 Bacteria 1939
2393 Ga0496100_0238331 3300048903 Bacteria 1341
2394 Ga0496100_0963494 3300048903 Bacteria 671
2395 Ga0496101_0031279 3300048904 Bacteria 3740
2396 Ga0496101_0165807 3300048904 Bacteria 1696
2397 Ga0496101_0200730 3300048904 Bacteria 1542
2398 Ga0496102_0000242 3300048905 Bacteria 71504
2399 Ga0496102_0062468 3300048905 Bacteria 3410
2400 Ga0496102_0078142 3300048905 Bacteria 3046
2401 Ga0496102_0154937 3300048905 Bacteria 2154
2402 Ga0496102_0165326 3300048905 Bacteria 2082
2403 Ga0496102_0252580 3300048905 Bacteria 1663
2404 Ga0496102_0445394 3300048905 Bacteria 1215
2405 Ga0496103_0000626 3300048906 Bacteria 27077
2406 Ga0496103_0002738 3300048906 Bacteria 11002
2407 Ga0496103_0011559 3300048906 Bacteria 5234
2408 Ga0496103_0094773 3300048906 Bacteria 1886
2409 Ga0496103_0157222 3300048906 Bacteria 1457
2410 Ga0496103_0190007 3300048906 Bacteria 1320
2411 Ga0496104_0000117 3300048907 Bacteria 74244
2412 Ga0496104_0014002 3300048907 Bacteria 7236
2413 Ga0496105_0000094 3300048908 Bacteria 61105
2414 Ga0496105_0052502 3300048908 Bacteria 3367
2415 Ga0496105_0264168 3300048908 Bacteria 1391
2416 Ga0496106_0006476 3300048909 Bacteria 8674
2417 Ga0496106_0086951 3300048909 Bacteria 2408
2418 Ga0496106_0172907 3300048909 Bacteria 1713
2419 Ga0496106_0320511 3300048909 Bacteria 1244
2420 Ga0496107_0052092 3300048910 Bacteria 2952
2421 Ga0496107_0499946 3300048910 Bacteria 902
2422 Ga0496108_0038314 3300048911 Bacteria 3993
2423 Ga0496108_0050533 3300048911 Bacteria 3480
2424 Ga0496108_0082076 3300048911 Bacteria 2733
2425 Ga0496108_0183412 3300048911 Bacteria 1813
2426 Ga0496108_0251476 3300048911 Bacteria 1538
2427 Ga0496108_0316448 3300048911 Bacteria 1360
2428 Ga0496108_0319478 3300048911 Bacteria 1354
2429 Ga0496109_0012725 3300048912 Bacteria 7270
2430 Ga0496109_0029841 3300048912 Bacteria 4887
2431 Ga0496109_0034529 3300048912 Bacteria 4556
2432 Ga0496109_0040022 3300048912 Bacteria 4245
2433 Ga0496109_0041867 3300048912 Bacteria 4149
2434 Ga0496109_0202928 3300048912 Bacteria 1864
2435 Ga0496109_0206026 3300048912 Bacteria 1849
2436 Ga0496109_0300014 3300048912 Bacteria 1515
2437 Ga0496109_0588243 3300048912 Bacteria 1049
2438 Ga0496110_0021144 3300048913 Bacteria 5501
2439 Ga0496110_0046927 3300048913 Bacteria 3780
2440 Ga0496110_0053956 3300048913 Bacteria 3535
2441 Ga0496110_0074269 3300048913 Bacteria 3019
2442 Ga0496110_0169179 3300048913 Bacteria 1982
2443 Ga0496110_0289272 3300048913 Bacteria 1492
2444 Ga0496110_0303093 3300048913 Bacteria 1455
2445 Ga0496110_0786251 3300048913 Bacteria 856
2446 Ga0496111_0007449 3300048914 Bacteria 7176
2447 Ga0496111_0056900 3300048914 Bacteria 2830
2448 Ga0496111_0141272 3300048914 Bacteria 1784
2449 Ga0496111_0283840 3300048914 Bacteria 1228
2450 Ga0496112_0007965 3300048915 Bacteria 9447
2451 Ga0496112_0018603 3300048915 Bacteria 6545
2452 Ga0496112_0020508 3300048915 Bacteria 6266
2453 Ga0496112_0044202 3300048915 Bacteria 4364
2454 Ga0496112_0075137 3300048915 Bacteria 3342
2455 Ga0496112_0281895 3300048915 Bacteria 1609
2456 Ga0496113_0003118 3300048916 Bacteria 9857
2457 Ga0496113_0007525 3300048916 Bacteria 7018
2458 Ga0496113_0077796 3300048916 Bacteria 2537
2459 Ga0496113_0119714 3300048916 Bacteria 2057
2460 Ga0496113_0223395 3300048916 Bacteria 1501
2461 Ga0496113_0628299 3300048916 Bacteria 859
2462 Ga0496114_0068119 3300048917 Bacteria 2987
2463 Ga0496114_0119523 3300048917 Bacteria 2265
2464 Ga0496114_0287901 3300048917 Bacteria 1449
2465 Ga0496114_0491921 3300048917 Bacteria 1085
2466 Ga0496115_0004609 3300048918 Bacteria 9982
2467 Ga0496115_0128312 3300048918 Bacteria 2090
2468 Ga0496115_0210568 3300048918 Bacteria 1606
2469 Ga0496115_0304905 3300048918 Bacteria 1304
2470 Ga0496116_0000683 3300048919 Bacteria 44065
2471 Ga0496116_0002937 3300048919 Bacteria 17363
2472 Ga0496116_0020906 3300048919 Bacteria 4953
2473 Ga0496116_0032512 3300048919 Bacteria 3717
2474 Ga0496116_0047802 3300048919 Bacteria 2877
2475 Ga0496116_0101077 3300048919 Bacteria 1722
2476 Ga0496117_0003211 3300048920 Bacteria 19328
2477 Ga0496117_0005257 3300048920 Bacteria 13736
2478 Ga0496117_0019674 3300048920 Bacteria 5534
2479 Ga0496117_0048571 3300048920 Bacteria 3029
2480 Ga0496117_0074238 3300048920 Bacteria 2265
2481 Ga0496118_0003853 3300048921 Bacteria 18433
2482 Ga0496118_0007447 3300048921 Bacteria 11596
2483 Ga0496118_0016697 3300048921 Bacteria 6723
2484 Ga0496118_0030050 3300048921 Bacteria 4544
2485 Ga0496118_0058704 3300048921 Bacteria 2872
2486 Ga0496118_0087525 3300048921 Bacteria 2160
2487 Ga0496118_0124171 3300048921 Bacteria 1675
2488 Ga0496118_0350624 3300048921 Bacteria 787
2489 Ga0496119_0002464 3300048922 Bacteria 20306
2490 Ga0496119_0008202 3300048922 Bacteria 9241
2491 Ga0496119_0011706 3300048922 Bacteria 7220
2492 Ga0496119_0029911 3300048922 Bacteria 3682
2493 Ga0496119_0081275 3300048922 Bacteria 1867
2494 Ga0496119_0083671 3300048922 Bacteria 1831
2495 Ga0496120_0018208 3300048923 Bacteria 4534
2496 Ga0496120_0031593 3300048923 Bacteria 3204
2497 Ga0496120_0050604 3300048923 Bacteria 2378
2498 Ga0496120_0208502 3300048923 Bacteria 941
2499 Ga0496121_0000152 3300048924 Bacteria 150767
2500 Ga0496121_0002015 3300048924 Bacteria 32249
2501 Ga0496121_0003388 3300048924 Bacteria 22823
2502 Ga0496121_0046205 3300048924 Bacteria 3729
2503 Ga0496121_0052002 3300048924 Bacteria 3445
2504 Ga0496121_0066931 3300048924 Bacteria 2914
2505 Ga0496121_0075758 3300048924 Bacteria 2686
2506 Ga0496121_0108991 3300048924 Bacteria 2117
2507 Ga0496121_0144911 3300048924 Bacteria 1756
2508 Ga0496121_0188142 3300048924 Bacteria 1483
2509 Ga0496121_0407159 3300048924 Bacteria 889
2510 Ga0496122_0002069 3300048925 Bacteria 29741
2511 Ga0496122_0004933 3300048925 Bacteria 16180
2512 Ga0496122_0010642 3300048925 Bacteria 9447
2513 Ga0496122_0054987 3300048925 Bacteria 2983
2514 Ga0496122_0060931 3300048925 Bacteria 2774
2515 Ga0496122_0240685 3300048925 Bacteria 1021
2516 Ga0496123_0001437 3300048926 Bacteria 33190
2517 Ga0496123_0001744 3300048926 Bacteria 28715
2518 Ga0496123_0013068 3300048926 Bacteria 7008
2519 Ga0496123_0016318 3300048926 Bacteria 6041
2520 Ga0496123_0091372 3300048926 Bacteria 1805
2521 Ga0496123_0300592 3300048926 Bacteria 766
2522 Ga0496124_0001525 3300048927 Bacteria 33722
2523 Ga0496124_0002487 3300048927 Bacteria 24022
2524 Ga0496124_0007753 3300048927 Bacteria 11342
2525 Ga0496124_0016268 3300048927 Bacteria 7083
2526 Ga0496124_0058390 3300048927 Bacteria 3245
2527 Ga0496124_0062102 3300048927 Bacteria 3128
2528 Ga0496124_0114984 3300048927 Bacteria 2160
2529 Ga0496124_0169422 3300048927 Bacteria 1693
2530 Ga0496124_0220647 3300048927 Bacteria 1426
2531 Ga0496124_0223548 3300048927 Bacteria 1414
2532 Ga0496125_0000048 3300048928 Bacteria 290651
2533 Ga0496125_0002654 3300048928 Bacteria 22862
2534 Ga0496125_0014173 3300048928 Bacteria 7775
2535 Ga0496125_0015019 3300048928 Bacteria 7519
2536 Ga0496125_0035464 3300048928 Bacteria 4374
2537 Ga0496125_0040819 3300048928 Bacteria 3975
2538 Ga0496125_0046370 3300048928 Bacteria 3647
2539 Ga0496125_0072407 3300048928 Bacteria 2685
2540 Ga0496125_0118303 3300048928 Bacteria 1898
2541 Ga0496125_0238363 3300048928 Bacteria 1157
2542 Ga0496126_0052191 3300048929 Bacteria 3717
2543 Ga0496126_0091775 3300048929 Bacteria 2670
2544 Ga0496126_0176721 3300048929 Bacteria 1816
2545 Ga0495678_000555 3300049459 Bacteria 35861
2546 Ga0495678_000751 3300049459 Bacteria 29470
2547 Ga0495678_000937 3300049459 Bacteria 25350
2548 Ga0495678_001323 3300049459 Bacteria 19858
2549 Ga0495678_001462 3300049459 Bacteria 18522
2550 Ga0495678_005057 3300049459 Bacteria 7413
2551 Ga0495678_007359 3300049459 Bacteria 5718
2552 Ga0495678_011926 3300049459 Bacteria 4139
2553 Ga0495678_021005 3300049459 Bacteria 2882
2554 Ga0495678_026447 3300049459 Bacteria 2477
2555 Ga0495682_0002674 3300049460 Bacteria 8318
2556 Ga0495682_0003481 3300049460 Bacteria 6997
2557 Ga0495682_0016588 3300049460 Bacteria 2787
2558 Ga0495682_0086599 3300049460 Bacteria 1126
2559 Ga0495682_0104934 3300049460 Bacteria 1013
2560 Ga0501290_000751 3300049513 Bacteria 4814
2561 Ga0501292_002330 3300049515 Bacteria 2440
2562 Ga0501292_029294 3300049515 Bacteria 920
2563 Ga0501294_006094 3300049517 Bacteria 1150
2564 Ga0501298_004272 3300049521 Bacteria 2246
2565 Ga0501300_011625 3300049523 Bacteria 1281
2566 Ga0501303_003674 3300049526 Bacteria 1240
2567 Ga0501031_0023053 3300049568 Bacteria 4060
2568 Ga0501031_0052120 3300049568 Bacteria 2666
2569 Ga0501034_0003723 3300049571 Bacteria 17221
2570 Ga0501034_0078947 3300049571 Bacteria 3295
2571 Ga0501034_0125443 3300049571 Bacteria 2553
2572 Ga0501036_0019057 3300049572 Bacteria 5757
2573 Ga0501036_0258483 3300049572 Bacteria 1459
2574 Ga0501036_0603036 3300049572 Bacteria 911
2575 Ga0501037_0115165 3300049573 Bacteria 1935
2576 Ga0501037_0415049 3300049573 Bacteria 922
2577 Ga0501037_0759259 3300049573 Bacteria 642
2578 Ga0501038_0009783 3300049574 Bacteria 8784
2579 Ga0501038_0069078 3300049574 Bacteria 3002
2580 Ga0501038_0140995 3300049574 Bacteria 1972
2581 Ga0501039_0019991 3300049575 Bacteria 5133
2582 Ga0501039_0088928 3300049575 Bacteria 2406
2583 Ga0501039_0320832 3300049575 Bacteria 1218
2584 Ga0501039_0351727 3300049575 Bacteria 1158
2585 Ga0501039_0430649 3300049575 Bacteria 1036
2586 Ga0501040_0111905 3300049576 Bacteria 1909
2587 Ga0501041_0038647 3300049577 Bacteria 2894
2588 Ga0501041_0132776 3300049577 Bacteria 1551
2589 Ga0501042_0046292 3300049578 Bacteria 3101
2590 Ga0501042_0109569 3300049578 Bacteria 1988
2591 Ga0501043_0228182 3300049579 Bacteria 1439
2592 Ga0501046_0337003 3300049580 Bacteria 1097
2593 Ga0501047_0034832 3300049581 Bacteria 4861
2594 Ga0501047_0047685 3300049581 Bacteria 4138
2595 Ga0501048_0131815 3300049582 Bacteria 1766
2596 Ga0501048_0254888 3300049582 Bacteria 1246
2597 Ga0501048_0319519 3300049582 Bacteria 1106
2598 Ga0501048_0324979 3300049582 Bacteria 1096
2599 Ga0501048_0393158 3300049582 Bacteria 991
2600 Ga0501067_0032780 3300049583 Bacteria 2883
2601 Ga0501067_0079901 3300049583 Bacteria 1812
2602 Ga0501067_0193328 3300049583 Bacteria 1134
2603 Ga0501068_0124104 3300049584 Bacteria 1612
2604 Ga0501069_0020859 3300049585 Bacteria 3553
2605 Ga0501070_0470245 3300049586 Bacteria 1012
2606 Ga0501071_0003797 3300049587 Bacteria 9494
2607 Ga0501071_0072849 3300049587 Bacteria 2505
2608 Ga0501071_0160596 3300049587 Bacteria 1679
2609 Ga0501071_0357783 3300049587 Bacteria 1111
2610 Ga0501071_0532805 3300049587 Bacteria 901
2611 Ga0501072_0042363 3300049588 Bacteria 3576
2612 Ga0501072_0076259 3300049588 Bacteria 2652
2613 Ga0501072_0095664 3300049588 Bacteria 2361
2614 Ga0501072_0428793 3300049588 Bacteria 1048
2615 Ga0501072_0601634 3300049588 Bacteria 867
2616 Ga0501073_0098324 3300049589 Bacteria 2032
2617 Ga0501073_0281410 3300049589 Bacteria 1148
2618 Ga0501073_0636499 3300049589 Bacteria 736
2619 Ga0501074_0092009 3300049590 Bacteria 2172
2620 Ga0501075_0011615 3300049591 Bacteria 6235
2621 Ga0501075_0321857 3300049591 Bacteria 1178
2622 Ga0501075_0511454 3300049591 Bacteria 916
2623 Ga0501076_0059167 3300049592 Bacteria 3047
2624 Ga0501076_0067829 3300049592 Bacteria 2849
2625 Ga0501076_0120680 3300049592 Bacteria 2123
2626 Ga0501076_0515721 3300049592 Bacteria 985
2627 Ga0501077_0047894 3300049593 Bacteria 2716
2628 Ga0501198_010962 3300049649 Bacteria 1347
2629 Ga0501211_000658 3300049658 Bacteria 3481
2630 Ga0501223_000003 3300049663 Bacteria 145549
2631 Ga0501223_000020 3300049663 Bacteria 67103
2632 Ga0501224_000004 3300049664 Bacteria 169090
2633 Ga0501233_010218 3300049668 Bacteria 1844
2634 Ga0501235_001348 3300049669 Bacteria 5207
2635 Ga0501235_001564 3300049669 Bacteria 4901
2636 Ga0501235_013471 3300049669 Bacteria 1800
2637 Ga0501236_022010 3300049670 Bacteria 949
2638 Ga0501246_000607 3300049676 Bacteria 2612
2639 Ga0501257_000050 3300049686 Bacteria 33034
2640 Ga0501257_017806 3300049686 Bacteria 1654
2641 Ga0501221_004867 3300049704 Bacteria 2234
2642 Ga0501225_0000002 3300049705 Bacteria 147414
2643 Ga0501225_0000629 3300049705 Bacteria 10996
2644 Ga0501225_0002548 3300049705 Bacteria 5625
2645 Ga0501225_0011951 3300049705 Bacteria 2441
2646 Ga0501225_0043123 3300049705 Bacteria 1246
2647 Ga0501225_0096096 3300049705 Bacteria 862
2648 Ga0501234_003641 3300049707 Bacteria 2423
2649 Ga0501079_0030222 3300049741 Bacteria 4163
2650 Ga0501079_0042326 3300049741 Bacteria 3518
2651 Ga0501079_0074830 3300049741 Bacteria 2618
2652 Ga0501079_0084183 3300049741 Bacteria 2460
2653 Ga0501080_0053495 3300049742 Bacteria 3760
2654 Ga0501080_0446367 3300049742 Bacteria 1160
2655 Ga0501081_0047224 3300049743 Bacteria 2962
2656 Ga0501081_0099890 3300049743 Bacteria 2050
2657 Ga0501081_0100055 3300049743 Bacteria 2049
2658 Ga0501083_0071689 3300049744 Bacteria 2303
2659 Ga0501262_000403 3300049759 Bacteria 5235
2660 Ga0501265_001360 3300049762 Bacteria 2763
2661 Ga0501279_004708 3300049775 Bacteria 1790
2662 Ga0501280_001539 3300049776 Bacteria 4190
2663 Ga0501035_0179254 3300049822 Bacteria 1826
2664 Ga0501035_0427912 3300049822 Bacteria 1098
2665 Ga0501044_0247713 3300049823 Bacteria 1724
2666 Ga0501044_0248368 3300049823 Bacteria 1721
2667 Ga0501045_0134534 3300049824 Bacteria 1838
2668 Ga0501045_0209622 3300049824 Bacteria 1452
2669 Ga0501045_0225619 3300049824 Bacteria 1394
2670 Ga0501045_0407528 3300049824 Bacteria 1012
2671 Ga0501045_0460795 3300049824 Bacteria 945
2672 Ga0501226_000018 3300049853 Bacteria 147268
2673 nmdc:mga03683_170918_c1 3300050489 Bacteria 988
2674 nmdc:mga03683_286335_c1 3300050489 Bacteria 771
2675 nmdc:mga03683_38855_c1 3300050489 Bacteria 1946
2676 nmdc:mga03683_61369_c1 3300050489 Bacteria 1590
2677 nmdc:mga03683_71513_c1 3300050489 Bacteria 1484
2678 nmdc:mga03683_7763_c1 3300050489 Bacteria 3739
2679 nmdc:mga03n38_115896_c1 3300050490 Bacteria 1311
2680 nmdc:mga00v17_13191_c1 3300050491 Bacteria 4579
2681 nmdc:mga00v17_13811_c1 3300050491 Bacteria 4491
2682 nmdc:mga00v17_199256_c1 3300050491 Bacteria 1294
2683 nmdc:mga00v17_437864_c1 3300050491 Bacteria 849
2684 nmdc:mga00v17_45020_c1 3300050491 Bacteria 2664
2685 nmdc:mga00v17_599108_c1 3300050491 Bacteria 711
2686 nmdc:mga00v17_7261_c1 3300050491 Bacteria 5904
2687 nmdc:mga0yw44_101080_c1 3300050492 Bacteria 1837
2688 nmdc:mga0yw44_13080_c1 3300050492 Bacteria 4354
2689 nmdc:mga0yw44_218865_c1 3300050492 Bacteria 1261
2690 nmdc:mga0yw44_283911_c1 3300050492 Bacteria 1107
2691 nmdc:mga0yw44_46065_c1 3300050492 Bacteria 2617
2692 nmdc:mga0yw44_55441_c1 3300050492 Bacteria 2412
2693 nmdc:mga0yw44_81611_c1 3300050492 Bacteria 2028
2694 nmdc:mga0yw44_90945_c1 3300050492 Bacteria 1928
2695 nmdc:mga0k408_104933_c1 3300050493 Bacteria 1668
2696 nmdc:mga0k408_1177_c1 3300050493 Bacteria 14308
2697 nmdc:mga0k408_134761_c1 3300050493 Bacteria 1467
2698 nmdc:mga0k408_14277_c1 3300050493 Bacteria 4373
2699 nmdc:mga0k408_18322_c1 3300050493 Bacteria 3907
2700 nmdc:mga0k408_37140_c1 3300050493 Bacteria 2796
2701 nmdc:mga0k408_4014_c1 3300050493 Bacteria 7810
2702 nmdc:mga0k408_456999_c1 3300050493 Bacteria 758
2703 nmdc:mga0k408_51787_c1 3300050493 Bacteria 2379
2704 nmdc:mga0k408_55881_c1 3300050493 Bacteria 2289
2705 nmdc:mga0k408_80041_c1 3300050493 Bacteria 1912
2706 nmdc:mga06z11_147999_c1 3300050494 Bacteria 1333
2707 nmdc:mga06z11_53669_c1 3300050494 Bacteria 2074
2708 nmdc:mga06z11_60830_c1 3300050494 Bacteria 1968
2709 nmdc:mga04h51_143778_c1 3300050495 Bacteria 907
2710 nmdc:mga07m45_10927_c1 3300050496 Bacteria 4756
2711 nmdc:mga07m45_113521_c1 3300050496 Bacteria 1562
2712 nmdc:mga07m45_133677_c1 3300050496 Bacteria 1436
2713 nmdc:mga07m45_23361_c1 3300050496 Bacteria 3380
2714 nmdc:mga07m45_48798_c1 3300050496 Bacteria 2381
2715 nmdc:mga07m45_5675_c1 3300050496 Bacteria 6237
2716 nmdc:mga07m45_59935_c1 3300050496 Bacteria 2154
2717 nmdc:mga07m45_6019_c1 3300050496 Bacteria 6104
2718 nmdc:mga05p37_101008_c1 3300050507 Bacteria 3553
2719 nmdc:mga05p37_190923_c1 3300050507 Bacteria 2487
2720 nmdc:mga05p37_203925_c1 3300050507 Bacteria 2393
2721 nmdc:mga05p37_321735_c1 3300050507 Bacteria 1830
2722 nmdc:mga05p37_549568_c1 3300050507 Bacteria 1315
2723 nmdc:mga05p37_568477_c1 3300050507 Bacteria 1287
2724 nmdc:mga05p37_619272_c1 3300050507 Bacteria 1218
2725 nmdc:mga09592_1028_c1 3300050508 Bacteria 22182
2726 nmdc:mga09592_161724_c1 3300050508 Bacteria 1934
2727 nmdc:mga09592_241464_c1 3300050508 Bacteria 1565
2728 nmdc:mga09592_31102_c1 3300050508 Bacteria 4446
2729 nmdc:mga09592_7474_c1 3300050508 Bacteria 8883
2730 nmdc:mga0qj67_188916_c1 3300050509 Bacteria 1674
2731 nmdc:mga0qj67_44761_c1 3300050509 Bacteria 3490
2732 nmdc:mga0qj67_56321_c1 3300050509 Bacteria 3116
2733 nmdc:mga06r32_279850_c1 3300050510 Bacteria 1655
2734 nmdc:mga06r32_717_c1 3300050510 Bacteria 29013
2735 nmdc:mga08y16_1265_c1 3300050511 Bacteria 25109
2736 nmdc:mga08y16_131561_c1 3300050511 Bacteria 2602
2737 nmdc:mga08y16_16_c1 3300050511 Bacteria 386948
2738 nmdc:mga08y16_1753_c1 3300050511 Bacteria 21980
2739 nmdc:mga08y16_45379_c1 3300050511 Bacteria 4605
2740 nmdc:mga08y16_54335_c1 3300050511 Bacteria 4185
2741 nmdc:mga08y16_663730_c1 3300050511 Bacteria 1046
2742 nmdc:mga08y16_964944_c1 3300050511 Bacteria 834
2743 nmdc:mga0n895_14847_c1 3300050512 Bacteria 7088
2744 nmdc:mga0n895_19632_c1 3300050512 Bacteria 6285
2745 nmdc:mga0n895_248263_c1 3300050512 Bacteria 1806
2746 nmdc:mga0n895_27128_c1 3300050512 Bacteria 5437
2747 nmdc:mga0n895_272875_c1 3300050512 Bacteria 1715
2748 nmdc:mga0n895_331692_c1 3300050512 Bacteria 1541
2749 nmdc:mga0n895_403881_c1 3300050512 Bacteria 1382
2750 nmdc:mga0rr50_107275_c1 3300050513 Bacteria 2205
2751 nmdc:mga0rr50_27954_c1 3300050513 Bacteria 3958
2752 nmdc:mga0rr50_476740_c1 3300050513 Bacteria 1059
2753 nmdc:mga0rr50_485091_c1 3300050513 Bacteria 1050
2754 nmdc:mga08x19_318092_c1 3300050514 Bacteria 1083
2755 nmdc:mga08x19_389751_c1 3300050514 Bacteria 976
2756 nmdc:mga08x19_43627_c1 3300050514 Bacteria 2861
2757 nmdc:mga08x19_5747_c1 3300050514 Bacteria 7336
2758 nmdc:mga08x19_75319_c1 3300050514 Bacteria 2206
2759 nmdc:mga0a205_13549_c3 3300050515 Bacteria 2483
2760 nmdc:mga0a205_147_c1 3300050515 Bacteria 45502
2761 nmdc:mga0sz30_102934_c1 3300050516 Bacteria 1248
2762 nmdc:mga0sz30_2829_c2 3300050516 Bacteria 2944
2763 nmdc:mga0sz30_44256_c2 3300050516 Bacteria 1340
2764 nmdc:mga0sz30_74802_c1 3300050516 Bacteria 1461
2765 nmdc:mga0sz30_85802_c1 3300050516 Bacteria 1366
2766 nmdc:mga0sz30_8666_c1 3300050516 Bacteria 3847
2767 Ga0495601_0003885 3300053077 Bacteria 8598
2768 Ga0495601_0006659 3300053077 Bacteria 6762
2769 Ga0495601_0044625 3300053077 Bacteria 2786
2770 Ga0495601_0359188 3300053077 Bacteria 947
2771 Ga0500635_0006632 3300053080 Bacteria 3099
2772 Ga0495655_0064198 3300053083 Bacteria 1010
2773 Ga0495595_0023049 3300053084 Bacteria 2738
2774 Ga0495619_0055776 3300053085 Bacteria 2618
2775 Ga0495619_0082025 3300053085 Bacteria 2172
2776 Ga0495619_0148271 3300053085 Bacteria 1618
2777 Ga0495619_0181529 3300053085 Bacteria 1456
2778 Ga0495619_0210095 3300053085 Bacteria 1348
2779 Ga0500578_0012512 3300053086 Bacteria 5476
2780 Ga0500578_0102527 3300053086 Bacteria 1810
2781 Ga0500578_0103224 3300053086 Bacteria 1803
2782 Ga0500643_000210 3300053087 Bacteria 55059
2783 Ga0500643_036240 3300053087 Bacteria 1474
2784 Ga0500644_0004386 3300053088 Bacteria 3530
2785 Ga0500644_0019826 3300053088 Bacteria 1990
2786 Ga0500644_0138052 3300053088 Bacteria 966
2787 Ga0500581_098050 3300053089 Bacteria 1444
2788 Ga0500646_0008037 3300053090 Bacteria 2696
2789 Ga0500646_0012958 3300053090 Bacteria 2157
2790 Ga0500647_0035651 3300053091 Bacteria 2378
2791 Ga0500583_0059916 3300053092 Bacteria 1793
2792 Ga0500583_0223559 3300053092 Bacteria 933
2793 Ga0500651_0001142 3300053093 Bacteria 13169
2794 Ga0500651_0083089 3300053093 Bacteria 1982
2795 Ga0500566_0002544 3300053094 Bacteria 10842
2796 Ga0500641_0001644 3300053096 Bacteria 7966
2797 Ga0500641_0004116 3300053096 Bacteria 5134
2798 Ga0500641_0009129 3300053096 Bacteria 3556
2799 Ga0500641_0013631 3300053096 Bacteria 2988
2800 Ga0500641_0021871 3300053096 Bacteria 2443
2801 Ga0500650_0000023 3300053098 Bacteria 61675
2802 Ga0500650_0022011 3300053098 Bacteria 2816
2803 Ga0500650_0057807 3300053098 Bacteria 1809
2804 Ga0500555_016790 3300053103 Bacteria 2110
2805 Ga0500555_037594 3300053103 Bacteria 1356
2806 Ga0500556_0000012 3300053104 Bacteria 250391
2807 Ga0500556_0000070 3300053104 Bacteria 101159
2808 Ga0500556_0000130 3300053104 Bacteria 63676
2809 Ga0500556_0009789 3300053104 Bacteria 2795
2810 Ga0500556_0030835 3300053104 Bacteria 1820
2811 Ga0500557_001787 3300053105 Bacteria 3691
2812 Ga0500560_000039 3300053107 Bacteria 13425
2813 Ga0500562_005358 3300053108 Bacteria 3223
2814 Ga0500562_026754 3300053108 Bacteria 1512
2815 Ga0500562_055860 3300053108 Bacteria 1058
2816 Ga0500572_000916 3300053111 Bacteria 9102
2817 Ga0500572_049694 3300053111 Bacteria 1245
2818 Ga0500592_001211 3300053116 Bacteria 4201
2819 Ga0500593_038527 3300053117 Bacteria 2139
2820 Ga0500594_0007020 3300053118 Bacteria 2542
2821 Ga0500595_002653 3300053119 Bacteria 8702
2822 Ga0500595_003874 3300053119 Bacteria 6870
2823 Ga0500595_005707 3300053119 Bacteria 5390
2824 Ga0500595_017412 3300053119 Bacteria 2653
2825 Ga0500595_042897 3300053119 Bacteria 1444
2826 Ga0500597_197178 3300053120 Bacteria 847
2827 Ga0500608_010353 3300053122 Bacteria 4000
2828 Ga0500608_025245 3300053122 Bacteria 2780
2829 Ga0500614_047721 3300053123 Bacteria 1113
2830 Ga0500618_001941 3300053125 Bacteria 8495
2831 Ga0500621_118221 3300053126 Bacteria 1029
2832 Ga0500642_0000230 3300053130 Bacteria 21813
2833 Ga0500642_0001073 3300053130 Bacteria 7879
2834 Ga0500642_0067463 3300053130 Bacteria 1621
2835 Ga0500642_0095910 3300053130 Bacteria 1375
2836 Ga0500652_000290 3300053131 Bacteria 18374
2837 Ga0500652_017020 3300053131 Bacteria 2658
2838 Ga0500652_139998 3300053131 Bacteria 1007
2839 Ga0500655_025929 3300053133 Bacteria 1114
2840 Ga0500658_0011652 3300053134 Bacteria 3240
2841 Ga0500658_0015836 3300053134 Bacteria 2805
2842 Ga0500658_0087079 3300053134 Bacteria 1345
2843 Ga0500658_0182617 3300053134 Bacteria 955
2844 Ga0500559_0000082 3300053136 Bacteria 75166
2845 Ga0500568_0000339 3300053139 Bacteria 36709
2846 Ga0500568_0007694 3300053139 Bacteria 5258
2847 Ga0500568_0019065 3300053139 Bacteria 2990
2848 Ga0500568_0030169 3300053139 Bacteria 2246
2849 Ga0500568_0049079 3300053139 Bacteria 1667
2850 Ga0500573_0002497 3300053140 Bacteria 9213
2851 Ga0500574_000040 3300053141 Bacteria 16446
2852 Ga0500574_001837 3300053141 Bacteria 3308
2853 Ga0500577_0000790 3300053142 Bacteria 8156
2854 Ga0500577_0083957 3300053142 Bacteria 1275
2855 Ga0500577_0089116 3300053142 Bacteria 1243
2856 Ga0500577_0112212 3300053142 Bacteria 1126
2857 Ga0500588_0012751 3300053146 Bacteria 2092
2858 Ga0500588_0068756 3300053146 Bacteria 1155
2859 Ga0500590_009781 3300053148 Bacteria 4829
2860 Ga0500604_0002065 3300053151 Bacteria 5528
2861 Ga0500604_0006820 3300053151 Bacteria 3023
2862 Ga0500616_0000035 3300053153 Bacteria 394242
2863 Ga0500616_0001372 3300053153 Bacteria 23606
2864 Ga0500616_0066592 3300053153 Bacteria 1849
2865 Ga0500616_0109361 3300053153 Bacteria 1337
2866 Ga0500619_000640 3300053154 Bacteria 5943
2867 Ga0500619_008138 3300053154 Bacteria 2528
2868 Ga0500620_000285 3300053155 Bacteria 9803
2869 Ga0500622_0000826 3300053156 Bacteria 26531
2870 Ga0500622_0001170 3300053156 Bacteria 21729
2871 Ga0500622_0004207 3300053156 Bacteria 9171
2872 Ga0500622_0081583 3300053156 Bacteria 1619
2873 Ga0500624_001154 3300053157 Bacteria 4837
2874 Ga0500624_006141 3300053157 Bacteria 1619
2875 Ga0500627_0034727 3300053158 Bacteria 2139
2876 Ga0500627_0110789 3300053158 Bacteria 1235
2877 Ga0500633_0132753 3300053160 Bacteria 930
2878 Ga0500634_0000001 3300053161 Bacteria 258285
2879 Ga0500634_0040879 3300053161 Bacteria 2519
2880 Ga0500638_000034 3300053162 Bacteria 44726
2881 Ga0500638_040298 3300053162 Bacteria 2268
2882 Ga0500639_002487 3300053163 Bacteria 9214
2883 Ga0500636_0000158 3300053177 Bacteria 35449
2884 Ga0500636_0022405 3300053177 Bacteria 3737
2885 Ga0500636_0032162 3300053177 Bacteria 3105
2886 Ga0500636_0033803 3300053177 Bacteria 3025
2887 Ga0500636_0043890 3300053177 Bacteria 2638
2888 Ga0500636_0104157 3300053177 Bacteria 1610
2889 Ga0500636_0143694 3300053177 Bacteria 1318
2890 Ga0500637_0039000 3300053178 Bacteria 2678
2891 Ga0500637_0091058 3300053178 Bacteria 1766
2892 Ga0500611_003892 3300053727 Bacteria 1959
2893 Ga0500611_056060 3300053727 Bacteria 918
2894 Ga0500657_160758 3300053728 Bacteria 815
2895 Ga0500645_020476 3300053730 Bacteria 2050
2896 Ga0500599_000198 3300053736 Bacteria 5613
2897 Ga0501084_0012758 3300054114 Bacteria 6961
2898 Ga0501084_0140779 3300054114 Bacteria 2031
2899 Ga0501084_0281400 3300054114 Bacteria 1405
2900 Ga0501084_0545571 3300054114 Bacteria 980
2901 Ga0590071_024159 3300059421 Bacteria 1440
2902 Ga0590075_009898 3300059424 Bacteria 2289
2903 Ga0590077_018369 3300059426 Bacteria 1476
2904 Ga0590077_021672 3300059426 Bacteria 1370
2905 Ga0587070_038339 3300059491 Bacteria 905
2906 Ga0587083_0005554 3300059505 Bacteria 1830
2907 Ga0587101_027760 3300059623 Bacteria 863
2908 Ga0587109_017179 3300059624 Bacteria 1249
2909 Ga0587062_002685 3300059639 Bacteria 1725
2910 Ga0587069_021972 3300059642 Bacteria 965
2911 Ga0587076_001419 3300059645 Bacteria 2431
2912 Ga0587079_003398 3300059647 Bacteria 2066
2913 Ga0501082_0010201 3300060353 Bacteria 8088
2914 Ga0501082_0127802 3300060353 Bacteria 2204
2915 Ga0501082_0450566 3300060353 Bacteria 1124
2916 Ga0501082_0746233 3300060353 Bacteria 857
2917 Ga0530510_0587831 3300061734 Bacteria 846
2918 2508697157 2508501042 Bacteria 8719808
2919 2508729167 2508501050 Bacteria 9633614
2920 2509078022 2508501114 Bacteria 7082538
2921 2509107958 2508501122 Bacteria 6292184
2922 2509117577 2508501123 Bacteria 6283661
2923 2509141782 2508501127 Bacteria 7037543
2924 2509150336 2508501128 Bacteria 8613869
2925 2511187185 2510917028 Bacteria 6185411
2926 2511256450 2511231004 Bacteria 6669789
2927 2511263933 2511231006 Bacteria 6794709
2928 2511270528 2511231007 Bacteria 6306603
2929 2511279813 2511231008 Bacteria 6624100
2930 2511303549 2511231012 Bacteria 6738011
2931 2511314671 2511231014 Bacteria 6462302
2932 2511317597 2511231015 Bacteria 6598026
2933 2511329279 2511231016 Bacteria 6704427
2934 2511331229 2511231017 Bacteria 6503007
2935 2511336681 2511231018 Bacteria 6436256
2936 2511341909 2511231019 Bacteria 6520662
2937 2511352655 2511231020 Bacteria 6115223
2938 2511356082 2511231021 Bacteria 7302637
2939 2511364960 2511231022 Bacteria 6719296
2940 2512327846 2512047018 Bacteria 6663241
2941 2512931055 2512875016 Bacteria 6529530
2942 2513556973 2513237082 Bacteria 8640282
2943 2513565798 2513237083 Bacteria 8410967
2944 2513599093 2513237088 Bacteria 6927906
2945 2513610984 2513237090 Bacteria 7096802
2946 2513622309 2513237092 Bacteria 8341956
2947 2513629684 2513237093 Bacteria 7545552
2948 2513638830 2513237094 Bacteria 8789602
2949 2513658245 2513237096 Bacteria 8722461
2950 2513672560 2513237098 Bacteria 9902361
2951 2513694233 2513237101 Bacteria 7952346
2952 2513708331 2513237103 Bacteria 7647401
2953 2513718344 2513237104 Bacteria 10034502
2954 2513861712 2513237137 Bacteria 9558895
2955 2513867568 2513237138 Bacteria 7368160
2956 2513873182 2513237139 Bacteria 8737671
2957 2513888014 2513237141 Bacteria 8496279
2958 2513908338 2513237144 Bacteria 7530820
2959 2513920263 2513237145 Bacteria 8979722
2960 2513926802 2513237146 Bacteria 7166346
2961 2513997418 2513237159 Bacteria 6810126
2962 2514016473 2513237161 Bacteria 8871253
2963 2514420299 2513237305 Bacteria 7293571
2964 2514586574 2513237351 Bacteria 6968952
2965 2516205985 2516143018 Bacteria 6951533
2966 2517036415 2516653077 Bacteria 7555578
2967 2517102574 2517093001 Bacteria 9002274
2968 2517407150 2517287029 Bacteria 6905599
2969 2517893689 2517572143 Bacteria 9484767
2970 2520381494 2519899620 Bacteria 6499161
2971 2524437780 2524023205 Bacteria 8918781
2972 2524459766 2524023209 Bacteria 6679728
2973 2524466653 2524023210 Bacteria 9029266
2974 2524535914 2524023228 Bacteria 10118060
2975 2528848752 2528768022 Bacteria 10457665
2976 2535519573 2534681796 Bacteria 7146037
2977 2537875229 2537561587 Bacteria 5425293
2978 2545679531 2545555834 Bacteria 8130841
2979 2583789942 2582580891 Bacteria 6800976
2980 2585167738 2582581283 Bacteria 6030556
2981 2585204881 2582581294 Bacteria 6626667
2982 2585227654 2582581299 Bacteria 6518058
2983 2585269808 2582581306 Bacteria 6450535
2984 2585276517 2582581307 Bacteria 6597605
2985 2585283250 2582581308 Bacteria 7413247
2986 2585327631 2582581315 Bacteria 7318924
2987 2585336395 2582581316 Bacteria 7774528
2988 2585391066 2582581865 Bacteria 6644329
2989 2585395333 2582581866 Bacteria 6859583
2990 2585403373 2582581867 Bacteria 7184437
2991 2585532272 2585427527 Bacteria 7273426
2992 2585552633 2585427530 Bacteria 7383882
2993 2585564586 2585427531 Bacteria 6992870
2994 2585823669 2585427590 Bacteria 6824633
2995 2585900111 2585427608 Bacteria 6544331
2996 2585903157 2585427609 Bacteria 6667127
2997 2587978587 2585428125 Bacteria 6662905
2998 2588516812 2588253730 Bacteria 6881675
2999 2597028092 2596583598 Bacteria 5251611
3000 2597814232 2597489875 Bacteria 7010078
3001 2597855519 2597489887 Bacteria 6666321
3002 2599420705 2599185170 Bacteria 7295545
3003 2599485408 2599185185 Bacteria 6652270
3004 2599604773 2599185210 Bacteria 5624189
3005 2599737917 2599185239 Bacteria 8686614
3006 2599806551 2599185257 Bacteria 6492581
3007 2599938303 2599185301 Bacteria 6161860
3008 2600196883 2599185352 Bacteria 7228948
3009 2600368411 2600254931 Bacteria 6734225
3010 2603857898 2602042107 Bacteria 6226103
3011 2616292182 2615840624 Bacteria 6557588
3012 2616307585 2615840626 Bacteria 7921970
3013 2617346952 2617270735 Bacteria 9163226
3014 2617375371 2617270741 Bacteria 8201522
3015 2617384140 2617270742 Bacteria 6808054
3016 2624493836 2623620446 Bacteria 6500345
3017 2643786965 2643221554 Bacteria 6603920
3018 2643804490 2643221557 Bacteria 7184309
3019 2643953364 2643221589 Bacteria 6250934
3020 2644021106 2643221602 Bacteria 6249926
3021 2644052230 2643221607 Bacteria 6314006
3022 2644065261 2643221610 Bacteria 7480339
3023 2644105554 2643221618 Bacteria 7717186
3024 2644131112 2643221623 Bacteria 5239945
3025 2644146557 2643221626 Bacteria 8069654
3026 2644169739 2643221629 Bacteria 5850260
3027 2644187564 2643221633 Bacteria 6733554
3028 2644191528 2643221634 Bacteria 6705461
3029 2644205024 2643221636 Bacteria 6583769
3030 2644208246 2643221637 Bacteria 5345260
3031 2644215946 2643221638 Bacteria 6579467
3032 2644241718 2643221643 Bacteria 5749658
3033 2644247962 2643221644 Bacteria 6865017
3034 2644254417 2643221645 Bacteria 7207331
3035 2644308305 2643221655 Bacteria 7722067
3036 2644334132 2643221659 Bacteria 7890716
3037 2644350372 2643221662 Bacteria 5851492
3038 2644377670 2643221668 Bacteria 7306521
3039 2644418133 2643221675 Bacteria 7473456
3040 2644451389 2643221680 Bacteria 7473610
3041 2644484973 2643221686 Bacteria 6310811
3042 2644541726 2643221698 Bacteria 7756764
3043 2644615587 2643221712 Bacteria 7729434
3044 2644652005 2643221718 Bacteria 5345506
3045 2644672673 2643221723 Bacteria 7095460
3046 2644691631 2643221726 Bacteria 7455827
3047 2644730295 2643221733 Bacteria 5690728
3048 2671117239 2667528174 Bacteria 6435400
3049 2671120799 2667528175 Bacteria 7532676
3050 2671772202 2671180172 Bacteria 6495783
3051 2719181562 2718217882 Bacteria 6556348
3052 2719665900 2718217997 Bacteria 6740740
3053 2719732226 2718218009 Bacteria 6478651
3054 2720492320 2718218199 Bacteria 6740745
3055 2720613674 2718218232 Bacteria 6720332
3056 2720620462 2718218233 Bacteria 6662049
3057 2720631883 2718218235 Bacteria 6630699
3058 2720775611 2718218269 Bacteria 6906114
3059 2721147654 2718218363 Bacteria 6524337
3060 2721159104 2718218365 Bacteria 6274507
3061 2721164489 2718218366 Bacteria 6425255
3062 2722840659 2721755514 Bacteria 6424414
3063 2723027222 2721755556 Bacteria 6745503
3064 2723560837 2721755684 Bacteria 6859907
3065 2723567430 2721755685 Bacteria 6704835
3066 2723575813 2721755686 Bacteria 7343952
3067 2723846599 2721755755 Bacteria 8322773
3068 2724044982 2721755810 Bacteria 6479005
3069 2724090218 2721755819 Bacteria 6906405
3070 2724104695 2721755822 Bacteria 6726041
3071 2724110502 2721755823 Bacteria 6752556
3072 2730108158 2728369352 Bacteria 6745171
3073 2730164797 2728369365 Bacteria 6555560
3074 2730298736 2728369397 Bacteria 6274511
3075 2739197448 2738543004 Bacteria 6381073
3076 2739262340 2738543015 Bacteria 6750701
3077 2739309754 2738543024 Bacteria 5603683
3078 2743734934 2740892503 Bacteria 6855563
3079 2745074808 2744054633 Bacteria 8678936
3080 2756675754 2756170246 Bacteria 7451806
3081 2765468323 2765235802 Bacteria 5618596
3082 2766066737 2765235942 Bacteria 7445910
3083 2770196259 2767802442 Bacteria 5747986
3084 2774869504 2773857925 Bacteria 6472445
3085 2776258871 2775506901 Bacteria 9631051
3086 2776268602 2775506902 Bacteria 6208009
3087 2776285317 2775506904 Bacteria 5954060
3088 2778123499 2775507255 Bacteria 3945731
3089 2778178600 2775507266 Bacteria 7392367
3090 2792749762 2791355123 Bacteria 8049106
3091 2792834207 2791355137 Bacteria 9654227
3092 2793080576
3093 2793323083 2791355260 Bacteria 6598818
3094 2793326282 2791355261 Bacteria 6661293
3095 2793344120 2791355263 Bacteria 6872478
3096 2793349832 2791355264 Bacteria 6429314
3097 2793367089 2791355267 Bacteria 7222458
3098 2805914827 2802429603 Bacteria 8777136
3099 2808959178 2808606382 Bacteria 6841132
3100 2819540741 2818991436 Bacteria 5376622
3101 2819610236 2818991448 Bacteria 6772224
3102 2819631762 2818991452 Bacteria 8442785
3103 2819640518 2818991453 Bacteria 7181617
3104 2824602314 2824600985 Bacteria 8488197
3105 2824610592 2824609381 Bacteria 8672835
3106 2824654282 2824653114 Bacteria 8493680
3107 2824661639 2824661429 Bacteria 9877870
3108 2824672084 2824671348 Bacteria 8369588
3109 2824679912 2824679649 Bacteria 8248951
3110 2824688683 2824687955 Bacteria 8360029
3111 2824697079 2824696289 Bacteria 8335049
3112 2824713049 2824704595 Bacteria 9667483
3113 2824734560 2824732956 Bacteria 7810675
3114 2824749852 2824746037 Bacteria 7911610
3115 2824754421 2824753945 Bacteria 9787441
3116 2824769158 2824763712 Bacteria 9792355
3117 2824780397 2824773399 Bacteria 8360218
3118 2834643626 2834641062 Bacteria 5559922
3119 2835312826 2835312727 Bacteria 7413381
3120 2838017911 2838016132 Bacteria 6577831
3121 2838028781 2838022645 Bacteria 6494267
3122 2838034403 2838029111 Bacteria 6603031
3123 2838040621 2838035591 Bacteria 7166484
3124 2838043735 2838042994 Bacteria 6046894
3125 2838051789 2838048938 Bacteria 6044578
3126 2838066214 2838061910 Bacteria 6794874
3127 2838074678 2838068647 Bacteria 6208656
3128 2838080544 2838074704 Bacteria 6785777
3129 2838123303 2838122688 Bacteria 8803140
3130 2838664991 2838661181 Bacteria 7385261
3131 2838679056 2838675328 Bacteria 4909118
3132 2838681866 2838680041 Bacteria 6545511
3133 2838696437 2838694306 Bacteria 6853137
3134 2838710323 2838707686 Bacteria 6619912
3135 2838718010 2838714209 Bacteria 5525906
3136 2838723355 2838719591 Bacteria 5523910
3137 2838728724 2838724970 Bacteria 4908691
3138 2839997642 2839993093 Bacteria 5512535
3139 2840770547 2840764183 Bacteria 6358399
3140 2841739728 2841734538 Bacteria 6784580
3141 2841761618 2841760612 Bacteria 6454112
3142 2841851468 2841846520 Bacteria 5345850
3143 2841863556 2841859092 Bacteria 5436171
3144 2841946595 2841941048 Bacteria 8688029
3145 2841954174 2841949485 Bacteria 8680857
3146 2841961025 2841957949 Bacteria 8652217
3147 2841969549 2841966195 Bacteria 8673214
3148 2841974567 2841974524 Bacteria 8931498
3149 2841983872 2841983080 Bacteria 8395090
3150 2842078498 2842077413 Bacteria 6508645
3151 2842118994 2842118031 Bacteria 7033875
3152 2842130052 2842124991 Bacteria 5346824
3153 2842133793 2842130223 Bacteria 4909145
3154 2842155943 2842152218 Bacteria 4908957
3155 2842174255 2842170452 Bacteria 5525737
3156 2842179407 2842175837 Bacteria 4908771
3157 2842190927 2842187318 Bacteria 5524014
3158 2842204802 2842198810 Bacteria 6608673
3159 2842215242 2842211629 Bacteria 5523832
3160 2842217642 2842217011 Bacteria 7497767
3161 2842228119 2842224351 Bacteria 5524473
3162 2842239735 2842237096 Bacteria 6620661
3163 2842265744 2842264693 Bacteria 6472963
3164 2842285844 2842285085 Bacteria 6011953
3165 2842292159 2842291075 Bacteria 7076806
3166 2842301631 2842298080 Bacteria 6123127
3167 2842316580 2842311132 Bacteria 6616990
3168 2842361800 2842357229 Bacteria 6485165
3169 2842372432 2842370503 Bacteria 7038661
3170 2842378556 2842377471 Bacteria 7140707
3171 2842385503 2842384541 Bacteria 7057858
3172 2842403203 2842402390 Bacteria 6681310
3173 2842409424 2842409023 Bacteria 6687331
3174 2842416077 2842415677 Bacteria 6596907
3175 2842428290 2842422224 Bacteria 6239196
3176 2842429619 2842428310 Bacteria 6767288
3177 2842436232 2842434925 Bacteria 6502746
3178 2842442579 2842441272 Bacteria 6769273
3179 2842453034 2842447887 Bacteria 6754142
3180 2842464040 2842462802 Bacteria 6588055
3181 2842470561 2842469257 Bacteria 6752936
3182 2842481149 2842475841 Bacteria 6603183
3183 2842507863 2842502639 Bacteria 6604161
3184 2842513469 2842509118 Bacteria 6850950
3185 2842520339 2842515876 Bacteria 5436280
3186 2842522341 2842521101 Bacteria 6569494
3187 2842713170 2842711865 Bacteria 7155354
3188 2844006266 2844002411 Bacteria 7168230
3189 2844014878 2844009547 Bacteria 6728125
3190 2844104643 2844104063 Bacteria 6440972
3191 2844166470 2844163670 Bacteria 7266046
3192 2844539985 2844533157 Bacteria 7517899
3193 2847675993 2847670302 Bacteria 6165597
3194 2847692646 2847686936 Bacteria 6278406
3195 2847936625 2847930680 Bacteria 9342022
3196 2847946974 2847939898 Bacteria 8606328
3197 2851185380 2851182111 Bacteria 6047226
3198 2851247631 2851246043 Bacteria 6439203
3199 2852395153 2852387548 Bacteria 8025568
3200 2854902178 2854896431 Bacteria 5869725
3201 2854917267 2854916844 Bacteria 5725939
3202 2856314449 2856314179 Bacteria 6477897
3203 2856325683 2856320880 Bacteria 7263508
3204 2856342870 2856342000 Bacteria 7176905
3205 2856352671 2856349417 Bacteria 6230045
3206 2856360726 2856356410 Bacteria 6297484
3207 2856370567 2856364286 Bacteria 6939991
3208 2857350607 2857349434 Bacteria 7926032
3209 2857520178 2857516855 Bacteria 7787325
3210 2857527271 2857524615 Bacteria 6615449
3211 2860340334 2860339153 Bacteria 6846989
3212 2869164415 2869162929 Bacteria 6399702
3213 2869238432 2869234852 Bacteria 6654993
3214 2869263905 2869256925 Bacteria 6981691
3215 2869279305 2869278585 Bacteria 7077053
3216 2869291706 2869285874 Bacteria 6901219
3217 2871434916 2871429161 Bacteria 6547891
3218 2871451335 2871444079 Bacteria 6423508
3219 2871466915 2871466892 Bacteria 6923287
3220 2871480325 2871474448 Bacteria 6806570
3221 2871495562 2871488783 Bacteria 6929816
3222 2871502817 2871495908 Bacteria 6935695
3223 2874103292 2874102143 Bacteria 6342645
3224 2874111136 2874109183 Bacteria 6517025
3225 2874130844 2874123672 Bacteria 7238285
3226 2874145052 2874139085 Bacteria 7021506
3227 2874149306 2874146452 Bacteria 7533118
3228 2874157570 2874155637 Bacteria 6724144
3229 2874174346 2874168670 Bacteria 8062617
3230 2874608230 2874604998 Bacteria 7834745
3231 2874619328 2874612657 Bacteria 8252029
3232 2874622405 2874620515 Bacteria 8290088
3233 2874632317 2874628541 Bacteria 8630250
3234 2876365692 2876363079 Bacteria 6544991
3235 2876375067 2876369609 Bacteria 6807521
3236 2876394650 2876392853 Bacteria 6660880
3237 2876415772 2876413966 Bacteria 6831344
3238 2876769336 2876761206 Bacteria 10111113
3239 2876813704 2876808645 Bacteria 8824342
3240 2878040064 2878035449 Bacteria 6555736
3241 2878734893 2878730984 Bacteria 6380721
3242 2878745689 2878738818 Bacteria 7136951
3243 2878752050 2878745973 Bacteria 6867388
3244 2878757843 2878753008 Bacteria 6922523
3245 2878766709 2878760144 Bacteria 6823465
3246 2878773906 2878767105 Bacteria 6898628
3247 2878788848 2878788777 Bacteria 6567085
3248 2879088031 2879083081 Bacteria 8587928
3249 2879108394 2879099564 Bacteria 10442239
3250 2879112309 2879110137 Bacteria 8907982
3251 2881152002 2881147464 Bacteria 7779814
3252 2881155727 2881155292 Bacteria 6461656
3253 2881167945 2881161766 Bacteria 7127907
3254 2881672488 2881665667 Bacteria 8175609
3255 2881856213 2881853255 Bacteria 6698367
3256 2881868013 2881861095 Bacteria 7128710
3257 2882458754 2882456835 Bacteria 6863978
3258 2882637048 2882632389 Bacteria 8154593
3259 2882913983 2882912400 Bacteria 6801539
3260 2885266307 2885266251 Bacteria 4796748
3261 2885309868 2885305155 Bacteria 7348390
3262 2885316948 2885312484 Bacteria 6415165
3263 2885318918 2885318864 Bacteria 6729568
3264 2885330410 2885326080 Bacteria 7134805
3265 2885340778 2885334103 Bacteria 7216818
3266 2885344346 2885342637 Bacteria 7011821
3267 2885352029 2885350715 Bacteria 6787678
3268 2885370494 2885366525 Bacteria 8326213
3269 2885376601 2885374607 Bacteria 8927485
3270 2885417720 2885409591 Bacteria 9235467
3271 2888339873 2888337043 Bacteria 6629336
3272 2888347299 2888343758 Bacteria 6611049
3273 2888356219 2888350351 Bacteria 7372807
3274 2888424966 2888419890 Bacteria 7857137
3275 2889011151 2889010040 Bacteria 6749192
3276 2889017127 2889016732 Bacteria 6700763
3277 2889039352 2889033259 Bacteria 9099371
3278 2889792643 2889790730 Bacteria 5689708
3279 2889918963 2889914905 Bacteria 5702301
3280 2893071206 2893066018 Bacteria 6158120
3281 2894237133 2894232714 Bacteria 8834183
3282 2896391304 2896384573 Bacteria 7700774
3283 2899793879 2899792073 Bacteria 4926588
3284 2900582524 2900577576 Bacteria 5438534
3285 2903455480 2903448605 Bacteria 7357801
3286 2903493392 2903492973 Bacteria 13473544
3287 2903506560 2903492973 Bacteria 13473544
3288 2903517055 2903513507 Bacteria 6344008
3289 2903523621 2903521522 Bacteria 6525694
3290 2903534255 2903528002 Bacteria 6586099
3291 2903547956 2903540706 Bacteria 7062119
3292 2903751452 2903748898 Bacteria 9972761
3293 2903770642 2903768456 Bacteria 9749579
3294 2904554646 2904550169 Bacteria 6221258
3295 2904581880 2904578770 Bacteria 5302906
3296 2904625303 2904615490 Bacteria 10047340
3297 2904661284 2904659560 Bacteria 6685615
3298 2904671588 2904666416 Bacteria 8226587
3299 2904697631 2904690495 Bacteria 9412302
3300 2904701415
3301 2904715144 2904711408 Bacteria 9771557
3302 2906314444 2906308376 Bacteria 6841989
3303 2906327612 2906321335 Bacteria 6579571
3304 2906329603 2906328253 Bacteria 6585166
3305 2906381648 2906378014 Bacteria 6911440
3306 2906414403 2906414383 Bacteria 6580790
3307 2906627888 2906626472 Bacteria 8826946
3308 2906638574 2906635258 Bacteria 8601019
3309 2906646151 2906643746 Bacteria 8722424
3310 2906666075 2906660503 Bacteria 8595048
3311 2908757738 2908756301 Bacteria 8864324
3312 2908780573 2908775508 Bacteria 8092255
3313 2917555265 2917554339 Bacteria 4987857
3314 2919078387 2919073203 Bacteria 6531949
3315 2919118247 2919114240 Bacteria 5700270
3316 2919123548 2919119836 Bacteria 5208557
3317 2919414206 2919408235 Bacteria 6149349
3318 2919455655 2919450847 Bacteria 5631160
3319 2919700246 2919697872 Bacteria 6553725
3320 2920761093 2920760137 Bacteria 7427611
3321 2920825728 2920822456 Bacteria 6897201
3322 2921653888 2921643360 Bacteria 11448031
3323 2922133062 2922130491 Bacteria 7173936
3324 2922158968 2922158528 Bacteria 6573167
3325 2922187462 2922185730 Bacteria 7113964
3326 2922374940
3327 2922391358 2922386360 Bacteria 7017218
3328 2922394525 2922393267 Bacteria 8285685
3329 2922428769
3330 2923153926 2923153595 Bacteria 6870622
3331 2923558918 2923556063 Bacteria 6793593
3332 2924725480 2924718760 Bacteria 6331356
3333 2924731756 2924726620 Bacteria 6271473
3334 2924760258 2924754689 Bacteria 6774424
3335 2924766863 2924762789 Bacteria 6561353
3336 2924783934 2924776078 Bacteria 7492003
3337 2924784557 2924784321 Bacteria 7416538
3338 2926758011 2926754445 Bacteria 5964435
3339 2928162179 2928157003 Bacteria 7522202
3340 2928166371 2928163908 Bacteria 7561269
3341 2928173619 2928170801 Bacteria 8785406
3342 2929621980 2929615660 Bacteria 9193770
3343 2929629713 2929624759 Bacteria 9339455
3344 2931399759 2931396565 Bacteria 7251677
3345 2932788846 2932784394 Bacteria 9704911
3346 2932794981 2932794094 Bacteria 7915132
3347 2932805228 2932801729 Bacteria 7987968
3348 2932812822 2932809354 Bacteria 9135765
3349 2932819086 2932818245 Bacteria 9955613
3350 2932830512 2932828146 Bacteria 9745859
3351 2933010968 2933006813 Bacteria 4912075
3352 2933016031 2933011516 Bacteria 5439334
3353 2933017509 2933016740 Bacteria 6355406
3354 2933583745 2933577622 Bacteria 9116884
3355 2933605132 2933599457 Bacteria 5858799
3356 2935616807 2935616580 Bacteria 9032984
3357 2935635561 2935630451 Bacteria 8169952
3358 2935641863 2935638405 Bacteria 10015038
3359 2935655850 2935648319 Bacteria 8801166
3360 2935664729 2935656913 Bacteria 8965014
3361 2935672994 2935665750 Bacteria 9571747
3362 2935683512 2935675223 Bacteria 9928132
3363 2935685788 2935684952 Bacteria 9590419
3364 2935697958 2935694250 Bacteria 9291695
3365 2935705636 2935703347 Bacteria 10242284
3366 2935714340 2935713505 Bacteria 9608509
3367 2935724959 2935722832 Bacteria 9608746
3368 2935732682 2935732158 Bacteria 9706831
3369 2935742061 2935741537 Bacteria 9707219
3370 2935751753 2935750917 Bacteria 9590372
3371 2935765017 2935760218 Bacteria 9817913
3372 2935769753 2935769743 Bacteria 7878163
3373 2935778947 2935777560 Bacteria 8077691
3374 2935786005 2935785616 Bacteria 7962367
3375 2935794067 2935793552 Bacteria 8012592
3376 2935802614 2935801545 Bacteria 9301974
3377 2935813556 2935810662 Bacteria 9401221
3378 2935830030 2935827899 Bacteria 10038562
3379 2935837948 2935837841 Bacteria 9454360
3380 2935855431 2935855204 Bacteria 9035059
3381 2935867325 2935864058 Bacteria 9784707
3382 2935875856 2935873716 Bacteria 9632195
3383 2935887684 2935883170 Bacteria 7964738
3384 2935897706 2935894831 Bacteria 6620579
3385 2935963932 2935959822 Bacteria 7869783
3386 2935981909 2935975950 Bacteria 8347125
3387 2935988122 2935984226 Bacteria 8302647
3388 2935996520 2935992306 Bacteria 9802711
3389 2936003800 2936002035 Bacteria 9362176
3390 2936019067 2936011229 Bacteria 8801034
3391 2936027319 2936019824 Bacteria 8804134
3392 2936036787 2936028420 Bacteria 8965941
3393 2936042729 2936037263 Bacteria 9446081
3394 2936054451 2936046547 Bacteria 8903709
3395 2936063151 2936055302 Bacteria 8785755
3396 2936380866 2936375103 Bacteria 6652732
3397 2936386716 2936381700 Bacteria 7006523
3398 2937816252 2937813078 Bacteria 7783518
3399 2937824939 2937822353 Bacteria 7290551
3400 2937837955 2937836603 Bacteria 6811263
3401 2937843654 2937843397 Bacteria 5256375
3402 2937855037 2937848649 Bacteria 6983481
3403 2937877464 2937877337 Bacteria 7246526
3404 2937892171 2937891427 Bacteria 6357007
3405 2937975431 2937972304 Bacteria 7532020
3406 2938001833 2937994558 Bacteria 7036190
3407 2939641487 2939636861 Bacteria 6297853
3408 2940557444 2940556831 Bacteria 9590747
3409 2941504501 2941499720 Bacteria 7599444
3410 2941509210 2941507105 Bacteria 8166816
3411 2941517039 2941515067 Bacteria 8166720
3412 2941524866 2941523033 Bacteria 8169134
3413 2941539386 2941538514 Bacteria 9402094
3414 2958035446 2958034702 Bacteria 6989922
3415 2958043633 2958041894 Bacteria 13082850
3416 2958069493 2958064165 Bacteria 7158582
3417 2958072629 2958071322 Bacteria 6815895
3418 2958084570 2958084443 Bacteria 7312792
3419 2958103615 2958100919 Bacteria 6800575
3420 2958118840 2958115193 Bacteria 6923548
3421 2958136105 2958130278 Bacteria 6897202
3422 2958150495 2958144490 Bacteria 6677056
3423 2958171888 2958165035 Bacteria 6906348
3424 2958185573 2958179912 Bacteria 6874908
3425 2961083950 2961077736 Bacteria 7079850
3426 2961116436 2961114664 Bacteria 6680456
3427 2961129365 2961127735 Bacteria 7196641
3428 2961170334 2961163497 Bacteria 6901077
3429 2961174386 2961170736 Bacteria 7072258
3430 2963648167 2963644680 Bacteria 6530403
3431 2965025080 2965018300 Bacteria 6883036
3432 2965066904 2965062239 Bacteria 7412989
3433 2965124085 2965119406 Bacteria 6956431
3434 2968000376 2967996073 Bacteria 6787468
3435 2968003739 2968003550 Bacteria 6929263
3436 2968018007 2968016561 Bacteria 7022047
3437 2968090990 2968083720 Bacteria 7351627
3438 2968094514 2968091066 Bacteria 6052692
3439 2968100813 2968097103 Bacteria 6107094
3440 2968112342 2968110612 Bacteria 6814636
3441 2968121147 2968117919 Bacteria 6536078
3442 2968132707 2968128360 Bacteria 6270294
3443 2968141982 2968138860 Bacteria 6605449
3444 2968178721 2968171901 Bacteria 6894245
3445 2970471818 2970469710 Bacteria 6969209
3446 2970506973 2970503327 Bacteria 7099517
3447 2970512972 2970510686 Bacteria 7006402
3448 2970530789 2970524798 Bacteria 6840927
3449 2970542180 2970540015 Bacteria 6977556
3450 2970561566 2970554993 Bacteria 6814252
3451 2970593901 2970593180 Bacteria 7073582
3452 2970620988 2970619444 Bacteria 6986144
3453 2977822375 2977821940 Bacteria 6906439
3454 2977832541 2977828996 Bacteria 7007971
3455 2977846487 2977843712 Bacteria 6753583
3456 2977861652 2977858184 Bacteria 6215359
3457 2977865843 2977864932 Bacteria 7534097
3458 2977929294 2977922695 Bacteria 6956781
3459 2977947686 2977942078 Bacteria 7570577
3460 2977976004 2977971508 Bacteria 7472917
3461 2979710698 2979710463 Bacteria 6785254
3462 2979743262 2979742915 Bacteria 7301278
3463 2979812168 2979808191 Bacteria 7179355
3464 2981995515 2981990288 Bacteria 7590678
3465 2984292164 2984286254 Bacteria 6702062
3466 2987637791 2987636660 Bacteria 8088555
3467 2987657466 2987652177 Bacteria 6969023
3468 2987666575 2987659509 Bacteria 6966464
3469 2987668795 2987666974 Bacteria 6509233
3470 2996315293 2996310559 Bacteria 6357320
3471 2996347224 2996341866 Bacteria 6643098
3472 2996350602 2996348954 Bacteria 7239054
3473 2996890118 2996887358 Bacteria 5795980
3474 2996896360 2996893221 Bacteria 5823108
3475 3000140135 3000135777 Bacteria 6891109
3476 3003935469 3003930520 Bacteria 5667563
3477 3004169370 3004167301 Bacteria 8330599
3478 3004195577 3004188549 Bacteria 6952365
3479 3004205887 3004203850 Bacteria 7307914
3480 3004211850 3004211236 Bacteria 7417683
3481 3004219097 3004218560 Bacteria 7421728
3482 3004237944 3004232784 Bacteria 6662140
3483 3004277300 3004275668 Bacteria 7114440
3484 3004293211 3004289098 Bacteria 6135450
3485 3004341235 3004334049 Bacteria 8449246
3486 3005415653 3005409236 Bacteria 7188837
3487 3005421088 3005416602 Bacteria 7064308
3488 3005450703 3005445848 Bacteria 6906074
3489 3005478895 3005474847 Bacteria 9259049
3490 3005484706 3005483717 Bacteria 7877331
3491 3005587648 3005587118 Bacteria 7794411
3492 3005599669 3005594810 Bacteria 8716512
3493 637074160 637000159 Bacteria 7596297
3494 639648917 639633055 Bacteria 7751309
3495 641644056 641522639 Bacteria 7737025
3496 642416331 641736154 Bacteria 7689995
3497 643600092 643348564 Bacteria 8839022
3498 8001845519 8001845381 Bacteria 5804942
3499 8002063831 8002060224 Bacteria 4026565
3500 8002290279 8002285264 Bacteria 6717907
3501 8003405010 8003400568 Bacteria 5535898
3502 8003961723 8003955200 Bacteria 8601927
3503 8004379354 8004374579 Bacteria 6898112
3504 8004394567 8004387939 Bacteria 7049250
3505 8004400779 8004395343 Bacteria 6620908
3506 8004448451 8004445564 Bacteria 6322258
3507 8004637315 8004633249 Bacteria 6723080
3508 8004640293 8004640170 Bacteria 6723001
3509 8004709742 8004703790 Bacteria 8006957
3510 8004720707 8004714634 Bacteria 6776161
3511 8005262161 8005258706 Bacteria 6184835
3512 8005288114 8005282627 Bacteria 6675747
3513 8005302854 8005301065 Bacteria 6614431
3514 8005319177 8005314921 Bacteria 7072929
3515 8005324645 8005321885 Bacteria 5795980
3516 8005387421 8005382845 Bacteria 6732062
3517 8005399999 8005395548 Bacteria 6806915
3518 8005431612 8005430974 Bacteria 6689030
3519 8005489478 8005484373 Bacteria 6297373
3520 8005500633 8005497431 Bacteria 6477605
3521 8005547271 8005542996 Bacteria 7077758
3522 8005622010 8005619151 Bacteria 7030230
3523 8005632512 8005626139 Bacteria 6534237
3524 8005648010 8005645114 Bacteria 6950293
3525 8005672052 8005668836 Bacteria 6953162
3526 8005689940 8005688590 Bacteria 6610080
3527 8006942442 8006933436 Bacteria 10410654
3528 8006965328 8006964411 Bacteria 8966052
3529 8006982169 8006973647 Bacteria 10679141
3530 8006987831 8006984368 Bacteria 9651211
3531 8006996758 8006994254 Bacteria 8309700
3532 8016521776 8016511872 Bacteria 9921665
3533 8016529187 8016522445 Bacteria 8156687
3534 8016534398 8016530956 Bacteria 8155261
3535 8016547623 8016539877 Bacteria 8155419
3536 8016554518 8016548790 Bacteria 8155074
3537 8016562889 8016557553 Bacteria 8154380
3538 8016572739 8016566248 Bacteria 8158151
3539 8016576896 8016575299 Bacteria 8154085
3540 8016593327 8016583857 Bacteria 10421953
3541 8016600660 8016595262 Bacteria 8149947
3542 8016610073 8016603502 Bacteria 8731218
3543 8016626117 8016622563 Bacteria 7999408
3544 8017063872 8017057580 Bacteria 10023680
3545 8018130214 8018127388 Bacteria 7351159
3546 8018847489 8018845410 Bacteria 8933938
3547 8019545301 8019538911 Bacteria 7872763
3548 8019553210 8019547302 Bacteria 7996444
3549 8019558205 8019555841 Bacteria 9642137
3550 8019591030 8019586578 Bacteria 10212056
3551 8019600311 8019597564 Bacteria 10041141
3552 8019618230 8019608314 Bacteria 10042931
3553 8019621342 8019619141 Bacteria 9218857
3554 8019648353 8019638758 Bacteria 9062356
3555 8019658981 8019648815 Bacteria 10014479
3556 8019659694 8019659431 Bacteria 8577854
3557 8019669255 8019668869 Bacteria 8791617
3558 8019776912 8019775933 Bacteria 6858656
3559 8021125027 8021120328 Bacteria 8782274
3560 8024483154 8024479707 Bacteria 6954785
3561 8024489223 8024486573 Bacteria 6540512
3562 8046769075 8046767195 Bacteria 7547379
3563 8054562263 8054558443 Bacteria 5204801
3564 8055302617 8055301274 Bacteria 8587385
3565 8055621356 8055617313 Bacteria 7548464
3566 8055745855 8055742211 Bacteria 9226248
3567 8055771285 8055770955 Bacteria 6827675
3568 8056129063 8056125926 Bacteria 6228218
3569 8056159412 8056155041 Bacteria 6486948
3570 8056376928 8056375014 Bacteria 7006639
3571 8056676983 8056673599 Bacteria 7871253
3572 8056685512 8056681323 Bacteria 8472857
3573 8057531954 8057529695 Bacteria 6306553
3574 8057576436 8057575449 Bacteria 7367519
3575 8057878710 8057874678 Bacteria 7494653
3576 Ga0395899_0073950
3577 JGI24740J21852_10010437
3578 JGI24740J21852_10024304
3579 JGI24740J21852_10032966
3580 JGI24739J22299_10004285
3581 JGI24735J21928_10023633
3582 JGI24735J21928_10067932
3583 JGI24738J21930_10038337
3584 JGI24034J26672_10034048
3585 JGI24751J29686_10056290
3586 JGI24751J29686_10066161
3587 JGI25156J39149_1004361
3588 JGI25162J39368_1000015
3589 JGI25162J39368_1000125
3590 JGI25162J39368_1000132
3591 JGI25158J39367_1001493
3592 JGI25158J39367_1001495
3593 JGI25157J39369_1000504
3594 JGI25163J39215_1000648
3595 JGI25164J39214_1000106
3596 JGI25152J39213_1001134
3597 JGI25152J39213_1002330
3598 JGI25152J39213_1004507
3599 JGI25150J39212_1003865
3600 JGI25159J45721_1000008
3601 JGI25159J45721_1002753
3602 JGI25159J45721_1003009
3603 JGI25159J45721_1004469
3604 JGI25159J45721_1011682
3605 JGI25159J45721_1018189
3606 JGI25151J46595_10000419
3607 JGI25151J46595_10037014
3608 JGI25406J46586_10009805
3609 JGI25406J46586_10035310
3610 JGI25406J46586_10094883
3611 JGI25165J46597_1000001
3612 JGI25165J46597_1000217
3613 JGI25165J46597_1000495
3614 JGI25165J46597_1003848
3615 JGI25165J46597_1016356
3616 JGI25153J46596_10007018
3617 JGI25153J46596_10009910
3618 Ga0006777J48905_1116347
3619 rootH1_10019293
3620 JGI25160J50197_1000026
3621 JGI25160J50197_1000033
3622 JGI25160J50197_1001034
3623 JGI25160J50197_1002573
3624 JGI25160J50197_1007363
3625 JGI25160J50197_1016585
3626 JGI25160J50197_1018595
3627 JGI25160J50197_1024094
3628 JGI25160J50197_1029885
3629 JGI25161J50226_1000014
3630 JGI25161J50226_1000135
3631 JGI25161J50226_1000508
3632 JGI25161J50226_1002530
3633 JGI25161J50226_1007169
3634 Ga0007409J51694_1049872
3635 JGI25404J52841_10000184
3636 JGI25404J52841_10002070
3637 JGI25404J52841_10020574
3638 Ga0055538_1000001
3639 Ga0055538_1002445
3640 Ga0055539_1000001
3641 Ga0055539_1000168
3642 Ga0055533_1000003
3643 Ga0055533_1001370
3644 Ga0055532_1000475
3645 Ga0055532_1001551
3646 Ga0055525_1000003
3647 Ga0055525_1000264
3648 Ga0055527_1000085
3649 Ga0055535_1000154
3650 Ga0055542_1000788
3651 Ga0055542_1001926
3652 Ga0055542_1011499
3653 Ga0055529_1000581
3654 Ga0055529_1003633
3655 Ga0055529_1009126
3656 Ga0055529_1009759
3657 Ga0055526_1002294
3658 Ga0055526_1003181
3659 Ga0055526_1007072
3660 Ga0055526_1016754
3661 Ga0055526_1019661
3662 Ga0055537_1000977
3663 Ga0055537_1014429
3664 Ga0055537_1016084
3665 Ga0055524_1000099
3666 Ga0055524_1000159
3667 Ga0055524_1002105
3668 Ga0055524_1005894
3669 Ga0055524_1008233
3670 Ga0055524_1011199
3671 Ga0055524_1018300
3672 Ga0055524_1034321
3673 Ga0055536_1002977
3674 Ga0055534_1000407
3675 Ga0055534_1016255
3676 Ga0055528_1000062
3677 Ga0055528_1000660
3678 Ga0055528_1017500
3679 Ga0055528_1019381
3680 Ga0055530_10000034
3681 Ga0055530_10002641
3682 Ga0055530_10006612
3683 Ga0055530_10010043
3684 Ga0055530_10021654
3685 Ga0055540_1000023
3686 Ga0055540_1000169
3687 Ga0055540_1001995
3688 Ga0055540_1017652
3689 Ga0055540_1018308
3690 Ga0055531_10000031
3691 Ga0055531_10003153
3692 Ga0055531_10005461
3693 Ga0055531_10011376
3694 Ga0055531_10028130
3695 Ga0055541_1000001
3696 Ga0055541_1004450
3697 Ga0055543_1000079
3698 Ga0055543_1000315
3699 Ga0055543_1000340
3700 Ga0055543_1002971
3701 Ga0058859_11814239
3702 Ga0058862_12556712
3703 Ga0065165_1000055
3704 Ga0065165_1000073
3705 Ga0065165_1000513
3706 Ga0065165_1007617
3707 Ga0065165_1008839
3708 Ga0065165_1014154
3709 Ga0065714_10005539
3710 Ga0065714_10105595
3711 Ga0065714_10146048
3712 Ga0065714_10175734
3713 Ga0065704_10007255
3714 Ga0065704_10024680
3715 Ga0065704_10127428
3716 Ga0065712_10069338
3717 Ga0065715_10197484
3718 Ga0065707_10103432
3719 Ga0065707_10233975
3720 Ga0070658_10013511
3721 Ga0070658_10185131
3722 Ga0070658_10453967
3723 Ga0070676_10024235
3724 Ga0070676_10047516
3725 Ga0070676_10052911
3726 Ga0070676_10157510
3727 Ga0070683_100112476
3728 Ga0070683_100265143
3729 Ga0070683_100417394
3730 Ga0070683_100497907
3731 Ga0070690_100001585
3732 Ga0070690_100037311
3733 Ga0070690_100243949
3734 Ga0070670_100000013
3735 Ga0070670_100012812
3736 Ga0070670_100016610
3737 Ga0070670_100023981
3738 Ga0070670_100035388
3739 Ga0070670_100221403
3740 Ga0070670_100416391
3741 Ga0070677_10054708
3742 Ga0068869_100005571
3743 Ga0068869_100007091
3744 Ga0068869_100028424
3745 Ga0068869_100292833
3746 Ga0068869_100371865
3747 Ga0070666_10005328
3748 Ga0070666_10014714
3749 Ga0070666_10037259
3750 Ga0070680_100006058
3751 Ga0070680_100008151
3752 Ga0070680_100153828
3753 Ga0070680_100367676
3754 Ga0070682_100009800
3755 Ga0070682_100016597
3756 Ga0068868_100003060
3757 Ga0068868_100027633
3758 Ga0068868_100094618
3759 Ga0070660_100000026
3760 Ga0070660_100006027
3761 Ga0070660_100424929
3762 Ga0070689_100000486
3763 Ga0070689_100118853
3764 Ga0070689_100444800
3765 Ga0070691_10006042
3766 Ga0070691_10014552
3767 Ga0070691_10191219
3768 Ga0070687_100184633
3769 Ga0070661_100017484
3770 Ga0070661_100070953
3771 Ga0070661_100186401
3772 Ga0070661_100226132
3773 Ga0070692_10032396
3774 Ga0070692_10036549
3775 Ga0070668_100003313
3776 Ga0070668_100026512
3777 Ga0070668_100027926
3778 Ga0070668_100033762
3779 Ga0070669_100009584
3780 Ga0070669_100085373
3781 Ga0070669_100094082
3782 Ga0070669_100150389
3783 Ga0070669_100207384
3784 Ga0070675_100005481
3785 Ga0070675_100008915
3786 Ga0070675_100016915
3787 Ga0070675_100029099
3788 Ga0070675_100038513
3789 Ga0070675_100241700
3790 Ga0070671_100025796
3791 Ga0070671_100029982
3792 Ga0070671_100051326
3793 Ga0070671_100083407
3794 Ga0070671_100087653
3795 Ga0070671_100108285
3796 Ga0070671_100123368
3797 Ga0070671_100179587
3798 Ga0070671_100366207
3799 Ga0070671_100627181
3800 Ga0070674_100022659
3801 Ga0070674_100046149
3802 Ga0070674_100046368
3803 Ga0070674_100063040
3804 Ga0070674_100071273
3805 Ga0070674_100091052
3806 Ga0070673_100001302
3807 Ga0070673_100007798
3808 Ga0070673_100040390
3809 Ga0070673_100095247
3810 Ga0070673_100120155
3811 Ga0070673_100666735
3812 Ga0070688_100005818
3813 Ga0070688_100130696
3814 Ga0070688_100138569
3815 Ga0070659_100000054
3816 Ga0070659_100041261
3817 Ga0070659_100099179
3818 Ga0070659_100128402
3819 Ga0070659_100139064
3820 Ga0070659_100179362
3821 Ga0070659_100225714
3822 Ga0070667_100000233
3823 Ga0070667_100003362
3824 Ga0070667_100141563
3825 Ga0070667_100202201
3826 Ga0070667_100207130
3827 Ga0070667_100234681
3828 Ga0070667_100293076
3829 Ga0070667_100575159
3830 Ga0070703_10123763
3831 Ga0070709_10018594
3832 Ga0070709_10034031
3833 Ga0070709_10067055
3834 Ga0070709_10137459
3835 Ga0070714_100030880
3836 Ga0070714_100046843
3837 Ga0070714_100155735
3838 Ga0070714_100362579
3839 Ga0070713_100007098
3840 Ga0070713_100099903
3841 Ga0070713_100108240
3842 Ga0070713_100145633
3843 Ga0070710_10003806
3844 Ga0070710_10004027
3845 Ga0070710_10064775
3846 Ga0070701_10008482
3847 Ga0070711_100005558
3848 Ga0070711_100007109
3849 Ga0070711_100085829
3850 Ga0070711_100270934
3851 Ga0070705_100032862
3852 Ga0070705_100209075
3853 Ga0070700_100022510
3854 Ga0070700_100105644
3855 Ga0070700_100312976
3856 Ga0070700_100680435
3857 Ga0070694_100033376
3858 Ga0070694_100174993
3859 Ga0070694_100213054
3860 Ga0070708_100000519
3861 Ga0070708_100039742
3862 Ga0070708_100178261
3863 Ga0070708_100438092
3864 Ga0070708_100541376
3865 Ga0070708_100826659
3866 Ga0070663_100000934
3867 Ga0070663_100006590
3868 Ga0070663_100012831
3869 Ga0070663_100066217
3870 Ga0070663_100128920
3871 Ga0070663_100167763
3872 Ga0070678_100029341
3873 Ga0070678_100044334
3874 Ga0070678_100242791
3875 Ga0070678_100386862
3876 Ga0070662_100003166
3877 Ga0070662_100126270
3878 Ga0070662_100223581
3879 Ga0070662_100454874
3880 Ga0070681_10024150
3881 Ga0070681_10043648
3882 Ga0070681_10089558
3883 Ga0070681_10174879
3884 Ga0068867_100004515
3885 Ga0068867_100143013
3886 Ga0068867_100178109
3887 Ga0068867_100568435
3888 Ga0070685_10009074
3889 Ga0070685_10051372
3890 Ga0070706_100004958
3891 Ga0070706_100027930
3892 Ga0070706_100040404
3893 Ga0070706_100192877
3894 Ga0070706_100297606
3895 Ga0070706_100474002
3896 Ga0070707_100031403
3897 Ga0070707_100210462
3898 Ga0070707_100451034
3899 Ga0070698_100049272
3900 Ga0070698_100101354
3901 Ga0070698_100139778
3902 Ga0070698_100278415
3903 Ga0070698_100465161
3904 Ga0070699_100088921
3905 Ga0070699_100717085
3906 Ga0070679_100004126
3907 Ga0070679_100020888
3908 Ga0070679_100055517
3909 Ga0070679_100097707
3910 Ga0070679_100100615
3911 Ga0070679_100131397
3912 Ga0070684_100005879
3913 Ga0070684_100020407
3914 Ga0070684_100030174
3915 Ga0070684_100036763
3916 Ga0070684_100101158
3917 Ga0070684_100293825
3918 Ga0070697_100037770
3919 Ga0070697_100039746
3920 Ga0070697_100089914
3921 Ga0070697_100127673
3922 Ga0068853_100020766
3923 Ga0068853_100021864
3924 Ga0068853_100027138
3925 Ga0068853_100066009
3926 Ga0070672_100008399
3927 Ga0070672_100031979
3928 Ga0070672_100186210
3929 Ga0070686_100000614
3930 Ga0070686_100027639
3931 Ga0070686_100045752
3932 Ga0070686_100193900
3933 Ga0070695_100007955
3934 Ga0070695_100496565
3935 Ga0070696_100007912
3936 Ga0070696_100041745
3937 Ga0070696_100057901
3938 Ga0070696_100146819
3939 Ga0070693_100017942
3940 Ga0070693_100043375
3941 Ga0070693_100156256
3942 Ga0070665_100004066
3943 Ga0070665_100015354
3944 Ga0070665_100059585
3945 Ga0070665_100074040
3946 Ga0070665_100076593
3947 Ga0070665_100091477
3948 Ga0070665_100158370
3949 Ga0070665_100226909
3950 Ga0070665_100251422
3951 Ga0070665_100323375
3952 Ga0070665_100433449
3953 Ga0070665_100599391
3954 Ga0070704_100098724
3955 Ga0068855_100029788
3956 Ga0068855_100082367
3957 Ga0068855_100133273
3958 Ga0068855_100153877
3959 Ga0068855_100163194
3960 Ga0068855_100174665
3961 Ga0068855_100326177
3962 Ga0068855_100591276
3963 Ga0070664_100001003
3964 Ga0070664_100075412
3965 Ga0070664_100080947
3966 Ga0070664_100493702
3967 Ga0068857_100000878
3968 Ga0068857_100042019
3969 Ga0068857_100046330
3970 Ga0068857_100204345
3971 Ga0068857_100273837
3972 Ga0068857_100299772
3973 Ga0068854_100389307
3974 Ga0068856_100011136
3975 Ga0068856_100041754
3976 Ga0068856_100081215
3977 Ga0068856_100109636
3978 Ga0068856_100215588
3979 Ga0068856_100425090
3980 Ga0070702_100060959
3981 Ga0070702_100162117
3982 Ga0068852_100005102
3983 Ga0068852_100021683
3984 Ga0068852_100030010
3985 Ga0068852_100045251
3986 Ga0068852_100180693
3987 Ga0068852_100315150
3988 Ga0068852_100356389
3989 Ga0068852_100426413
3990 Ga0068859_100000800
3991 Ga0068859_100015731
3992 Ga0068859_100041971
3993 Ga0068859_100084267
3994 Ga0068859_100146258
3995 Ga0068859_100204459
3996 Ga0068859_100355096
3997 Ga0068859_100413683
3998 Ga0068859_101020736
3999 Ga0068859_101079920
4000 Ga0068864_100000142
4001 Ga0068864_100004679
4002 Ga0068864_100006821
4003 Ga0068864_100014776
4004 Ga0068864_100026256
4005 Ga0068864_100094887
4006 Ga0068864_100105187
4007 Ga0068864_100106636
4008 Ga0068864_100210123
4009 Ga0068864_100434726
4010 Ga0068866_10113653
4011 Ga0068861_100021834
4012 Ga0068861_100031951
4013 Ga0068861_100082034
4014 Ga0068861_100135041
4015 Ga0068861_100764708
4016 Ga0068851_10012797
4017 Ga0068851_10193400
4018 Ga0068870_10060969
4019 Ga0068870_10173072
4020 Ga0068870_10180929
4021 Ga0068863_100000220
4022 Ga0068863_100005419
4023 Ga0068863_100007101
4024 Ga0068863_100018121
4025 Ga0068863_100018292
4026 Ga0068863_100146501
4027 Ga0068863_100252869
4028 Ga0068863_100284705
4029 Ga0068863_100480326
4030 Ga0068863_100988554
4031 Ga0068858_100003282
4032 Ga0068858_100072516
4033 Ga0068858_100149047
4034 Ga0068858_100227025
4035 Ga0068858_100537962
4036 Ga0068858_100582162
4037 Ga0068860_100000421
4038 Ga0068860_100002509
4039 Ga0068860_100027297
4040 Ga0068860_100030026
4041 Ga0068860_100049785
4042 Ga0068860_100070217
4043 Ga0068860_100231506
4044 Ga0068860_100417201
4045 Ga0068860_100489963
4046 Ga0068862_100003605
4047 Ga0068862_100008355
4048 Ga0068862_100013633
4049 Ga0068862_100036838
4050 Ga0068862_100040183
4051 Ga0068862_100060178
4052 Ga0068862_100114498
4053 Ga0068862_100217033
4054 Ga0081455_10003564
4055 Ga0081455_10006934
4056 Ga0081455_10011421
4057 Ga0081455_10020400
4058 Ga0081455_10028061
4059 Ga0081455_10165785
4060 Ga0081455_10292683
4061 Ga0081538_10003894
4062 Ga0081538_10006867
4063 Ga0081538_10007292
4064 Ga0081538_10037877
4065 Ga0081540_1002667
4066 Ga0081540_1002792
4067 Ga0081540_1006168
4068 Ga0081540_1007391
4069 Ga0081540_1008663
4070 Ga0081540_1009142
4071 Ga0081540_1010656
4072 Ga0081540_1016145
4073 Ga0081540_1019390
4074 Ga0081540_1020227
4075 Ga0081540_1027571
4076 Ga0081540_1128945
4077 Ga0081539_10001498
4078 Ga0081539_10005634
4079 Ga0081539_10007640
4080 Ga0081539_10048894
4081 Ga0081539_10088597
4082 Ga0070717_10009138
4083 Ga0070717_10032952
4084 Ga0075365_10008842
4085 Ga0075365_10010225
4086 Ga0075365_10052246
4087 Ga0075365_10060756
4088 Ga0075365_10066846
4089 Ga0075365_10075161
4090 Ga0075365_10094453
4091 Ga0075365_10142540
4092 Ga0075365_10166989
4093 Ga0075365_10279990
4094 Ga0075365_10298880
4095 Ga0075368_10001535
4096 Ga0075368_10017936
4097 Ga0075368_10062170
4098 Ga0075368_10066520
4099 Ga0075363_100042091
4100 Ga0075363_100048458
4101 Ga0075363_100055498
4102 Ga0075363_100068089
4103 Ga0075364_10003655
4104 Ga0075364_10050121
4105 Ga0075364_10107903
4106 Ga0075364_10129379
4107 Ga0075364_10132372
4108 Ga0075364_10360275
4109 Ga0075364_10499921
4110 Ga0075432_10029627
4111 Ga0075432_10040333
4112 Ga0070715_10000344
4113 Ga0070715_10134774
4114 Ga0070716_100019459
4115 Ga0070716_100077270
4116 Ga0070716_100135540
4117 Ga0070712_100004625
4118 Ga0070712_100087120
4119 Ga0070712_100112802
4120 Ga0075362_10002110
4121 Ga0075362_10008885
4122 Ga0075362_10015330
4123 Ga0075362_10021208
4124 Ga0075362_10031909
4125 Ga0075362_10063391
4126 Ga0075362_10140811
4127 Ga0075367_10001171
4128 Ga0075367_10014596
4129 Ga0075367_10019131
4130 Ga0075367_10023320
4131 Ga0075367_10036137
4132 Ga0075367_10050201
4133 Ga0075367_10084113
4134 Ga0075367_10093183
4135 Ga0075367_10103561
4136 Ga0075367_10284207
4137 Ga0075369_10008749
4138 Ga0075369_10012764
4139 Ga0075369_10066710
4140 Ga0075369_10143537
4141 Ga0075366_10002895
4142 Ga0075366_10010221
4143 Ga0075366_10176174
4144 Ga0075366_10240477
4145 Ga0097621_100007290
4146 Ga0097621_100057662
4147 Ga0097621_100074238
4148 Ga0097621_100104470
4149 Ga0097621_100112493
4150 Ga0097621_100542545
4151 Ga0075370_10001596
4152 Ga0075370_10002463
4153 Ga0075370_10003699
4154 Ga0075370_10009011
4155 Ga0075370_10021725
4156 Ga0075370_10043357
4157 Ga0068871_100011916
4158 Ga0068871_100015227
4159 Ga0068871_100052042
4160 Ga0068871_100076665
4161 Ga0068871_100080184
4162 Ga0068871_100138815
4163 Ga0075428_100074486
4164 Ga0075428_100100640
4165 Ga0075428_100111834
4166 Ga0075428_101022271
4167 Ga0075430_100033044
4168 Ga0075430_100051629
4169 Ga0075430_100076429
4170 Ga0075431_100000624
4171 Ga0075433_10000772
4172 Ga0075434_100000891
4173 Ga0075434_100129292
4174 Ga0075434_100254051
4175 Ga0075434_100358192
4176 Ga0075434_100614608
4177 Ga0075429_100007172
4178 Ga0075429_100009104
4179 Ga0075429_100042584
4180 Ga0075429_100204204
4181 Ga0075429_100331475
4182 Ga0068865_100027629
4183 Ga0068865_100028473
4184 Ga0068865_100323395
4185 Ga0075436_100026728
4186 Ga0075436_100033292
4187 Ga0075436_100047903
4188 Ga0075436_100083194
4189 Ga0075436_100085911
4190 Ga0075436_100547935
4191 Ga0097620_100000800
4192 Ga0097620_100015731
4193 Ga0097620_100041971
4194 Ga0097620_100084260
4195 Ga0097620_100146270
4196 Ga0097620_100204468
4197 Ga0097620_100355100
4198 Ga0097620_100413658
4199 Ga0097620_101020772
4200 Ga0097620_101079916
4201 Ga0079104_1000068
4202 Ga0079104_1000071
4203 Ga0099826_10000002
4204 Ga0099826_10000011
4205 Ga0075435_100003277
4206 Ga0075435_100018966
4207 Ga0075435_100513788
4208 Ga0099794_10011698
4209 Ga0099794_10015660
4210 Ga0099794_10039980
4211 Ga0099794_10047139
4212 Ga0099794_10068909
4213 Ga0099794_10118205
4214 Ga0099795_10034242
4215 Ga0099795_10085059
4216 Ga0105251_10000660
4217 Ga0105251_10016211
4218 Ga0105251_10033412
4219 Ga0105251_10039324
4220 Ga0105251_10106453
4221 Ga0105251_10167518
4222 Ga0105244_10005347
4223 Ga0105250_10024040
4224 Ga0105250_10072671
4225 Ga0105240_10000012
4226 Ga0105240_10004505
4227 Ga0105240_10004758
4228 Ga0105240_10014043
4229 Ga0105240_10152921
4230 Ga0105240_10219203
4231 Ga0105240_10294429
4232 Ga0105240_10560545
4233 Ga0111539_10000520
4234 Ga0111539_10003392
4235 Ga0111539_10004538
4236 Ga0111539_10154755
4237 Ga0111539_10421078
4238 Ga0111539_10697485
4239 Ga0111539_10889061
4240 Ga0105245_10010680
4241 Ga0105245_10039217
4242 Ga0105245_10092888
4243 Ga0105245_10133823
4244 Ga0105245_10194458
4245 Ga0105245_10294739
4246 Ga0105245_10353378
4247 Ga0105245_10560492
4248 Ga0105247_10004988
4249 Ga0105247_10030494
4250 Ga0105247_10047833
4251 Ga0105247_10131456
4252 Ga0105247_10161858
4253 Ga0114129_10020308
4254 Ga0114129_10058263
4255 Ga0114129_10152069
4256 Ga0114129_10218687
4257 Ga0114129_10332770
4258 Ga0114129_10688131
4259 Ga0114129_10713689
4260 Ga0114129_11003519
4261 Ga0114129_11006953
4262 Ga0114129_11253159
4263 Ga0105243_10019520
4264 Ga0105243_10051317
4265 Ga0105243_10076336
4266 Ga0105243_10077571
4267 Ga0105243_10223767
4268 Ga0105243_10356358
4269 Ga0105241_10031806
4270 Ga0105241_10308105
4271 Ga0105241_10817084
4272 Ga0105242_10051245
4273 Ga0105242_10184237
4274 Ga0105242_10238842
4275 Ga0105242_10435530
4276 Ga0105242_10497658
4277 Ga0105242_10525415
4278 Ga0105242_10708589
4279 Ga0105242_10825526
4280 Ga0105242_10910310
4281 Ga0105248_10000694
4282 Ga0105248_10001296
4283 Ga0105248_10004337
4284 Ga0105248_10017418
4285 Ga0105248_10074491
4286 Ga0105248_10080910
4287 Ga0105248_10099718
4288 Ga0105248_10252794
4289 Ga0105248_10398558
4290 Ga0105237_10001938
4291 Ga0105237_10004557
4292 Ga0105237_10008632
4293 Ga0105237_10016990
4294 Ga0105237_10033190
4295 Ga0105237_10091859
4296 Ga0105237_10127812
4297 Ga0105237_10170857
4298 Ga0105237_10179243
4299 Ga0105237_10186749
4300 Ga0105237_10299509
4301 Ga0105238_10001033
4302 Ga0105238_10001851
4303 Ga0105238_10011939
4304 Ga0105238_10013209
4305 Ga0105238_10019059
4306 Ga0105238_10031142
4307 Ga0105238_10052610
4308 Ga0105238_10164044
4309 Ga0105238_10166911
4310 Ga0105238_10795760
4311 Ga0105249_10000072
4312 Ga0105249_10000422
4313 Ga0105249_10060242
4314 Ga0105249_10076890
4315 Ga0105249_10155192
4316 Ga0105249_10172032
4317 Ga0105249_10284433
4318 Ga0105249_10345108
4319 Ga0105249_10372944
4320 Ga0105148_100123
4321 Ga0105033_106106
4322 Ga0099796_10102196
4323 Ga0105239_10001549
4324 Ga0105239_10003708
4325 Ga0105239_10006999
4326 Ga0105239_10008095
4327 Ga0105239_10009580
4328 Ga0105239_10009841
4329 Ga0105239_10015936
4330 Ga0105239_10049420
4331 Ga0105239_10208814
4332 Ga0105239_10280846
4333 Ga0105239_10301988
4334 Ga0105246_10002169
4335 Ga0105246_10253142
4336 Ga0105246_10338657
4337 Ga0105246_10462946
4338 Ga0105246_10590327
4339 Ga0157326_1005286
4340 Ga0157338_1004667
4341 Ga0157373_10001947
4342 Ga0157373_10009729
4343 Ga0157373_10043061
4344 Ga0157373_10503217
4345 Ga0157371_10000281
4346 Ga0157370_10000758
4347 Ga0157370_10003818
4348 Ga0157370_10018565
4349 Ga0157370_10076676
4350 Ga0157370_10134764
4351 Ga0157370_10259109
4352 Ga0157370_10413522
4353 Ga0157369_10016214
4354 Ga0157369_10016964
4355 Ga0157369_10024565
4356 Ga0157369_10062042
4357 Ga0157369_10137939
4358 Ga0157369_10273477
4359 Ga0157369_10604222
4360 Ga0171463_1007
4361 Ga0157374_10004057
4362 Ga0157374_10046486
4363 Ga0157374_10152153
4364 Ga0157374_10381418
4365 Ga0157374_10407843
4366 Ga0157374_10874981
4367 Ga0157378_10006674
4368 Ga0157378_10045538
4369 Ga0157378_10101445
4370 Ga0157378_10102404
4371 Ga0157378_10109215
4372 Ga0157378_10110261
4373 Ga0163162_10016637
4374 Ga0163162_10021320
4375 Ga0163162_10029014
4376 Ga0163162_10049302
4377 Ga0163162_10063796
4378 Ga0163162_10131787
4379 Ga0163162_10175750
4380 Ga0163162_10309489
4381 Ga0163162_10321047
4382 Ga0163162_10393846
4383 Ga0163162_10399422
4384 Ga0163162_10562446
4385 Ga0157372_10004406
4386 Ga0157372_10053498
4387 Ga0157372_11167518
4388 Ga0157375_10013529
4389 Ga0157375_10014936
4390 Ga0157375_10069081
4391 Ga0157375_10080667
4392 Ga0157375_10083336
4393 Ga0157375_10173065
4394 Ga0157375_10406734
4395 Ga0157375_10490362
4396 Ga0157375_10862573
4397 Ga0157375_11218101
4398 Ga0163163_10001632
4399 Ga0163163_10002519
4400 Ga0163163_10057729
4401 Ga0163163_10107222
4402 Ga0163163_10242087
4403 Ga0163163_10346613
4404 Ga0163163_10392888
4405 Ga0163163_10620127
4406 Ga0157380_10005754
4407 Ga0157380_10011551
4408 Ga0157380_10021745
4409 Ga0157380_10081370
4410 Ga0157380_10201757
4411 Ga0157380_10518073
4412 Ga0182008_10009235
4413 Ga0182008_10015180
4414 Ga0182008_10018126
4415 Ga0182008_10040083
4416 Ga0182008_10057401
4417 Ga0157377_10007749
4418 Ga0157377_10122687
4419 Ga0157377_10427455
4420 Ga0157379_10001714
4421 Ga0157379_10003508
4422 Ga0157379_10020827
4423 Ga0157379_10023488
4424 Ga0157379_10030392
4425 Ga0157379_10110343
4426 Ga0157379_10201212
4427 Ga0157379_10264934
4428 Ga0157376_10012925
4429 Ga0157376_10025170
4430 Ga0157376_10377135
4431 Ga0157376_10749176
4432 Ga0157376_11021805
4433 Ga0182006_1000757
4434 Ga0182006_1034530
4435 Ga0182007_10001344
4436 Ga0182007_10001622
4437 Ga0182007_10076443
4438 Ga0182005_1000525
4439 Ga0182005_1002502
4440 Ga0182005_1014364
4441 Ga0182005_1065658
4442 Ga0183362_10004
4443 Ga0183363_1153
4444 Ga0163161_10050964
4445 Ga0163161_10244960
4446 Ga0214544_1000002
4447 Ga0214542_1000001
4448 Ga0214545_1000001
4449 Ga0214543_1000001
4450 Ga0213872_10000518
4451 Ga0213872_10005444
4452 Ga0213872_10146833
4453 Ga0213871_10067367
4454 Ga0224712_10000233
4455 Ga0224712_10001202
4456 Ga0224712_10001870
4457 Ga0224712_10067892
4458 Ga0209760_100047
4459 Ga0209760_108054
4460 Ga0209436_100059
4461 Ga0209436_101427
4462 Ga0209436_104658
4463 Ga0209436_111587
4464 Ga0209436_113890
4465 Ga0209784_100004
4466 Ga0209784_100024
4467 Ga0209566_100004
4468 Ga0209566_100018
4469 Ga0209566_100724
4470 Ga0209674_100006
4471 Ga0209674_100046
4472 Ga0209674_101530
4473 Ga0209672_100040
4474 Ga0209147_100037
4475 Ga0209147_100048
4476 Ga0209563_100009
4477 Ga0209563_100039
4478 Ga0209563_100090
4479 Ga0207427_100029
4480 Ga0207427_102311
4481 Ga0209437_100004
4482 Ga0209437_100009
4483 Ga0209437_100022
4484 Ga0209258_100070
4485 Ga0207425_1000001
4486 Ga0207425_1002122
4487 Ga0207425_1003481
4488 Ga0207425_1013748
4489 Ga0209646_1000148
4490 Ga0209646_1006777
4491 Ga0209646_1007597
4492 Ga0209646_1011532
4493 Ga0209026_1000024
4494 Ga0209677_100005
4495 Ga0209677_100024
4496 Ga0209677_102058
4497 Ga0209677_105071
4498 Ga0209677_112153
4499 Ga0209148_1000050
4500 Ga0209148_1000311
4501 Ga0209148_1000689
4502 Ga0209759_1002587
4503 Ga0209759_1017592
4504 Ga0209129_1000001
4505 Ga0209129_1001284
4506 Ga0209129_1002137
4507 Ga0209129_1003531
4508 Ga0209129_1004963
4509 Ga0209129_1014726
4510 Ga0209233_1000005
4511 Ga0209233_1000031
4512 Ga0209233_1000032
4513 Ga0209233_1000161
4514 Ga0209233_1002879
4515 Ga0209233_1004223
4516 Ga0209233_1013320
4517 Ga0209565_1000167
4518 Ga0209565_1000506
4519 Ga0209565_1002339
4520 Ga0209565_1005322
4521 Ga0209565_1013952
4522 Ga0209565_1014319
4523 Ga0209565_1030578
4524 Ga0209455_1000183
4525 Ga0209455_1000351
4526 Ga0209455_1000483
4527 Ga0209455_1000549
4528 Ga0209455_1009579
4529 Ga0209673_1000051
4530 Ga0209673_1000351
4531 Ga0209673_1000522
4532 Ga0209673_1001992
4533 Ga0209673_1004076
4534 Ga0209673_1006656
4535 Ga0209130_1000004
4536 Ga0209130_1000017
4537 Ga0209130_1000091
4538 Ga0209130_1000219
4539 Ga0209130_1000565
4540 Ga0209130_1005513
4541 Ga0209675_1000027
4542 Ga0209675_1001526
4543 Ga0209675_1002032
4544 Ga0209675_1014230
4545 Ga0209675_1050630
4546 Ga0209676_1000032
4547 Ga0209676_1002673
4548 Ga0209676_1003015
4549 Ga0209025_1000099
4550 Ga0209025_1000153
4551 Ga0209025_1000828
4552 Ga0209025_1003821
4553 Ga0209025_1028384
4554 Ga0209025_1030189
4555 Ga0209025_1031166
4556 Ga0209025_1048922
4557 Ga0209564_1000094
4558 Ga0209564_1000362
4559 Ga0209564_1000370
4560 Ga0209564_1000372
4561 Ga0209564_1005207
4562 Ga0209564_1006917
4563 Ga0209564_1027899
4564 Ga0209758_1000073
4565 Ga0209758_1000770
4566 Ga0209758_1000983
4567 Ga0209758_1001597
4568 Ga0209758_1002834
4569 Ga0209758_1009519
4570 Ga0209758_1025302
4571 Ga0209050_1000025
4572 Ga0209050_1000046
4573 Ga0209050_1000782
4574 Ga0209050_1001654
4575 Ga0209050_1002669
4576 Ga0209050_1003720
4577 Ga0209050_1005042
4578 Ga0209256_1000044
4579 Ga0209256_1000051
4580 Ga0209256_1000257
4581 Ga0209256_1000265
4582 Ga0209256_1000349
4583 Ga0209256_1000401
4584 Ga0209256_1000467
4585 Ga0209256_1005032
4586 Ga0209256_1005739
4587 Ga0209256_1006154
4588 Ga0209256_1011544
4589 Ga0209256_1024210
4590 Ga0209256_1056444
4591 Ga0207426_1000003
4592 Ga0207426_1000006
4593 Ga0207426_1000065
4594 Ga0207426_1000075
4595 Ga0207426_1000387
4596 Ga0207426_1001109
4597 Ga0207426_1001540
4598 Ga0209051_1000025
4599 Ga0209051_1000039
4600 Ga0209051_1000047
4601 Ga0209051_1000079
4602 Ga0209051_1000418
4603 Ga0209051_1003452
4604 Ga0209051_1003587
4605 Ga0209051_1008212
4606 Ga0209051_1016244
4607 Ga0209051_1031189
4608 Ga0209051_1065377
4609 Ga0209257_1000016
4610 Ga0209257_1000039
4611 Ga0209257_1000068
4612 Ga0209257_1000183
4613 Ga0209257_1009889
4614 Ga0209257_1016227
4615 Ga0207697_10029675
4616 Ga0207656_10010305
4617 Ga0207656_10177812
4618 Ga0207656_10194131
4619 Ga0207655_1001842
4620 Ga0207655_1006055
4621 Ga0207655_1011081
4622 Ga0207655_1027269
4623 Ga0207713_1010112
4624 Ga0207713_1039951
4625 Ga0207713_1072831
4626 Ga0207653_10002361
4627 Ga0207682_10026461
4628 Ga0207682_10043796
4629 Ga0207692_10000670
4630 Ga0207692_10002135
4631 Ga0207642_10344608
4632 Ga0207710_10014376
4633 Ga0207710_10019559
4634 Ga0207710_10032805
4635 Ga0207710_10035090
4636 Ga0207710_10131632
4637 Ga0207688_10015608
4638 Ga0207688_10048415
4639 Ga0207688_10077534
4640 Ga0207680_10013415
4641 Ga0207680_10027837
4642 Ga0207647_10007948
4643 Ga0207647_10010522
4644 Ga0207647_10034320
4645 Ga0207685_10101122
4646 Ga0207685_10125583
4647 Ga0207699_10001071
4648 Ga0207699_10001673
4649 Ga0207645_10147021
4650 Ga0207645_10247814
4651 Ga0207643_10007787
4652 Ga0207643_10172979
4653 Ga0207643_10196813
4654 Ga0207705_10105536
4655 Ga0207705_10148077
4656 Ga0207705_10243246
4657 Ga0207705_10274363
4658 Ga0207705_10345601
4659 Ga0207705_10503104
4660 Ga0207705_10516243
4661 Ga0207684_10004126
4662 Ga0207684_10005128
4663 Ga0207684_10019121
4664 Ga0207684_10090594
4665 Ga0207654_10012434
4666 Ga0207654_10032756
4667 Ga0207654_10074027
4668 Ga0207654_10306942
4669 Ga0207707_10007364
4670 Ga0207707_10012064
4671 Ga0207707_10062460
4672 Ga0207707_10076309
4673 Ga0207695_10000097
4674 Ga0207695_10087770
4675 Ga0207695_10189999
4676 Ga0207671_10000289
4677 Ga0207671_10009421
4678 Ga0207671_10013183
4679 Ga0207671_10026951
4680 Ga0207671_10043314
4681 Ga0207693_10115338
4682 Ga0207663_10001416
4683 Ga0207663_10004294
4684 Ga0207663_10005704
4685 Ga0207663_10070938
4686 Ga0207663_10099050
4687 Ga0207663_10189051
4688 Ga0207660_10003393
4689 Ga0207660_10055450
4690 Ga0207660_10094588
4691 Ga0207660_10125121
4692 Ga0207662_10191174
4693 Ga0207657_10000155
4694 Ga0207657_10005499
4695 Ga0207657_10012946
4696 Ga0207657_10034421
4697 Ga0207657_10087906
4698 Ga0207657_10254064
4699 Ga0207649_10453179
4700 Ga0207652_10003525
4701 Ga0207652_10058466
4702 Ga0207652_10103027
4703 Ga0207652_10225136
4704 Ga0207652_10277445
4705 Ga0207646_10009547
4706 Ga0207646_10101937
4707 Ga0207681_10059033
4708 Ga0207681_10098654
4709 Ga0207681_10120291
4710 Ga0207681_10131810
4711 Ga0207681_10163901
4712 Ga0207681_10332781
4713 Ga0207694_10006772
4714 Ga0207694_10021236
4715 Ga0207694_10052146
4716 Ga0207694_10070471
4717 Ga0207694_10081625
4718 Ga0207694_10112604
4719 Ga0207694_10345719
4720 Ga0207650_10021229
4721 Ga0207650_10060286
4722 Ga0207650_10110141
4723 Ga0207659_10007943
4724 Ga0207659_10017421
4725 Ga0207659_10028047
4726 Ga0207659_10064785
4727 Ga0207659_10338203
4728 Ga0207687_10014427
4729 Ga0207687_10033459
4730 Ga0207687_10067935
4731 Ga0207687_10198623
4732 Ga0207687_10299403
4733 Ga0207687_10538702
4734 Ga0207700_10037721
4735 Ga0207700_10043703
4736 Ga0207700_10783809
4737 Ga0207664_10014742
4738 Ga0207664_10025256
4739 Ga0207664_10156933
4740 Ga0207664_10182542
4741 Ga0207664_10213927
4742 Ga0207644_10067016
4743 Ga0207644_10071079
4744 Ga0207644_10095341
4745 Ga0207644_10131856
4746 Ga0207644_10164953
4747 Ga0207644_10222891
4748 Ga0207644_10303479
4749 Ga0207644_10353017
4750 Ga0207690_10000016
4751 Ga0207690_10043249
4752 Ga0207690_10101491
4753 Ga0207690_10166354
4754 Ga0207690_10202883
4755 Ga0207690_10389725
4756 Ga0207690_10392541
4757 Ga0207690_10407862
4758 Ga0207706_10010244
4759 Ga0207706_10031079
4760 Ga0207706_10055884
4761 Ga0207706_10134855
4762 Ga0207706_10248429
4763 Ga0207686_10388674
4764 Ga0207686_10470818
4765 Ga0207709_10192545
4766 Ga0207709_10365662
4767 Ga0207670_10005962
4768 Ga0207670_10191842
4769 Ga0207670_10451246
4770 Ga0207669_10014715
4771 Ga0207669_10061996
4772 Ga0207669_10110898
4773 Ga0207669_10144707
4774 Ga0207669_10402028
4775 Ga0207704_10072532
4776 Ga0207704_10315275
4777 Ga0207704_10561511
4778 Ga0207665_10006290
4779 Ga0207665_10010762
4780 Ga0207665_10055187
4781 Ga0207665_10089693
4782 Ga0207691_10002059
4783 Ga0207691_10037781
4784 Ga0207691_10062558
4785 Ga0207691_10072106
4786 Ga0207691_10096617
4787 Ga0207691_10170671
4788 Ga0207711_10000895
4789 Ga0207711_10004656
4790 Ga0207711_10008469
4791 Ga0207711_10029507
4792 Ga0207711_10081967
4793 Ga0207711_10110908
4794 Ga0207711_10228974
4795 Ga0207711_10249682
4796 Ga0207711_10541320
4797 Ga0207689_10007870
4798 Ga0207689_10031032
4799 Ga0207689_10067917
4800 Ga0207689_10323279
4801 Ga0207689_10445033
4802 Ga0207661_10013228
4803 Ga0207661_10027967
4804 Ga0207661_10046528
4805 Ga0207661_10146305
4806 Ga0207661_10399641
4807 Ga0207661_10415301
4808 Ga0207661_10647801
4809 Ga0207679_10003944
4810 Ga0207679_10005110
4811 Ga0207679_10009475
4812 Ga0207679_10100378
4813 Ga0207679_10467659
4814 Ga0207679_10616421
4815 Ga0207667_10011485
4816 Ga0207667_10014677
4817 Ga0207667_10023627
4818 Ga0207667_10103342
4819 Ga0207667_10186196
4820 Ga0207667_10233898
4821 Ga0207667_10296827
4822 Ga0207651_10006206
4823 Ga0207651_10060520
4824 Ga0207651_10073900
4825 Ga0207651_10121289
4826 Ga0207651_10584876
4827 Ga0207712_10000055
4828 Ga0207712_10006090
4829 Ga0207712_10007926
4830 Ga0207712_10012350
4831 Ga0207712_10046519
4832 Ga0207712_10125911
4833 Ga0207712_10239435
4834 Ga0207712_10345521
4835 Ga0207712_10462241
4836 Ga0207668_10000183
4837 Ga0207668_10362834
4838 Ga0207668_10686215
4839 Ga0207640_10197968
4840 Ga0207640_10350625
4841 Ga0207658_10000875
4842 Ga0207658_10046420
4843 Ga0207658_10519582
4844 Ga0207677_10014387
4845 Ga0207677_10031537
4846 Ga0207677_10066822
4847 Ga0207677_10129867
4848 Ga0207677_10228682
4849 Ga0207677_10425699
4850 Ga0207703_10003104
4851 Ga0207703_10012761
4852 Ga0207703_10135055
4853 Ga0207703_10136851
4854 Ga0207703_10176371
4855 Ga0207703_10318401
4856 Ga0207703_10325451
4857 Ga0207703_10796455
4858 Ga0207703_10888794
4859 Ga0207703_10932961
4860 Ga0207639_10206693
4861 Ga0207639_10280651
4862 Ga0207639_10283211
4863 Ga0207678_10002024
4864 Ga0207678_10002790
4865 Ga0207678_10006965
4866 Ga0207678_10032328
4867 Ga0207678_10050675
4868 Ga0207678_10076585
4869 Ga0207678_10253515
4870 Ga0207708_10021858
4871 Ga0207708_10029046
4872 Ga0207708_10128033
4873 Ga0207702_10012957
4874 Ga0207702_10057012
4875 Ga0207702_10081341
4876 Ga0207702_10157748
4877 Ga0207702_10164314
4878 Ga0207702_10193667
4879 Ga0207702_10394766
4880 Ga0207641_10000578
4881 Ga0207641_10004073
4882 Ga0207641_10017424
4883 Ga0207641_10019155
4884 Ga0207641_10069256
4885 Ga0207641_10126157
4886 Ga0207641_10146973
4887 Ga0207641_10229736
4888 Ga0207641_10669134
4889 Ga0207641_10692950
4890 Ga0207641_10980188
4891 Ga0207648_10002166
4892 Ga0207648_10008252
4893 Ga0207648_10023229
4894 Ga0207648_10055624
4895 Ga0207648_10072250
4896 Ga0207648_10097358
4897 Ga0207648_10183478
4898 Ga0207648_10202652
4899 Ga0207648_10570237
4900 Ga0207676_10000073
4901 Ga0207676_10001562
4902 Ga0207676_10003095
4903 Ga0207676_10007877
4904 Ga0207676_10035417
4905 Ga0207676_10088569
4906 Ga0207676_10308616
4907 Ga0207676_10381432
4908 Ga0207676_10512045
4909 Ga0207676_10587822
4910 Ga0207674_10002499
4911 Ga0207674_10028670
4912 Ga0207674_10037955
4913 Ga0207674_10052615
4914 Ga0207674_10053405
4915 Ga0207674_10073221
4916 Ga0207674_10075973
4917 Ga0207674_10085922
4918 Ga0207674_11119899
4919 Ga0207675_100007680
4920 Ga0207675_100027051
4921 Ga0207675_100035751
4922 Ga0207675_100049695
4923 Ga0207675_100052547
4924 Ga0207675_100089771
4925 Ga0207675_100223136
4926 Ga0207683_10004441
4927 Ga0207683_10012070
4928 Ga0207683_10050351
4929 Ga0207683_10074144
4930 Ga0207683_10233203
4931 Ga0207698_10043253
4932 Ga0207698_10063652
4933 Ga0207698_10083569
4934 Ga0207698_10125536
4935 Ga0207698_10386156
4936 Ga0209281_1000098
4937 Ga0209281_1000135
4938 Ga0209281_1000168
4939 Ga0209389_1000100
4940 Ga0209389_1000107
4941 Ga0209371_1000717
4942 Ga0209371_1010800
4943 Ga0209589_1000092
4944 Ga0209969_1011427
4945 Ga0209489_100006
4946 Ga0209489_110323
4947 Ga0209700_100005
4948 Ga0209981_1005111
4949 Ga0209996_1010440
4950 Ga0209996_1013328
4951 Ga0209984_1029758
4952 Ga0209179_1008051
4953 Ga0209179_1025209
4954 Ga0209968_1003794
4955 Ga0209982_1007738
4956 Ga0209970_1006138
4957 Ga0210002_1004102
4958 Ga0209983_1015889
4959 Ga0209983_1020482
4960 Ga0209282_1000001
4961 Ga0209282_1000050
4962 Ga0209282_1055877
4963 Ga0209588_1007408
4964 Ga0209588_1008591
4965 Ga0209588_1017377
4966 Ga0209588_1021588
4967 Ga0209813_10015383
4968 Ga0209813_10017346
4969 Ga0209974_10085079
4970 Ga0209974_10100509
4971 Ga0207428_10000206
4972 Ga0207428_10004916
4973 Ga0207428_10015046
4974 Ga0207428_10022322
4975 Ga0207428_10038813
4976 Ga0207428_10435589
4977 Ga0207428_10451735
4978 Ga0268266_10000903
4979 Ga0268266_10012572
4980 Ga0268266_10017592
4981 Ga0268266_10024502
4982 Ga0268266_10024967
4983 Ga0268266_10033368
4984 Ga0268266_10050775
4985 Ga0268266_10080036
4986 Ga0268266_10094524
4987 Ga0268266_10109320
4988 Ga0268266_10191575
4989 Ga0268266_10258996
4990 Ga0268266_10416901
4991 Ga0268266_10426856
4992 Ga0268266_10999217
4993 Ga0268265_10000366
4994 Ga0268265_10004088
4995 Ga0268265_10004279
4996 Ga0268265_10005646
4997 Ga0268265_10021488
4998 Ga0268265_10032398
4999 Ga0268265_10120571
5000 Ga0268264_10000068
5001 Ga0268264_10000555
5002 Ga0268264_10054569
5003 Ga0268264_10070461
5004 Ga0268264_10075029
5005 Ga0268264_10110191
5006 Ga0268264_10365130
5007 Ga0268264_10537897
5008 Ga0307517_10000062
5009 Ga0307517_10001270
5010 Ga0307517_10140610
5011 Ga0307517_10172001
5012 Ga0307517_10359894
5013 Ga0307515_10000043
5014 Ga0307515_10000066
5015 Ga0307515_10002166
5016 Ga0307515_10002598
5017 Ga0307515_10172393
5018 Ga0307515_10328167
5019 Ga0307515_10372082
5020 Ga0265338_10261203
5021 Ga0268256_1001412
5022 Ga0268256_1004589
5023 Ga0307511_10049682
5024 Ga0307511_10086923
5025 Ga0265328_10000053
5026 Ga0265328_10010498
5027 Ga0265328_10032629
5028 Ga0265329_10004721
5029 Ga0265331_10000026
5030 Ga0265331_10000964
5031 Ga0265331_10001610
5032 Ga0265327_10008003
5033 Ga0265327_10020140
5034 Ga0265327_10091299
5035 Ga0265316_10000907
5036 Ga0265316_10028559
5037 Ga0265316_10163786
5038 Ga0307513_10102950
5039 Ga0307513_10255047
5040 Ga0307509_10005522
5041 Ga0307509_10425173
5042 Ga0307408_100002861
5043 Ga0307408_100012426
5044 Ga0307408_100012720
5045 Ga0307408_100042899
5046 Ga0307408_100054112
5047 Ga0307408_100058519
5048 Ga0307408_100066057
5049 Ga0307408_100246776
5050 Ga0307508_10002693
5051 Ga0307508_10072835
5052 Ga0307508_10097395
5053 Ga0307508_10228386
5054 Ga0316576_10008242
5055 Ga0316578_10235885
5056 Ga0307516_10005056
5057 Ga0307516_10020437
5058 Ga0307516_10023734
5059 Ga0307516_10045117
5060 Ga0307516_10164140
5061 Ga0307516_10548085
5062 Ga0307405_10002305
5063 Ga0307405_10011374
5064 Ga0307405_10074864
5065 Ga0307405_10128676
5066 Ga0307405_10241863
5067 Ga0307405_10258671
5068 Ga0307405_10330547
5069 Ga0307405_10583268
5070 Ga0307413_10091767
5071 Ga0307413_10171445
5072 Ga0307413_10384034
5073 Ga0307413_10484692
5074 Ga0307413_10645891
5075 Ga0307410_10024714
5076 Ga0307410_10045245
5077 Ga0307410_10085081
5078 Ga0307410_10105915
5079 Ga0307410_10736590
5080 Ga0307406_10020468
5081 Ga0307406_10065411
5082 Ga0307406_10068540
5083 Ga0307406_10114259
5084 Ga0307406_10133256
5085 Ga0307406_10321438
5086 Ga0307407_10015676
5087 Ga0307407_10029276
5088 Ga0307407_10075555
5089 Ga0307407_10249434
5090 Ga0307412_10000302
5091 Ga0307412_10008473
5092 Ga0307412_10013193
5093 Ga0307412_10067907
5094 Ga0307412_10099677
5095 Ga0307412_10141988
5096 Ga0307412_10253360
5097 Ga0307412_10356653
5098 Ga0307409_100008074
5099 Ga0307409_100020978
5100 Ga0307409_100223107
5101 Ga0307409_100591694
5102 Ga0307409_100716442
5103 Ga0307409_101021146
5104 Ga0307416_100009769
5105 Ga0307416_100009975
5106 Ga0307416_100055616
5107 Ga0307416_100110714
5108 Ga0307416_100123710
5109 Ga0307416_100221438
5110 Ga0307416_100288003
5111 Ga0307416_100330674
5112 Ga0307416_100380224
5113 Ga0307416_100585068
5114 Ga0307416_100839975
5115 Ga0307414_10000206
5116 Ga0307414_10022759
5117 Ga0307414_10110403
5118 Ga0307414_10216227
5119 Ga0307414_10495720
5120 Ga0307411_10019375
5121 Ga0307411_10046242
5122 Ga0307411_10103206
5123 Ga0307411_10142996
5124 Ga0307411_10225359
5125 Ga0307415_100003211
5126 Ga0307415_100138775
5127 Ga0307415_100200319
5128 Ga0307415_100291016
5129 Ga0307415_100492569
5130 Ga0307507_10007150
5131 Ga0307507_10075020
5132 Ga0307510_10001303
5133 Ga0307510_10014005
5134 Ga0307510_10172817
5135 Ga0307510_10271744
5136 Ga0315911_1000009
5137 Ga0373926_0042305
5138 Ga0373926_0134037
5139 Ga0373926_0179151
5140 Ga0373929_0069330
5141 Ga0373944_0058049
5142 Ga0373936_0162000
5143 Ga0373941_0128067
5144 Ga0373945_0140089
5145 Ga0373954_0097339
5146 Ga0373957_0079555
5147 Ga0373943_0003222
5148 Ga0373943_0008936
5149 Ga0373943_0094638
5150 Ga0373943_0175433
5151 Ga0373946_0004653
5152 Ga0373946_0032417
5153 Ga0373946_0294967
5154 Ga0373955_0018062
5155 Ga0373955_0030305
5156 Ga0373955_0200030
5157 Ga0373961_0016728
5158 Ga0316574_0011998
5159 Ga0373931_0392509
5160 Ga0373935_0028621
5161 Ga0373935_0044978
5162 Ga0373935_0115993
5163 Ga0373935_0192602
5164 Ga0373927_0005644
5165 Ga0373927_0012739
5166 Ga0373927_0020294
5167 Ga0373927_0027713
5168 Ga0373927_0028596
5169 Ga0373927_0028627
5170 Ga0373927_0042274
5171 Ga0373927_0163130
5172 Ga0373927_0167276
5173 Ga0373933_0036595
5174 Ga0373933_0050782
5175 Ga0373947_0003799
5176 Ga0373947_0003989
5177 Ga0373947_0027175
5178 Ga0373947_0080375
5179 Ga0373947_0126522
5180 Ga0373947_0311511
5181 Ga0373937_0024454
5182 Ga0373937_0075196
5183 Ga0373937_0090609
5184 Ga0373937_0157733
5185 Ga0373937_0790115
5186 Ga0316582_0242414
5187 Ga0316584_0109122
5188 Ga0373925_0007689
5189 Ga0373925_0010250
5190 Ga0373925_0043795
5191 Ga0373925_0084048
5192 Ga0373925_0215386
5193 Ga0373925_0308472
5194 Ga0373925_0705778
5195 Ga0395899_0014066
5196 Ga0395899_0106957
5197 Ga0395899_0138768
5198 Ga0395899_0162185
5199 Ga0395900_0009281
5200 Ga0395900_0022114
5201 Ga0395900_0029037
5202 Ga0395900_0077532
5203 Ga0395900_0121539
5204 Ga0395900_0318510
5205 Ga0395900_0400950
5206 Ga0395898_0003443
5207 Ga0395898_0018962
5208 Ga0395898_0033916
5209 Ga0395898_0041030
5210 Ga0395898_0081008
5211 Ga0395898_0298021
5212 Ga0395898_0350039
5213 Ga0395898_0593868
5214 Ga0395905_0000043
5215 Ga0395905_0000137
5216 Ga0395905_0001830
5217 Ga0395905_0003792
5218 Ga0395905_0004910
5219 Ga0395905_0005011
5220 Ga0395905_0010999
5221 Ga0395905_0019116
5222 Ga0395905_0041193
5223 Ga0395905_0071083
5224 Ga0395905_0134531
5225 Ga0395905_0224679
5226 Ga0395905_0247775
5227 Ga0395905_0314531
5228 Ga0395905_0351400
5229 Ga0436364_0429582
5230 Ga0395901_0007717
5231 Ga0395901_0036715
5232 Ga0395901_0040908
5233 Ga0395901_0100650
5234 Ga0395901_0300499
5235 Ga0395901_0449658
5236 Ga0395901_0549383
5237 Ga0242420_005082
5238 Ga0436365_1455024
5239 Ga0436365_1886126
5240 Ga0436360_1366726
5241 Ga0436361_0060433
5242 Ga0436361_0595316
5243 Ga0436361_0853954
5244 Ga0436361_0998063
5245 Ga0436361_1009582
5246 Ga0436363_0957632
5247 Ga0439436_0019658
5248 Ga0439436_0047133
5249 Ga0439438_000260
5250 Ga0439438_001046
5251 Ga0439438_003032
5252 Ga0439438_004977
5253 Ga0439438_011566
5254 Ga0439439_0124005
5255 Ga0439447_000142
5256 Ga0439447_000618
5257 Ga0439447_001165
5258 Ga0439447_002000
5259 Ga0439447_002117
5260 Ga0439447_029429
5261 Ga0439461_0008364
5262 Ga0439466_0000165
5263 Ga0439466_0001150
5264 Ga0439466_0001929
5265 Ga0439466_0002202
5266 Ga0439466_0004550
5267 Ga0439466_0034431
5268 Ga0439465_0003554
5269 Ga0439465_0013402
5270 Ga0439465_0059525
5271 Ga0439465_0074163
5272 Ga0439465_0131724
5273 Ga0451853_1946290
5274 Ga0439431_0021146
5275 Ga0439441_007656
5276 Ga0439442_039469
5277 Ga0439432_002801
5278 Ga0439432_002903
5279 Ga0439432_005178
5280 Ga0439432_011392
5281 Ga0439432_013663
5282 Ga0439432_014072
5283 Ga0439432_034185
5284 Ga0439432_089320
5285 Ga0439449_0015799
5286 Ga0439451_000064
5287 Ga0439451_000770
5288 Ga0439451_003674
5289 Ga0439451_004382
5290 Ga0439452_000777
5291 Ga0439452_001492
5292 Ga0439452_005072
5293 Ga0439452_008193
5294 Ga0439452_010723
5295 Ga0439452_020499
5296 Ga0439452_025015
5297 Ga0439454_020880
5298 Ga0439456_001012
5299 Ga0439456_001910
5300 Ga0439456_003441
5301 Ga0439456_004502
5302 Ga0439456_005173
5303 Ga0439456_009851
5304 Ga0439462_0005633
5305 Ga0439463_000053
5306 Ga0439463_001967
5307 Ga0439463_064047
5308 Ga0450911_000969
5309 Ga0450919_000048
5310 Ga0450921_003465
5311 Ga0450922_000198
5312 Ga0450922_001343
5313 Ga0450923_000302
5314 Ga0450923_000640
5315 Ga0450923_024433
5316 Ga0450890_000068
5317 Ga0450890_002924
5318 Ga0450890_010029
5319 Ga0450891_008845
5320 Ga0450894_008485
5321 Ga0450894_025754
5322 Ga0450898_003315
5323 Ga0450898_012295
5324 Ga0450898_023901
5325 Ga0450902_012637
5326 Ga0450903_000951
5327 Ga0450903_001219
5328 Ga0450903_001821
5329 Ga0450903_004815
5330 Ga0450906_000120
5331 Ga0450906_014033
5332 Ga0450907_000041
5333 Ga0450907_028011
5334 Ga0450910_003946
5335 Ga0450910_010753
5336 Ga0450910_011623
5337 Ga0439446_0000180
5338 Ga0439446_0001133
5339 Ga0439446_0005173
5340 Ga0439446_0015312
5341 Ga0439458_0016151
5342 Ga0439458_0016794
5343 Ga0439458_0065343
5344 Ga0450908_000565
5345 Ga0450908_002148
5346 Ga0450908_014635
5347 Ga0450909_000056
5348 Ga0450909_002385
5349 Ga0439434_0000029
5350 Ga0439434_0064726
5351 Ga0439434_0078214
5352 Ga0439435_0022238
5353 Ga0439444_0007202
5354 Ga0439444_0079850
5355 Ga0439464_0015024
5356 Ga0439464_0122258
5357 Ga0439460_0000261
5358 Ga0439460_0000599
5359 Ga0439460_0001047
5360 Ga0439460_0029911
5361 Ga0450918_000771
5362 Ga0450918_002265
5363 Ga0450918_002383
5364 Ga0450893_0010027
5365 Ga0450893_0022149
5366 Ga0450901_006145
5367 Ga0451577_0065557
5368 Ga0451577_0433180
5369 Ga0439440_0001338
5370 Ga0439440_0020124
5371 Ga0466972_0001120
5372 Ga0466972_0011127
5373 Ga0466972_0014900
5374 Ga0466972_0034802
5375 Ga0466972_0039643
5376 Ga0453683_0021525
5377 Ga0466965_0004130
5378 Ga0466965_0022296
5379 Ga0466965_0025548
5380 Ga0466961_0000837
5381 Ga0466964_0018333
5382 Ga0466964_0029876
5383 Ga0466964_0089537
5384 Ga0453684_0513363
5385 Ga0466968_0003653
5386 Ga0466968_0014467
5387 Ga0466968_0031237
5388 Ga0466968_0034736
5389 Ga0466968_0038429
5390 Ga0466960_0060670
5391 Ga0466960_0064618
5392 Ga0466959_0004842
5393 Ga0466959_0118371
5394 Ga0451576_0004677
5395 Ga0451576_0057263
5396 Ga0451576_0105831
5397 Ga0495617_000221
5398 Ga0495617_000410
5399 Ga0495617_001311
5400 Ga0495617_029521
5401 Ga0495617_050795
5402 Ga0495627_011403
5403 Ga0495627_058777
5404 Ga0495592_0018584
5405 Ga0495603_0000494
5406 Ga0495603_0204703
5407 Ga0495603_0265083
5408 Ga0495590_0000022
5409 Ga0495590_0005871
5410 Ga0495590_0010290
5411 Ga0495590_0011818
5412 Ga0495590_0067418
5413 Ga0495591_001375
5414 Ga0495591_017113
5415 Ga0495591_019675
5416 Ga0495591_045456
5417 Ga0495629_0001268
5418 Ga0495629_0031695
5419 Ga0495629_0100605
5420 Ga0495629_0109490
5421 Ga0495638_0000229
5422 Ga0495638_0000274
5423 Ga0495638_0000709
5424 Ga0495638_0000966
5425 Ga0495638_0001163
5426 Ga0495638_0002629
5427 Ga0495638_0004432
5428 Ga0495638_0007819
5429 Ga0495638_0011225
5430 Ga0495638_0020754
5431 Ga0495638_0050022
5432 Ga0495638_0050387
5433 Ga0495638_0073207
5434 Ga0495638_0083336
5435 Ga0495638_0164672
5436 Ga0495641_0028632
5437 Ga0495651_0001592
5438 Ga0495651_0003787
5439 Ga0495651_0086911
5440 Ga0495651_0097158
5441 Ga0495653_0001109
5442 Ga0495653_0052803
5443 Ga0495653_0058772
5444 Ga0495653_0077320
5445 Ga0495653_0109117
5446 Ga0495650_0001935
5447 Ga0495650_0002311
5448 Ga0495650_0005109
5449 Ga0495580_0004421
5450 Ga0495580_0110107
5451 Ga0495580_0153945
5452 Ga0495580_0468462
5453 Ga0495582_0000438
5454 Ga0495582_0011570
5455 Ga0495582_0033326
5456 Ga0495582_0146425
5457 Ga0495582_0252133
5458 Ga0495605_0000458
5459 Ga0495605_0000800
5460 Ga0495605_0001066
5461 Ga0495605_0001962
5462 Ga0495605_0002116
5463 Ga0495605_0002355
5464 Ga0495605_0004594
5465 Ga0495605_0020857
5466 Ga0495605_0056893
5467 Ga0495605_0123004
5468 Ga0495605_0157378
5469 Ga0495605_0230818
5470 Ga0495639_0000324
5471 Ga0495639_0003808
5472 Ga0495639_0007031
5473 Ga0495639_0050943
5474 Ga0495662_0002124
5475 Ga0495662_0068222
5476 Ga0495664_0004377
5477 Ga0495664_0018795
5478 Ga0495584_0000385
5479 Ga0495584_0001423
5480 Ga0495584_0004237
5481 Ga0495584_0008517
5482 Ga0495584_0026446
5483 Ga0495584_0028678
5484 Ga0495584_0046507
5485 Ga0495584_0070657
5486 Ga0495584_0102738
5487 Ga0495585_0003261
5488 Ga0495585_0009663
5489 Ga0495585_0013083
5490 Ga0495585_0057662
5491 Ga0495585_0077846
5492 Ga0495585_0124172
5493 Ga0495585_0150566
5494 Ga0495585_0153252
5495 Ga0495585_0192891
5496 Ga0495594_0001620
5497 Ga0495594_0008110
5498 Ga0495594_0056930
5499 Ga0495594_0061457
5500 Ga0495594_0085230
5501 Ga0495596_0004110
5502 Ga0495596_0014598
5503 Ga0495607_0002361
5504 Ga0495607_0003960
5505 Ga0495607_0004377
5506 Ga0495607_0004932
5507 Ga0495607_0004993
5508 Ga0495607_0005142
5509 Ga0495607_0023295
5510 Ga0495607_0035097
5511 Ga0495607_0043218
5512 Ga0495607_0048515
5513 Ga0495607_0057456
5514 Ga0495607_0110277
5515 Ga0495607_0116844
5516 Ga0495607_0238079
5517 Ga0495583_0000035
5518 Ga0495583_0000239
5519 Ga0495583_0000373
5520 Ga0495583_0004667
5521 Ga0495583_0006914
5522 Ga0495583_0011899
5523 Ga0495583_0016308
5524 Ga0495583_0024056
5525 Ga0495583_0057820
5526 Ga0495606_0007258
5527 Ga0495606_0007352
5528 Ga0495606_0017470
5529 Ga0495606_0093858
5530 Ga0495608_0006903
5531 Ga0495608_0093821
5532 Ga0495608_0120097
5533 Ga0495610_0000259
5534 Ga0495610_0007569
5535 Ga0495610_0007605
5536 Ga0495610_0007851
5537 Ga0495610_0016071
5538 Ga0495610_0018844
5539 Ga0495610_0141442
5540 Ga0495616_0002213
5541 Ga0495616_0019459
5542 Ga0495616_0023991
5543 Ga0495616_0030198
5544 Ga0495616_0031769
5545 Ga0495616_0032201
5546 Ga0495616_0036680
5547 Ga0495616_0051266
5548 Ga0495616_0052392
5549 Ga0495618_0017817
5550 Ga0495618_0018417
5551 Ga0495618_0040434
5552 Ga0495620_0005009
5553 Ga0495620_0006851
5554 Ga0495620_0017840
5555 Ga0495620_0027136
5556 Ga0495620_0047661
5557 Ga0495620_0066141
5558 Ga0495620_0083447
5559 Ga0495620_0131799
5560 Ga0495628_0003023
5561 Ga0495628_0010092
5562 Ga0495628_0231381
5563 Ga0495628_0257774
5564 Ga0495630_0036826
5565 Ga0495630_0067417
5566 Ga0495630_0120350
5567 Ga0495631_0011013
5568 Ga0495631_0011575
5569 Ga0495631_0091111
5570 Ga0495631_0136504
5571 Ga0495632_0000341
5572 Ga0495632_0000598
5573 Ga0495632_0011122
5574 Ga0495632_0011555
5575 Ga0495632_0017274
5576 Ga0495632_0062046
5577 Ga0495632_0079714
5578 Ga0495632_0126326
5579 Ga0495637_0002322
5580 Ga0495637_0004848
5581 Ga0495637_0005373
5582 Ga0495637_0005440
5583 Ga0495637_0006912
5584 Ga0495637_0028584
5585 Ga0495637_0034570
5586 Ga0495643_0000318
5587 Ga0495643_0000771
5588 Ga0495643_0003467
5589 Ga0495643_0003626
5590 Ga0495643_0009745
5591 Ga0495643_0026274
5592 Ga0495643_0039953
5593 Ga0495643_0041262
5594 Ga0495643_0110907
5595 Ga0495644_0000241
5596 Ga0495644_0016846
5597 Ga0495644_0039305
5598 Ga0495644_0051533
5599 Ga0495644_0061056
5600 Ga0495648_0000004
5601 Ga0495648_0000195
5602 Ga0495648_0000541
5603 Ga0495648_0004283
5604 Ga0495648_0006148
5605 Ga0495648_0007143
5606 Ga0495648_0009169
5607 Ga0495648_0019366
5608 Ga0495648_0026003
5609 Ga0495648_0029675
5610 Ga0495648_0035622
5611 Ga0495648_0037268
5612 Ga0495648_0054406
5613 Ga0495648_0067434
5614 Ga0495648_0100330
5615 Ga0495648_0238346
5616 Ga0495663_0001423
5617 Ga0495663_0008215
5618 Ga0495666_0009302
5619 Ga0495666_0016715
5620 Ga0495666_0017043
5621 Ga0495666_0020502
5622 Ga0495642_0000037
5623 Ga0495642_0000101
5624 Ga0495642_0000116
5625 Ga0495642_0003718
5626 Ga0495642_0003930
5627 Ga0495642_0015421
5628 Ga0495642_0079787
5629 Ga0495642_0190823
5630 Ga0495652_0003794
5631 Ga0495652_0027444
5632 Ga0495652_0036962
5633 Ga0495652_0048403
5634 Ga0495652_0072485
5635 Ga0495654_0000498
5636 Ga0495654_0000657
5637 Ga0495654_0003609
5638 Ga0495654_0013886
5639 Ga0495654_0019063
5640 Ga0495654_0049550
5641 Ga0495654_0067919
5642 Ga0495654_0075919
5643 Ga0495654_0091348
5644 Ga0495654_0115323
5645 Ga0495654_0120427
5646 Ga0495665_0018499
5647 Ga0495665_0118158
5648 Ga0495640_0019619
5649 Ga0495640_0048473
5650 Ga0495586_0005657
5651 Ga0495587_0000297
5652 Ga0495587_0001541
5653 Ga0495587_0005350
5654 Ga0495587_0012614
5655 Ga0495598_0000455
5656 Ga0495598_0042065
5657 Ga0495609_0000739
5658 Ga0495609_0001370
5659 Ga0495609_0001436
5660 Ga0495609_0002734
5661 Ga0495609_0003636
5662 Ga0495609_0010727
5663 Ga0495609_0030245
5664 Ga0495609_0087138
5665 Ga0495609_0098512
5666 Ga0495621_0004814
5667 Ga0495621_0111722
5668 Ga0495621_0137003
5669 Ga0495597_0000147
5670 Ga0495597_0000161
5671 Ga0495597_0000832
5672 Ga0495597_0004353
5673 Ga0495597_0006700
5674 Ga0495597_0008750
5675 Ga0495597_0021542
5676 Ga0495597_0022440
5677 Ga0495597_0150268
5678 Ga0495645_0030133
5679 Ga0495645_0075190
5680 Ga0495645_0095310
5681 Ga0495622_0000155
5682 Ga0495622_0000545
5683 Ga0495622_0001915
5684 Ga0495622_0002366
5685 Ga0495622_0008600
5686 Ga0495622_0029126
5687 Ga0495622_0036611
5688 Ga0495622_0039844
5689 Ga0495622_0260332
5690 Ga0495633_0000068
5691 Ga0495633_0009900
5692 Ga0495633_0036723
5693 Ga0495633_0073669
5694 Ga0495633_0075780
5695 Ga0495633_0236069
5696 Ga0495667_0025478
5697 Ga0495667_0032523
5698 Ga0495656_0002385
5699 Ga0495656_0040980
5700 Ga0495656_0348748
5701 Ga0495668_0000093
5702 Ga0495668_0002276
5703 Ga0495668_0006229
5704 Ga0495668_0007245
5705 Ga0495668_0010021
5706 Ga0495668_0077103
5707 Ga0495668_0193656
5708 Ga0495634_0001010
5709 Ga0495634_0004672
5710 Ga0495634_0010343
5711 Ga0495634_0129213
5712 Ga0495611_0006444
5713 Ga0495611_0057986
5714 Ga0495611_0095142
5715 Ga0495611_0104817
5716 Ga0495625_0000257
5717 Ga0495625_0000322
5718 Ga0495625_0002292
5719 Ga0495625_0004901
5720 Ga0495625_0005239
5721 Ga0495625_0017229
5722 Ga0495625_0019246
5723 Ga0495625_0034185
5724 Ga0495625_0103805
5725 Ga0495625_0106996
5726 Ga0495625_0115459
5727 Ga0495625_0129624
5728 Ga0495625_0132503
5729 Ga0495625_0161787
5730 Ga0495625_0172035
5731 Ga0495625_0271235
5732 Ga0495635_0000627
5733 Ga0495635_0001044
5734 Ga0495635_0019223
5735 Ga0495635_0088404
5736 Ga0495635_0314057
5737 Ga0495659_0000137
5738 Ga0495659_0001999
5739 Ga0495659_0007691
5740 Ga0495659_0017460
5741 Ga0495659_0022644
5742 Ga0495661_0008384
5743 Ga0495661_0020592
5744 Ga0495661_0031884
5745 Ga0495661_0085750
5746 Ga0495661_0090384
5747 Ga0495661_0099134
5748 Ga0495661_0109961
5749 Ga0495661_0115657
5750 Ga0495661_0120399
5751 Ga0495588_0000459
5752 Ga0495588_0005783
5753 Ga0495588_0008455
5754 Ga0495588_0011241
5755 Ga0495588_0065281
5756 Ga0495588_0082953
5757 Ga0495588_0110333
5758 Ga0495657_0012774
5759 Ga0495599_0001025
5760 Ga0495599_0005149
5761 Ga0495599_0019202
5762 Ga0495599_0028265
5763 Ga0495623_0000495
5764 Ga0495623_0014458
5765 Ga0495623_0023566
5766 Ga0495623_0137482
5767 Ga0495623_0344724
5768 Ga0495646_0000079
5769 Ga0495646_0006783
5770 Ga0495646_0037062
5771 Ga0495646_0038417
5772 Ga0495646_0051165
5773 Ga0495647_0006089
5774 Ga0495658_0006716
5775 Ga0495658_0014776
5776 Ga0495658_0156820
5777 Ga0495658_0237626
5778 Ga0495669_0002062
5779 Ga0495669_0007762
5780 Ga0495669_0038687
5781 Ga0495613_0026346
5782 Ga0495613_0033253
5783 Ga0495613_0038859
5784 Ga0495624_0002994
5785 Ga0495624_0030236
5786 Ga0495624_0030706
5787 Ga0495624_0097625
5788 Ga0495624_0157434
5789 Ga0495670_0000288
5790 Ga0495670_0002138
5791 Ga0495670_0010201
5792 Ga0495670_0014820
5793 Ga0495670_0031349
5794 Ga0495670_0056836
5795 Ga0495670_0077183
5796 Ga0495670_0206065
5797 Ga0495671_0000125
5798 Ga0495671_0000168
5799 Ga0495671_0000699
5800 Ga0495671_0005180
5801 Ga0495671_0011851
5802 Ga0495671_0026118
5803 Ga0495671_0029473
5804 Ga0495671_0042241
5805 Ga0495671_0071038
5806 Ga0495671_0081268
5807 Ga0495671_0088042
5808 Ga0495671_0126160
5809 Ga0495649_0001058
5810 Ga0495649_0001144
5811 Ga0495649_0003310
5812 Ga0495649_0004148
5813 Ga0495649_0004156
5814 Ga0495649_0007156
5815 Ga0495649_0011249
5816 Ga0495649_0014782
5817 Ga0495649_0019757
5818 Ga0495649_0020589
5819 Ga0495649_0038346
5820 Ga0495649_0080128
5821 Ga0495649_0083885
5822 Ga0495649_0096917
5823 Ga0495649_0219781
5824 Ga0495589_0000305
5825 Ga0495589_0002686
5826 Ga0495589_0023845
5827 Ga0495589_0030346
5828 Ga0495589_0035793
5829 Ga0495589_0073286
5830 Ga0495589_0184699
5831 Ga0495600_0007077
5832 Ga0495600_0014007
5833 Ga0495600_0103878
5834 Ga0495600_0269760
5835 Ga0495660_0005263
5836 Ga0495660_0012111
5837 Ga0495660_0022216
5838 Ga0495660_0029221
5839 Ga0495660_0042022
5840 Ga0495660_0045360
5841 Ga0495660_0061171
5842 Ga0495660_0074144
5843 Ga0495660_0079112
5844 Ga0495660_0120097
5845 Ga0495660_0128779
5846 Ga0495581_0000360
5847 Ga0495581_0001332
5848 Ga0495581_0017266
5849 Ga0495581_0397354
5850 Ga0495604_0002071
5851 Ga0495604_0008401
5852 Ga0495604_0016309
5853 Ga0495604_0039718
5854 Ga0495604_0078148
5855 Ga0495604_0082538
5856 Ga0495636_0002769
5857 Ga0495636_0007634
5858 Ga0495636_0009139
5859 Ga0495636_0026245
5860 Ga0495636_0052146
5861 Ga0495636_0082608
5862 Ga0495636_0284639
5863 Ga0495674_0000633
5864 Ga0495674_0006909
5865 Ga0495674_0026346
5866 Ga0495674_0117406
5867 Ga0495674_0124326
5868 Ga0495674_0276176
5869 Ga0495672_0000550
5870 Ga0495672_0002301
5871 Ga0495672_0002328
5872 Ga0495672_0005036
5873 Ga0495672_0005065
5874 Ga0495672_0005088
5875 Ga0495672_0006036
5876 Ga0495672_0010391
5877 Ga0495672_0033526
5878 Ga0495672_0040381
5879 Ga0495672_0049182
5880 Ga0495672_0080207
5881 Ga0495672_0096577
5882 Ga0495672_0104989
5883 Ga0495672_0107810
5884 Ga0495676_0060365
5885 Ga0495676_0132934
5886 Ga0495680_0000249
5887 Ga0495680_0004905
5888 Ga0495680_0026189
5889 Ga0495680_0055500
5890 Ga0495680_0066552
5891 Ga0495680_0098252
5892 Ga0495680_0543610
5893 Ga0495683_0001613
5894 Ga0495683_0002687
5895 Ga0495683_0005163
5896 Ga0495683_0006164
5897 Ga0495683_0052117
5898 Ga0495683_0099229
5899 Ga0495683_0100302
5900 Ga0495683_0165328
5901 Ga0495687_000148
5902 Ga0495687_000202
5903 Ga0495687_000222
5904 Ga0495687_000399
5905 Ga0495687_001094
5906 Ga0495687_004867
5907 Ga0495687_010476
5908 Ga0495687_011008
5909 Ga0495687_012425
5910 Ga0495687_100571
5911 Ga0495675_0049478
5912 Ga0495677_0000197
5913 Ga0495677_0007897
5914 Ga0495677_0015610
5915 Ga0495677_0028178
5916 Ga0495677_0036744
5917 Ga0495679_009103
5918 Ga0495679_021629
5919 Ga0495685_000077
5920 Ga0495685_015963
5921 Ga0495685_018639
5922 Ga0495685_038319
5923 Ga0495685_045512
5924 Ga0495685_108757
5925 Ga0495673_0000074
5926 Ga0495673_0000275
5927 Ga0495673_0001175
5928 Ga0495673_0001287
5929 Ga0495673_0001850
5930 Ga0495673_0017424
5931 Ga0495673_0023990
5932 Ga0495673_0056928
5933 Ga0495673_0078348
5934 Ga0495673_0108461
5935 Ga0495673_0142675
5936 Ga0495673_0160794
5937 Ga0495681_0000199
5938 Ga0495681_0000393
5939 Ga0495681_0000775
5940 Ga0495681_0002259
5941 Ga0495681_0027532
5942 Ga0495681_0028344
5943 Ga0495684_0045471
5944 Ga0495684_0127356
5945 Ga0495686_0001066
5946 Ga0495686_0001944
5947 Ga0495686_0008643
5948 Ga0495686_0027251
5949 Ga0495686_0035966
5950 Ga0495686_0045987
5951 Ga0495686_0126523
5952 Ga0495593_0000528
5953 Ga0495593_0011211
5954 Ga0495593_0053789
5955 Ga0495602_0007320
5956 Ga0495602_0039597
5957 Ga0495602_0263047
5958 Ga0495614_0038453
5959 Ga0495626_0000072
5960 Ga0495626_0000351
5961 Ga0495626_0000938
5962 Ga0495626_0001059
5963 Ga0495626_0018829
5964 Ga0495626_0022371
5965 Ga0495626_0080139
5966 Ga0495626_0101624
5967 Ga0496100_0106669
5968 Ga0496100_0238331
5969 Ga0496100_0963494
5970 Ga0496101_0031279
5971 Ga0496101_0165807
5972 Ga0496101_0200730
5973 Ga0496102_0000242
5974 Ga0496102_0062468
5975 Ga0496102_0078142
5976 Ga0496102_0154937
5977 Ga0496102_0165326
5978 Ga0496102_0252580
5979 Ga0496102_0445394
5980 Ga0496103_0000626
5981 Ga0496103_0002738
5982 Ga0496103_0011559
5983 Ga0496103_0094773
5984 Ga0496103_0157222
5985 Ga0496103_0190007
5986 Ga0496104_0000117
5987 Ga0496104_0014002
5988 Ga0496105_0000094
5989 Ga0496105_0052502
5990 Ga0496105_0264168
5991 Ga0496106_0006476
5992 Ga0496106_0086951
5993 Ga0496106_0172907
5994 Ga0496106_0320511
5995 Ga0496107_0052092
5996 Ga0496107_0499946
5997 Ga0496108_0038314
5998 Ga0496108_0050533
5999 Ga0496108_0082076
6000 Ga0496108_0183412
6001 Ga0496108_0251476
6002 Ga0496108_0316448
6003 Ga0496108_0319478
6004 Ga0496109_0012725
6005 Ga0496109_0029841
6006 Ga0496109_0034529
6007 Ga0496109_0040022
6008 Ga0496109_0041867
6009 Ga0496109_0202928
6010 Ga0496109_0206026
6011 Ga0496109_0300014
6012 Ga0496109_0588243
6013 Ga0496110_0021144
6014 Ga0496110_0046927
6015 Ga0496110_0053956
6016 Ga0496110_0074269
6017 Ga0496110_0169179
6018 Ga0496110_0289272
6019 Ga0496110_0303093
6020 Ga0496110_0786251
6021 Ga0496111_0007449
6022 Ga0496111_0056900
6023 Ga0496111_0141272
6024 Ga0496111_0283840
6025 Ga0496112_0007965
6026 Ga0496112_0018603
6027 Ga0496112_0020508
6028 Ga0496112_0044202
6029 Ga0496112_0075137
6030 Ga0496112_0281895
6031 Ga0496113_0003118
6032 Ga0496113_0007525
6033 Ga0496113_0077796
6034 Ga0496113_0119714
6035 Ga0496113_0223395
6036 Ga0496113_0628299
6037 Ga0496114_0068119
6038 Ga0496114_0119523
6039 Ga0496114_0287901
6040 Ga0496114_0491921
6041 Ga0496115_0004609
6042 Ga0496115_0128312
6043 Ga0496115_0210568
6044 Ga0496115_0304905
6045 Ga0496116_0000683
6046 Ga0496116_0002937
6047 Ga0496116_0020906
6048 Ga0496116_0032512
6049 Ga0496116_0047802
6050 Ga0496116_0101077
6051 Ga0496117_0003211
6052 Ga0496117_0005257
6053 Ga0496117_0019674
6054 Ga0496117_0048571
6055 Ga0496117_0074238
6056 Ga0496118_0003853
6057 Ga0496118_0007447
6058 Ga0496118_0016697
6059 Ga0496118_0030050
6060 Ga0496118_0058704
6061 Ga0496118_0087525
6062 Ga0496118_0124171
6063 Ga0496118_0350624
6064 Ga0496119_0002464
6065 Ga0496119_0008202
6066 Ga0496119_0011706
6067 Ga0496119_0029911
6068 Ga0496119_0081275
6069 Ga0496119_0083671
6070 Ga0496120_0018208
6071 Ga0496120_0031593
6072 Ga0496120_0050604
6073 Ga0496120_0208502
6074 Ga0496121_0000152
6075 Ga0496121_0002015
6076 Ga0496121_0003388
6077 Ga0496121_0046205
6078 Ga0496121_0052002
6079 Ga0496121_0066931
6080 Ga0496121_0075758
6081 Ga0496121_0108991
6082 Ga0496121_0144911
6083 Ga0496121_0188142
6084 Ga0496121_0407159
6085 Ga0496122_0002069
6086 Ga0496122_0004933
6087 Ga0496122_0010642
6088 Ga0496122_0054987
6089 Ga0496122_0060931
6090 Ga0496122_0240685
6091 Ga0496123_0001437
6092 Ga0496123_0001744
6093 Ga0496123_0013068
6094 Ga0496123_0016318
6095 Ga0496123_0091372
6096 Ga0496123_0300592
6097 Ga0496124_0001525
6098 Ga0496124_0002487
6099 Ga0496124_0007753
6100 Ga0496124_0016268
6101 Ga0496124_0058390
6102 Ga0496124_0062102
6103 Ga0496124_0114984
6104 Ga0496124_0169422
6105 Ga0496124_0220647
6106 Ga0496124_0223548
6107 Ga0496125_0000048
6108 Ga0496125_0002654
6109 Ga0496125_0014173
6110 Ga0496125_0015019
6111 Ga0496125_0035464
6112 Ga0496125_0040819
6113 Ga0496125_0046370
6114 Ga0496125_0072407
6115 Ga0496125_0118303
6116 Ga0496125_0238363
6117 Ga0496126_0052191
6118 Ga0496126_0091775
6119 Ga0496126_0176721
6120 Ga0495678_000555
6121 Ga0495678_000751
6122 Ga0495678_000937
6123 Ga0495678_001323
6124 Ga0495678_001462
6125 Ga0495678_005057
6126 Ga0495678_007359
6127 Ga0495678_011926
6128 Ga0495678_021005
6129 Ga0495678_026447
6130 Ga0495682_0002674
6131 Ga0495682_0003481
6132 Ga0495682_0016588
6133 Ga0495682_0086599
6134 Ga0495682_0104934
6135 Ga0501290_000751
6136 Ga0501292_002330
6137 Ga0501292_029294
6138 Ga0501294_006094
6139 Ga0501298_004272
6140 Ga0501300_011625
6141 Ga0501303_003674
6142 Ga0501031_0023053
6143 Ga0501031_0052120
6144 Ga0501034_0003723
6145 Ga0501034_0078947
6146 Ga0501034_0125443
6147 Ga0501036_0019057
6148 Ga0501036_0258483
6149 Ga0501036_0603036
6150 Ga0501037_0115165
6151 Ga0501037_0415049
6152 Ga0501037_0759259
6153 Ga0501038_0009783
6154 Ga0501038_0069078
6155 Ga0501038_0140995
6156 Ga0501039_0019991
6157 Ga0501039_0088928
6158 Ga0501039_0320832
6159 Ga0501039_0351727
6160 Ga0501039_0430649
6161 Ga0501040_0111905
6162 Ga0501041_0038647
6163 Ga0501041_0132776
6164 Ga0501042_0046292
6165 Ga0501042_0109569
6166 Ga0501043_0228182
6167 Ga0501046_0337003
6168 Ga0501047_0034832
6169 Ga0501047_0047685
6170 Ga0501048_0131815
6171 Ga0501048_0254888
6172 Ga0501048_0319519
6173 Ga0501048_0324979
6174 Ga0501048_0393158
6175 Ga0501067_0032780
6176 Ga0501067_0079901
6177 Ga0501067_0193328
6178 Ga0501068_0124104
6179 Ga0501069_0020859
6180 Ga0501070_0470245
6181 Ga0501071_0003797
6182 Ga0501071_0072849
6183 Ga0501071_0160596
6184 Ga0501071_0357783
6185 Ga0501071_0532805
6186 Ga0501072_0042363
6187 Ga0501072_0076259
6188 Ga0501072_0095664
6189 Ga0501072_0428793
6190 Ga0501072_0601634
6191 Ga0501073_0098324
6192 Ga0501073_0281410
6193 Ga0501073_0636499
6194 Ga0501074_0092009
6195 Ga0501075_0011615
6196 Ga0501075_0321857
6197 Ga0501075_0511454
6198 Ga0501076_0059167
6199 Ga0501076_0067829
6200 Ga0501076_0120680
6201 Ga0501076_0515721
6202 Ga0501077_0047894
6203 Ga0501198_010962
6204 Ga0501211_000658
6205 Ga0501223_000003
6206 Ga0501223_000020
6207 Ga0501224_000004
6208 Ga0501233_010218
6209 Ga0501235_001348
6210 Ga0501235_001564
6211 Ga0501235_013471
6212 Ga0501236_022010
6213 Ga0501246_000607
6214 Ga0501257_000050
6215 Ga0501257_017806
6216 Ga0501221_004867
6217 Ga0501225_0000002
6218 Ga0501225_0000629
6219 Ga0501225_0002548
6220 Ga0501225_0011951
6221 Ga0501225_0043123
6222 Ga0501225_0096096
6223 Ga0501234_003641
6224 Ga0501079_0030222
6225 Ga0501079_0042326
6226 Ga0501079_0074830
6227 Ga0501079_0084183
6228 Ga0501080_0053495
6229 Ga0501080_0446367
6230 Ga0501081_0047224
6231 Ga0501081_0099890
6232 Ga0501081_0100055
6233 Ga0501083_0071689
6234 Ga0501262_000403
6235 Ga0501265_001360
6236 Ga0501279_004708
6237 Ga0501280_001539
6238 Ga0501035_0179254
6239 Ga0501035_0427912
6240 Ga0501044_0247713
6241 Ga0501044_0248368
6242 Ga0501045_0134534
6243 Ga0501045_0209622
6244 Ga0501045_0225619
6245 Ga0501045_0407528
6246 Ga0501045_0460795
6247 Ga0501226_000018
6248 nmdc:mga03683_170918_c1
6249 nmdc:mga03683_286335_c1
6250 nmdc:mga03683_38855_c1
6251 nmdc:mga03683_61369_c1
6252 nmdc:mga03683_71513_c1
6253 nmdc:mga03683_7763_c1
6254 nmdc:mga03n38_115896_c1
6255 nmdc:mga00v17_13191_c1
6256 nmdc:mga00v17_13811_c1
6257 nmdc:mga00v17_199256_c1
6258 nmdc:mga00v17_437864_c1
6259 nmdc:mga00v17_45020_c1
6260 nmdc:mga00v17_599108_c1
6261 nmdc:mga00v17_7261_c1
6262 nmdc:mga0yw44_101080_c1
6263 nmdc:mga0yw44_13080_c1
6264 nmdc:mga0yw44_218865_c1
6265 nmdc:mga0yw44_283911_c1
6266 nmdc:mga0yw44_46065_c1
6267 nmdc:mga0yw44_55441_c1
6268 nmdc:mga0yw44_81611_c1
6269 nmdc:mga0yw44_90945_c1
6270 nmdc:mga0k408_104933_c1
6271 nmdc:mga0k408_1177_c1
6272 nmdc:mga0k408_134761_c1
6273 nmdc:mga0k408_14277_c1
6274 nmdc:mga0k408_18322_c1
6275 nmdc:mga0k408_37140_c1
6276 nmdc:mga0k408_4014_c1
6277 nmdc:mga0k408_456999_c1
6278 nmdc:mga0k408_51787_c1
6279 nmdc:mga0k408_55881_c1
6280 nmdc:mga0k408_80041_c1
6281 nmdc:mga06z11_147999_c1
6282 nmdc:mga06z11_53669_c1
6283 nmdc:mga06z11_60830_c1
6284 nmdc:mga04h51_143778_c1
6285 nmdc:mga07m45_10927_c1
6286 nmdc:mga07m45_113521_c1
6287 nmdc:mga07m45_133677_c1
6288 nmdc:mga07m45_23361_c1
6289 nmdc:mga07m45_48798_c1
6290 nmdc:mga07m45_5675_c1
6291 nmdc:mga07m45_59935_c1
6292 nmdc:mga07m45_6019_c1
6293 nmdc:mga05p37_101008_c1
6294 nmdc:mga05p37_190923_c1
6295 nmdc:mga05p37_203925_c1
6296 nmdc:mga05p37_321735_c1
6297 nmdc:mga05p37_549568_c1
6298 nmdc:mga05p37_568477_c1
6299 nmdc:mga05p37_619272_c1
6300 nmdc:mga09592_1028_c1
6301 nmdc:mga09592_161724_c1
6302 nmdc:mga09592_241464_c1
6303 nmdc:mga09592_31102_c1
6304 nmdc:mga09592_7474_c1
6305 nmdc:mga0qj67_188916_c1
6306 nmdc:mga0qj67_44761_c1
6307 nmdc:mga0qj67_56321_c1
6308 nmdc:mga06r32_279850_c1
6309 nmdc:mga06r32_717_c1
6310 nmdc:mga08y16_1265_c1
6311 nmdc:mga08y16_131561_c1
6312 nmdc:mga08y16_16_c1
6313 nmdc:mga08y16_1753_c1
6314 nmdc:mga08y16_45379_c1
6315 nmdc:mga08y16_54335_c1
6316 nmdc:mga08y16_663730_c1
6317 nmdc:mga08y16_964944_c1
6318 nmdc:mga0n895_14847_c1
6319 nmdc:mga0n895_19632_c1
6320 nmdc:mga0n895_248263_c1
6321 nmdc:mga0n895_27128_c1
6322 nmdc:mga0n895_272875_c1
6323 nmdc:mga0n895_331692_c1
6324 nmdc:mga0n895_403881_c1
6325 nmdc:mga0rr50_107275_c1
6326 nmdc:mga0rr50_27954_c1
6327 nmdc:mga0rr50_476740_c1
6328 nmdc:mga0rr50_485091_c1
6329 nmdc:mga08x19_318092_c1
6330 nmdc:mga08x19_389751_c1
6331 nmdc:mga08x19_43627_c1
6332 nmdc:mga08x19_5747_c1
6333 nmdc:mga08x19_75319_c1
6334 nmdc:mga0a205_13549_c3
6335 nmdc:mga0a205_147_c1
6336 nmdc:mga0sz30_102934_c1
6337 nmdc:mga0sz30_2829_c2
6338 nmdc:mga0sz30_44256_c2
6339 nmdc:mga0sz30_74802_c1
6340 nmdc:mga0sz30_85802_c1
6341 nmdc:mga0sz30_8666_c1
6342 Ga0495601_0003885
6343 Ga0495601_0006659
6344 Ga0495601_0044625
6345 Ga0495601_0359188
6346 Ga0500635_0006632
6347 Ga0495655_0064198
6348 Ga0495595_0023049
6349 Ga0495619_0055776
6350 Ga0495619_0082025
6351 Ga0495619_0148271
6352 Ga0495619_0181529
6353 Ga0495619_0210095
6354 Ga0500578_0012512
6355 Ga0500578_0102527
6356 Ga0500578_0103224
6357 Ga0500643_000210
6358 Ga0500643_036240
6359 Ga0500644_0004386
6360 Ga0500644_0019826
6361 Ga0500644_0138052
6362 Ga0500581_098050
6363 Ga0500646_0008037
6364 Ga0500646_0012958
6365 Ga0500647_0035651
6366 Ga0500583_0059916
6367 Ga0500583_0223559
6368 Ga0500651_0001142
6369 Ga0500651_0083089
6370 Ga0500566_0002544
6371 Ga0500641_0001644
6372 Ga0500641_0004116
6373 Ga0500641_0009129
6374 Ga0500641_0013631
6375 Ga0500641_0021871
6376 Ga0500650_0000023
6377 Ga0500650_0022011
6378 Ga0500650_0057807
6379 Ga0500555_016790
6380 Ga0500555_037594
6381 Ga0500556_0000012
6382 Ga0500556_0000070
6383 Ga0500556_0000130
6384 Ga0500556_0009789
6385 Ga0500556_0030835
6386 Ga0500557_001787
6387 Ga0500560_000039
6388 Ga0500562_005358
6389 Ga0500562_026754
6390 Ga0500562_055860
6391 Ga0500572_000916
6392 Ga0500572_049694
6393 Ga0500592_001211
6394 Ga0500593_038527
6395 Ga0500594_0007020
6396 Ga0500595_002653
6397 Ga0500595_003874
6398 Ga0500595_005707
6399 Ga0500595_017412
6400 Ga0500595_042897
6401 Ga0500597_197178
6402 Ga0500608_010353
6403 Ga0500608_025245
6404 Ga0500614_047721
6405 Ga0500618_001941
6406 Ga0500621_118221
6407 Ga0500642_0000230
6408 Ga0500642_0001073
6409 Ga0500642_0067463
6410 Ga0500642_0095910
6411 Ga0500652_000290
6412 Ga0500652_017020
6413 Ga0500652_139998
6414 Ga0500655_025929
6415 Ga0500658_0011652
6416 Ga0500658_0015836
6417 Ga0500658_0087079
6418 Ga0500658_0182617
6419 Ga0500559_0000082
6420 Ga0500568_0000339
6421 Ga0500568_0007694
6422 Ga0500568_0019065
6423 Ga0500568_0030169
6424 Ga0500568_0049079
6425 Ga0500573_0002497
6426 Ga0500574_000040
6427 Ga0500574_001837
6428 Ga0500577_0000790
6429 Ga0500577_0083957
6430 Ga0500577_0089116
6431 Ga0500577_0112212
6432 Ga0500588_0012751
6433 Ga0500588_0068756
6434 Ga0500590_009781
6435 Ga0500604_0002065
6436 Ga0500604_0006820
6437 Ga0500616_0000035
6438 Ga0500616_0001372
6439 Ga0500616_0066592
6440 Ga0500616_0109361
6441 Ga0500619_000640
6442 Ga0500619_008138
6443 Ga0500620_000285
6444 Ga0500622_0000826
6445 Ga0500622_0001170
6446 Ga0500622_0004207
6447 Ga0500622_0081583
6448 Ga0500624_001154
6449 Ga0500624_006141
6450 Ga0500627_0034727
6451 Ga0500627_0110789
6452 Ga0500633_0132753
6453 Ga0500634_0000001
6454 Ga0500634_0040879
6455 Ga0500638_000034
6456 Ga0500638_040298
6457 Ga0500639_002487
6458 Ga0500636_0000158
6459 Ga0500636_0022405
6460 Ga0500636_0032162
6461 Ga0500636_0033803
6462 Ga0500636_0043890
6463 Ga0500636_0104157
6464 Ga0500636_0143694
6465 Ga0500637_0039000
6466 Ga0500637_0091058
6467 Ga0500611_003892
6468 Ga0500611_056060
6469 Ga0500657_160758
6470 Ga0500645_020476
6471 Ga0500599_000198
6472 Ga0501084_0012758
6473 Ga0501084_0140779
6474 Ga0501084_0281400
6475 Ga0501084_0545571
6476 Ga0590071_024159
6477 Ga0590075_009898
6478 Ga0590077_018369
6479 Ga0590077_021672
6480 Ga0587070_038339
6481 Ga0587083_0005554
6482 Ga0587101_027760
6483 Ga0587109_017179
6484 Ga0587062_002685
6485 Ga0587069_021972
6486 Ga0587076_001419
6487 Ga0587079_003398
6488 Ga0501082_0010201
6489 Ga0501082_0127802
6490 Ga0501082_0450566
6491 Ga0501082_0746233
6492 Ga0530510_0587831
6493 2508697157
6494 2508729167
6495 2509078022
6496 2509107958
6497 2509117577
6498 2509141782
6499 2509150336
6500 2511187185
6501 2511256450
6502 2511263933
6503 2511270528
6504 2511279813
6505 2511303549
6506 2511314671
6507 2511317597
6508 2511329279
6509 2511331229
6510 2511336681
6511 2511341909
6512 2511352655
6513 2511356082
6514 2511364960
6515 2512327846
6516 2512931055
6517 2513556973
6518 2513565798
6519 2513599093
6520 2513610984
6521 2513622309
6522 2513629684
6523 2513638830
6524 2513658245
6525 2513672560
6526 2513694233
6527 2513708331
6528 2513718344
6529 2513861712
6530 2513867568
6531 2513873182
6532 2513888014
6533 2513908338
6534 2513920263
6535 2513926802
6536 2513997418
6537 2514016473
6538 2514420299
6539 2514586574
6540 2516205985
6541 2517036415
6542 2517102574
6543 2517407150
6544 2517893689
6545 2520381494
6546 2524437780
6547 2524459766
6548 2524466653
6549 2524535914
6550 2528848752
6551 2535519573
6552 2537875229
6553 2545679531
6554 2583789942
6555 2585167738
6556 2585204881
6557 2585227654
6558 2585269808
6559 2585276517
6560 2585283250
6561 2585327631
6562 2585336395
6563 2585391066
6564 2585395333
6565 2585403373
6566 2585532272
6567 2585552633
6568 2585564586
6569 2585823669
6570 2585900111
6571 2585903157
6572 2587978587
6573 2588516812
6574 2597028092
6575 2597814232
6576 2597855519
6577 2599420705
6578 2599485408
6579 2599604773
6580 2599737917
6581 2599806551
6582 2599938303
6583 2600196883
6584 2600368411
6585 2603857898
6586 2616292182
6587 2616307585
6588 2617346952
6589 2617375371
6590 2617384140
6591 2624493836
6592 2643786965
6593 2643804490
6594 2643953364
6595 2644021106
6596 2644052230
6597 2644065261
6598 2644105554
6599 2644131112
6600 2644146557
6601 2644169739
6602 2644187564
6603 2644191528
6604 2644205024
6605 2644208246
6606 2644215946
6607 2644241718
6608 2644247962
6609 2644254417
6610 2644308305
6611 2644334132
6612 2644350372
6613 2644377670
6614 2644418133
6615 2644451389
6616 2644484973
6617 2644541726
6618 2644615587
6619 2644652005
6620 2644672673
6621 2644691631
6622 2644730295
6623 2671117239
6624 2671120799
6625 2671772202
6626 2719181562
6627 2719665900
6628 2719732226
6629 2720492320
6630 2720613674
6631 2720620462
6632 2720631883
6633 2720775611
6634 2721147654
6635 2721159104
6636 2721164489
6637 2722840659
6638 2723027222
6639 2723560837
6640 2723567430
6641 2723575813
6642 2723846599
6643 2724044982
6644 2724090218
6645 2724104695
6646 2724110502
6647 2730108158
6648 2730164797
6649 2730298736
6650 2739197448
6651 2739262340
6652 2739309754
6653 2743734934
6654 2745074808
6655 2756675754
6656 2765468323
6657 2766066737
6658 2770196259
6659 2774869504
6660 2776258871
6661 2776268602
6662 2776285317
6663 2778123499
6664 2778178600
6665 2792749762
6666 2792834207
6667 2793080576
6668 2793323083
6669 2793326282
6670 2793344120
6671 2793349832
6672 2793367089
6673 2805914827
6674 2808959178
6675 2819540741
6676 2819610236
6677 2819631762
6678 2819640518
6679 2824602314
6680 2824610592
6681 2824654282
6682 2824661639
6683 2824672084
6684 2824679912
6685 2824688683
6686 2824697079
6687 2824713049
6688 2824734560
6689 2824749852
6690 2824754421
6691 2824769158
6692 2824780397
6693 2834643626
6694 2835312826
6695 2838017911
6696 2838028781
6697 2838034403
6698 2838040621
6699 2838043735
6700 2838051789
6701 2838066214
6702 2838074678
6703 2838080544
6704 2838123303
6705 2838664991
6706 2838679056
6707 2838681866
6708 2838696437
6709 2838710323
6710 2838718010
6711 2838723355
6712 2838728724
6713 2839997642
6714 2840770547
6715 2841739728
6716 2841761618
6717 2841851468
6718 2841863556
6719 2841946595
6720 2841954174
6721 2841961025
6722 2841969549
6723 2841974567
6724 2841983872
6725 2842078498
6726 2842118994
6727 2842130052
6728 2842133793
6729 2842155943
6730 2842174255
6731 2842179407
6732 2842190927
6733 2842204802
6734 2842215242
6735 2842217642
6736 2842228119
6737 2842239735
6738 2842265744
6739 2842285844
6740 2842292159
6741 2842301631
6742 2842316580
6743 2842361800
6744 2842372432
6745 2842378556
6746 2842385503
6747 2842403203
6748 2842409424
6749 2842416077
6750 2842428290
6751 2842429619
6752 2842436232
6753 2842442579
6754 2842453034
6755 2842464040
6756 2842470561
6757 2842481149
6758 2842507863
6759 2842513469
6760 2842520339
6761 2842522341
6762 2842713170
6763 2844006266
6764 2844014878
6765 2844104643
6766 2844166470
6767 2844539985
6768 2847675993
6769 2847692646
6770 2847936625
6771 2847946974
6772 2851185380
6773 2851247631
6774 2852395153
6775 2854902178
6776 2854917267
6777 2856314449
6778 2856325683
6779 2856342870
6780 2856352671
6781 2856360726
6782 2856370567
6783 2857350607
6784 2857520178
6785 2857527271
6786 2860340334
6787 2869164415
6788 2869238432
6789 2869263905
6790 2869279305
6791 2869291706
6792 2871434916
6793 2871451335
6794 2871466915
6795 2871480325
6796 2871495562
6797 2871502817
6798 2874103292
6799 2874111136
6800 2874130844
6801 2874145052
6802 2874149306
6803 2874157570
6804 2874174346
6805 2874608230
6806 2874619328
6807 2874622405
6808 2874632317
6809 2876365692
6810 2876375067
6811 2876394650
6812 2876415772
6813 2876769336
6814 2876813704
6815 2878040064
6816 2878734893
6817 2878745689
6818 2878752050
6819 2878757843
6820 2878766709
6821 2878773906
6822 2878788848
6823 2879088031
6824 2879108394
6825 2879112309
6826 2881152002
6827 2881155727
6828 2881167945
6829 2881672488
6830 2881856213
6831 2881868013
6832 2882458754
6833 2882637048
6834 2882913983
6835 2885266307
6836 2885309868
6837 2885316948
6838 2885318918
6839 2885330410
6840 2885340778
6841 2885344346
6842 2885352029
6843 2885370494
6844 2885376601
6845 2885417720
6846 2888339873
6847 2888347299
6848 2888356219
6849 2888424966
6850 2889011151
6851 2889017127
6852 2889039352
6853 2889792643
6854 2889918963
6855 2893071206
6856 2894237133
6857 2896391304
6858 2899793879
6859 2900582524
6860 2903455480
6861 2903493392
6862 2903506560
6863 2903517055
6864 2903523621
6865 2903534255
6866 2903547956
6867 2903751452
6868 2903770642
6869 2904554646
6870 2904581880
6871 2904625303
6872 2904661284
6873 2904671588
6874 2904697631
6875 2904701415
6876 2904715144
6877 2906314444
6878 2906327612
6879 2906329603
6880 2906381648
6881 2906414403
6882 2906627888
6883 2906638574
6884 2906646151
6885 2906666075
6886 2908757738
6887 2908780573
6888 2917555265
6889 2919078387
6890 2919118247
6891 2919123548
6892 2919414206
6893 2919455655
6894 2919700246
6895 2920761093
6896 2920825728
6897 2921653888
6898 2922133062
6899 2922158968
6900 2922187462
6901 2922374940
6902 2922391358
6903 2922394525
6904 2922428769
6905 2923153926
6906 2923558918
6907 2924725480
6908 2924731756
6909 2924760258
6910 2924766863
6911 2924783934
6912 2924784557
6913 2926758011
6914 2928162179
6915 2928166371
6916 2928173619
6917 2929621980
6918 2929629713
6919 2931399759
6920 2932788846
6921 2932794981
6922 2932805228
6923 2932812822
6924 2932819086
6925 2932830512
6926 2933010968
6927 2933016031
6928 2933017509
6929 2933583745
6930 2933605132
6931 2935616807
6932 2935635561
6933 2935641863
6934 2935655850
6935 2935664729
6936 2935672994
6937 2935683512
6938 2935685788
6939 2935697958
6940 2935705636
6941 2935714340
6942 2935724959
6943 2935732682
6944 2935742061
6945 2935751753
6946 2935765017
6947 2935769753
6948 2935778947
6949 2935786005
6950 2935794067
6951 2935802614
6952 2935813556
6953 2935830030
6954 2935837948
6955 2935855431
6956 2935867325
6957 2935875856
6958 2935887684
6959 2935897706
6960 2935963932
6961 2935981909
6962 2935988122
6963 2935996520
6964 2936003800
6965 2936019067
6966 2936027319
6967 2936036787
6968 2936042729
6969 2936054451
6970 2936063151
6971 2936380866
6972 2936386716
6973 2937816252
6974 2937824939
6975 2937837955
6976 2937843654
6977 2937855037
6978 2937877464
6979 2937892171
6980 2937975431
6981 2938001833
6982 2939641487
6983 2940557444
6984 2941504501
6985 2941509210
6986 2941517039
6987 2941524866
6988 2941539386
6989 2958035446
6990 2958043633
6991 2958069493
6992 2958072629
6993 2958084570
6994 2958103615
6995 2958118840
6996 2958136105
6997 2958150495
6998 2958171888
6999 2958185573
7000 2961083950
7001 2961116436
7002 2961129365
7003 2961170334
7004 2961174386
7005 2963648167
7006 2965025080
7007 2965066904
7008 2965124085
7009 2968000376
7010 2968003739
7011 2968018007
7012 2968090990
7013 2968094514
7014 2968100813
7015 2968112342
7016 2968121147
7017 2968132707
7018 2968141982
7019 2968178721
7020 2970471818
7021 2970506973
7022 2970512972
7023 2970530789
7024 2970542180
7025 2970561566
7026 2970593901
7027 2970620988
7028 2977822375
7029 2977832541
7030 2977846487
7031 2977861652
7032 2977865843
7033 2977929294
7034 2977947686
7035 2977976004
7036 2979710698
7037 2979743262
7038 2979812168
7039 2981995515
7040 2984292164
7041 2987637791
7042 2987657466
7043 2987666575
7044 2987668795
7045 2996315293
7046 2996347224
7047 2996350602
7048 2996890118
7049 2996896360
7050 3000140135
7051 3003935469
7052 3004169370
7053 3004195577
7054 3004205887
7055 3004211850
7056 3004219097
7057 3004237944
7058 3004277300
7059 3004293211
7060 3004341235
7061 3005415653
7062 3005421088
7063 3005450703
7064 3005478895
7065 3005484706
7066 3005587648
7067 3005599669
7068 637074160
7069 639648917
7070 641644056
7071 642416331
7072 643600092
7073 8001845519
7074 8002063831
7075 8002290279
7076 8003405010
7077 8003961723
7078 8004379354
7079 8004394567
7080 8004400779
7081 8004448451
7082 8004637315
7083 8004640293
7084 8004709742
7085 8004720707
7086 8005262161
7087 8005288114
7088 8005302854
7089 8005319177
7090 8005324645
7091 8005387421
7092 8005399999
7093 8005431612
7094 8005489478
7095 8005500633
7096 8005547271
7097 8005622010
7098 8005632512
7099 8005648010
7100 8005672052
7101 8005689940
7102 8006942442
7103 8006965328
7104 8006982169
7105 8006987831
7106 8006996758
7107 8016521776
7108 8016529187
7109 8016534398
7110 8016547623
7111 8016554518
7112 8016562889
7113 8016572739
7114 8016576896
7115 8016593327
7116 8016600660
7117 8016610073
7118 8016626117
7119 8017063872
7120 8018130214
7121 8018847489
7122 8019545301
7123 8019553210
7124 8019558205
7125 8019591030
7126 8019600311
7127 8019618230
7128 8019621342
7129 8019648353
7130 8019658981
7131 8019659694
7132 8019669255
7133 8019776912
7134 8021125027
7135 8024483154
7136 8024489223
7137 8046769075
7138 8054562263
7139 8055302617
7140 8055621356
7141 8055745855
7142 8055771285
7143 8056129063
7144 8056159412
7145 8056376928
7146 8056676983
7147 8056685512
7148 8057531954
7149 8057576436
7150 8057878710

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00510

COX3

Cytochrome c oxidase subunit III

44

266

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
6adq-assembly1.cif.gz_S respiratory complex ciii2civ2sod2 from mycobacterium smegmatis 0.8626 38 237
7e1v-assembly1.cif.gz_G cryo-em structure of apo hybrid respiratory supercomplex consisting of mycobacterium tuberculosis complexiii and mycobacterium smegmatis complexiv 0.8602 40 237
2yev-assembly2.cif.gz_A structure of caa3-type cytochrome oxidase 0.8542 42 239
8hcr-assembly1.cif.gz_S cryo-em structure of the mycobacterium tuberculosis cytochrome bcc:aa3 supercomplex and a novel inhibitor targeting subunit cytochrome ci 0.8411 34 237
7cub-assembly1.cif.gz_C 2.55-angstrom cryo-em structure of cytochrome bo3 from escherichia coli in native membrane 0.8327 38 238
ID Description Score Start End Superfamily
af_Q8BLK9_233_308_1.20.58.80 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.8686 98 192 1.20.58.80
af_Q2FZK1_13_198_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.8665 39 234 1.20.120.80
af_A0A0G2KB60_233_309_1.20.58.80 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.8633 98 192 1.20.58.80
af_P9WP67_20_203_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.861 34 234 1.20.120.80
2yevD03 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.8432 33 239 1.20.120.80
ID Description Score Start End GO Terms
AF-A0A382ZAH5-F1-model_v4 Heme-copper oxidase subunit III family profile domain-containing protein 0.9647 52 239 GO:0004129
GO:0005886
GO:0019646
AF-A0A2V7V7T6-F1-model_v4 Cytochrome oxidase subunit III 0.9601 69 195 GO:0004129
GO:0005886
GO:0019646
AF-A0A382PPP1-F1-model_v4 Heme-copper oxidase subunit III family profile domain-containing protein 0.9559 71 239 GO:0004129
GO:0005886
GO:0019646
AF-A0A529XLZ4-F1-model_v4 deleted 0.9554 89 239
AF-A0A3E0KQI7-F1-model_v4 Bb3-type cytochrome oxidase subunit IV 0.9533 42 238 GO:0004129
GO:0005886
GO:0019646

Map