F497348

General Info

Members Datasets Scaffolds Average Seq Length
3580 1804 2439 218

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2738543031|2739347265
Length 256
Sequence VNPIGLRLGINRTWDSRWFAGKTEYGALLHEDLAIRNFLFEELKAAAVAKVVIERPHKKCRVTIHSARPGVVIGKKGADIEKLRKLIAKFTTSEVHLNIVEVRKPETDATLIAASIAQQLERRVAFRRAMKRSVQSAMRLGAEGIRINAGGRLGGAEIARLEWYREGRVPLHTLRADIDYGIATAHTAYGTNGLKVWVFKGEILEHDPLASERRALEGGNDGERPGGDRRRERDPRNDREGRGRGRGRDRDTGGAH

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
3 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
4 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
5 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
6 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
7 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
8 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
9 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
10 2509276019 Ensifer aridi TW10 Isolate Nodule
11 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
12 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
13 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
14 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
15 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
16 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
17 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
18 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
19 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
20 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
21 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
22 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
23 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
24 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
25 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
26 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
27 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
28 2512875024 Mesorhizobium loti R88b Isolate Nodule
29 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
30 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
31 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
32 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
33 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
34 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
35 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
36 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
37 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
38 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
39 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
40 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
41 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
42 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
43 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
44 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
45 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
46 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
47 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
48 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
49 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
50 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
51 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
52 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
53 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
54 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
55 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
56 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
57 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
58 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
59 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
60 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
61 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
62 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
63 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
64 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
65 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
66 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
67 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
68 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
69 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
70 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
71 2516143018 Ensifer sp. BR816 Isolate Nodule
72 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
73 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
74 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
75 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
76 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
77 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
78 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
79 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
80 2519899620 Rhizobium sp. Pop5 Isolate Nodule
81 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
82 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
83 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
84 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
85 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
86 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
87 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
88 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
89 2534681786 Brucella suis 92/29 Isolate Unclassified
90 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
91 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
92 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
93 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
94 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
95 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
96 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
97 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
98 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
99 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
100 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
101 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
102 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
103 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
104 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
105 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
106 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
107 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
108 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
109 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
110 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
111 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
112 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
113 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
114 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
115 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
116 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
117 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
118 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
119 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
120 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
121 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
122 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
123 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
124 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
125 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
126 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
127 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
128 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
129 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
130 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
131 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
132 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
133 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
134 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
135 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
136 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
137 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
138 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
139 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
140 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
141 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
142 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
143 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
144 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
145 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
146 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
147 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
148 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
149 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
150 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
151 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
152 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
153 2643221557 Ensifer sp. Root558 Isolate Unclassified
154 2643221558 Rhizobium sp. Root149 Isolate Unclassified
155 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
156 2643221568 Rhizobium sp. Root564 Isolate Unclassified
157 2643221580 Devosia sp. Root635 Isolate Unclassified
158 2643221582 Rhizobium sp. Root651 Isolate Unclassified
159 2643221591 Devosia sp. Root685 Isolate Unclassified
160 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
161 2643221599 Rhizobium sp. Root708 Isolate Unclassified
162 2643221607 Rhizobium sp. Root73 Isolate Unclassified
163 2643221610 Ensifer sp. Root74 Isolate Unclassified
164 2643221618 Ensifer sp. Root231 Isolate Unclassified
165 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
166 2643221626 Ensifer sp. Root31 Isolate Unclassified
167 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
168 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
169 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
170 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
171 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
172 2643221651 Afipia sp. Root123D2 Isolate Unclassified
173 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
174 2643221655 Ensifer sp. Root1252 Isolate Unclassified
175 2643221659 Ensifer sp. Root127 Isolate Unclassified
176 2643221662 Devosia sp. Root413D1 Isolate Unclassified
177 2643221668 Ensifer sp. Root423 Isolate Unclassified
178 2643221674 Devosia sp. Root436 Isolate Unclassified
179 2643221675 Ensifer sp. Root1298 Isolate Unclassified
180 2643221680 Ensifer sp. Root1312 Isolate Unclassified
181 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
182 2643221688 Rhizobium sp. Root482 Isolate Unclassified
183 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
184 2643221693 Rhizobium sp. Root491 Isolate Unclassified
185 2643221698 Ensifer sp. Root142 Isolate Unclassified
186 2643221712 Ensifer sp. Root258 Isolate Unclassified
187 2643221718 Rhizobium sp. Root268 Isolate Unclassified
188 2643221719 Rhizobium sp. Root274 Isolate Unclassified
189 2643221723 Ensifer sp. Root278 Isolate Unclassified
190 2643221726 Ensifer sp. Root954 Isolate Unclassified
191 2643221733 Bosea sp. Root381 Isolate Unclassified
192 2643221734 Bosea sp. Root670 Isolate Unclassified
193 2643221736 Bosea sp. Root483D1 Isolate Unclassified
194 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
195 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
196 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
197 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
198 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
199 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
200 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
201 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
202 2718217882 Rhizobium sp. N741 Isolate Nodule
203 2718217927 Rhizobium sp. N324 Isolate Nodule
204 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
205 2718218009 Rhizobium sp. N561 Isolate Nodule
206 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
207 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
208 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
209 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
210 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
211 2718218363 Rhizobium sp. N113 Isolate Nodule
212 2718218365 Rhizobium sp. N731 Isolate Nodule
213 2718218366 Rhizobium sp. N621 Isolate Nodule
214 2718218423 Rhizobium sp. N941 Isolate Nodule
215 2721755514 Rhizobium sp. N6212 Isolate Nodule
216 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
217 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
218 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
219 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
220 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
221 2721755809 Rhizobium sp. N541 Isolate Nodule
222 2721755810 Rhizobium sp. N871 Isolate Nodule
223 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
224 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
225 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
226 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
227 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
228 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
229 2728369365 Rhizobium sp. N1341 Isolate Nodule
230 2728369397 Rhizobium sp. N1314 Isolate Nodule
231 2738541293 Rhizobium sp. GV031 Isolate Unclassified
232 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
233 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
234 2738543024 Aminobacter sp. AP02 Isolate Unclassified
235 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
236 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
237 2751185800 Brucella pituitosa AA2 Isolate Unclassified
238 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
239 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
240 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
241 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
242 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
243 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
244 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
245 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
246 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
247 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
248 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
249 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
250 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
251 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
252 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
253 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
254 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
255 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
256 2791355199
257 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
258 2791355256 Rhizobium sp. M10 Isolate Nodule
259 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
260 2791355260 Rhizobium sp. L9 Isolate Nodule
261 2791355261 Rhizobium sp. J15 Isolate Nodule
262 2791355262 Rhizobium sp. M1 Isolate Nodule
263 2791355263 Rhizobium chutanense C5 Isolate Nodule
264 2791355264 Rhizobium sp. S9 Isolate Nodule
265 2791355265 Rhizobium sp. H4 Isolate Nodule
266 2791355266 Rhizobium sp. L43 Isolate Nodule
267 2791355267 Rhizobium sp. L18 Isolate Nodule
268 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
269 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
270 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
271 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
272 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
273 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
274 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
275 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
276 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
277 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
278 2802429633 Rhizobium anhuiense J3 Isolate Nodule
279 2802429634 Rhizobium anhuiense S10 Isolate Nodule
280 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
281 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
282 2802429637 Rhizobium anhuiense C15 Isolate Nodule
283 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
284 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
285 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
286 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
287 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
288 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
289 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
290 2818991467 Bosea vestrisii 3192 Isolate Unclassified
291 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
292 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
293 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
294 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
295 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
296 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
297 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
298 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
299 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
300 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
301 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
302 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
303 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
304 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
305 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
306 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
307 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
308 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
309 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
310 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
311 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
312 2834578030 Paracoccus thiocyanatus SST Isolate Unclassified
313 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
314 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
315 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
316 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
317 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
318 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
319 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
320 2838048938 Rhizobium pisi 27/80 Isolate Nodule
321 2838061910 Rhizobium phaseoli L15 Isolate Nodule
322 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
323 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
324 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
325 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
326 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
327 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
328 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
329 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
330 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
331 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
332 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
333 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
334 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
335 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
336 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
337 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
338 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
339 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
340 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
341 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
342 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
343 2841760612 Bosea sp. Tri-49 Isolate Nodule
344 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
345 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
346 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
347 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
348 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
349 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
350 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
351 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
352 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
353 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
354 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
355 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
356 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
357 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
358 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
359 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
360 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
361 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
362 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
363 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
364 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
365 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
366 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
367 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
368 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
369 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
370 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
371 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
372 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
373 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
374 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
375 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
376 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
377 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
378 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
379 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
380 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
381 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
382 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
383 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
384 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
385 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
386 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
387 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
388 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
389 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
390 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
391 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
392 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
393 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
394 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
395 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
396 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
397 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
398 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
399 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
400 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
401 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
402 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
403 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
404 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
405 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
406 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
407 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
408 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
409 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
410 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
411 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
412 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
413 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
414 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
415 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
416 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
417 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
418 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
419 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
420 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
421 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
422 2844104063 Bosea sp. Tri-39 Isolate Nodule
423 2844163670 Ensifer sp. 1H6 Isolate Unclassified
424 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
425 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
426 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
427 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
428 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
429 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
430 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
431 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
432 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
433 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
434 2851182111 Bosea sp. Tri-44 Isolate Nodule
435 2851246043 Bosea sp. Tri-54 Isolate Nodule
436 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
437 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
438 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
439 2854911287 Brucella lupini LUP21 Isolate Unclassified
440 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
441 2855020534 Paracoccus endophyticus SYSUP0003 Isolate Stem Tuber
442 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
443 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
444 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
445 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
446 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
447 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
448 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
449 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
450 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
451 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
452 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
453 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
454 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
455 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
456 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
457 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
458 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
459 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
460 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
461 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
462 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
463 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
464 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
465 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
466 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
467 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
468 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
469 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
470 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
471 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
472 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
473 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
474 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
475 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
476 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
477 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
478 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
479 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
480 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
481 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
482 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
483 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
484 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
485 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
486 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
487 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
488 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
489 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
490 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
491 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
492 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
493 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
494 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
495 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
496 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
497 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
498 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
499 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
500 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
501 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
502 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
503 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
504 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
505 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
506 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
507 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
508 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
509 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
510 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
511 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
512 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
513 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
514 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
515 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
516 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
517 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
518 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
519 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
520 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
521 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
522 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
523 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
524 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
525 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
526 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
527 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
528 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
529 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
530 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
531 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
532 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
533 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
534 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
535 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
536 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
537 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
538 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
539 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
540 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
541 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
542 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
543 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
544 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
545 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
546 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
547 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
548 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
549 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
550 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
551 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
552 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
553 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
554 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
555 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
556 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
557 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
558 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
559 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
560 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
561 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
562 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
563 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
564 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
565 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
566 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
567 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
568 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
569 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
570 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
571 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
572 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
573 2904699407
574 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
575 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
576 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
577 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
578 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
579 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
580 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
581 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
582 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
583 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
584 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
585 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
586 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
587 2906610324
588 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
589 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
590 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
591 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
592 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
593 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
594 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
595 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
596 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
597 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
598 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
599 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
600 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
601 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
602 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
603 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
604 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
605 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
606 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
607 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
608 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
609 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
610 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
611 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
612 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
613 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
614 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
615 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
616 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
617 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
618 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
619 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
620 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
621 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
622 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
623 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
624 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
625 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
626 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
627 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
628 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
629 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
630 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
631 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
632 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
633 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
634 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
635 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
636 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
637 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
638 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
639 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
640 2922368715
641 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
642 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
643 2922425934
644 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
645 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
646 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
647 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
648 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
649 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
650 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
651 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
652 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
653 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
654 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
655 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
656 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
657 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
658 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
659 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
660 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
661 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
662 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
663 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
664 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
665 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
666 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
667 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
668 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
669 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
670 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
671 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
672 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
673 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
674 2932401849 Devosia sp. 2618 Isolate Rhizosphere
675 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
676 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
677 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
678 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
679 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
680 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
681 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
682 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
683 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
684 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
685 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
686 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
687 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
688 2933599457 Rhizobium phaseoli M3 Isolate Nodule
689 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
690 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
691 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
692 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
693 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
694 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
695 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
696 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
697 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
698 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
699 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
700 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
701 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
702 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
703 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
704 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
705 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
706 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
707 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
708 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
709 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
710 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
711 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
712 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
713 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
714 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
715 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
716 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
717 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
718 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
719 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
720 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
721 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
722 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
723 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
724 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
725 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
726 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
727 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
728 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
729 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
730 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
731 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
732 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
733 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
734 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
735 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
736 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
737 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
738 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
739 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
740 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
741 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
742 2936381700 Rhizobium chutanense C16 Isolate Unclassified
743 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
744 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
745 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
746 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
747 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
748 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
749 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
750 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
751 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
752 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
753 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
754 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
755 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
756 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
757 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
758 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
759 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
760 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
761 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
762 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
763 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
764 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
765 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
766 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
767 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
768 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
769 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
770 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
771 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
772 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
773 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
774 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
775 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
776 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
777 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
778 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
779 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
780 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
781 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
782 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
783 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
784 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
785 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
786 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
787 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
788 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
789 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
790 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
791 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
792 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
793 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
794 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
795 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
796 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
797 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
798 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
799 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
800 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
801 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
802 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
803 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
804 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
805 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
806 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
807 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
808 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
809 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
810 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
811 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
812 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
813 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
814 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
815 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
816 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
817 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
818 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
819 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
820 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
821 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
822 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
823 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
824 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
825 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
826 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
827 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
828 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
829 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
830 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
831 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
832 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
833 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
834 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
835 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
836 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
837 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
838 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
839 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
840 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
841 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
842 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
843 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
844 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
845 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
846 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
847 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
848 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
849 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
850 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
851 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
852 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
853 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
854 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
855 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
856 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
857 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
858 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
859 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
860 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
861 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
862 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
863 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
864 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
865 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
866 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
867 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
868 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
869 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
870 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
871 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
872 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
873 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
874 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
875 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
876 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
877 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
878 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
879 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
880 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
881 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
882 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
883 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
884 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
885 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
886 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
887 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
888 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
889 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
890 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
891 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
892 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
893 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
894 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
895 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
896 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
897 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
898 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
899 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
900 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
901 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
902 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
903 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
904 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
905 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
906 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
907 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
908 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
909 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
910 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
911 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
912 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
913 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
914 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
915 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
916 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
917 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
918 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
919 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
920 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
921 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
922 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
923 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
924 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
925 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
926 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
927 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
928 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
929 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
930 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
931 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
932 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
933 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
934 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
935 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
936 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
937 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
938 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
939 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
940 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
941 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
942 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
943 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
944 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
945 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
946 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
947 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
948 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
949 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
950 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
951 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
952 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
953 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
954 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
955 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
956 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
957 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
958 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
959 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
960 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
961 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
962 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
963 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
964 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
965 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
966 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
967 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
968 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
969 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
970 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
971 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
972 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
973 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
974 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
975 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
976 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
977 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
978 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
979 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
980 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
981 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
982 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
983 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
984 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
985 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
986 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
987 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
988 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
989 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
990 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
991 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
992 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
993 2996887358 Rhizobium sp. R711 Isolate Nodule
994 2996893221 Rhizobium sp. R635 Isolate Nodule
995 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere
996 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
997 3000405567 Rhodobacteraceae bacterium LNNU 3342 Isolate Rhizosphere
998 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
999 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
1000 3004167301 Mesorhizobium loti 582 Isolate Unclassified
1001 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
1002 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
1003 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
1004 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
1005 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
1006 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
1007 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
1008 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
1009 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
1010 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
1011 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
1012 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
1013 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
1014 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
1015 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
1016 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
1017 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
1018 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
1019 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
1020 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
1021 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
1022 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
1023 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
1024 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
1025 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
1026 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
1027 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
1028 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
1029 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
1030 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
1031 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
1032 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
1033 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
1034 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
1035 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
1036 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
1037 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
1038 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
1039 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
1040 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
1041 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
1042 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
1043 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
1044 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
1045 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
1046 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
1047 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
1048 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
1049 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
1050 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
1051 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
1052 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
1053 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
1054 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
1055 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
1056 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
1057 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
1058 3300003300 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
1059 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
1060 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
1061 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
1062 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
1063 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
1064 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1065 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
1066 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
1067 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
1068 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
1069 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
1070 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
1071 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
1072 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
1073 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
1074 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
1075 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
1076 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
1077 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
1078 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
1079 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
1080 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
1081 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
1082 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
1083 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
1084 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
1085 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
1086 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
1087 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
1088 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
1089 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
1090 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
1091 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
1092 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
1093 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
1094 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
1095 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
1096 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
1097 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
1098 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
1099 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
1100 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
1101 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
1102 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
1103 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
1104 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
1105 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
1106 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
1107 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
1108 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
1109 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
1110 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
1111 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
1112 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
1113 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
1114 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
1115 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
1116 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
1117 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
1118 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
1119 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
1120 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
1121 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
1122 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
1123 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
1124 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
1125 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
1126 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
1127 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
1128 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
1129 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
1130 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
1131 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
1132 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
1133 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
1134 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
1135 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
1136 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
1137 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
1138 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
1139 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
1140 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
1141 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
1142 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
1143 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
1144 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
1145 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
1146 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
1147 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
1148 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
1149 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
1150 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
1151 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
1152 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
1153 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
1154 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
1155 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
1156 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
1157 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
1158 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
1159 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
1160 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
1161 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
1162 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
1163 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
1164 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
1165 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
1166 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
1167 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
1168 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
1169 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
1170 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
1171 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
1172 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
1173 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
1174 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
1175 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
1176 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
1177 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
1178 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
1179 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
1180 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
1181 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
1182 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
1183 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
1184 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
1185 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
1186 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
1187 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
1188 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
1189 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
1190 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
1191 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
1192 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
1193 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
1194 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
1195 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
1196 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
1197 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
1198 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
1199 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
1200 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
1201 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
1202 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
1203 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
1204 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
1205 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
1206 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
1207 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
1208 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
1209 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
1210 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
1211 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
1212 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
1213 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
1214 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
1215 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
1216 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
1217 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
1218 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
1219 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
1220 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
1221 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
1222 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
1223 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
1224 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
1225 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
1226 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
1227 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
1228 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
1229 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
1230 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
1231 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
1232 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
1233 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
1234 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
1235 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
1236 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
1237 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
1238 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
1239 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
1240 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
1241 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
1242 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
1243 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
1244 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
1245 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
1246 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
1247 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
1248 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
1249 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
1250 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
1251 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
1252 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
1253 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
1254 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
1255 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
1256 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
1257 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1258 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1259 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1260 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1261 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
1262 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1263 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
1264 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1265 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
1266 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1267 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1268 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1269 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
1270 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1271 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1272 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
1273 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1274 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1275 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1276 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1277 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
1278 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
1279 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1280 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1281 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
1282 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1283 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1284 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1285 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1286 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1287 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1288 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1289 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1290 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1291 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1292 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1293 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1294 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1295 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
1296 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1297 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
1298 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1299 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1300 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1301 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
1302 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
1303 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1304 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
1305 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1306 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1307 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1308 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
1309 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1310 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
1311 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
1312 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
1313 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1314 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1315 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
1316 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
1317 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
1318 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
1319 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
1320 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
1321 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1322 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
1323 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
1324 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
1325 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
1326 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
1327 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
1328 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
1329 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
1330 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
1331 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
1332 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
1333 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
1334 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
1335 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
1336 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
1337 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1338 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
1339 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
1340 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
1341 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
1342 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
1343 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
1344 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
1345 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
1346 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
1347 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
1348 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
1349 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
1350 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
1351 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
1352 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
1353 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
1354 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
1355 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
1356 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
1357 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
1358 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
1359 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
1360 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
1361 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
1362 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
1363 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
1364 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
1365 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
1366 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
1367 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
1368 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
1369 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
1370 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
1371 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
1372 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
1373 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
1374 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
1375 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
1376 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
1377 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
1378 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1379 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
1380 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
1381 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1382 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1383 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1384 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1385 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
1386 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
1387 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
1388 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
1389 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
1390 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
1391 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
1392 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
1393 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
1394 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
1395 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
1396 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
1397 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
1398 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
1399 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
1400 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
1401 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
1402 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
1403 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
1404 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
1405 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
1406 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
1407 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
1408 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
1409 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
1410 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
1411 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
1412 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
1413 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
1414 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
1415 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
1416 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
1417 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
1418 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
1419 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
1420 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
1421 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
1422 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
1423 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
1424 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
1425 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
1426 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
1427 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
1428 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
1429 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
1430 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
1431 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
1432 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
1433 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
1434 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
1435 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
1436 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
1437 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
1438 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
1439 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
1440 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
1441 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
1442 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
1443 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
1444 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
1445 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
1446 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
1447 3300041446 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT Metatranscriptome Rhizoplane
1448 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
1449 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
1450 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
1451 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
1452 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
1453 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
1454 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
1455 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
1456 3300041504 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaT Metatranscriptome Unclassified
1457 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
1458 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
1459 3300041510 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT Metatranscriptome Unclassified
1460 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
1461 3300041916 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run Metatranscriptome Unclassified
1462 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
1463 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
1464 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
1465 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
1466 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
1467 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
1468 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
1469 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
1470 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
1471 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
1472 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
1473 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
1474 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
1475 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
1476 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
1477 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
1478 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
1479 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
1480 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
1481 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
1482 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
1483 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
1484 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
1485 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
1486 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
1487 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
1488 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
1489 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
1490 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
1491 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
1492 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
1493 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
1494 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
1495 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
1496 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
1497 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
1498 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
1499 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
1500 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
1501 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
1502 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
1503 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
1504 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
1505 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
1506 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
1507 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
1508 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
1509 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
1510 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
1511 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
1512 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
1513 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
1514 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
1515 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
1516 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
1517 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
1518 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
1519 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
1520 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
1521 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
1522 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
1523 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
1524 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
1525 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
1526 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
1527 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
1528 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
1529 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
1530 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
1531 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
1532 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
1533 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
1534 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
1535 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
1536 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
1537 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
1538 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
1539 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
1540 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
1541 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
1542 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
1543 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
1544 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
1545 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
1546 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
1547 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
1548 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
1549 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
1550 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
1551 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
1552 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
1553 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
1554 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
1555 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
1556 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
1557 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
1558 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
1559 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
1560 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
1561 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
1562 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
1563 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
1564 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
1565 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
1566 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
1567 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
1568 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
1569 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
1570 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
1571 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
1572 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
1573 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
1574 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
1575 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
1576 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
1577 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
1578 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
1579 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
1580 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1581 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1582 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1583 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
1584 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1585 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1586 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1587 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1588 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1589 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
1590 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
1591 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
1592 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
1593 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
1594 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
1595 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
1596 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
1597 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
1598 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
1599 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
1600 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
1601 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
1602 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
1603 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
1604 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
1605 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
1606 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
1607 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
1608 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
1609 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
1610 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
1611 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
1612 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
1613 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
1614 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
1615 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
1616 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
1617 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
1618 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
1619 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
1620 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
1621 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
1622 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
1623 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
1624 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
1625 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
1626 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
1627 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
1628 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
1629 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
1630 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
1631 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
1632 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
1633 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
1634 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
1635 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
1636 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
1637 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
1638 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
1639 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
1640 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
1641 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
1642 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
1643 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
1644 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
1645 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
1646 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
1647 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
1648 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
1649 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
1650 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
1651 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
1652 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
1653 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
1654 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
1655 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
1656 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
1657 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
1658 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
1659 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
1660 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
1661 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
1662 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
1663 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
1664 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
1665 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
1666 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
1667 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1668 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1669 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1670 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1671 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1672 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1673 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1674 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1675 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1676 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1677 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1678 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1679 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1680 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1681 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1682 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1683 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1684 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1685 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1686 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
1687 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
1688 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
1689 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
1690 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
1691 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
1692 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
1693 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
1694 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
1695 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
1696 8002060224 Methylocystis sp. Sn-Cys Isolate Unclassified
1697 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
1698 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
1699 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
1700 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
1701 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
1702 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
1703 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
1704 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
1705 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
1706 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
1707 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
1708 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
1709 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
1710 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
1711 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
1712 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
1713 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
1714 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
1715 8005258706 Rhizobium sp. R693 Isolate Nodule
1716 8005275841 Rhizobium sp. N4311 Isolate Nodule
1717 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
1718 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
1719 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
1720 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
1721 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
1722 8005321885 Rhizobium sp. R72 Isolate Nodule
1723 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
1724 8005382845 Rhizobium sp. R634 Isolate Nodule
1725 8005395548 Rhizobium sp. R339 Isolate Nodule
1726 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
1727 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
1728 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
1729 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
1730 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
1731 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
1732 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
1733 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
1734 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
1735 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
1736 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
1737 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
1738 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
1739 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
1740 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
1741 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
1742 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
1743 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
1744 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
1745 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
1746 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
1747 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
1748 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
1749 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
1750 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
1751 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
1752 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
1753 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
1754 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
1755 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
1756 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
1757 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
1758 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
1759 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
1760 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
1761 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
1762 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
1763 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
1764 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
1765 8018176218 Rhizobium sp. N122 Isolate Nodule
1766 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
1767 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
1768 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
1769 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
1770 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
1771 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
1772 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
1773 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
1774 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
1775 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
1776 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
1777 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
1778 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
1779 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
1780 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
1781 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
1782 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
1783 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
1784 8024501048 Rhizobium sp. H4 Isolate Nodule
1785 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
1786 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
1787 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
1788 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
1789 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
1790 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
1791 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
1792 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
1793 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
1794 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
1795 8056382006 Rhizobium croatiense 13T Isolate Nodule
1796 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
1797 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
1798 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
1799 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
1800 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule
1801 8057132660 Paracoccus rhizosphaerae LMG 21293 Isolate Rhizosphere
1802 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule
1803 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
1804 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 66.46
Metatranscriptomes 1.76
Isolates 31.78

Biome Distribution

Category Percentage (%)
Aerial Root 0.14
Bulb 0
Endosphere 6.15
Nodule 23.6
Rhizoplane 3.55
Rhizosphere 57.51
Stem 0
Stem Tuber 0.03
Unclassified 9.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214600497 2209111006 Bacteria 5417
2 ARcpr5oldR_c000035 3300000041 Bacteria 26838
3 ARSoilYngRDRAFT_c00061 3300000042 Bacteria 17682
4 ARcpr5yngRDRAFT_c000075 3300000043 Bacteria 16570
5 ARSoilOldRDRAFT_c000053 3300000044 Bacteria 23841
6 ARCol0oldRDRAFT_c01419 3300000045 Bacteria 1573
7 ARCol0yngRDRAFT_1000025 3300000652 Bacteria 26845
8 JGI24746J21847_1000313 3300001977 Bacteria 6996
9 JGI24746J21847_1003445 3300001977 Bacteria 2490
10 JGI24747J21853_1000061 3300001978 Bacteria 4381
11 JGI24740J21852_10003174 3300001979 Bacteria 7258
12 JGI24740J21852_10023908 3300001979 Bacteria 2079
13 JGI24739J22299_10001271 3300001989 Bacteria 9474
14 JGI24739J22299_10033386 3300001989 Bacteria 1761
15 JGI24737J22298_10002957 3300001990 Bacteria 6024
16 JGI24735J21928_10031068 3300002067 Bacteria 1584
17 JGI24750J21931_1001646 3300002070 Bacteria 2741
18 JGI24750J21931_1003325 3300002070 Bacteria 1927
19 JGI24745J21846_1000034 3300002073 Bacteria 9049
20 JGI24748J21848_1002374 3300002074 Bacteria 2124
21 JGI24738J21930_10001067 3300002075 Bacteria 7782
22 JGI24749J21850_1002276 3300002076 Bacteria 2701
23 JGI24749J21850_1022172 3300002076 Bacteria 900
24 JGI24744J21845_10000241 3300002077 Bacteria 8837
25 JGI24744J21845_10010859 3300002077 Bacteria 1864
26 JGI24035J26624_1000089 3300002126 Bacteria 7679
27 JGI24035J26624_1000142 3300002126 Bacteria 6397
28 JGI24033J26618_1001337 3300002155 Bacteria 2436
29 JGI24034J26672_10000419 3300002239 Bacteria 5507
30 JGI24034J26672_10004985 3300002239 Bacteria 1894
31 JGI24751J29686_10003449 3300002459 Bacteria 3183
32 JGI25155J39150_1000061 3300002704 Bacteria 71144
33 JGI25156J39149_1002868 3300002705 Bacteria 5905
34 JGI25154J39366_1002032 3300002738 Bacteria 5822
35 JGI25158J39367_1000460 3300002739 Bacteria 8345
36 JGI25157J39369_1000106 3300002741 Bacteria 71144
37 JGI25152J39213_1007293 3300002773 Bacteria 2882
38 JGI25152J39213_1011184 3300002773 Bacteria 1998
39 JGI25150J39212_1004887 3300002774 Bacteria 2921
40 JGI25150J39212_1023476 3300002774 Bacteria 916
41 JGI25159J45721_1002997 3300002987 Bacteria 6137
42 JGI25159J45721_1003109 3300002987 Bacteria 5991
43 JGI25159J45721_1003302 3300002987 Bacteria 5767
44 JGI25159J45721_1003394 3300002987 Bacteria 5647
45 JGI25151J46595_10000038 3300003187 Bacteria 180430
46 JGI25151J46595_10019741 3300003187 Bacteria 2855
47 JGI25151J46595_10026766 3300003187 Bacteria 2322
48 JGI25151J46595_10048471 3300003187 Bacteria 1467
49 JGI25406J46586_10001918 3300003203 Bacteria 9806
50 JGI25165J46597_1001315 3300003214 Bacteria 14050
51 JGI25165J46597_1009422 3300003214 Bacteria 1471
52 JGI25153J46596_10000830 3300003215 Bacteria 18874
53 JGI25153J46596_10008996 3300003215 Bacteria 4702
54 JGI25153J46596_10017054 3300003215 Bacteria 2878
55 Ga0006758J48902_1009309 3300003300 Bacteria 6323
56 JGI25160J50197_1004536 3300003354 Bacteria 5991
57 JGI25160J50197_1004964 3300003354 Bacteria 5647
58 JGI25160J50197_1007159 3300003354 Bacteria 4397
59 JGI25160J50197_1008863 3300003354 Bacteria 3785
60 JGI26145J50221_1008735 3300003371 Bacteria 873
61 JGI25161J50226_1001962 3300003374 Bacteria 5647
62 JGI25161J50226_1004961 3300003374 Bacteria 2691
63 Ga0006562J51391_1011078 3300003578 Bacteria 6635
64 JGI25404J52841_10000285 3300003659 Bacteria 6540
65 Ga0032354_1024703 3300003693 Bacteria 11216
66 Ga0055526_1003723 3300003771 Bacteria 9520
67 Ga0055526_1038833 3300003771 Bacteria 1221
68 Ga0055524_1009499 3300003775 Bacteria 3949
69 Ga0055524_1034597 3300003775 Bacteria 1394
70 Ga0055536_1005568 3300003781 Bacteria 6116
71 Ga0055536_1005747 3300003781 Bacteria 5976
72 Ga0055528_1027652 3300003790 Bacteria 1588
73 Ga0055530_10011178 3300003791 Bacteria 3246
74 Ga0055530_10039824 3300003791 Bacteria 1158
75 Ga0055540_1004924 3300003792 Bacteria 5819
76 Ga0055540_1009828 3300003792 Bacteria 3247
77 Ga0055540_1010479 3300003792 Bacteria 3082
78 Ga0055540_1013480 3300003792 Bacteria 2494
79 Ga0055540_1015732 3300003792 Bacteria 2185
80 Ga0055531_10006856 3300003794 Bacteria 6350
81 Ga0055531_10008090 3300003794 Bacteria 5609
82 Ga0055531_10021596 3300003794 Bacteria 2490
83 Ga0055531_10035388 3300003794 Bacteria 1563
84 Ga0058692_1004593 3300003856 Bacteria 4069
85 Ga0055543_1000856 3300004625 Bacteria 14666
86 Ga0055543_1000880 3300004625 Bacteria 14315
87 Ga0055543_1006650 3300004625 Bacteria 2761
88 Ga0055543_1006890 3300004625 Bacteria 2689
89 Ga0065165_1000631 3300005262 Bacteria 51108
90 Ga0065165_1002620 3300005262 Bacteria 14666
91 Ga0065165_1002688 3300005262 Bacteria 14315
92 Ga0065165_1007230 3300005262 Bacteria 5526
93 Ga0065165_1017228 3300005262 Bacteria 2671
94 Ga0065165_1023746 3300005262 Bacteria 2072
95 Ga0065716_1004957 3300005277 Bacteria 933
96 Ga0065704_10105469 3300005289 Bacteria 2110
97 Ga0065704_10137584 3300005289 Bacteria 1553
98 Ga0065712_10032322 3300005290 Bacteria 1174
99 Ga0065712_10073769 3300005290 Bacteria 4278
100 Ga0065712_10086308 3300005290 Bacteria 2644
101 Ga0065712_10174400 3300005290 Bacteria 1226
102 Ga0065715_10002813 3300005293 Bacteria 5934
103 Ga0065715_10006156 3300005293 Bacteria 3537
104 Ga0065707_10256958 3300005295 Bacteria 1108
105 Ga0070658_10021396 3300005327 Bacteria 5184
106 Ga0070658_10076960 3300005327 Bacteria 2737
107 Ga0070658_10246106 3300005327 Bacteria 1516
108 Ga0070658_10474194 3300005327 Bacteria 1079
109 Ga0070658_10546941 3300005327 Bacteria 1002
110 Ga0070676_10001242 3300005328 Bacteria 12829
111 Ga0070676_10033602 3300005328 Bacteria 2942
112 Ga0070676_10061261 3300005328 Bacteria 2236
113 Ga0070683_100002064 3300005329 Bacteria 15853
114 Ga0070683_100014681 3300005329 Bacteria 6861
115 Ga0070683_100023089 3300005329 Bacteria 5563
116 Ga0070683_100084181 3300005329 Bacteria 2980
117 Ga0070690_100007778 3300005330 Bacteria 6144
118 Ga0070690_100023262 3300005330 Bacteria 3799
119 Ga0070690_100032710 3300005330 Bacteria 3250
120 Ga0070690_100209294 3300005330 Bacteria 1361
121 Ga0070690_100222909 3300005330 Bacteria 1322
122 Ga0070670_100000376 3300005331 Bacteria 37212
123 Ga0070670_100003237 3300005331 Bacteria 13450
124 Ga0070670_100006103 3300005331 Bacteria 10185
125 Ga0070670_100043548 3300005331 Bacteria 3858
126 Ga0070670_100221823 3300005331 Bacteria 1645
127 Ga0070677_10003234 3300005333 Bacteria 5245
128 Ga0068869_100000755 3300005334 Bacteria 18338
129 Ga0068869_100289812 3300005334 Bacteria 1319
130 Ga0068869_100526918 3300005334 Bacteria 990
131 Ga0070666_10004644 3300005335 Bacteria 8386
132 Ga0070666_10039473 3300005335 Bacteria 3147
133 Ga0070680_100002998 3300005336 Bacteria 12534
134 Ga0070680_100008294 3300005336 Bacteria 7948
135 Ga0070680_100024678 3300005336 Bacteria 4805
136 Ga0070680_100125958 3300005336 Bacteria 2140
137 Ga0070680_100214999 3300005336 Bacteria 1622
138 Ga0070680_100492483 3300005336 Bacteria 1048
139 Ga0070682_100000693 3300005337 Bacteria 20306
140 Ga0070682_100002069 3300005337 Bacteria 11170
141 Ga0070682_100008998 3300005337 Bacteria 5643
142 Ga0070682_100009331 3300005337 Bacteria 5553
143 Ga0070682_100353338 3300005337 Bacteria 1096
144 Ga0068868_100011054 3300005338 Bacteria 6563
145 Ga0068868_100026839 3300005338 Bacteria 4391
146 Ga0068868_100131481 3300005338 Bacteria 2048
147 Ga0070660_100000686 3300005339 Bacteria 22383
148 Ga0070660_100020152 3300005339 Bacteria 4897
149 Ga0070660_100051230 3300005339 Bacteria 3178
150 Ga0070660_100103046 3300005339 Bacteria 2263
151 Ga0070660_100106441 3300005339 Bacteria 2227
152 Ga0070689_100000122 3300005340 Bacteria 44668
153 Ga0070689_100018438 3300005340 Bacteria 5141
154 Ga0070689_100041149 3300005340 Bacteria 3546
155 Ga0070689_100060425 3300005340 Bacteria 2947
156 Ga0070689_100062210 3300005340 Bacteria 2904
157 Ga0070689_100107242 3300005340 Bacteria 2217
158 Ga0070691_10000273 3300005341 Bacteria 18063
159 Ga0070691_10000386 3300005341 Bacteria 16019
160 Ga0070691_10007803 3300005341 Bacteria 4900
161 Ga0070691_10020829 3300005341 Bacteria 3031
162 Ga0070687_100000768 3300005343 Bacteria 10675
163 Ga0070687_100251803 3300005343 Bacteria 1098
164 Ga0070687_100271210 3300005343 Bacteria 1064
165 Ga0070661_100000385 3300005344 Bacteria 34633
166 Ga0070661_100005946 3300005344 Bacteria 8403
167 Ga0070661_100006236 3300005344 Bacteria 8222
168 Ga0070661_100049078 3300005344 Bacteria 3090
169 Ga0070661_100087287 3300005344 Bacteria 2307
170 Ga0070661_100149567 3300005344 Bacteria 1764
171 Ga0070661_100163613 3300005344 Bacteria 1686
172 Ga0070661_100249255 3300005344 Bacteria 1370
173 Ga0070661_100504705 3300005344 Bacteria 968
174 Ga0070692_10011527 3300005345 Bacteria 4062
175 Ga0070668_100002043 3300005347 Bacteria 14764
176 Ga0070668_100032428 3300005347 Bacteria 3975
177 Ga0070668_100120669 3300005347 Bacteria 2095
178 Ga0070668_100169909 3300005347 Bacteria 1774
179 Ga0070668_100406048 3300005347 Bacteria 1164
180 Ga0070669_100002082 3300005353 Bacteria 14453
181 Ga0070669_100004204 3300005353 Bacteria 10419
182 Ga0070669_100013136 3300005353 Bacteria 5885
183 Ga0070669_100136297 3300005353 Bacteria 1888
184 Ga0070675_100004033 3300005354 Bacteria 11145
185 Ga0070675_100016237 3300005354 Bacteria 5907
186 Ga0070675_100086075 3300005354 Bacteria 2626
187 Ga0070675_100265261 3300005354 Bacteria 1506
188 Ga0070675_100484270 3300005354 Bacteria 1113
189 Ga0070671_100001283 3300005355 Bacteria 18858
190 Ga0070671_100028610 3300005355 Bacteria 4590
191 Ga0070671_100070233 3300005355 Bacteria 2921
192 Ga0070671_100122166 3300005355 Bacteria 2192
193 Ga0070671_100129708 3300005355 Bacteria 2123
194 Ga0070671_100380986 3300005355 Bacteria 1205
195 Ga0070674_100000649 3300005356 Bacteria 17518
196 Ga0070674_100001294 3300005356 Bacteria 13164
197 Ga0070674_100065137 3300005356 Bacteria 2556
198 Ga0070674_100069691 3300005356 Bacteria 2481
199 Ga0070674_100106879 3300005356 Bacteria 2048
200 Ga0070673_100002163 3300005364 Bacteria 11899
201 Ga0070673_100002364 3300005364 Bacteria 11471
202 Ga0070673_100038437 3300005364 Bacteria 3655
203 Ga0070673_100113453 3300005364 Bacteria 2251
204 Ga0070673_100356387 3300005364 Bacteria 1299
205 Ga0070688_100000217 3300005365 Bacteria 30556
206 Ga0070688_100007596 3300005365 Bacteria 5852
207 Ga0070688_100012304 3300005365 Bacteria 4790
208 Ga0070688_100019070 3300005365 Bacteria 3970
209 Ga0070688_100029336 3300005365 Bacteria 3294
210 Ga0070688_100086886 3300005365 Bacteria 2036
211 Ga0070659_100003485 3300005366 Bacteria 11201
212 Ga0070659_100005048 3300005366 Bacteria 9461
213 Ga0070659_100037037 3300005366 Bacteria 3803
214 Ga0070659_100058933 3300005366 Bacteria 3031
215 Ga0070659_100156142 3300005366 Bacteria 1863
216 Ga0070659_100173078 3300005366 Bacteria 1769
217 Ga0070659_100248237 3300005366 Bacteria 1474
218 Ga0070659_100794602 3300005366 Bacteria 823
219 Ga0070667_100003614 3300005367 Bacteria 13156
220 Ga0070667_100010781 3300005367 Bacteria 7552
221 Ga0070667_100072538 3300005367 Bacteria 2934
222 Ga0070667_100221474 3300005367 Bacteria 1684
223 Ga0070667_100259816 3300005367 Bacteria 1554
224 Ga0070709_10001353 3300005434 Bacteria 13379
225 Ga0070709_10003511 3300005434 Bacteria 8423
226 Ga0070709_10010455 3300005434 Bacteria 5143
227 Ga0070709_10023639 3300005434 Bacteria 3613
228 Ga0070709_10029058 3300005434 Bacteria 3303
229 Ga0070709_10029946 3300005434 Bacteria 3261
230 Ga0070709_10095361 3300005434 Bacteria 1970
231 Ga0070714_100006925 3300005435 Bacteria 8788
232 Ga0070714_100027595 3300005435 Bacteria 4703
233 Ga0070714_100063995 3300005435 Bacteria 3165
234 Ga0070714_100065873 3300005435 Bacteria 3121
235 Ga0070714_100152013 3300005435 Bacteria 2087
236 Ga0070714_100180397 3300005435 Bacteria 1921
237 Ga0070713_100000012 3300005436 Bacteria 137708
238 Ga0070713_100001694 3300005436 Bacteria 14164
239 Ga0070713_100046417 3300005436 Bacteria 3564
240 Ga0070713_100056910 3300005436 Bacteria 3253
241 Ga0070710_10005298 3300005437 Bacteria 6115
242 Ga0070710_10008237 3300005437 Bacteria 5073
243 Ga0070710_10045905 3300005437 Bacteria 2431
244 Ga0070710_10058489 3300005437 Bacteria 2187
245 Ga0070710_10208805 3300005437 Bacteria 1237
246 Ga0070701_10000897 3300005438 Bacteria 10740
247 Ga0070701_10025750 3300005438 Bacteria 2860
248 Ga0070711_100000834 3300005439 Bacteria 16154
249 Ga0070711_100030956 3300005439 Bacteria 3548
250 Ga0070711_100539060 3300005439 Bacteria 967
251 Ga0070705_100001475 3300005440 Bacteria 12439
252 Ga0070705_100001981 3300005440 Bacteria 10455
253 Ga0070705_100163011 3300005440 Bacteria 1492
254 Ga0070705_100330170 3300005440 Bacteria 1104
255 Ga0070705_100365550 3300005440 Bacteria 1057
256 Ga0070700_100010431 3300005441 Bacteria 5131
257 Ga0070700_100044432 3300005441 Bacteria 2736
258 Ga0070700_100205987 3300005441 Bacteria 1385
259 Ga0070700_100222353 3300005441 Bacteria 1338
260 Ga0070694_100000195 3300005444 Bacteria 32086
261 Ga0070694_100010924 3300005444 Bacteria 5618
262 Ga0070708_100171035 3300005445 Bacteria 2028
263 Ga0070663_100000352 3300005455 Bacteria 24139
264 Ga0070663_100010153 3300005455 Bacteria 5859
265 Ga0070663_100041358 3300005455 Bacteria 3232
266 Ga0070663_100099452 3300005455 Bacteria 2168
267 Ga0070663_100247892 3300005455 Bacteria 1409
268 Ga0070663_100329866 3300005455 Bacteria 1230
269 Ga0070678_100001146 3300005456 Bacteria 14002
270 Ga0070678_100004700 3300005456 Bacteria 7775
271 Ga0070678_100010048 3300005456 Bacteria 5761
272 Ga0070678_100030537 3300005456 Bacteria 3705
273 Ga0070678_100178873 3300005456 Bacteria 1734
274 Ga0070662_100000412 3300005457 Bacteria 25384
275 Ga0070662_100007011 3300005457 Bacteria 7290
276 Ga0070662_100024005 3300005457 Bacteria 4196
277 Ga0070662_100061180 3300005457 Bacteria 2748
278 Ga0070662_100112197 3300005457 Bacteria 2079
279 Ga0070662_100345141 3300005457 Bacteria 1219
280 Ga0070681_10000037 3300005458 Bacteria 96087
281 Ga0070681_10029025 3300005458 Bacteria 5554
282 Ga0070681_10089017 3300005458 Bacteria 3038
283 Ga0070681_10191377 3300005458 Bacteria 1965
284 Ga0070681_10234315 3300005458 Bacteria 1750
285 Ga0070681_10242511 3300005458 Bacteria 1716
286 Ga0068867_100003543 3300005459 Bacteria 10976
287 Ga0070685_10013328 3300005466 Bacteria 4333
288 Ga0070685_10033923 3300005466 Bacteria 2871
289 Ga0070706_100528828 3300005467 Bacteria 1097
290 Ga0070707_100119123 3300005468 Bacteria 2563
291 Ga0070679_100008411 3300005530 Bacteria 9712
292 Ga0070679_100035943 3300005530 Bacteria 4915
293 Ga0070679_100040109 3300005530 Bacteria 4658
294 Ga0070679_100049456 3300005530 Bacteria 4187
295 Ga0070679_100084772 3300005530 Bacteria 3156
296 Ga0070679_100236676 3300005530 Bacteria 1784
297 Ga0070679_100284185 3300005530 Bacteria 1607
298 Ga0070679_100428233 3300005530 Bacteria 1268
299 Ga0070684_100007624 3300005535 Bacteria 8437
300 Ga0070684_100057198 3300005535 Bacteria 3404
301 Ga0070684_100075494 3300005535 Bacteria 2973
302 Ga0070684_100109327 3300005535 Bacteria 2478
303 Ga0070697_100000391 3300005536 Bacteria 34002
304 Ga0070697_100003225 3300005536 Bacteria 12516
305 Ga0070697_100313263 3300005536 Bacteria 1350
306 Ga0068853_100000888 3300005539 Bacteria 20812
307 Ga0068853_100001082 3300005539 Bacteria 19264
308 Ga0068853_100002020 3300005539 Bacteria 15004
309 Ga0068853_100002660 3300005539 Bacteria 13466
310 Ga0068853_100570137 3300005539 Bacteria 1073
311 Ga0068853_100595721 3300005539 Bacteria 1049
312 Ga0068853_100836299 3300005539 Bacteria 882
313 Ga0070672_100002637 3300005543 Bacteria 11467
314 Ga0070672_100035019 3300005543 Bacteria 3813
315 Ga0070686_100001391 3300005544 Bacteria 13661
316 Ga0070686_100049366 3300005544 Bacteria 2669
317 Ga0070686_100072127 3300005544 Bacteria 2263
318 Ga0070686_100093249 3300005544 Bacteria 2019
319 Ga0070686_100457413 3300005544 Bacteria 983
320 Ga0070695_100000238 3300005545 Bacteria 27265
321 Ga0070695_100002611 3300005545 Bacteria 10409
322 Ga0070695_100003098 3300005545 Bacteria 9679
323 Ga0070695_100037816 3300005545 Bacteria 3043
324 Ga0070696_100000815 3300005546 Bacteria 20059
325 Ga0070696_100050054 3300005546 Bacteria 2904
326 Ga0070696_100091134 3300005546 Bacteria 2170
327 Ga0070696_100094139 3300005546 Bacteria 2137
328 Ga0070696_100349467 3300005546 Bacteria 1145
329 Ga0070696_100651256 3300005546 Bacteria 854
330 Ga0070693_100000455 3300005547 Bacteria 18375
331 Ga0070693_100010280 3300005547 Bacteria 4685
332 Ga0070693_100016709 3300005547 Bacteria 3802
333 Ga0070665_100006166 3300005548 Bacteria 12264
334 Ga0070665_100014624 3300005548 Bacteria 7876
335 Ga0070665_100044684 3300005548 Bacteria 4449
336 Ga0070665_100054832 3300005548 Bacteria 3998
337 Ga0070665_100116987 3300005548 Bacteria 2668
338 Ga0070665_100233446 3300005548 Bacteria 1840
339 Ga0070665_100241632 3300005548 Bacteria 1806
340 Ga0070665_100759557 3300005548 Bacteria 982
341 Ga0070665_100919321 3300005548 Bacteria 887
342 Ga0070665_100960738 3300005548 Bacteria 867
343 Ga0070665_101033666 3300005548 Bacteria 834
344 Ga0070704_100000124 3300005549 Bacteria 27978
345 Ga0070704_100058612 3300005549 Bacteria 2743
346 Ga0068855_100002691 3300005563 Bacteria 21916
347 Ga0068855_100057023 3300005563 Bacteria 4580
348 Ga0068855_100076631 3300005563 Bacteria 3880
349 Ga0068855_100132159 3300005563 Bacteria 2849
350 Ga0068855_100200660 3300005563 Bacteria 2245
351 Ga0068855_100270018 3300005563 Bacteria 1891
352 Ga0068855_100289062 3300005563 Bacteria 1818
353 Ga0068855_100299852 3300005563 Bacteria 1780
354 Ga0070664_100002450 3300005564 Bacteria 14942
355 Ga0070664_100004534 3300005564 Bacteria 11145
356 Ga0070664_100090651 3300005564 Bacteria 2646
357 Ga0070664_100097992 3300005564 Bacteria 2546
358 Ga0070664_100121742 3300005564 Bacteria 2285
359 Ga0068857_100006037 3300005577 Bacteria 10344
360 Ga0068857_100007896 3300005577 Bacteria 9178
361 Ga0068857_100008457 3300005577 Bacteria 8896
362 Ga0068857_100224493 3300005577 Bacteria 1717
363 Ga0068854_100006037 3300005578 Bacteria 7675
364 Ga0068854_100007856 3300005578 Bacteria 6824
365 Ga0068854_100225910 3300005578 Bacteria 1483
366 Ga0068856_100001032 3300005614 Bacteria 29659
367 Ga0068856_100005122 3300005614 Bacteria 12946
368 Ga0068856_100008706 3300005614 Bacteria 9874
369 Ga0068856_100034393 3300005614 Bacteria 4964
370 Ga0068856_100114856 3300005614 Bacteria 2691
371 Ga0068856_100128535 3300005614 Bacteria 2537
372 Ga0068856_100210039 3300005614 Bacteria 1962
373 Ga0070702_100000018 3300005615 Bacteria 47204
374 Ga0070702_100000378 3300005615 Bacteria 15718
375 Ga0070702_100041319 3300005615 Bacteria 2586
376 Ga0070702_100062278 3300005615 Bacteria 2175
377 Ga0070702_100358290 3300005615 Bacteria 1030
378 Ga0068852_100006800 3300005616 Bacteria 8301
379 Ga0068852_100010938 3300005616 Bacteria 6801
380 Ga0068852_100017082 3300005616 Bacteria 5683
381 Ga0068852_100026746 3300005616 Bacteria 4695
382 Ga0068852_100426593 3300005616 Bacteria 1309
383 Ga0068852_100593367 3300005616 Bacteria 1111
384 Ga0068852_100663922 3300005616 Bacteria 1051
385 Ga0068852_101044254 3300005616 Bacteria 836
386 Ga0068859_100007402 3300005617 Bacteria 11142
387 Ga0068859_100029393 3300005617 Bacteria 5514
388 Ga0068859_100030651 3300005617 Bacteria 5398
389 Ga0068859_100076838 3300005617 Bacteria 3379
390 Ga0068859_100323648 3300005617 Bacteria 1636
391 Ga0068859_100950915 3300005617 Bacteria 942
392 Ga0068864_100000595 3300005618 Bacteria 30701
393 Ga0068864_100002243 3300005618 Bacteria 15978
394 Ga0068864_100047292 3300005618 Bacteria 3694
395 Ga0068864_100198418 3300005618 Bacteria 1842
396 Ga0068864_100288199 3300005618 Bacteria 1534
397 Ga0068864_101114684 3300005618 Bacteria 786
398 Ga0068866_10000834 3300005718 Bacteria 13673
399 Ga0068866_10001983 3300005718 Bacteria 8531
400 Ga0068866_10024794 3300005718 Bacteria 2812
401 Ga0068866_10028552 3300005718 Bacteria 2660
402 Ga0068866_10028876 3300005718 Bacteria 2647
403 Ga0068861_100000942 3300005719 Bacteria 17675
404 Ga0068861_100002973 3300005719 Bacteria 11183
405 Ga0068861_100039077 3300005719 Bacteria 3540
406 Ga0068861_100163854 3300005719 Bacteria 1836
407 Ga0068861_100440079 3300005719 Bacteria 1166
408 Ga0068851_10011945 3300005834 Bacteria 4083
409 Ga0068851_10084680 3300005834 Bacteria 1661
410 Ga0068870_10000216 3300005840 Bacteria 20877
411 Ga0068863_100007838 3300005841 Bacteria 10440
412 Ga0068863_100022557 3300005841 Bacteria 6011
413 Ga0068863_100056946 3300005841 Bacteria 3700
414 Ga0068863_100221748 3300005841 Bacteria 1822
415 Ga0068863_100262074 3300005841 Bacteria 1671
416 Ga0068863_100424170 3300005841 Bacteria 1303
417 Ga0068863_100672713 3300005841 Bacteria 1028
418 Ga0068863_100816290 3300005841 Bacteria 931
419 Ga0068858_100019589 3300005842 Bacteria 6325
420 Ga0068858_100024760 3300005842 Bacteria 5589
421 Ga0068858_100078512 3300005842 Bacteria 3067
422 Ga0068858_100141594 3300005842 Bacteria 2258
423 Ga0068858_100209082 3300005842 Bacteria 1847
424 Ga0068858_100405268 3300005842 Bacteria 1310
425 Ga0068858_100462430 3300005842 Bacteria 1223
426 Ga0068860_100000598 3300005843 Bacteria 43069
427 Ga0068860_100007174 3300005843 Bacteria 11145
428 Ga0068860_100049233 3300005843 Bacteria 4014
429 Ga0068860_100198111 3300005843 Bacteria 1945
430 Ga0068860_100228154 3300005843 Bacteria 1809
431 Ga0068860_100866220 3300005843 Bacteria 918
432 Ga0068862_100017504 3300005844 Bacteria 5970
433 Ga0068862_100038406 3300005844 Bacteria 4060
434 Ga0068862_100136266 3300005844 Bacteria 2175
435 Ga0068862_100137280 3300005844 Bacteria 2168
436 Ga0068862_100355311 3300005844 Bacteria 1360
437 Ga0081455_10000048 3300005937 Bacteria 126551
438 Ga0081455_10001008 3300005937 Bacteria 35646
439 Ga0081455_10012098 3300005937 Bacteria 8627
440 Ga0081455_10012767 3300005937 Bacteria 8353
441 Ga0081455_10014358 3300005937 Bacteria 7770
442 Ga0081455_10068347 3300005937 Bacteria 2958
443 Ga0081540_1000645 3300005983 Bacteria 33098
444 Ga0081540_1001166 3300005983 Bacteria 23099
445 Ga0081540_1002663 3300005983 Bacteria 14523
446 Ga0081540_1016488 3300005983 Bacteria 4620
447 Ga0081540_1066916 3300005983 Bacteria 1681
448 Ga0081540_1093559 3300005983 Bacteria 1316
449 Ga0081540_1104290 3300005983 Bacteria 1214
450 Ga0081540_1132292 3300005983 Bacteria 1016
451 Ga0081539_10004419 3300005985 Bacteria 15563
452 Ga0081539_10031106 3300005985 Bacteria 3297
453 Ga0070717_10034816 3300006028 Bacteria 4073
454 Ga0075365_10009705 3300006038 Bacteria 5556
455 Ga0075365_10010146 3300006038 Bacteria 5469
456 Ga0075365_10069048 3300006038 Bacteria 2375
457 Ga0075365_10074713 3300006038 Bacteria 2286
458 Ga0075365_10165421 3300006038 Bacteria 1543
459 Ga0075365_10170405 3300006038 Bacteria 1519
460 Ga0075365_10465813 3300006038 Bacteria 893
461 Ga0075368_10000564 3300006042 Bacteria 11114
462 Ga0075368_10003116 3300006042 Bacteria 5502
463 Ga0075368_10033606 3300006042 Bacteria 1995
464 Ga0075368_10060949 3300006042 Bacteria 1510
465 Ga0075363_100064107 3300006048 Bacteria 1985
466 Ga0075363_100115484 3300006048 Bacteria 1494
467 Ga0075363_100228193 3300006048 Bacteria 1068
468 Ga0075364_10019371 3300006051 Bacteria 4271
469 Ga0075364_10028265 3300006051 Bacteria 3589
470 Ga0075364_10081228 3300006051 Bacteria 2143
471 Ga0075364_10245182 3300006051 Bacteria 1217
472 Ga0075432_10000910 3300006058 Bacteria 9311
473 Ga0070715_10002284 3300006163 Bacteria 5834
474 Ga0070715_10003461 3300006163 Bacteria 5024
475 Ga0070715_10365018 3300006163 Bacteria 792
476 Ga0070715_10404540 3300006163 Bacteria 759
477 Ga0070716_100000346 3300006173 Bacteria 18854
478 Ga0070716_100001603 3300006173 Bacteria 10188
479 Ga0070716_100038559 3300006173 Bacteria 2647
480 Ga0070716_100276309 3300006173 Bacteria 1157
481 Ga0070712_100000902 3300006175 Bacteria 17764
482 Ga0070712_100027843 3300006175 Bacteria 3776
483 Ga0070712_100043397 3300006175 Bacteria 3095
484 Ga0070712_100052247 3300006175 Bacteria 2849
485 Ga0070712_100133693 3300006175 Bacteria 1883
486 Ga0070712_100296281 3300006175 Bacteria 1308
487 Ga0070712_100437551 3300006175 Bacteria 1087
488 Ga0075362_10008904 3300006177 Bacteria 3858
489 Ga0075362_10010315 3300006177 Bacteria 3644
490 Ga0075362_10013066 3300006177 Bacteria 3314
491 Ga0075362_10035551 3300006177 Bacteria 2175
492 Ga0075362_10078492 3300006177 Bacteria 1519
493 Ga0075367_10001854 3300006178 Bacteria 9330
494 Ga0075367_10041209 3300006178 Bacteria 2699
495 Ga0075367_10130793 3300006178 Bacteria 1551
496 Ga0075367_10175029 3300006178 Bacteria 1337
497 Ga0075369_10031240 3300006186 Bacteria 2246
498 Ga0075369_10033715 3300006186 Bacteria 2171
499 Ga0075369_10048331 3300006186 Bacteria 1836
500 Ga0075369_10100179 3300006186 Bacteria 1299
501 Ga0075366_10000815 3300006195 Bacteria 14969
502 Ga0075366_10007231 3300006195 Bacteria 6117
503 Ga0075366_10121590 3300006195 Bacteria 1573
504 Ga0097621_100000600 3300006237 Bacteria 25393
505 Ga0097621_100147597 3300006237 Bacteria 2015
506 Ga0097621_100261458 3300006237 Bacteria 1518
507 Ga0097621_100272520 3300006237 Bacteria 1487
508 Ga0097621_100441315 3300006237 Bacteria 1171
509 Ga0097621_100499666 3300006237 Bacteria 1101
510 Ga0075370_10006197 3300006353 Bacteria 6002
511 Ga0075370_10063824 3300006353 Bacteria 2100
512 Ga0068871_100000118 3300006358 Bacteria 49211
513 Ga0068871_100054371 3300006358 Bacteria 3248
514 Ga0068871_100195885 3300006358 Bacteria 1742
515 Ga0068871_100461540 3300006358 Bacteria 1140
516 Ga0068871_100628603 3300006358 Bacteria 978
517 Ga0075428_100015890 3300006844 Bacteria 8329
518 Ga0075428_100016989 3300006844 Bacteria 8039
519 Ga0075428_100054274 3300006844 Bacteria 4392
520 Ga0075428_100085887 3300006844 Bacteria 3432
521 Ga0075428_100268781 3300006844 Bacteria 1835
522 Ga0075428_100537004 3300006844 Bacteria 1250
523 Ga0075428_100547567 3300006844 Bacteria 1237
524 Ga0075428_100812557 3300006844 Bacteria 993
525 Ga0075430_100000196 3300006846 Bacteria 40930
526 Ga0075430_100012358 3300006846 Bacteria 7262
527 Ga0075430_100068070 3300006846 Bacteria 2988
528 Ga0075431_100003503 3300006847 Bacteria 15211
529 Ga0075431_100004125 3300006847 Bacteria 14184
530 Ga0075431_100046747 3300006847 Bacteria 4464
531 Ga0075431_100055672 3300006847 Bacteria 4080
532 Ga0075431_100058192 3300006847 Bacteria 3987
533 Ga0075431_100060290 3300006847 Bacteria 3915
534 Ga0075431_100191472 3300006847 Bacteria 2095
535 Ga0075431_100368290 3300006847 Bacteria 1442
536 Ga0075431_100516073 3300006847 Bacteria 1185
537 Ga0075433_10001194 3300006852 Bacteria 18909
538 Ga0075433_10023032 3300006852 Bacteria 5237
539 Ga0075433_10029412 3300006852 Bacteria 4680
540 Ga0075433_10035758 3300006852 Bacteria 4275
541 Ga0075433_10240648 3300006852 Bacteria 1606
542 Ga0075433_10354914 3300006852 Bacteria 1295
543 Ga0075433_10407426 3300006852 Bacteria 1199
544 Ga0075434_100004950 3300006871 Bacteria 12081
545 Ga0075434_100006955 3300006871 Bacteria 10427
546 Ga0075434_100031946 3300006871 Bacteria 5190
547 Ga0075434_100201192 3300006871 Bacteria 2012
548 Ga0075434_100239666 3300006871 Bacteria 1834
549 Ga0075434_100402696 3300006871 Bacteria 1389
550 Ga0075434_100431176 3300006871 Bacteria 1339
551 Ga0075434_100681676 3300006871 Bacteria 1045
552 Ga0075429_100000573 3300006880 Bacteria 28269
553 Ga0075429_100024809 3300006880 Bacteria 5205
554 Ga0075429_100031579 3300006880 Bacteria 4602
555 Ga0068865_100007181 3300006881 Bacteria 6840
556 Ga0068865_100052261 3300006881 Bacteria 2831
557 Ga0068865_100227133 3300006881 Bacteria 1462
558 Ga0068865_100635049 3300006881 Bacteria 906
559 Ga0075436_100002564 3300006914 Bacteria 12509
560 Ga0075436_100008941 3300006914 Bacteria 6857
561 Ga0075436_100014756 3300006914 Bacteria 5354
562 Ga0075436_100019157 3300006914 Bacteria 4689
563 Ga0075436_100173883 3300006914 Bacteria 1521
564 Ga0097620_100007402 3300006931 Bacteria 11142
565 Ga0097620_100029394 3300006931 Bacteria 5514
566 Ga0097620_100030651 3300006931 Bacteria 5398
567 Ga0097620_100076839 3300006931 Bacteria 3379
568 Ga0097620_100323639 3300006931 Bacteria 1636
569 Ga0097620_100950910 3300006931 Bacteria 942
570 Ga0079104_1000547 3300006946 Bacteria 39191
571 Ga0079104_1060066 3300006946 Bacteria 821
572 Ga0079104_1060067 3300006946 Bacteria 821
573 Ga0099826_10030933 3300006948 Bacteria 3878
574 Ga0075435_100012698 3300007076 Bacteria 6239
575 Ga0075435_100013282 3300007076 Bacteria 6120
576 Ga0075435_100034006 3300007076 Bacteria 4035
577 Ga0075435_100040317 3300007076 Bacteria 3729
578 Ga0075435_100104949 3300007076 Bacteria 2345
579 Ga0075435_100114165 3300007076 Bacteria 2249
580 Ga0075435_100206962 3300007076 Bacteria 1663
581 Ga0075435_100470532 3300007076 Bacteria 1085
582 Ga0075435_100762444 3300007076 Bacteria 842
583 Ga0105251_10011425 3300009011 Bacteria 5076
584 Ga0105251_10060798 3300009011 Bacteria 1778
585 Ga0105244_10029155 3300009036 Bacteria 2954
586 Ga0105250_10008602 3300009092 Bacteria 4327
587 Ga0105250_10039803 3300009092 Bacteria 1885
588 Ga0105240_10000005 3300009093 Bacteria 702630
589 Ga0105240_10015848 3300009093 Bacteria 10226
590 Ga0105240_10017473 3300009093 Bacteria 9666
591 Ga0105240_10130104 3300009093 Bacteria 3020
592 Ga0105240_10167533 3300009093 Bacteria 2604
593 Ga0105240_10338251 3300009093 Bacteria 1710
594 Ga0105240_10656230 3300009093 Bacteria 1149
595 Ga0105240_10748939 3300009093 Bacteria 1062
596 Ga0111539_10000683 3300009094 Bacteria 43914
597 Ga0111539_10009902 3300009094 Bacteria 12026
598 Ga0111539_10010079 3300009094 Bacteria 11909
599 Ga0111539_10041077 3300009094 Bacteria 5564
600 Ga0111539_10090609 3300009094 Bacteria 3593
601 Ga0111539_10092029 3300009094 Bacteria 3563
602 Ga0111539_10092356 3300009094 Bacteria 3557
603 Ga0111539_10100865 3300009094 Bacteria 3389
604 Ga0111539_10114413 3300009094 Bacteria 3164
605 Ga0111539_10245567 3300009094 Bacteria 2084
606 Ga0111539_10460054 3300009094 Bacteria 1482
607 Ga0105245_10000718 3300009098 Bacteria 29853
608 Ga0105245_10017665 3300009098 Bacteria 6226
609 Ga0105245_10026779 3300009098 Bacteria 5076
610 Ga0105245_10061390 3300009098 Bacteria 3388
611 Ga0105245_10192450 3300009098 Bacteria 1954
612 Ga0105245_10854387 3300009098 Bacteria 950
613 Ga0105247_10001104 3300009101 Bacteria 20096
614 Ga0105247_10005639 3300009101 Bacteria 7852
615 Ga0105247_10017435 3300009101 Bacteria 4311
616 Ga0105247_10050875 3300009101 Bacteria 2550
617 Ga0114129_10008352 3300009147 Bacteria 14760
618 Ga0114129_10030751 3300009147 Bacteria 7593
619 Ga0114129_10043173 3300009147 Bacteria 6344
620 Ga0114129_10051465 3300009147 Bacteria 5782
621 Ga0114129_10079719 3300009147 Bacteria 4552
622 Ga0114129_10110222 3300009147 Bacteria 3800
623 Ga0114129_10118024 3300009147 Bacteria 3655
624 Ga0114129_10278251 3300009147 Bacteria 2237
625 Ga0105243_10001752 3300009148 Bacteria 18680
626 Ga0105243_10009714 3300009148 Bacteria 7327
627 Ga0105243_10009969 3300009148 Bacteria 7221
628 Ga0105243_10015043 3300009148 Bacteria 5856
629 Ga0105243_10020823 3300009148 Bacteria 4976
630 Ga0105243_10148326 3300009148 Bacteria 2009
631 Ga0105243_10212915 3300009148 Bacteria 1703
632 Ga0105241_10003357 3300009174 Bacteria 11919
633 Ga0105241_10083130 3300009174 Bacteria 2511
634 Ga0105242_10010515 3300009176 Bacteria 7104
635 Ga0105242_10016828 3300009176 Bacteria 5691
636 Ga0105242_10065726 3300009176 Bacteria 2993
637 Ga0105242_10082759 3300009176 Bacteria 2686
638 Ga0105242_10397181 3300009176 Bacteria 1286
639 Ga0105248_10002832 3300009177 Bacteria 19248
640 Ga0105248_10070068 3300009177 Bacteria 3938
641 Ga0105248_10106162 3300009177 Bacteria 3167
642 Ga0105248_10140934 3300009177 Bacteria 2720
643 Ga0105248_10204250 3300009177 Bacteria 2226
644 Ga0105248_10346812 3300009177 Bacteria 1672
645 Ga0105248_10725852 3300009177 Bacteria 1121
646 Ga0105248_10929750 3300009177 Bacteria 982
647 Ga0105237_10001070 3300009545 Bacteria 36790
648 Ga0105237_10001618 3300009545 Bacteria 29243
649 Ga0105237_10059280 3300009545 Bacteria 3830
650 Ga0105237_10210047 3300009545 Bacteria 1947
651 Ga0105237_11039593 3300009545 Bacteria 826
652 Ga0105238_10001939 3300009551 Bacteria 20807
653 Ga0105238_10007984 3300009551 Bacteria 10588
654 Ga0105238_10060184 3300009551 Bacteria 3803
655 Ga0105238_10146346 3300009551 Bacteria 2339
656 Ga0105238_10148250 3300009551 Bacteria 2322
657 Ga0105238_10190252 3300009551 Bacteria 2028
658 Ga0105238_10542462 3300009551 Bacteria 1167
659 Ga0105249_10000814 3300009553 Bacteria 28107
660 Ga0105249_10002122 3300009553 Bacteria 17209
661 Ga0105249_10023350 3300009553 Bacteria 5549
662 Ga0105249_10057216 3300009553 Bacteria 3571
663 Ga0105249_10238958 3300009553 Bacteria 1795
664 Ga0105249_10539453 3300009553 Bacteria 1216
665 Ga0123341_1017290 3300009765 Bacteria 6322
666 Ga0123342_1036794 3300009766 Bacteria 2000
667 Ga0105239_10028473 3300010375 Bacteria 6145
668 Ga0105239_10030108 3300010375 Bacteria 5968
669 Ga0105239_10039505 3300010375 Bacteria 5170
670 Ga0105239_10052904 3300010375 Bacteria 4454
671 Ga0105239_10060445 3300010375 Bacteria 4159
672 Ga0105239_10132704 3300010375 Bacteria 2771
673 Ga0105239_10157527 3300010375 Bacteria 2537
674 Ga0105239_10415482 3300010375 Bacteria 1523
675 Ga0105239_10459213 3300010375 Bacteria 1445
676 Ga0105239_10836028 3300010375 Bacteria 1055
677 Ga0105246_10002439 3300011119 Bacteria 11222
678 Ga0105246_10002558 3300011119 Bacteria 10995
679 Ga0105246_10087255 3300011119 Bacteria 2239
680 Ga0105246_10521650 3300011119 Bacteria 1013
681 Ga0105246_10578245 3300011119 Bacteria 967
682 Ga0157373_10000820 3300013100 Bacteria 24076
683 Ga0157373_10183707 3300013100 Bacteria 1473
684 Ga0157373_10598985 3300013100 Bacteria 802
685 Ga0157371_10009195 3300013102 Bacteria 7800
686 Ga0157371_10009953 3300013102 Bacteria 7442
687 Ga0157371_10018898 3300013102 Bacteria 5090
688 Ga0157371_10074676 3300013102 Bacteria 2401
689 Ga0157370_10001829 3300013104 Bacteria 26206
690 Ga0157370_10003448 3300013104 Bacteria 18559
691 Ga0157370_10011636 3300013104 Bacteria 9184
692 Ga0157370_10224550 3300013104 Bacteria 1739
693 Ga0157369_10001227 3300013105 Bacteria 31941
694 Ga0157369_10001535 3300013105 Bacteria 28280
695 Ga0157369_10028075 3300013105 Bacteria 6232
696 Ga0157369_10030062 3300013105 Bacteria 5994
697 Ga0157369_10150003 3300013105 Bacteria 2464
698 Ga0157369_10195577 3300013105 Bacteria 2124
699 Ga0157369_10777483 3300013105 Bacteria 984
700 Ga0171463_1011 3300013249 Bacteria 230603
701 Ga0171462_1042 3300013250 Bacteria 66199
702 Ga0157374_10021639 3300013296 Bacteria 5726
703 Ga0157374_10028235 3300013296 Bacteria 5068
704 Ga0157374_10322788 3300013296 Bacteria 1530
705 Ga0157378_10000470 3300013297 Bacteria 38483
706 Ga0157378_10015153 3300013297 Bacteria 6749
707 Ga0157378_10229421 3300013297 Bacteria 1769
708 Ga0157378_10655439 3300013297 Bacteria 1066
709 Ga0163162_10004532 3300013306 Bacteria 13382
710 Ga0163162_10028695 3300013306 Bacteria 5508
711 Ga0163162_10099317 3300013306 Bacteria 3001
712 Ga0163162_10120909 3300013306 Bacteria 2723
713 Ga0163162_10232744 3300013306 Bacteria 1973
714 Ga0163162_10300098 3300013306 Bacteria 1738
715 Ga0163162_10348498 3300013306 Bacteria 1614
716 Ga0163162_10461077 3300013306 Bacteria 1402
717 Ga0157372_10001215 3300013307 Bacteria 27865
718 Ga0157372_10023820 3300013307 Bacteria 6641
719 Ga0157372_10101268 3300013307 Bacteria 3288
720 Ga0157372_10128879 3300013307 Bacteria 2910
721 Ga0157372_10189514 3300013307 Bacteria 2382
722 Ga0157372_10996343 3300013307 Bacteria 971
723 Ga0157375_10007178 3300013308 Bacteria 9737
724 Ga0157375_10007439 3300013308 Bacteria 9585
725 Ga0157375_10020813 3300013308 Bacteria 6003
726 Ga0157375_10105208 3300013308 Bacteria 2912
727 Ga0163163_10005311 3300014325 Bacteria 11124
728 Ga0163163_10008003 3300014325 Bacteria 9355
729 Ga0163163_10020116 3300014325 Bacteria 6282
730 Ga0163163_10056493 3300014325 Bacteria 3880
731 Ga0163163_10196364 3300014325 Bacteria 2066
732 Ga0163163_10352185 3300014325 Bacteria 1529
733 Ga0157380_10027055 3300014326 Bacteria 4358
734 Ga0157380_10073142 3300014326 Bacteria 2778
735 Ga0157380_10227059 3300014326 Bacteria 1674
736 Ga0182008_10192790 3300014497 Bacteria 1034
737 Ga0157377_10000628 3300014745 Bacteria 14665
738 Ga0157377_10006965 3300014745 Bacteria 5428
739 Ga0157379_10001927 3300014968 Bacteria 17169
740 Ga0157379_10018151 3300014968 Bacteria 6200
741 Ga0157379_10021324 3300014968 Bacteria 5734
742 Ga0157379_10033322 3300014968 Bacteria 4595
743 Ga0157379_10183731 3300014968 Bacteria 1889
744 Ga0157379_10395879 3300014968 Bacteria 1269
745 Ga0157376_10000606 3300014969 Bacteria 23175
746 Ga0157376_10006966 3300014969 Bacteria 8018
747 Ga0157376_10019101 3300014969 Bacteria 5273
748 Ga0157376_10132510 3300014969 Bacteria 2226
749 Ga0157376_10176068 3300014969 Bacteria 1952
750 Ga0157376_10258956 3300014969 Bacteria 1629
751 Ga0157376_10571240 3300014969 Bacteria 1122
752 Ga0183363_1181 3300015690 Bacteria 13522
753 Ga0163161_10000415 3300017792 Bacteria 35797
754 Ga0163161_10002394 3300017792 Bacteria 13438
755 Ga0163161_10009359 3300017792 Bacteria 6779
756 Ga0163161_10045363 3300017792 Bacteria 3169
757 Ga0206353_10183169 3300020082 Bacteria 1282
758 Ga0214544_1002211 3300021320 Bacteria 40993
759 Ga0214542_1002553 3300021321 Bacteria 37593
760 Ga0214542_1019955 3300021321 Bacteria 5086
761 Ga0214543_1000032 3300021327 Bacteria 200766
762 Ga0214543_1005345 3300021327 Bacteria 23734
763 Ga0213874_10004012 3300021377 Bacteria 3318
764 Ga0213874_10005223 3300021377 Bacteria 3016
765 Ga0213876_10000421 3300021384 Bacteria 35344
766 Ga0213876_10003189 3300021384 Bacteria 9433
767 Ga0228711_1000015 3300022739 Bacteria 126974
768 Ga0228710_1000015 3300022740 Bacteria 133640
769 Ga0209435_100024 3300025206 Bacteria 199665
770 Ga0209436_101533 3300025208 Bacteria 7892
771 Ga0209436_102647 3300025208 Bacteria 5224
772 Ga0209563_103733 3300025230 Bacteria 3071
773 Ga0209437_100969 3300025233 Bacteria 10256
774 Ga0209437_100970 3300025233 Bacteria 10253
775 Ga0207425_1002690 3300025245 Bacteria 6088
776 Ga0207425_1004689 3300025245 Bacteria 4040
777 Ga0207425_1018210 3300025245 Bacteria 1526
778 Ga0209646_1000064 3300025246 Bacteria 246524
779 Ga0209026_1000053 3300025250 Bacteria 246524
780 Ga0209677_101193 3300025253 Bacteria 11899
781 Ga0209759_1000042 3300025256 Bacteria 246524
782 Ga0209129_1004899 3300025258 Bacteria 4998
783 Ga0209129_1006151 3300025258 Bacteria 3992
784 Ga0209129_1009244 3300025258 Bacteria 2626
785 Ga0209129_1016631 3300025258 Bacteria 1469
786 Ga0209129_1018693 3300025258 Bacteria 1326
787 Ga0209233_1000013 3300025261 Bacteria 1013785
788 Ga0209233_1003146 3300025261 Bacteria 5855
789 Ga0209233_1004786 3300025261 Bacteria 4561
790 Ga0209565_1015168 3300025263 Bacteria 1744
791 Ga0207666_1000185 3300025271 Bacteria 9376
792 Ga0207666_1017327 3300025271 Bacteria 1039
793 Ga0209673_1000825 3300025273 Bacteria 40781
794 Ga0209673_1000864 3300025273 Bacteria 39329
795 Ga0209673_1004573 3300025273 Bacteria 7339
796 Ga0209673_1021339 3300025273 Bacteria 2268
797 Ga0209130_1000006 3300025284 Bacteria 596528
798 Ga0209130_1000007 3300025284 Bacteria 591584
799 Ga0209130_1001130 3300025284 Bacteria 19559
800 Ga0209130_1001794 3300025284 Bacteria 12605
801 Ga0209130_1029764 3300025284 Bacteria 1134
802 Ga0207673_1000115 3300025290 Bacteria 7456
803 Ga0209675_1002527 3300025291 Bacteria 9311
804 Ga0209676_1001545 3300025292 Bacteria 20721
805 Ga0209676_1002955 3300025292 Bacteria 11087
806 Ga0209676_1010666 3300025292 Bacteria 3791
807 Ga0209676_1026047 3300025292 Bacteria 1864
808 Ga0209025_1000014 3300025294 Bacteria 865448
809 Ga0209025_1000303 3300025294 Bacteria 110086
810 Ga0209025_1000320 3300025294 Bacteria 106773
811 Ga0209025_1000405 3300025294 Bacteria 87670
812 Ga0209025_1010834 3300025294 Bacteria 6115
813 Ga0209025_1010837 3300025294 Bacteria 6114
814 Ga0209025_1011543 3300025294 Bacteria 5802
815 Ga0209025_1016908 3300025294 Bacteria 4256
816 Ga0209564_1000140 3300025295 Bacteria 179856
817 Ga0209564_1002872 3300025295 Bacteria 12632
818 Ga0209564_1009622 3300025295 Bacteria 4572
819 Ga0209564_1012959 3300025295 Bacteria 3584
820 Ga0209758_1000013 3300025297 Bacteria 873003
821 Ga0209758_1000548 3300025297 Bacteria 59657
822 Ga0209758_1007716 3300025297 Bacteria 7224
823 Ga0209758_1007810 3300025297 Bacteria 7143
824 Ga0209758_1010916 3300025297 Bacteria 5351
825 Ga0209758_1013305 3300025297 Bacteria 4501
826 Ga0209758_1056458 3300025297 Bacteria 1326
827 Ga0209758_1060988 3300025297 Bacteria 1245
828 Ga0209050_1002103 3300025298 Bacteria 18193
829 Ga0209050_1003219 3300025298 Bacteria 12352
830 Ga0209050_1017582 3300025298 Bacteria 2838
831 Ga0209256_1000108 3300025299 Bacteria 185884
832 Ga0209256_1000540 3300025299 Bacteria 54759
833 Ga0209256_1002683 3300025299 Bacteria 13954
834 Ga0209256_1004555 3300025299 Bacteria 8604
835 Ga0209256_1004663 3300025299 Bacteria 8427
836 Ga0209256_1010415 3300025299 Bacteria 3898
837 Ga0207426_1000003 3300025302 Bacteria 1063212
838 Ga0207426_1000044 3300025302 Bacteria 428043
839 Ga0207426_1000064 3300025302 Bacteria 358276
840 Ga0207426_1004654 3300025302 Bacteria 6596
841 Ga0207426_1014855 3300025302 Bacteria 2844
842 Ga0207426_1016359 3300025302 Bacteria 2664
843 Ga0209051_1000914 3300025303 Bacteria 29357
844 Ga0209051_1002149 3300025303 Bacteria 14647
845 Ga0209051_1010708 3300025303 Bacteria 4594
846 Ga0209051_1026165 3300025303 Bacteria 2358
847 Ga0209051_1029797 3300025303 Bacteria 2129
848 Ga0209051_1050281 3300025303 Bacteria 1397
849 Ga0209257_1000817 3300025304 Bacteria 45150
850 Ga0209257_1002507 3300025304 Bacteria 18088
851 Ga0209257_1024790 3300025304 Bacteria 2066
852 Ga0209257_1026877 3300025304 Bacteria 1928
853 Ga0209257_1045286 3300025304 Bacteria 1278
854 Ga0207697_10003861 3300025315 Bacteria 7309
855 Ga0207656_10000708 3300025321 Bacteria 10913
856 Ga0207713_1025626 3300025735 Bacteria 2718
857 Ga0207653_10017893 3300025885 Bacteria 2233
858 Ga0207682_10000350 3300025893 Bacteria 21096
859 Ga0207692_10012995 3300025898 Bacteria 3597
860 Ga0207692_10043007 3300025898 Bacteria 2245
861 Ga0207692_10233009 3300025898 Bacteria 1096
862 Ga0207642_10001478 3300025899 Bacteria 7266
863 Ga0207642_10002270 3300025899 Bacteria 5983
864 Ga0207642_10025851 3300025899 Bacteria 2381
865 Ga0207642_10032220 3300025899 Bacteria 2204
866 Ga0207710_10003497 3300025900 Bacteria 6990
867 Ga0207710_10008108 3300025900 Bacteria 4435
868 Ga0207710_10035506 3300025900 Bacteria 2194
869 Ga0207688_10002614 3300025901 Bacteria 9749
870 Ga0207688_10007287 3300025901 Bacteria 6019
871 Ga0207688_10101952 3300025901 Bacteria 1658
872 Ga0207688_10150216 3300025901 Bacteria 1376
873 Ga0207680_10006344 3300025903 Bacteria 5711
874 Ga0207680_10074338 3300025903 Bacteria 2116
875 Ga0207680_10079452 3300025903 Bacteria 2057
876 Ga0207680_10087949 3300025903 Bacteria 1969
877 Ga0207647_10001458 3300025904 Bacteria 18183
878 Ga0207647_10053013 3300025904 Bacteria 2502
879 Ga0207647_10088707 3300025904 Bacteria 1846
880 Ga0207685_10000290 3300025905 Bacteria 7986
881 Ga0207685_10009749 3300025905 Bacteria 2802
882 Ga0207685_10141936 3300025905 Bacteria 1078
883 Ga0207699_10000164 3300025906 Bacteria 41177
884 Ga0207699_10011603 3300025906 Bacteria 4457
885 Ga0207699_10045934 3300025906 Bacteria 2551
886 Ga0207699_10068253 3300025906 Bacteria 2165
887 Ga0207645_10000222 3300025907 Bacteria 47139
888 Ga0207645_10010484 3300025907 Bacteria 6361
889 Ga0207645_10041455 3300025907 Bacteria 2946
890 Ga0207645_10148037 3300025907 Bacteria 1532
891 Ga0207645_10151959 3300025907 Bacteria 1511
892 Ga0207643_10000009 3300025908 Bacteria 160496
893 Ga0207643_10101468 3300025908 Bacteria 1688
894 Ga0207643_10354663 3300025908 Bacteria 921
895 Ga0207705_10004720 3300025909 Bacteria 10265
896 Ga0207705_10124003 3300025909 Bacteria 1919
897 Ga0207705_10422437 3300025909 Bacteria 1032
898 Ga0207654_10003285 3300025911 Bacteria 8172
899 Ga0207654_10012590 3300025911 Bacteria 4337
900 Ga0207654_10023567 3300025911 Bacteria 3299
901 Ga0207654_10024045 3300025911 Bacteria 3271
902 Ga0207654_10103726 3300025911 Bacteria 1756
903 Ga0207707_10000011 3300025912 Bacteria 282857
904 Ga0207707_10004335 3300025912 Bacteria 12560
905 Ga0207707_10006091 3300025912 Bacteria 10552
906 Ga0207707_10051244 3300025912 Bacteria 3594
907 Ga0207707_10379643 3300025912 Bacteria 1215
908 Ga0207707_10557285 3300025912 Bacteria 973
909 Ga0207707_10589425 3300025912 Bacteria 942
910 Ga0207695_10000011 3300025913 Bacteria 910221
911 Ga0207695_10034689 3300025913 Bacteria 5483
912 Ga0207695_10036358 3300025913 Bacteria 5325
913 Ga0207695_10047727 3300025913 Bacteria 4528
914 Ga0207695_10060808 3300025913 Bacteria 3908
915 Ga0207695_10109547 3300025913 Bacteria 2743
916 Ga0207695_10141820 3300025913 Bacteria 2350
917 Ga0207671_10001852 3300025914 Bacteria 23614
918 Ga0207671_10016535 3300025914 Bacteria 5730
919 Ga0207671_10117979 3300025914 Bacteria 2026
920 Ga0207671_10169816 3300025914 Bacteria 1693
921 Ga0207693_10000493 3300025915 Bacteria 35669
922 Ga0207693_10001929 3300025915 Bacteria 18163
923 Ga0207693_10015635 3300025915 Bacteria 6084
924 Ga0207693_10090686 3300025915 Bacteria 2396
925 Ga0207693_10135259 3300025915 Bacteria 1938
926 Ga0207663_10001067 3300025916 Bacteria 12565
927 Ga0207663_10145258 3300025916 Bacteria 1657
928 Ga0207663_10233518 3300025916 Bacteria 1345
929 Ga0207660_10000197 3300025917 Bacteria 38486
930 Ga0207660_10003537 3300025917 Bacteria 10180
931 Ga0207660_10450141 3300025917 Bacteria 1041
932 Ga0207660_10482583 3300025917 Bacteria 1005
933 Ga0207660_10699184 3300025917 Bacteria 827
934 Ga0207662_10002067 3300025918 Bacteria 9951
935 Ga0207662_10010568 3300025918 Bacteria 5102
936 Ga0207662_10180235 3300025918 Bacteria 1359
937 Ga0207662_10267266 3300025918 Bacteria 1128
938 Ga0207657_10000282 3300025919 Bacteria 54101
939 Ga0207657_10022013 3300025919 Bacteria 5985
940 Ga0207657_10028527 3300025919 Bacteria 5090
941 Ga0207657_10030957 3300025919 Bacteria 4850
942 Ga0207657_10113792 3300025919 Bacteria 2232
943 Ga0207657_10121967 3300025919 Bacteria 2144
944 Ga0207657_10172620 3300025919 Bacteria 1751
945 Ga0207649_10000052 3300025920 Bacteria 106800
946 Ga0207649_10003305 3300025920 Bacteria 8827
947 Ga0207649_10017750 3300025920 Bacteria 4034
948 Ga0207649_10126434 3300025920 Bacteria 1731
949 Ga0207652_10000824 3300025921 Bacteria 29561
950 Ga0207652_10004826 3300025921 Bacteria 10919
951 Ga0207652_10007272 3300025921 Bacteria 8921
952 Ga0207652_10107912 3300025921 Bacteria 2466
953 Ga0207652_10147609 3300025921 Bacteria 2105
954 Ga0207652_10154533 3300025921 Bacteria 2055
955 Ga0207652_10156241 3300025921 Bacteria 2043
956 Ga0207652_10176721 3300025921 Bacteria 1917
957 Ga0207652_10258914 3300025921 Bacteria 1569
958 Ga0207652_10563381 3300025921 Bacteria 1023
959 Ga0207652_10611943 3300025921 Bacteria 976
960 Ga0207646_10411174 3300025922 Bacteria 1222
961 Ga0207681_10001135 3300025923 Bacteria 17191
962 Ga0207681_10020623 3300025923 Bacteria 4180
963 Ga0207681_10181132 3300025923 Bacteria 1605
964 Ga0207694_10008694 3300025924 Bacteria 7666
965 Ga0207694_10011574 3300025924 Bacteria 6656
966 Ga0207694_10019951 3300025924 Bacteria 5071
967 Ga0207694_10064378 3300025924 Bacteria 2857
968 Ga0207694_10085496 3300025924 Bacteria 2483
969 Ga0207694_10112695 3300025924 Bacteria 2165
970 Ga0207694_10702792 3300025924 Bacteria 853
971 Ga0207650_10002132 3300025925 Bacteria 13834
972 Ga0207650_10002693 3300025925 Bacteria 12270
973 Ga0207650_10115626 3300025925 Bacteria 2082
974 Ga0207650_10201869 3300025925 Bacteria 1593
975 Ga0207659_10002396 3300025926 Bacteria 11152
976 Ga0207659_10005250 3300025926 Bacteria 7843
977 Ga0207659_10148016 3300025926 Bacteria 1831
978 Ga0207659_10177303 3300025926 Bacteria 1686
979 Ga0207687_10008117 3300025927 Bacteria 6871
980 Ga0207687_10008551 3300025927 Bacteria 6694
981 Ga0207700_10000295 3300025928 Bacteria 29631
982 Ga0207700_10022753 3300025928 Bacteria 4305
983 Ga0207700_10115423 3300025928 Bacteria 2168
984 Ga0207700_10259527 3300025928 Bacteria 1487
985 Ga0207700_10558935 3300025928 Bacteria 1016
986 Ga0207664_10012756 3300025929 Bacteria 6015
987 Ga0207664_10598571 3300025929 Bacteria 990
988 Ga0207644_10000212 3300025931 Bacteria 40175
989 Ga0207644_10017754 3300025931 Bacteria 4810
990 Ga0207644_10032576 3300025931 Bacteria 3637
991 Ga0207644_10037330 3300025931 Bacteria 3417
992 Ga0207644_10154463 3300025931 Bacteria 1778
993 Ga0207690_10001288 3300025932 Bacteria 15841
994 Ga0207690_10003444 3300025932 Bacteria 9444
995 Ga0207690_10214062 3300025932 Bacteria 1471
996 Ga0207690_10270071 3300025932 Bacteria 1321
997 Ga0207690_10388850 3300025932 Bacteria 1110
998 Ga0207690_10618028 3300025932 Bacteria 886
999 Ga0207706_10000270 3300025933 Bacteria 56584
1000 Ga0207706_10016311 3300025933 Bacteria 6707
1001 Ga0207706_10107179 3300025933 Bacteria 2459
1002 Ga0207706_10204141 3300025933 Bacteria 1733
1003 Ga0207706_10218770 3300025933 Bacteria 1668
1004 Ga0207706_10496828 3300025933 Bacteria 1053
1005 Ga0207706_10598655 3300025933 Bacteria 947
1006 Ga0207686_10002314 3300025934 Bacteria 10431
1007 Ga0207686_10010731 3300025934 Bacteria 4990
1008 Ga0207686_10063006 3300025934 Bacteria 2356
1009 Ga0207686_10146162 3300025934 Bacteria 1640
1010 Ga0207686_10262639 3300025934 Bacteria 1266
1011 Ga0207709_10000530 3300025935 Bacteria 33097
1012 Ga0207709_10027072 3300025935 Bacteria 3299
1013 Ga0207709_10032580 3300025935 Bacteria 3053
1014 Ga0207670_10011341 3300025936 Bacteria 5169
1015 Ga0207670_10015207 3300025936 Bacteria 4592
1016 Ga0207670_10025739 3300025936 Bacteria 3698
1017 Ga0207670_10175513 3300025936 Bacteria 1610
1018 Ga0207670_10594259 3300025936 Bacteria 908
1019 Ga0207669_10000235 3300025937 Bacteria 25138
1020 Ga0207669_10002208 3300025937 Bacteria 8271
1021 Ga0207669_10024031 3300025937 Bacteria 3268
1022 Ga0207669_10282956 3300025937 Bacteria 1252
1023 Ga0207704_10000198 3300025938 Bacteria 31182
1024 Ga0207704_10021735 3300025938 Bacteria 3423
1025 Ga0207704_10066691 3300025938 Bacteria 2260
1026 Ga0207665_10000273 3300025939 Bacteria 35752
1027 Ga0207665_10001538 3300025939 Bacteria 15513
1028 Ga0207665_10048387 3300025939 Bacteria 2854
1029 Ga0207665_10076554 3300025939 Bacteria 2295
1030 Ga0207665_10088220 3300025939 Bacteria 2146
1031 Ga0207665_10369237 3300025939 Bacteria 1087
1032 Ga0207665_10532161 3300025939 Bacteria 911
1033 Ga0207691_10053192 3300025940 Bacteria 3697
1034 Ga0207691_10067644 3300025940 Bacteria 3230
1035 Ga0207691_10102538 3300025940 Bacteria 2552
1036 Ga0207691_10512124 3300025940 Bacteria 1019
1037 Ga0207711_10127202 3300025941 Bacteria 2281
1038 Ga0207711_10151001 3300025941 Bacteria 2096
1039 Ga0207711_10230737 3300025941 Bacteria 1695
1040 Ga0207711_10759270 3300025941 Bacteria 904
1041 Ga0207689_10000031 3300025942 Bacteria 97131
1042 Ga0207689_10006518 3300025942 Bacteria 10303
1043 Ga0207689_10048864 3300025942 Bacteria 3490
1044 Ga0207689_10473180 3300025942 Bacteria 1048
1045 Ga0207661_10003727 3300025944 Bacteria 10622
1046 Ga0207661_10022097 3300025944 Bacteria 4783
1047 Ga0207661_10858952 3300025944 Bacteria 835
1048 Ga0207679_10000183 3300025945 Bacteria 51645
1049 Ga0207679_10004166 3300025945 Bacteria 8986
1050 Ga0207679_10102987 3300025945 Bacteria 2236
1051 Ga0207679_10132890 3300025945 Bacteria 1999
1052 Ga0207679_10324181 3300025945 Bacteria 1335
1053 Ga0207679_10462893 3300025945 Bacteria 1126
1054 Ga0207667_10004001 3300025949 Bacteria 18104
1055 Ga0207667_10006198 3300025949 Bacteria 14519
1056 Ga0207667_10011595 3300025949 Bacteria 10234
1057 Ga0207667_10032645 3300025949 Bacteria 5606
1058 Ga0207667_10059983 3300025949 Bacteria 3983
1059 Ga0207667_10090231 3300025949 Bacteria 3167
1060 Ga0207667_10099077 3300025949 Bacteria 3007
1061 Ga0207667_10119839 3300025949 Bacteria 2712
1062 Ga0207651_10000051 3300025960 Bacteria 54163
1063 Ga0207651_10093180 3300025960 Bacteria 2211
1064 Ga0207651_10269508 3300025960 Bacteria 1402
1065 Ga0207712_10001703 3300025961 Bacteria 14771
1066 Ga0207712_10037061 3300025961 Bacteria 3325
1067 Ga0207712_10042972 3300025961 Bacteria 3115
1068 Ga0207712_10115402 3300025961 Bacteria 2022
1069 Ga0207668_10001057 3300025972 Bacteria 16415
1070 Ga0207668_10001674 3300025972 Bacteria 12959
1071 Ga0207668_10029024 3300025972 Bacteria 3623
1072 Ga0207668_10105875 3300025972 Bacteria 2100
1073 Ga0207668_10125743 3300025972 Bacteria 1949
1074 Ga0207668_10183896 3300025972 Bacteria 1651
1075 Ga0207668_10574644 3300025972 Bacteria 979
1076 Ga0207640_10000343 3300025981 Bacteria 30767
1077 Ga0207640_10003639 3300025981 Bacteria 8314
1078 Ga0207640_10019616 3300025981 Bacteria 3999
1079 Ga0207640_10095916 3300025981 Bacteria 2066
1080 Ga0207640_10121661 3300025981 Bacteria 1871
1081 Ga0207658_10007478 3300025986 Bacteria 7442
1082 Ga0207658_10066111 3300025986 Bacteria 2718
1083 Ga0207658_10109450 3300025986 Bacteria 2181
1084 Ga0207658_10139551 3300025986 Bacteria 1959
1085 Ga0207658_10476475 3300025986 Bacteria 1108
1086 Ga0207658_10675322 3300025986 Bacteria 932
1087 Ga0207677_10003168 3300026023 Bacteria 8684
1088 Ga0207677_10040326 3300026023 Bacteria 3077
1089 Ga0207677_10046226 3300026023 Bacteria 2913
1090 Ga0207703_10010584 3300026035 Bacteria 7208
1091 Ga0207703_10039114 3300026035 Bacteria 3789
1092 Ga0207703_10083526 3300026035 Bacteria 2669
1093 Ga0207703_10351386 3300026035 Bacteria 1357
1094 Ga0207703_10424934 3300026035 Bacteria 1237
1095 Ga0207639_10002448 3300026041 Bacteria 12454
1096 Ga0207639_10010763 3300026041 Bacteria 6339
1097 Ga0207639_10052582 3300026041 Bacteria 3104
1098 Ga0207639_10237229 3300026041 Bacteria 1584
1099 Ga0207639_10506251 3300026041 Bacteria 1104
1100 Ga0207678_10000477 3300026067 Bacteria 36336
1101 Ga0207678_10005779 3300026067 Bacteria 11029
1102 Ga0207678_10021836 3300026067 Bacteria 5614
1103 Ga0207678_10024280 3300026067 Bacteria 5295
1104 Ga0207678_10166893 3300026067 Bacteria 1880
1105 Ga0207678_10336599 3300026067 Bacteria 1300
1106 Ga0207678_10380647 3300026067 Bacteria 1220
1107 Ga0207678_10472587 3300026067 Bacteria 1091
1108 Ga0207708_10000337 3300026075 Bacteria 36962
1109 Ga0207708_10014839 3300026075 Bacteria 5830
1110 Ga0207708_10016146 3300026075 Bacteria 5609
1111 Ga0207708_10271234 3300026075 Bacteria 1372
1112 Ga0207708_10614434 3300026075 Bacteria 922
1113 Ga0207702_10000315 3300026078 Bacteria 55383
1114 Ga0207702_10004643 3300026078 Bacteria 12151
1115 Ga0207702_10009824 3300026078 Bacteria 8022
1116 Ga0207702_10063888 3300026078 Bacteria 3149
1117 Ga0207702_10498314 3300026078 Bacteria 1187
1118 Ga0207702_10599284 3300026078 Bacteria 1081
1119 Ga0207702_10858171 3300026078 Bacteria 899
1120 Ga0207702_10967464 3300026078 Bacteria 844
1121 Ga0207641_10001831 3300026088 Bacteria 20447
1122 Ga0207641_10017486 3300026088 Bacteria 5870
1123 Ga0207641_10096916 3300026088 Bacteria 2591
1124 Ga0207641_10202763 3300026088 Bacteria 1830
1125 Ga0207641_10324756 3300026088 Bacteria 1460
1126 Ga0207641_10649489 3300026088 Bacteria 1036
1127 Ga0207648_10068585 3300026089 Bacteria 3090
1128 Ga0207648_10240702 3300026089 Bacteria 1611
1129 Ga0207676_10000124 3300026095 Bacteria 67747
1130 Ga0207676_10028077 3300026095 Bacteria 4199
1131 Ga0207676_10064765 3300026095 Bacteria 2908
1132 Ga0207676_10250941 3300026095 Bacteria 1593
1133 Ga0207676_10339638 3300026095 Bacteria 1385
1134 Ga0207674_10001605 3300026116 Bacteria 29115
1135 Ga0207674_10016004 3300026116 Bacteria 8216
1136 Ga0207674_10030575 3300026116 Bacteria 5660
1137 Ga0207674_10081317 3300026116 Bacteria 3242
1138 Ga0207674_10103964 3300026116 Bacteria 2819
1139 Ga0207674_10269417 3300026116 Bacteria 1650
1140 Ga0207674_10364721 3300026116 Bacteria 1396
1141 Ga0207675_100001292 3300026118 Bacteria 25099
1142 Ga0207675_100022526 3300026118 Bacteria 5865
1143 Ga0207675_100029702 3300026118 Bacteria 5090
1144 Ga0207675_100262552 3300026118 Bacteria 1674
1145 Ga0207675_100309836 3300026118 Bacteria 1539
1146 Ga0207683_10000242 3300026121 Bacteria 48576
1147 Ga0207683_10000681 3300026121 Bacteria 31192
1148 Ga0207683_10010724 3300026121 Bacteria 7813
1149 Ga0207683_10036836 3300026121 Bacteria 4260
1150 Ga0207683_10177349 3300026121 Bacteria 1932
1151 Ga0207683_10190520 3300026121 Bacteria 1862
1152 Ga0207698_10010960 3300026142 Bacteria 5857
1153 Ga0207698_10012405 3300026142 Bacteria 5574
1154 Ga0207698_10021538 3300026142 Bacteria 4461
1155 Ga0207698_10089559 3300026142 Bacteria 2513
1156 Ga0207698_10164361 3300026142 Bacteria 1946
1157 Ga0207698_11026729 3300026142 Bacteria 836
1158 Ga0209281_1000573 3300027111 Bacteria 43668
1159 Ga0209281_1001498 3300027111 Bacteria 13357
1160 Ga0209973_1014002 3300027252 Bacteria 996
1161 Ga0209371_1000058 3300027312 Bacteria 237920
1162 Ga0209371_1002385 3300027312 Bacteria 10609
1163 Ga0209371_1003464 3300027312 Bacteria 7645
1164 Ga0209995_1033375 3300027471 Bacteria 864
1165 Ga0209968_1012500 3300027526 Bacteria 1323
1166 Ga0209970_1006501 3300027614 Bacteria 1919
1167 Ga0210002_1009632 3300027617 Bacteria 1476
1168 Ga0209282_1000054 3300027666 Bacteria 101427
1169 Ga0209282_1018246 3300027666 Bacteria 4454
1170 Ga0209971_1004807 3300027682 Bacteria 3209
1171 Ga0209966_1001282 3300027695 Bacteria 4460
1172 Ga0209998_10010168 3300027717 Bacteria 1948
1173 Ga0209998_10020523 3300027717 Bacteria 1414
1174 Ga0209998_10021393 3300027717 Bacteria 1389
1175 Ga0209813_10000248 3300027866 Bacteria 15848
1176 Ga0209813_10000406 3300027866 Bacteria 10561
1177 Ga0209813_10038178 3300027866 Bacteria 1450
1178 Ga0209974_10031999 3300027876 Bacteria 1742
1179 Ga0207428_10000037 3300027907 Bacteria 218857
1180 Ga0207428_10002442 3300027907 Bacteria 18563
1181 Ga0207428_10008303 3300027907 Bacteria 9386
1182 Ga0207428_10020203 3300027907 Bacteria 5663
1183 Ga0207428_10044624 3300027907 Bacteria 3576
1184 Ga0207428_10189753 3300027907 Bacteria 1550
1185 Ga0207428_10256809 3300027907 Bacteria 1302
1186 Ga0268266_10000557 3300028379 Bacteria 51935
1187 Ga0268266_10007549 3300028379 Bacteria 9794
1188 Ga0268266_10012480 3300028379 Bacteria 7342
1189 Ga0268266_10036033 3300028379 Bacteria 4209
1190 Ga0268266_10037309 3300028379 Bacteria 4141
1191 Ga0268266_10149237 3300028379 Bacteria 2105
1192 Ga0268266_10194952 3300028379 Bacteria 1851
1193 Ga0268266_10250643 3300028379 Bacteria 1637
1194 Ga0268266_10467463 3300028379 Bacteria 1201
1195 Ga0268266_10836611 3300028379 Bacteria 889
1196 Ga0268266_10865957 3300028379 Bacteria 873
1197 Ga0268265_10003320 3300028380 Bacteria 11642
1198 Ga0268265_10028090 3300028380 Bacteria 4025
1199 Ga0268265_10028273 3300028380 Bacteria 4013
1200 Ga0268265_10108682 3300028380 Bacteria 2258
1201 Ga0268265_10118353 3300028380 Bacteria 2178
1202 Ga0268265_10158165 3300028380 Bacteria 1920
1203 Ga0268265_10628796 3300028380 Bacteria 1029
1204 Ga0268264_10003234 3300028381 Bacteria 14103
1205 Ga0268264_10020640 3300028381 Bacteria 5382
1206 Ga0268264_10036227 3300028381 Bacteria 4063
1207 Ga0268264_10177216 3300028381 Bacteria 1933
1208 Ga0265334_10040684 3300028573 Bacteria 1819
1209 Ga0265318_10000037 3300028577 Bacteria 138223
1210 Ga0265318_10004765 3300028577 Bacteria 6501
1211 Ga0265318_10046641 3300028577 Bacteria 1635
1212 Ga0265318_10048808 3300028577 Bacteria 1594
1213 Ga0307515_10001393 3300028794 Bacteria 54715
1214 Ga0307515_10038448 3300028794 Bacteria 7654
1215 Ga0307515_10058447 3300028794 Bacteria 5553
1216 Ga0307515_10091937 3300028794 Bacteria 3783
1217 Ga0307515_10168973 3300028794 Bacteria 2190
1218 Ga0265338_10000017 3300028800 Bacteria 344481
1219 Ga0265338_10007393 3300028800 Bacteria 13651
1220 Ga0265338_10017000 3300028800 Bacteria 7869
1221 Ga0265338_10023435 3300028800 Bacteria 6346
1222 Ga0265338_10080854 3300028800 Bacteria 2728
1223 Ga0265338_10084066 3300028800 Bacteria 2659
1224 Ga0268256_1000056 3300030500 Bacteria 231684
1225 Ga0268256_1002127 3300030500 Bacteria 10559
1226 Ga0316181_1138026 3300030744 Bacteria 2108
1227 Ga0316182_1083286 3300030745 Bacteria 2893
1228 Ga0265330_10010675 3300031235 Bacteria 4322
1229 Ga0265330_10046835 3300031235 Bacteria 1904
1230 Ga0265330_10107712 3300031235 Bacteria 1191
1231 Ga0265332_10012502 3300031238 Bacteria 3767
1232 Ga0265332_10017013 3300031238 Bacteria 3208
1233 Ga0265332_10157487 3300031238 Bacteria 949
1234 Ga0265328_10000041 3300031239 Bacteria 89398
1235 Ga0265328_10002900 3300031239 Bacteria 7646
1236 Ga0265328_10005203 3300031239 Bacteria 5592
1237 Ga0265328_10009346 3300031239 Bacteria 3996
1238 Ga0265328_10013913 3300031239 Bacteria 3175
1239 Ga0265328_10039260 3300031239 Bacteria 1746
1240 Ga0265325_10000014 3300031241 Bacteria 131579
1241 Ga0265325_10001071 3300031241 Bacteria 19727
1242 Ga0265325_10007856 3300031241 Bacteria 6350
1243 Ga0265325_10012680 3300031241 Bacteria 4814
1244 Ga0265325_10015753 3300031241 Bacteria 4242
1245 Ga0265325_10016753 3300031241 Bacteria 4090
1246 Ga0265325_10036457 3300031241 Bacteria 2604
1247 Ga0265325_10048954 3300031241 Bacteria 2183
1248 Ga0265325_10200478 3300031241 Bacteria 921
1249 Ga0265329_10032828 3300031242 Bacteria 1680
1250 Ga0265329_10054789 3300031242 Bacteria 1266
1251 Ga0265340_10001769 3300031247 Bacteria 12330
1252 Ga0265340_10006375 3300031247 Bacteria 6500
1253 Ga0265340_10006598 3300031247 Bacteria 6374
1254 Ga0265340_10021364 3300031247 Bacteria 3320
1255 Ga0265340_10031774 3300031247 Bacteria 2638
1256 Ga0265340_10062403 3300031247 Bacteria 1780
1257 Ga0265340_10065829 3300031247 Bacteria 1725
1258 Ga0265339_10000256 3300031249 Bacteria 42839
1259 Ga0265339_10002105 3300031249 Bacteria 14517
1260 Ga0265339_10004598 3300031249 Bacteria 9392
1261 Ga0265339_10007379 3300031249 Bacteria 7114
1262 Ga0265339_10009282 3300031249 Bacteria 6196
1263 Ga0265339_10045403 3300031249 Bacteria 2418
1264 Ga0265339_10077413 3300031249 Bacteria 1763
1265 Ga0265331_10004741 3300031250 Bacteria 8403
1266 Ga0265331_10005768 3300031250 Bacteria 7418
1267 Ga0265331_10014090 3300031250 Bacteria 4271
1268 Ga0265331_10018237 3300031250 Bacteria 3645
1269 Ga0265331_10029937 3300031250 Bacteria 2714
1270 Ga0265331_10034498 3300031250 Bacteria 2496
1271 Ga0265331_10087123 3300031250 Bacteria 1446
1272 Ga0265327_10001297 3300031251 Bacteria 32731
1273 Ga0265327_10014494 3300031251 Bacteria 5154
1274 Ga0265327_10040029 3300031251 Bacteria 2539
1275 Ga0265327_10091393 3300031251 Bacteria 1483
1276 Ga0265316_10015933 3300031344 Bacteria 6544
1277 Ga0265316_10030464 3300031344 Bacteria 4422
1278 Ga0265316_10076581 3300031344 Bacteria 2570
1279 Ga0265316_10104221 3300031344 Bacteria 2153
1280 Ga0307513_10005182 3300031456 Bacteria 17271
1281 Ga0307513_10028569 3300031456 Bacteria 6373
1282 Ga0307513_10082281 3300031456 Bacteria 3315
1283 Ga0307408_100012729 3300031548 Bacteria 5578
1284 Ga0265313_10000031 3300031595 Bacteria 128981
1285 Ga0265313_10000800 3300031595 Bacteria 31814
1286 Ga0265313_10007021 3300031595 Bacteria 7808
1287 Ga0265313_10009717 3300031595 Bacteria 6202
1288 Ga0265313_10016370 3300031595 Bacteria 4264
1289 Ga0265313_10016556 3300031595 Bacteria 4233
1290 Ga0265313_10019153 3300031595 Bacteria 3821
1291 Ga0265313_10022840 3300031595 Bacteria 3384
1292 Ga0265313_10031690 3300031595 Bacteria 2707
1293 Ga0265313_10041902 3300031595 Bacteria 2252
1294 Ga0265313_10081585 3300031595 Bacteria 1468
1295 Ga0307514_10164714 3300031649 Bacteria 1461
1296 Ga0316575_10000986 3300031665 Bacteria 8786
1297 Ga0316575_10024618 3300031665 Bacteria 2332
1298 Ga0316575_10106552 3300031665 Bacteria 1142
1299 Ga0316579_10010091 3300031691 Bacteria 3985
1300 Ga0316579_10077344 3300031691 Bacteria 1582
1301 Ga0265314_10008857 3300031711 Bacteria 8590
1302 Ga0265314_10009081 3300031711 Bacteria 8445
1303 Ga0265314_10019382 3300031711 Bacteria 5272
1304 Ga0265314_10025339 3300031711 Bacteria 4476
1305 Ga0265314_10027518 3300031711 Bacteria 4257
1306 Ga0265314_10040994 3300031711 Bacteria 3318
1307 Ga0265314_10082484 3300031711 Bacteria 2115
1308 Ga0265314_10084434 3300031711 Bacteria 2084
1309 Ga0265314_10093736 3300031711 Bacteria 1949
1310 Ga0265342_10000677 3300031712 Bacteria 35579
1311 Ga0265342_10004137 3300031712 Bacteria 11550
1312 Ga0265342_10030308 3300031712 Bacteria 3353
1313 Ga0265342_10030570 3300031712 Bacteria 3336
1314 Ga0265342_10042585 3300031712 Bacteria 2742
1315 Ga0265342_10046067 3300031712 Bacteria 2622
1316 Ga0265342_10061994 3300031712 Bacteria 2202
1317 Ga0265342_10065337 3300031712 Bacteria 2132
1318 Ga0316576_10005834 3300031727 Bacteria 7592
1319 Ga0316578_10029177 3300031728 Bacteria 3129
1320 Ga0316578_10041698 3300031728 Bacteria 2659
1321 Ga0307516_10057860 3300031730 Bacteria 3775
1322 Ga0307516_10110667 3300031730 Bacteria 2550
1323 Ga0307516_10199083 3300031730 Bacteria 1724
1324 Ga0307405_10006207 3300031731 Bacteria 5858
1325 Ga0307405_10032436 3300031731 Bacteria 3088
1326 Ga0316577_10009939 3300031733 Bacteria 5131
1327 Ga0307410_10026483 3300031852 Bacteria 3651
1328 Ga0315914_1000013 3300031967 Bacteria 133640
1329 Ga0307409_100146156 3300031995 Bacteria 2045
1330 Ga0307409_100305882 3300031995 Bacteria 1481
1331 Ga0307416_100319767 3300032002 Bacteria 1553
1332 Ga0307414_10010544 3300032004 Bacteria 5370
1333 Ga0307414_10034165 3300032004 Bacteria 3368
1334 Ga0307414_10289309 3300032004 Bacteria 1381
1335 Ga0307415_100698057 3300032126 Bacteria 915
1336 Ga0316583_10004306 3300032133 Bacteria 5075
1337 Ga0316585_10085954 3300032137 Bacteria 1027
1338 Ga0316593_10000349 3300032168 Bacteria 8071
1339 Ga0316593_10000860 3300032168 Bacteria 6144
1340 Ga0316593_10001189 3300032168 Bacteria 5568
1341 Ga0316593_10003175 3300032168 Bacteria 4037
1342 Ga0316593_10048236 3300032168 Bacteria 1433
1343 Ga0316593_10103732 3300032168 Bacteria 1011
1344 Ga0315913_1000097 3300033430 Bacteria 51051
1345 Ga0315915_1000001 3300033464 Bacteria 481518
1346 Ga0316592_1000190 3300033524 Bacteria 7350
1347 Ga0316592_1000411 3300033524 Bacteria 5776
1348 Ga0316586_1002540 3300033527 Bacteria 2287
1349 Ga0316588_1000167 3300033528 Bacteria 7370
1350 Ga0316596_1000615 3300033541 Bacteria 6324
1351 Ga0316596_1000644 3300033541 Bacteria 6242
1352 Ga0316596_1021562 3300033541 Bacteria 1643
1353 Ga0316596_1051566 3300033541 Bacteria 1089
1354 Ga0373930_0000191 3300034816 Bacteria 7407
1355 Ga0373930_0009279 3300034816 Bacteria 1739
1356 Ga0373930_0062679 3300034816 Bacteria 832
1357 Ga0373948_0003080 3300034817 Bacteria 2531
1358 Ga0373948_0004234 3300034817 Bacteria 2256
1359 Ga0373950_0000925 3300034818 Bacteria 3708
1360 Ga0373950_0006450 3300034818 Bacteria 1790
1361 Ga0373958_0022754 3300034819 Bacteria 1173
1362 Ga0373958_0033155 3300034819 Bacteria 1023
1363 Ga0373959_0003719 3300034820 Bacteria 2439
1364 Ga0373959_0007428 3300034820 Bacteria 1842
1365 Ga0373959_0023996 3300034820 Bacteria 1189
1366 Ga0373938_0004374 3300034957 Bacteria 2358
1367 Ga0373938_0012114 3300034957 Bacteria 1613
1368 Ga0373938_0012157 3300034957 Bacteria 1611
1369 Ga0373926_0016936 3300035083 Bacteria 2497
1370 Ga0373926_0084343 3300035083 Bacteria 1177
1371 Ga0373928_0006181 3300035084 Bacteria 2299
1372 Ga0373929_0001907 3300035085 Bacteria 3900
1373 Ga0373929_0015106 3300035085 Bacteria 1498
1374 Ga0373934_0025835 3300035086 Bacteria 2276
1375 Ga0373934_0026847 3300035086 Bacteria 2235
1376 Ga0373934_0047873 3300035086 Bacteria 1692
1377 Ga0373940_0001317 3300035088 Bacteria 4421
1378 Ga0373940_0009733 3300035088 Bacteria 2242
1379 Ga0373940_0018090 3300035088 Bacteria 1764
1380 Ga0373944_0002638 3300035089 Bacteria 4566
1381 Ga0373944_0008486 3300035089 Bacteria 2775
1382 Ga0373951_0000552 3300035091 Bacteria 10501
1383 Ga0373951_0003581 3300035091 Bacteria 3746
1384 Ga0373952_0005332 3300035092 Bacteria 2347
1385 Ga0373952_0012492 3300035092 Bacteria 1671
1386 Ga0373952_0046983 3300035092 Bacteria 1016
1387 Ga0373923_0000448 3300035111 Bacteria 9770
1388 Ga0373923_0046779 3300035111 Bacteria 1801
1389 Ga0373932_0002338 3300035112 Bacteria 4813
1390 Ga0373932_0002861 3300035112 Bacteria 4267
1391 Ga0373936_0037180 3300035113 Bacteria 1943
1392 Ga0373936_0047071 3300035113 Bacteria 1739
1393 Ga0373939_0001965 3300035114 Bacteria 4916
1394 Ga0373939_0008019 3300035114 Bacteria 2579
1395 Ga0373939_0011849 3300035114 Bacteria 2211
1396 Ga0373939_0012977 3300035114 Bacteria 2134
1397 Ga0373941_0007550 3300035115 Bacteria 2663
1398 Ga0373941_0009300 3300035115 Bacteria 2470
1399 Ga0373941_0067047 3300035115 Bacteria 1183
1400 Ga0373941_0144616 3300035115 Bacteria 867
1401 Ga0373945_0000882 3300035116 Bacteria 8855
1402 Ga0373953_0000440 3300035117 Bacteria 11394
1403 Ga0373953_0026149 3300035117 Bacteria 2234
1404 Ga0373954_0036748 3300035118 Bacteria 2274
1405 Ga0373954_0105233 3300035118 Bacteria 1362
1406 Ga0373956_0006607 3300035119 Bacteria 4650
1407 Ga0373956_0012098 3300035119 Bacteria 3570
1408 Ga0373956_0013435 3300035119 Bacteria 3406
1409 Ga0373957_0004663 3300035120 Bacteria 4190
1410 Ga0373957_0018481 3300035120 Bacteria 2443
1411 Ga0373960_0000068 3300035121 Bacteria 14664
1412 Ga0373960_0001622 3300035121 Bacteria 5029
1413 Ga0373960_0005540 3300035121 Bacteria 2930
1414 Ga0373960_0006767 3300035121 Bacteria 2697
1415 Ga0373960_0046732 3300035121 Bacteria 1271
1416 Ga0373943_0006231 3300035170 Bacteria 5358
1417 Ga0373943_0191945 3300035170 Bacteria 1127
1418 Ga0373946_0014458 3300035171 Bacteria 2977
1419 Ga0373946_0022633 3300035171 Bacteria 2448
1420 Ga0373955_0001179 3300035172 Bacteria 11123
1421 Ga0373955_0004283 3300035172 Bacteria 6301
1422 Ga0373955_0016494 3300035172 Bacteria 3637
1423 Ga0373955_0022992 3300035172 Bacteria 3170
1424 Ga0373942_0007725 3300035207 Bacteria 2501
1425 Ga0373942_0014455 3300035207 Bacteria 1911
1426 Ga0373961_0003115 3300035241 Bacteria 4156
1427 Ga0373961_0023022 3300035241 Bacteria 1672
1428 Ga0373961_0029192 3300035241 Bacteria 1526
1429 Ga0373961_0044148 3300035241 Bacteria 1299
1430 Ga0373961_0117116 3300035241 Bacteria 879
1431 Ga0373962_0000112 3300035242 Bacteria 16939
1432 Ga0373962_0002272 3300035242 Bacteria 4588
1433 Ga0373962_0009631 3300035242 Bacteria 2397
1434 Ga0373962_0011330 3300035242 Bacteria 2234
1435 Ga0373962_0022167 3300035242 Bacteria 1682
1436 Ga0316574_0001643 3300035398 Bacteria 10749
1437 Ga0316574_0009371 3300035398 Bacteria 5483
1438 Ga0316574_0347791 3300035398 Bacteria 938
1439 Ga0373924_0073776 3300035410 Bacteria 1443
1440 Ga0373931_0000305 3300035691 Bacteria 20657
1441 Ga0373931_0001634 3300035691 Bacteria 9691
1442 Ga0373931_0001781 3300035691 Bacteria 9363
1443 Ga0373931_0004918 3300035691 Bacteria 6144
1444 Ga0373931_0017627 3300035691 Bacteria 3535
1445 Ga0373931_0028314 3300035691 Bacteria 2867
1446 Ga0373931_0045705 3300035691 Bacteria 2313
1447 Ga0373931_0304390 3300035691 Bacteria 985
1448 Ga0373935_0003403 3300035692 Bacteria 9238
1449 Ga0373935_0030398 3300035692 Bacteria 3348
1450 Ga0373935_0062698 3300035692 Bacteria 2382
1451 Ga0373935_0064874 3300035692 Bacteria 2342
1452 Ga0373935_0077710 3300035692 Bacteria 2151
1453 Ga0373935_0466510 3300035692 Bacteria 914
1454 Ga0373927_0000971 3300035695 Bacteria 21800
1455 Ga0373927_0023717 3300035695 Bacteria 4016
1456 Ga0373927_0269383 3300035695 Bacteria 1120
1457 Ga0373933_0006317 3300035724 Bacteria 6451
1458 Ga0373933_0020677 3300035724 Bacteria 3731
1459 Ga0373933_0032722 3300035724 Bacteria 3023
1460 Ga0373933_0036285 3300035724 Bacteria 2884
1461 Ga0373933_0078302 3300035724 Bacteria 2022
1462 Ga0373947_0006238 3300035725 Bacteria 6931
1463 Ga0373947_0006914 3300035725 Bacteria 6575
1464 Ga0373947_0009172 3300035725 Bacteria 5687
1465 Ga0373947_0040331 3300035725 Bacteria 2780
1466 Ga0373947_0061291 3300035725 Bacteria 2286
1467 Ga0373947_0106611 3300035725 Bacteria 1766
1468 Ga0373937_0007608 3300036401 Bacteria 9383
1469 Ga0373937_0011350 3300036401 Bacteria 7816
1470 Ga0373937_0014628 3300036401 Bacteria 6929
1471 Ga0373937_0058492 3300036401 Bacteria 3541
1472 Ga0373937_0092550 3300036401 Bacteria 2802
1473 Ga0373937_0133914 3300036401 Bacteria 2316
1474 Ga0373937_0168260 3300036401 Bacteria 2056
1475 Ga0373937_0200254 3300036401 Bacteria 1877
1476 Ga0373937_0804191 3300036401 Bacteria 888
1477 Ga0316582_0009543 3300036647 Bacteria 5271
1478 Ga0316582_0012852 3300036647 Bacteria 4690
1479 Ga0316582_0075521 3300036647 Bacteria 2190
1480 Ga0316582_0082850 3300036647 Bacteria 2098
1481 Ga0316582_0094924 3300036647 Bacteria 1968
1482 Ga0316582_0120148 3300036647 Bacteria 1757
1483 Ga0316584_0001849 3300036712 Bacteria 13108
1484 Ga0316584_0135941 3300036712 Bacteria 1835
1485 Ga0373925_0002514 3300037068 Bacteria 14651
1486 Ga0373925_0011485 3300037068 Bacteria 6409
1487 Ga0373925_0032780 3300037068 Bacteria 3825
1488 Ga0373925_0058813 3300037068 Bacteria 2882
1489 Ga0373925_0125298 3300037068 Bacteria 1998
1490 Ga0373925_0269852 3300037068 Bacteria 1368
1491 Ga0395899_0026792 3300037312 Bacteria 4349
1492 Ga0395899_0081310 3300037312 Bacteria 2357
1493 Ga0395899_0289238 3300037312 Bacteria 1112
1494 Ga0395900_0022401 3300037418 Bacteria 6461
1495 Ga0395900_0087578 3300037418 Bacteria 3200
1496 Ga0395898_0021752 3300037466 Bacteria 6499
1497 Ga0395898_0052542 3300037466 Bacteria 3981
1498 Ga0395898_0055115 3300037466 Bacteria 3878
1499 Ga0395898_0209677 3300037466 Bacteria 1858
1500 Ga0395898_0274724 3300037466 Bacteria 1607
1501 Ga0395905_0002506 3300037471 Bacteria 20297
1502 Ga0395905_0012867 3300037471 Bacteria 8042
1503 Ga0395905_0033796 3300037471 Bacteria 4803
1504 Ga0395905_0257703 3300037471 Bacteria 1629
1505 Ga0395905_0353396 3300037471 Bacteria 1362
1506 Ga0316581_0000487 3300037588 Bacteria 7649
1507 Ga0316581_0001826 3300037588 Bacteria 4942
1508 Ga0436364_0638689 3300037853 Bacteria 1131
1509 Ga0395901_0002674 3300038443 Bacteria 17986
1510 Ga0395901_0067405 3300038443 Bacteria 3727
1511 Ga0395901_0478499 3300038443 Bacteria 1270
1512 Ga0400490_40073 3300038726 Bacteria 2055
1513 Ga0400485_07971 3300038735 Bacteria 1547
1514 Ga0400486_32139 3300038742 Bacteria 2745
1515 Ga0242420_001850 3300038996 Bacteria 2919
1516 Ga0400483_042328 3300039062 Bacteria 1928
1517 Ga0400483_079140 3300039062 Bacteria 6427
1518 Ga0400483_191097 3300039062 Bacteria 1152
1519 Ga0400483_260675 3300039062 Bacteria 2087
1520 Ga0400487_17567 3300039110 Bacteria 3710
1521 Ga0436365_0037314 3300039437 Bacteria 1393
1522 Ga0436365_0315304 3300039437 Bacteria 1086
1523 Ga0436365_0580625 3300039437 Bacteria 2820
1524 Ga0436365_0731580 3300039437 Bacteria 1027
1525 Ga0436365_0956500 3300039437 Bacteria 1202
1526 Ga0436365_1609996 3300039437 Bacteria 6251
1527 Ga0436365_1637588 3300039437 Bacteria 49130
1528 Ga0436365_1779536 3300039437 Bacteria 1120
1529 Ga0436361_0643647 3300039447 Bacteria 2141
1530 Ga0436363_0441746 3300039450 Bacteria 1356
1531 Ga0436363_1404294 3300039450 Bacteria 4549
1532 Ga0436363_1571548 3300039450 Bacteria 7951
1533 Ga0436363_1585904 3300039450 Bacteria 1025
1534 Ga0436362_0181583 3300039453 Bacteria 1373
1535 Ga0436362_0464518 3300039453 Bacteria 938
1536 Ga0439438_017474 3300041405 Bacteria 2064
1537 Ga0439453_0008967 3300041408 Bacteria 1620
1538 Ga0439465_0040351 3300041413 Bacteria 1508
1539 Ga0451794_39427 3300041446 Bacteria 1095
1540 Ga0451833_0093746 3300041491 Bacteria 5937
1541 Ga0451835_0028721 3300041492 Bacteria 5896
1542 Ga0451837_0879643 3300041494 Bacteria 4278
1543 Ga0451839_0229334 3300041496 Bacteria 4844
1544 Ga0451841_0087010 3300041498 Bacteria 4773
1545 Ga0451845_0062342 3300041501 Bacteria 6073
1546 Ga0451846_01205 3300041502 Bacteria 8545
1547 Ga0451847_0040601 3300041503 Bacteria 5858
1548 Ga0451848_08151 3300041504 Bacteria 1081
1549 Ga0451849_0038121 3300041505 Bacteria 2034
1550 Ga0451851_0046308 3300041507 Bacteria 6790
1551 Ga0451854_09647 3300041510 Bacteria 5803
1552 Ga0451853_2317430 3300041512 Bacteria 8180
1553 Ga0452271_14635 3300041916 Bacteria 2209
1554 Ga0439448_0017297 3300042005 Bacteria 2201
1555 Ga0439449_0002592 3300042007 Bacteria 7052
1556 Ga0439455_0003014 3300042012 Bacteria 3160
1557 Ga0439463_024157 3300042016 Bacteria 1523
1558 Ga0439458_0008522 3300042157 Bacteria 2285
1559 Ga0439464_0027732 3300042439 Bacteria 1575
1560 Ga0439460_0007741 3300042461 Bacteria 2695
1561 Ga0466969_0085473 3300044656 Bacteria 1500
1562 Ga0466966_0023993 3300044684 Bacteria 3992
1563 Ga0466963_0016197 3300044694 Bacteria 4633
1564 Ga0453684_0087005 3300044712 Bacteria 3875
1565 Ga0466957_0046178 3300044842 Bacteria 2643
1566 Ga0466957_0090403 3300044842 Bacteria 1917
1567 Ga0466957_0429825 3300044842 Bacteria 907
1568 Ga0466959_0011129 3300045049 Bacteria 6456
1569 Ga0466959_0142031 3300045049 Bacteria 1696
1570 Ga0451576_0010751 3300045051 Bacteria 10476
1571 Ga0451576_0073262 3300045051 Bacteria 3564
1572 Ga0451576_0354049 3300045051 Bacteria 1537
1573 Ga0466967_0011664 3300045976 Bacteria 6675
1574 Ga0466967_0131550 3300045976 Bacteria 2323
1575 Ga0466967_0541025 3300045976 Bacteria 1146
1576 Ga0466967_0637777 3300045976 Bacteria 1053
1577 Ga0495617_044945 3300046452 Bacteria 1473
1578 Ga0495592_0001138 3300046454 Bacteria 18507
1579 Ga0495592_0073224 3300046454 Bacteria 2491
1580 Ga0495592_0128170 3300046454 Bacteria 1777
1581 Ga0495592_0226222 3300046454 Bacteria 1248
1582 Ga0495603_0000280 3300046455 Bacteria 27139
1583 Ga0495603_0012514 3300046455 Bacteria 5137
1584 Ga0495603_0017036 3300046455 Bacteria 4397
1585 Ga0495629_0000177 3300046459 Bacteria 56906
1586 Ga0495629_0000317 3300046459 Bacteria 41238
1587 Ga0495629_0077709 3300046459 Bacteria 2317
1588 Ga0495629_0138137 3300046459 Bacteria 1696
1589 Ga0495638_0030598 3300046460 Bacteria 3463
1590 Ga0495638_0040593 3300046460 Bacteria 2948
1591 Ga0495641_0009769 3300046461 Bacteria 5662
1592 Ga0495641_0010544 3300046461 Bacteria 5343
1593 Ga0495641_0090972 3300046461 Bacteria 1363
1594 Ga0495651_0004850 3300046462 Bacteria 10291
1595 Ga0495651_0021253 3300046462 Bacteria 5043
1596 Ga0495651_0039704 3300046462 Bacteria 3663
1597 Ga0495651_0133660 3300046462 Bacteria 1808
1598 Ga0495651_0508101 3300046462 Bacteria 771
1599 Ga0495653_0009077 3300046463 Bacteria 8133
1600 Ga0495653_0061061 3300046463 Bacteria 2853
1601 Ga0495653_0103856 3300046463 Bacteria 2054
1602 Ga0495580_0000498 3300046472 Bacteria 32908
1603 Ga0495580_0003736 3300046472 Bacteria 12895
1604 Ga0495580_0118153 3300046472 Bacteria 1841
1605 Ga0495580_0489446 3300046472 Bacteria 822
1606 Ga0495582_0000185 3300046473 Bacteria 34065
1607 Ga0495582_0007655 3300046473 Bacteria 5970
1608 Ga0495582_0014384 3300046473 Bacteria 4350
1609 Ga0495582_0018420 3300046473 Bacteria 3818
1610 Ga0495639_0001788 3300046475 Bacteria 9521
1611 Ga0495639_0014947 3300046475 Bacteria 3364
1612 Ga0495662_0007059 3300046476 Bacteria 5577
1613 Ga0495664_0017680 3300046477 Bacteria 4077
1614 Ga0495664_0086743 3300046477 Bacteria 1880
1615 Ga0495584_0016774 3300046491 Bacteria 3734
1616 Ga0495584_0021305 3300046491 Bacteria 3294
1617 Ga0495584_0131949 3300046491 Bacteria 1267
1618 Ga0495585_0004711 3300046492 Bacteria 8786
1619 Ga0495594_0000224 3300046499 Bacteria 27588
1620 Ga0495594_0017716 3300046499 Bacteria 3766
1621 Ga0495594_0096582 3300046499 Bacteria 1660
1622 Ga0495594_0151982 3300046499 Bacteria 1314
1623 Ga0495607_0005316 3300046501 Bacteria 9259
1624 Ga0495583_0144109 3300046506 Bacteria 990
1625 Ga0495583_0161558 3300046506 Bacteria 924
1626 Ga0495608_0003772 3300046511 Bacteria 10886
1627 Ga0495608_0007771 3300046511 Bacteria 7551
1628 Ga0495608_0039811 3300046511 Bacteria 3149
1629 Ga0495608_0072723 3300046511 Bacteria 2243
1630 Ga0495610_0049507 3300046512 Bacteria 2057
1631 Ga0495610_0133827 3300046512 Bacteria 1074
1632 Ga0495618_0048059 3300046514 Bacteria 2693
1633 Ga0495628_0002285 3300046516 Bacteria 17341
1634 Ga0495628_0005831 3300046516 Bacteria 10790
1635 Ga0495628_0032936 3300046516 Bacteria 4179
1636 Ga0495628_0122932 3300046516 Bacteria 1990
1637 Ga0495630_0013363 3300046517 Bacteria 5975
1638 Ga0495630_0196354 3300046517 Bacteria 1540
1639 Ga0495630_0344292 3300046517 Bacteria 1141
1640 Ga0495637_0023780 3300046520 Bacteria 2777
1641 Ga0495637_0097986 3300046520 Bacteria 1149
1642 Ga0495643_0036171 3300046522 Bacteria 2714
1643 Ga0495644_0000713 3300046523 Bacteria 13759
1644 Ga0495644_0087680 3300046523 Bacteria 1173
1645 Ga0495663_0001514 3300046525 Bacteria 7303
1646 Ga0495666_0016673 3300046526 Bacteria 3657
1647 Ga0495652_0005034 3300046529 Bacteria 12508
1648 Ga0495652_0026548 3300046529 Bacteria 5115
1649 Ga0495652_0080765 3300046529 Bacteria 2684
1650 Ga0495652_0269116 3300046529 Bacteria 1253
1651 Ga0495654_0000169 3300046530 Bacteria 64210
1652 Ga0495665_0004028 3300046531 Bacteria 7928
1653 Ga0495665_0004234 3300046531 Bacteria 7745
1654 Ga0495640_0027827 3300046533 Bacteria 4072
1655 Ga0495586_0006192 3300046535 Bacteria 6400
1656 Ga0495586_0191946 3300046535 Bacteria 1157
1657 Ga0495587_0001073 3300046536 Bacteria 17964
1658 Ga0495587_0025139 3300046536 Bacteria 3641
1659 Ga0495587_0117665 3300046536 Bacteria 1523
1660 Ga0495598_0000729 3300046537 Bacteria 6257
1661 Ga0495609_0085132 3300046538 Bacteria 1379
1662 Ga0495609_0117575 3300046538 Bacteria 1145
1663 Ga0495621_0107912 3300046539 Bacteria 1065
1664 Ga0495597_0172058 3300046542 Bacteria 879
1665 Ga0495645_0005350 3300046543 Bacteria 8799
1666 Ga0495645_0031683 3300046543 Bacteria 3853
1667 Ga0495645_0071482 3300046543 Bacteria 2502
1668 Ga0495645_0093461 3300046543 Bacteria 2146
1669 Ga0495622_0000916 3300046557 Bacteria 15986
1670 Ga0495622_0014944 3300046557 Bacteria 3609
1671 Ga0495633_0000941 3300046558 Bacteria 24412
1672 Ga0495667_0004251 3300046559 Bacteria 9648
1673 Ga0495667_0006336 3300046559 Bacteria 8029
1674 Ga0495667_0011743 3300046559 Bacteria 5932
1675 Ga0495667_0135198 3300046559 Bacteria 1589
1676 Ga0495656_0000589 3300046615 Bacteria 11760
1677 Ga0495668_0166107 3300046616 Bacteria 1209
1678 Ga0495634_0003557 3300046642 Bacteria 12469
1679 Ga0495634_0017579 3300046642 Bacteria 5100
1680 Ga0495634_0065289 3300046642 Bacteria 2412
1681 Ga0495634_0165760 3300046642 Bacteria 1391
1682 Ga0495611_0001648 3300046648 Bacteria 10831
1683 Ga0495625_0355227 3300046660 Bacteria 925
1684 Ga0495635_0008888 3300046663 Bacteria 7012
1685 Ga0495635_0011224 3300046663 Bacteria 6280
1686 Ga0495635_0021335 3300046663 Bacteria 4514
1687 Ga0495659_0003548 3300046664 Bacteria 4967
1688 Ga0495661_0090083 3300046665 Bacteria 1747
1689 Ga0495661_0099349 3300046665 Bacteria 1641
1690 Ga0495588_0000617 3300046674 Bacteria 16755
1691 Ga0495588_0005432 3300046674 Bacteria 5672
1692 Ga0495657_0015052 3300046675 Bacteria 5670
1693 Ga0495657_0019703 3300046675 Bacteria 4863
1694 Ga0495657_0066740 3300046675 Bacteria 2363
1695 Ga0495657_0155950 3300046675 Bacteria 1415
1696 Ga0495657_0268203 3300046675 Bacteria 1024
1697 Ga0495599_0011690 3300046678 Bacteria 5397
1698 Ga0495599_0024541 3300046678 Bacteria 3770
1699 Ga0495623_0000858 3300046679 Bacteria 20593
1700 Ga0495646_0001927 3300046680 Bacteria 12478
1701 Ga0495646_0007260 3300046680 Bacteria 7040
1702 Ga0495647_0008676 3300046681 Bacteria 3421
1703 Ga0495647_0012430 3300046681 Bacteria 2931
1704 Ga0495647_0090310 3300046681 Bacteria 1255
1705 Ga0495658_0001492 3300046683 Bacteria 12268
1706 Ga0495658_0002288 3300046683 Bacteria 9659
1707 Ga0495658_0015585 3300046683 Bacteria 3900
1708 Ga0495658_0022000 3300046683 Bacteria 3367
1709 Ga0495613_0013711 3300046689 Bacteria 6013
1710 Ga0495613_0031187 3300046689 Bacteria 3958
1711 Ga0495613_0041650 3300046689 Bacteria 3400
1712 Ga0495613_0064734 3300046689 Bacteria 2673
1713 Ga0495613_0087320 3300046689 Bacteria 2261
1714 Ga0495624_0011751 3300046690 Bacteria 6011
1715 Ga0495624_0186813 3300046690 Bacteria 1261
1716 Ga0495670_0001016 3300046691 Bacteria 13619
1717 Ga0495670_0015418 3300046691 Bacteria 3755
1718 Ga0495670_0035476 3300046691 Bacteria 2486
1719 Ga0495671_0116647 3300046692 Bacteria 1303
1720 Ga0495589_0037315 3300046794 Bacteria 2435
1721 Ga0495600_0002535 3300046809 Bacteria 10511
1722 Ga0495600_0017451 3300046809 Bacteria 4567
1723 Ga0495600_0118752 3300046809 Bacteria 1720
1724 Ga0495600_0125819 3300046809 Bacteria 1667
1725 Ga0495600_0214737 3300046809 Bacteria 1232
1726 Ga0495581_0001367 3300047315 Bacteria 13506
1727 Ga0495581_0114214 3300047315 Bacteria 1570
1728 Ga0495581_0122051 3300047315 Bacteria 1516
1729 Ga0495604_0003635 3300047317 Bacteria 12295
1730 Ga0495604_0005022 3300047317 Bacteria 10472
1731 Ga0495604_0140180 3300047317 Bacteria 1728
1732 Ga0495674_0027562 3300047319 Bacteria 5190
1733 Ga0495674_0207723 3300047319 Bacteria 1623
1734 Ga0495674_0266237 3300047319 Bacteria 1407
1735 Ga0495672_0126057 3300047320 Bacteria 1354
1736 Ga0495672_0237273 3300047320 Bacteria 892
1737 Ga0495676_0008691 3300047321 Bacteria 9296
1738 Ga0495676_0050594 3300047321 Bacteria 3331
1739 Ga0495676_0087389 3300047321 Bacteria 2343
1740 Ga0495676_0191448 3300047321 Bacteria 1427
1741 Ga0495680_0013552 3300047322 Bacteria 7106
1742 Ga0495680_0027356 3300047322 Bacteria 4688
1743 Ga0495680_0037737 3300047322 Bacteria 3869
1744 Ga0495680_0042879 3300047322 Bacteria 3586
1745 Ga0495680_0083046 3300047322 Bacteria 2416
1746 Ga0495680_0107123 3300047322 Bacteria 2076
1747 Ga0495680_0136655 3300047322 Bacteria 1797
1748 Ga0495680_0192107 3300047322 Bacteria 1468
1749 Ga0495683_0155731 3300047323 Bacteria 1060
1750 Ga0495675_0006492 3300047444 Bacteria 7157
1751 Ga0495675_0033534 3300047444 Bacteria 3277
1752 Ga0495675_0060734 3300047444 Bacteria 2395
1753 Ga0495675_0141362 3300047444 Bacteria 1492
1754 Ga0495677_0026330 3300047445 Bacteria 2110
1755 Ga0495677_0068865 3300047445 Bacteria 1318
1756 Ga0495679_007990 3300047446 Bacteria 4349
1757 Ga0495684_0001009 3300047471 Bacteria 22928
1758 Ga0495684_0097147 3300047471 Bacteria 2229
1759 Ga0495593_0001943 3300047673 Bacteria 12328
1760 Ga0495593_0066194 3300047673 Bacteria 1883
1761 Ga0495602_0005814 3300048088 Bacteria 12947
1762 Ga0495602_0103585 3300048088 Bacteria 2329
1763 Ga0495602_0223847 3300048088 Bacteria 1418
1764 Ga0495602_0372459 3300048088 Bacteria 1025
1765 Ga0495602_0389607 3300048088 Bacteria 996
1766 Ga0495614_0000618 3300048089 Bacteria 14895
1767 Ga0495614_0003011 3300048089 Bacteria 7507
1768 Ga0495614_0150851 3300048089 Bacteria 1037
1769 Ga0495614_0191614 3300048089 Bacteria 923
1770 Ga0496100_0000345 3300048903 Bacteria 22686
1771 Ga0496100_0029207 3300048903 Bacteria 3408
1772 Ga0496100_0072649 3300048903 Bacteria 2300
1773 Ga0496100_0100037 3300048903 Bacteria 1996
1774 Ga0496100_0139615 3300048903 Bacteria 1716
1775 Ga0496101_0000969 3300048904 Bacteria 16936
1776 Ga0496101_0010556 3300048904 Bacteria 6102
1777 Ga0496101_0013181 3300048904 Bacteria 5533
1778 Ga0496101_0060073 3300048904 Bacteria 2757
1779 Ga0496101_0336746 3300048904 Bacteria 1185
1780 Ga0496101_0354302 3300048904 Bacteria 1153
1781 Ga0496101_0539249 3300048904 Bacteria 922
1782 Ga0496102_0004376 3300048905 Bacteria 11928
1783 Ga0496102_0021341 3300048905 Bacteria 5727
1784 Ga0496102_0024862 3300048905 Bacteria 5327
1785 Ga0496102_0043525 3300048905 Bacteria 4072
1786 Ga0496102_0132409 3300048905 Bacteria 2335
1787 Ga0496102_0164407 3300048905 Bacteria 2088
1788 Ga0496102_0321597 3300048905 Bacteria 1457
1789 Ga0496102_0328981 3300048905 Bacteria 1439
1790 Ga0496102_0331427 3300048905 Bacteria 1433
1791 Ga0496103_0001732 3300048906 Bacteria 14251
1792 Ga0496103_0030798 3300048906 Bacteria 3266
1793 Ga0496103_0365436 3300048906 Bacteria 927
1794 Ga0496104_0000399 3300048907 Bacteria 38066
1795 Ga0496104_0016470 3300048907 Bacteria 6715
1796 Ga0496104_0045259 3300048907 Bacteria 4138
1797 Ga0496104_0052818 3300048907 Bacteria 3838
1798 Ga0496104_0171951 3300048907 Bacteria 2077
1799 Ga0496104_0257745 3300048907 Bacteria 1657
1800 Ga0496104_0263891 3300048907 Bacteria 1634
1801 Ga0496104_0265624 3300048907 Bacteria 1628
1802 Ga0496104_0269395 3300048907 Bacteria 1615
1803 Ga0496105_0002417 3300048908 Bacteria 13529
1804 Ga0496105_0005504 3300048908 Bacteria 9611
1805 Ga0496105_0039469 3300048908 Bacteria 3891
1806 Ga0496105_0110910 3300048908 Bacteria 2264
1807 Ga0496105_0179095 3300048908 Bacteria 1736
1808 Ga0496106_0006762 3300048909 Bacteria 8490
1809 Ga0496106_0015788 3300048909 Bacteria 5584
1810 Ga0496106_0024149 3300048909 Bacteria 4518
1811 Ga0496106_0087648 3300048909 Bacteria 2398
1812 Ga0496106_0143840 3300048909 Bacteria 1877
1813 Ga0496106_0164547 3300048909 Bacteria 1755
1814 Ga0496106_0253074 3300048909 Bacteria 1408
1815 Ga0496106_0320238 3300048909 Bacteria 1245
1816 Ga0496107_0002978 3300048910 Bacteria 11215
1817 Ga0496107_0005598 3300048910 Bacteria 8604
1818 Ga0496107_0034153 3300048910 Bacteria 3641
1819 Ga0496107_0053345 3300048910 Bacteria 2916
1820 Ga0496107_0055486 3300048910 Bacteria 2862
1821 Ga0496107_0092297 3300048910 Bacteria 2213
1822 Ga0496107_0133846 3300048910 Bacteria 1831
1823 Ga0496108_0031377 3300048911 Bacteria 4409
1824 Ga0496108_0118495 3300048911 Bacteria 2269
1825 Ga0496108_0124272 3300048911 Bacteria 2214
1826 Ga0496108_0447522 3300048911 Bacteria 1128
1827 Ga0496108_0561385 3300048911 Bacteria 995
1828 Ga0496109_0005949 3300048912 Bacteria 10237
1829 Ga0496109_0012139 3300048912 Bacteria 7430
1830 Ga0496109_0017285 3300048912 Bacteria 6317
1831 Ga0496109_0084667 3300048912 Bacteria 2925
1832 Ga0496109_0119997 3300048912 Bacteria 2449
1833 Ga0496109_0164021 3300048912 Bacteria 2082
1834 Ga0496109_0238380 3300048912 Bacteria 1712
1835 Ga0496109_0351157 3300048912 Bacteria 1393
1836 Ga0496110_0008141 3300048913 Bacteria 8422
1837 Ga0496110_0030562 3300048913 Bacteria 4644
1838 Ga0496110_0047748 3300048913 Bacteria 3750
1839 Ga0496110_0075335 3300048913 Bacteria 2998
1840 Ga0496110_0108094 3300048913 Bacteria 2497
1841 Ga0496110_0137054 3300048913 Bacteria 2212
1842 Ga0496110_0323206 3300048913 Bacteria 1405
1843 Ga0496110_0586790 3300048913 Bacteria 1011
1844 Ga0496110_0721388 3300048913 Bacteria 899
1845 Ga0496110_0960134 3300048913 Bacteria 762
1846 Ga0496111_0010053 3300048914 Bacteria 6330
1847 Ga0496111_0023962 3300048914 Bacteria 4291
1848 Ga0496111_0041173 3300048914 Bacteria 3315
1849 Ga0496111_0085209 3300048914 Bacteria 2310
1850 Ga0496111_0132202 3300048914 Bacteria 1847
1851 Ga0496111_0194640 3300048914 Bacteria 1507
1852 Ga0496111_0232432 3300048914 Bacteria 1369
1853 Ga0496112_0003321 3300048915 Bacteria 13273
1854 Ga0496112_0034695 3300048915 Bacteria 4910
1855 Ga0496112_0056643 3300048915 Bacteria 3858
1856 Ga0496112_0094664 3300048915 Bacteria 2957
1857 Ga0496112_0113935 3300048915 Bacteria 2675
1858 Ga0496112_0744497 3300048915 Bacteria 906
1859 Ga0496113_0004259 3300048916 Bacteria 8765
1860 Ga0496113_0007674 3300048916 Bacteria 6960
1861 Ga0496113_0014734 3300048916 Bacteria 5347
1862 Ga0496113_0015868 3300048916 Bacteria 5190
1863 Ga0496113_0016963 3300048916 Bacteria 5042
1864 Ga0496113_0119259 3300048916 Bacteria 2061
1865 Ga0496114_0002647 3300048917 Bacteria 13668
1866 Ga0496114_0017438 3300048917 Bacteria 5795
1867 Ga0496114_0024283 3300048917 Bacteria 4946
1868 Ga0496114_0062704 3300048917 Bacteria 3111
1869 Ga0496114_0076700 3300048917 Bacteria 2817
1870 Ga0496114_0104199 3300048917 Bacteria 2425
1871 Ga0496114_0263208 3300048917 Bacteria 1519
1872 Ga0496114_0267595 3300048917 Bacteria 1506
1873 Ga0496114_0273158 3300048917 Bacteria 1489
1874 Ga0496114_0369177 3300048917 Bacteria 1270
1875 Ga0496114_0508239 3300048917 Bacteria 1066
1876 Ga0496115_0007035 3300048918 Bacteria 8266
1877 Ga0496115_0007121 3300048918 Bacteria 8213
1878 Ga0496115_0167415 3300048918 Bacteria 1817
1879 Ga0496115_0214681 3300048918 Bacteria 1589
1880 Ga0496115_0337391 3300048918 Bacteria 1230
1881 Ga0496115_0398147 3300048918 Bacteria 1117
1882 Ga0496115_0429514 3300048918 Bacteria 1069
1883 Ga0496116_0000092 3300048919 Bacteria 206620
1884 Ga0496116_0003281 3300048919 Bacteria 16092
1885 Ga0496116_0035292 3300048919 Bacteria 3513
1886 Ga0496117_0000002 3300048920 Bacteria 2483758
1887 Ga0496117_0014491 3300048920 Bacteria 6787
1888 Ga0496117_0019906 3300048920 Bacteria 5491
1889 Ga0496118_0002782 3300048921 Bacteria 22908
1890 Ga0496118_0020025 3300048921 Bacteria 5953
1891 Ga0496119_0000372 3300048922 Bacteria 62094
1892 Ga0496119_0004353 3300048922 Bacteria 14129
1893 Ga0496121_0000003 3300048924 Bacteria 1191431
1894 Ga0496121_0006108 3300048924 Bacteria 15150
1895 Ga0496121_0264467 3300048924 Bacteria 1186
1896 Ga0496122_0000001 3300048925 Bacteria 1827766
1897 Ga0496122_0000179 3300048925 Bacteria 149332
1898 Ga0496122_0000651 3300048925 Bacteria 70375
1899 Ga0496122_0006451 3300048925 Bacteria 13461
1900 Ga0496122_0032790 3300048925 Bacteria 4287
1901 Ga0496122_0084711 3300048925 Bacteria 2191
1902 Ga0496122_0091138 3300048925 Bacteria 2076
1903 Ga0496123_0000001 3300048926 Bacteria 1831497
1904 Ga0496123_0000305 3300048926 Bacteria 95376
1905 Ga0496123_0017126 3300048926 Bacteria 5847
1906 Ga0496123_0023779 3300048926 Bacteria 4680
1907 Ga0496124_0004355 3300048927 Bacteria 16569
1908 Ga0496124_0004631 3300048927 Bacteria 15936
1909 Ga0496124_0011120 3300048927 Bacteria 9030
1910 Ga0496124_0095630 3300048927 Bacteria 2414
1911 Ga0496125_0000141 3300048928 Bacteria 158991
1912 Ga0496125_0000815 3300048928 Bacteria 50702
1913 Ga0496125_0004886 3300048928 Bacteria 15201
1914 Ga0496125_0017448 3300048928 Bacteria 6842
1915 Ga0496125_0089238 3300048928 Bacteria 2319
1916 Ga0496125_0134455 3300048928 Bacteria 1733
1917 Ga0496126_0000480 3300048929 Bacteria 79257
1918 Ga0496126_0021992 3300048929 Bacteria 6216
1919 Ga0496126_0027409 3300048929 Bacteria 5441
1920 Ga0496126_0085885 3300048929 Bacteria 2773
1921 Ga0496126_0093217 3300048929 Bacteria 2644
1922 Ga0496126_0167062 3300048929 Bacteria 1877
1923 Ga0496126_0273833 3300048929 Bacteria 1400
1924 Ga0501308_005861 3300049128 Bacteria 1241
1925 Ga0501305_002601 3300049161 Bacteria 1964
1926 Ga0501305_004840 3300049161 Bacteria 1604
1927 Ga0501305_035288 3300049161 Bacteria 796
1928 Ga0501307_001858 3300049162 Bacteria 1882
1929 Ga0501307_002581 3300049162 Bacteria 1702
1930 Ga0495682_0160048 3300049460 Bacteria 802
1931 Ga0501311_000868 3300049527 Bacteria 2369
1932 Ga0501312_003063 3300049528 Bacteria 1863
1933 Ga0501314_003537 3300049530 Bacteria 1263
1934 Ga0501317_018674 3300049533 Bacteria 919
1935 Ga0501330_001328 3300049546 Bacteria 1265
1936 Ga0501031_0003843 3300049568 Bacteria 9657
1937 Ga0501031_0004402 3300049568 Bacteria 9129
1938 Ga0501031_0025716 3300049568 Bacteria 3840
1939 Ga0501031_0110797 3300049568 Bacteria 1792
1940 Ga0501032_0001915 3300049569 Bacteria 16407
1941 Ga0501032_0003488 3300049569 Bacteria 12021
1942 Ga0501032_0004362 3300049569 Bacteria 10681
1943 Ga0501032_0012326 3300049569 Bacteria 6112
1944 Ga0501032_0026774 3300049569 Bacteria 3963
1945 Ga0501032_0028510 3300049569 Bacteria 3837
1946 Ga0501032_0071493 3300049569 Bacteria 2312
1947 Ga0501032_0183915 3300049569 Bacteria 1368
1948 Ga0501032_0243901 3300049569 Bacteria 1167
1949 Ga0501032_0332669 3300049569 Bacteria 979
1950 Ga0501033_0000121 3300049570 Bacteria 75242
1951 Ga0501033_0005260 3300049570 Bacteria 10269
1952 Ga0501033_0006462 3300049570 Bacteria 9172
1953 Ga0501033_0007122 3300049570 Bacteria 8728
1954 Ga0501033_0017879 3300049570 Bacteria 5352
1955 Ga0501033_0023272 3300049570 Bacteria 4672
1956 Ga0501033_0029185 3300049570 Bacteria 4145
1957 Ga0501033_0037361 3300049570 Bacteria 3635
1958 Ga0501033_0053353 3300049570 Bacteria 2994
1959 Ga0501033_0092675 3300049570 Bacteria 2209
1960 Ga0501033_0123672 3300049570 Bacteria 1876
1961 Ga0501033_0130581 3300049570 Bacteria 1820
1962 Ga0501033_0160129 3300049570 Bacteria 1620
1963 Ga0501033_0172227 3300049570 Bacteria 1554
1964 Ga0501034_0000298 3300049571 Bacteria 88154
1965 Ga0501034_0000482 3300049571 Bacteria 65380
1966 Ga0501034_0009013 3300049571 Bacteria 10479
1967 Ga0501034_0010632 3300049571 Bacteria 9573
1968 Ga0501034_0014685 3300049571 Bacteria 8064
1969 Ga0501034_0014987 3300049571 Bacteria 7973
1970 Ga0501034_0023047 3300049571 Bacteria 6345
1971 Ga0501034_0034843 3300049571 Bacteria 5104
1972 Ga0501034_0035212 3300049571 Bacteria 5076
1973 Ga0501034_0056638 3300049571 Bacteria 3943
1974 Ga0501034_0058496 3300049571 Bacteria 3874
1975 Ga0501034_0060135 3300049571 Bacteria 3817
1976 Ga0501034_0064759 3300049571 Bacteria 3669
1977 Ga0501034_0071741 3300049571 Bacteria 3472
1978 Ga0501034_0099673 3300049571 Bacteria 2900
1979 Ga0501034_0101512 3300049571 Bacteria 2870
1980 Ga0501034_0131817 3300049571 Bacteria 2482
1981 Ga0501034_0185421 3300049571 Bacteria 2044
1982 Ga0501034_0187610 3300049571 Bacteria 2030
1983 Ga0501034_0191684 3300049571 Bacteria 2006
1984 Ga0501034_0250497 3300049571 Bacteria 1715
1985 Ga0501034_0263062 3300049571 Bacteria 1667
1986 Ga0501034_0368612 3300049571 Bacteria 1362
1987 Ga0501034_0512915 3300049571 Bacteria 1111
1988 Ga0501036_0000724 3300049572 Bacteria 24360
1989 Ga0501036_0005563 3300049572 Bacteria 10220
1990 Ga0501036_0005653 3300049572 Bacteria 10145
1991 Ga0501036_0014004 3300049572 Bacteria 6665
1992 Ga0501036_0018306 3300049572 Bacteria 5865
1993 Ga0501036_0021849 3300049572 Bacteria 5380
1994 Ga0501036_0027081 3300049572 Bacteria 4844
1995 Ga0501036_0042438 3300049572 Bacteria 3851
1996 Ga0501036_0071269 3300049572 Bacteria 2938
1997 Ga0501036_0088809 3300049572 Bacteria 2612
1998 Ga0501036_0273417 3300049572 Bacteria 1414
1999 Ga0501036_0592171 3300049572 Bacteria 920
2000 Ga0501037_0000191 3300049573 Bacteria 56839
2001 Ga0501037_0000195 3300049573 Bacteria 55440
2002 Ga0501037_0034293 3300049573 Bacteria 3745
2003 Ga0501037_0048165 3300049573 Bacteria 3123
2004 Ga0501037_0050247 3300049573 Bacteria 3052
2005 Ga0501037_0069851 3300049573 Bacteria 2556
2006 Ga0501038_0005274 3300049574 Bacteria 12021
2007 Ga0501038_0007256 3300049574 Bacteria 10233
2008 Ga0501038_0012441 3300049574 Bacteria 7775
2009 Ga0501038_0023939 3300049574 Bacteria 5453
2010 Ga0501038_0029459 3300049574 Bacteria 4863
2011 Ga0501038_0039812 3300049574 Bacteria 4110
2012 Ga0501038_0099119 3300049574 Bacteria 2429
2013 Ga0501038_0115386 3300049574 Bacteria 2220
2014 Ga0501038_0131427 3300049574 Bacteria 2055
2015 Ga0501038_0140388 3300049574 Bacteria 1977
2016 Ga0501038_0231612 3300049574 Bacteria 1470
2017 Ga0501038_0241573 3300049574 Bacteria 1434
2018 Ga0501038_0280002 3300049574 Bacteria 1313
2019 Ga0501038_0378541 3300049574 Bacteria 1098
2020 Ga0501038_0439836 3300049574 Bacteria 1004
2021 Ga0501038_0461700 3300049574 Bacteria 975
2022 Ga0501039_0000080 3300049575 Bacteria 72519
2023 Ga0501039_0018138 3300049575 Bacteria 5401
2024 Ga0501039_0019053 3300049575 Bacteria 5264
2025 Ga0501039_0082862 3300049575 Bacteria 2497
2026 Ga0501039_0103496 3300049575 Bacteria 2222
2027 Ga0501039_0126935 3300049575 Bacteria 2001
2028 Ga0501039_0166413 3300049575 Bacteria 1733
2029 Ga0501040_0028399 3300049576 Bacteria 3771
2030 Ga0501040_0099905 3300049576 Bacteria 2022
2031 Ga0501040_0427749 3300049576 Bacteria 952
2032 Ga0501041_0030131 3300049577 Bacteria 3275
2033 Ga0501041_0052753 3300049577 Bacteria 2479
2034 Ga0501041_0081843 3300049577 Bacteria 1988
2035 Ga0501041_0307741 3300049577 Bacteria 999
2036 Ga0501041_0421402 3300049577 Bacteria 846
2037 Ga0501042_0014227 3300049578 Bacteria 5429
2038 Ga0501042_0049150 3300049578 Bacteria 3008
2039 Ga0501042_0073631 3300049578 Bacteria 2443
2040 Ga0501042_0099109 3300049578 Bacteria 2095
2041 Ga0501042_0112613 3300049578 Bacteria 1959
2042 Ga0501042_0160509 3300049578 Bacteria 1622
2043 Ga0501042_0161539 3300049578 Bacteria 1617
2044 Ga0501042_0196229 3300049578 Bacteria 1456
2045 Ga0501042_0217545 3300049578 Bacteria 1378
2046 Ga0501043_0000080 3300049579 Bacteria 85372
2047 Ga0501043_0004023 3300049579 Bacteria 12021
2048 Ga0501043_0006867 3300049579 Bacteria 9085
2049 Ga0501043_0009304 3300049579 Bacteria 7720
2050 Ga0501043_0010388 3300049579 Bacteria 7296
2051 Ga0501043_0012919 3300049579 Bacteria 6526
2052 Ga0501043_0012997 3300049579 Bacteria 6508
2053 Ga0501043_0021749 3300049579 Bacteria 5029
2054 Ga0501043_0099954 3300049579 Bacteria 2280
2055 Ga0501043_0113305 3300049579 Bacteria 2130
2056 Ga0501043_0124264 3300049579 Bacteria 2023
2057 Ga0501043_0129225 3300049579 Bacteria 1980
2058 Ga0501046_0005416 3300049580 Bacteria 11410
2059 Ga0501046_0012992 3300049580 Bacteria 7068
2060 Ga0501046_0084789 3300049580 Bacteria 2443
2061 Ga0501046_0126860 3300049580 Bacteria 1938
2062 Ga0501046_0141630 3300049580 Bacteria 1819
2063 Ga0501046_0163291 3300049580 Bacteria 1674
2064 Ga0501046_0178166 3300049580 Bacteria 1591
2065 Ga0501047_0000235 3300049581 Bacteria 65603
2066 Ga0501047_0002319 3300049581 Bacteria 18206
2067 Ga0501047_0027205 3300049581 Bacteria 5508
2068 Ga0501047_0037488 3300049581 Bacteria 4687
2069 Ga0501047_0100301 3300049581 Bacteria 2774
2070 Ga0501047_0108871 3300049581 Bacteria 2653
2071 Ga0501047_0109042 3300049581 Bacteria 2651
2072 Ga0501047_0117481 3300049581 Bacteria 2541
2073 Ga0501047_0117831 3300049581 Bacteria 2537
2074 Ga0501047_0121226 3300049581 Bacteria 2497
2075 Ga0501047_0127913 3300049581 Bacteria 2420
2076 Ga0501047_0158759 3300049581 Bacteria 2133
2077 Ga0501047_0163204 3300049581 Bacteria 2099
2078 Ga0501047_0181203 3300049581 Bacteria 1973
2079 Ga0501047_0188242 3300049581 Bacteria 1928
2080 Ga0501047_0289265 3300049581 Bacteria 1482
2081 Ga0501047_0329898 3300049581 Bacteria 1364
2082 Ga0501047_0335131 3300049581 Bacteria 1351
2083 Ga0501047_0350156 3300049581 Bacteria 1314
2084 Ga0501047_0423121 3300049581 Bacteria 1163
2085 Ga0501047_0440868 3300049581 Bacteria 1132
2086 Ga0501047_0611852 3300049581 Bacteria 910
2087 Ga0501048_0006738 3300049582 Bacteria 8727
2088 Ga0501048_0056621 3300049582 Bacteria 2781
2089 Ga0501048_0066080 3300049582 Bacteria 2557
2090 Ga0501048_0125718 3300049582 Bacteria 1813
2091 Ga0501048_0245313 3300049582 Bacteria 1271
2092 Ga0501048_0303968 3300049582 Bacteria 1135
2093 Ga0501067_0001776 3300049583 Bacteria 11844
2094 Ga0501067_0016370 3300049583 Bacteria 4097
2095 Ga0501067_0052037 3300049583 Bacteria 2269
2096 Ga0501067_0052681 3300049583 Bacteria 2255
2097 Ga0501067_0163558 3300049583 Bacteria 1239
2098 Ga0501067_0192651 3300049583 Bacteria 1135
2099 Ga0501067_0234264 3300049583 Bacteria 1022
2100 Ga0501067_0305443 3300049583 Bacteria 886
2101 Ga0501068_0011134 3300049584 Bacteria 5067
2102 Ga0501068_0015296 3300049584 Bacteria 4404
2103 Ga0501068_0093639 3300049584 Bacteria 1856
2104 Ga0501069_0004122 3300049585 Bacteria 7502
2105 Ga0501069_0060723 3300049585 Bacteria 2110
2106 Ga0501069_0225969 3300049585 Bacteria 1089
2107 Ga0501069_0329127 3300049585 Bacteria 898
2108 Ga0501070_0006284 3300049586 Bacteria 10111
2109 Ga0501070_0014064 3300049586 Bacteria 6737
2110 Ga0501070_0026710 3300049586 Bacteria 4843
2111 Ga0501070_0031071 3300049586 Bacteria 4473
2112 Ga0501070_0037532 3300049586 Bacteria 4044
2113 Ga0501070_0040568 3300049586 Bacteria 3881
2114 Ga0501070_0057678 3300049586 Bacteria 3219
2115 Ga0501070_0060281 3300049586 Bacteria 3145
2116 Ga0501070_0108827 3300049586 Bacteria 2290
2117 Ga0501070_0224329 3300049586 Bacteria 1540
2118 Ga0501070_0275478 3300049586 Bacteria 1373
2119 Ga0501070_0468434 3300049586 Bacteria 1014
2120 Ga0501070_0487316 3300049586 Bacteria 991
2121 Ga0501071_0017063 3300049587 Bacteria 5001
2122 Ga0501071_0024767 3300049587 Bacteria 4198
2123 Ga0501071_0038781 3300049587 Bacteria 3405
2124 Ga0501071_0101470 3300049587 Bacteria 2121
2125 Ga0501071_0199116 3300049587 Bacteria 1504
2126 Ga0501072_0031734 3300049588 Bacteria 4137
2127 Ga0501072_0058632 3300049588 Bacteria 3034
2128 Ga0501072_0062754 3300049588 Bacteria 2930
2129 Ga0501072_0184065 3300049588 Bacteria 1667
2130 Ga0501072_0242569 3300049588 Bacteria 1435
2131 Ga0501072_0338405 3300049588 Bacteria 1195
2132 Ga0501073_0000083 3300049589 Bacteria 59733
2133 Ga0501073_0001669 3300049589 Bacteria 16438
2134 Ga0501073_0015881 3300049589 Bacteria 5456
2135 Ga0501073_0042595 3300049589 Bacteria 3203
2136 Ga0501073_0043107 3300049589 Bacteria 3182
2137 Ga0501073_0046649 3300049589 Bacteria 3046
2138 Ga0501073_0054449 3300049589 Bacteria 2801
2139 Ga0501073_0069063 3300049589 Bacteria 2462
2140 Ga0501073_0074091 3300049589 Bacteria 2370
2141 Ga0501073_0075457 3300049589 Bacteria 2347
2142 Ga0501073_0086647 3300049589 Bacteria 2178
2143 Ga0501073_0098248 3300049589 Bacteria 2033
2144 Ga0501073_0126741 3300049589 Bacteria 1769
2145 Ga0501073_0128507 3300049589 Bacteria 1756
2146 Ga0501073_0158889 3300049589 Bacteria 1566
2147 Ga0501073_0431995 3300049589 Bacteria 910
2148 Ga0501074_0002583 3300049590 Bacteria 12638
2149 Ga0501074_0002757 3300049590 Bacteria 12304
2150 Ga0501074_0015922 3300049590 Bacteria 5469
2151 Ga0501074_0029786 3300049590 Bacteria 3955
2152 Ga0501074_0035107 3300049590 Bacteria 3633
2153 Ga0501074_0035296 3300049590 Bacteria 3622
2154 Ga0501074_0096885 3300049590 Bacteria 2112
2155 Ga0501074_0110230 3300049590 Bacteria 1969
2156 Ga0501074_0295158 3300049590 Bacteria 1151
2157 Ga0501075_0013808 3300049591 Bacteria 5774
2158 Ga0501075_0116706 3300049591 Bacteria 2029
2159 Ga0501075_0218575 3300049591 Bacteria 1453
2160 Ga0501075_0265762 3300049591 Bacteria 1308
2161 Ga0501075_0275812 3300049591 Bacteria 1281
2162 Ga0501076_0000421 3300049592 Bacteria 26662
2163 Ga0501076_0052511 3300049592 Bacteria 3229
2164 Ga0501076_0081388 3300049592 Bacteria 2600
2165 Ga0501076_0094632 3300049592 Bacteria 2405
2166 Ga0501076_0236554 3300049592 Bacteria 1493
2167 Ga0501076_0339569 3300049592 Bacteria 1232
2168 Ga0501077_0000088 3300049593 Bacteria 46551
2169 Ga0501077_0011866 3300049593 Bacteria 5448
2170 Ga0501077_0019499 3300049593 Bacteria 4290
2171 Ga0501077_0022721 3300049593 Bacteria 3974
2172 Ga0501077_0065891 3300049593 Bacteria 2297
2173 Ga0501077_0067033 3300049593 Bacteria 2276
2174 Ga0501077_0083731 3300049593 Bacteria 2021
2175 Ga0501077_0120730 3300049593 Bacteria 1661
2176 Ga0501077_0142095 3300049593 Bacteria 1522
2177 Ga0501077_0161677 3300049593 Bacteria 1422
2178 Ga0501077_0173517 3300049593 Bacteria 1370
2179 Ga0501079_0001478 3300049741 Bacteria 16629
2180 Ga0501079_0041571 3300049741 Bacteria 3549
2181 Ga0501079_0166268 3300049741 Bacteria 1720
2182 Ga0501079_0186711 3300049741 Bacteria 1618
2183 Ga0501080_0003162 3300049742 Bacteria 14508
2184 Ga0501080_0006111 3300049742 Bacteria 10795
2185 Ga0501080_0009625 3300049742 Bacteria 8822
2186 Ga0501080_0010339 3300049742 Bacteria 8535
2187 Ga0501080_0018049 3300049742 Bacteria 6532
2188 Ga0501080_0033886 3300049742 Bacteria 4767
2189 Ga0501080_0055626 3300049742 Bacteria 3685
2190 Ga0501080_0090495 3300049742 Bacteria 2842
2191 Ga0501080_0181639 3300049742 Bacteria 1935
2192 Ga0501080_0190633 3300049742 Bacteria 1884
2193 Ga0501080_0201688 3300049742 Bacteria 1826
2194 Ga0501080_0202828 3300049742 Bacteria 1820
2195 Ga0501080_0229455 3300049742 Bacteria 1697
2196 Ga0501080_0374532 3300049742 Bacteria 1283
2197 Ga0501080_0414374 3300049742 Bacteria 1211
2198 Ga0501080_0834694 3300049742 Bacteria 806
2199 Ga0501081_0160483 3300049743 Bacteria 1620
2200 Ga0501081_0255165 3300049743 Bacteria 1280
2201 Ga0501083_0001214 3300049744 Bacteria 17447
2202 Ga0501083_0003307 3300049744 Bacteria 11261
2203 Ga0501083_0008114 3300049744 Bacteria 7426
2204 Ga0501083_0020957 3300049744 Bacteria 4543
2205 Ga0501083_0035683 3300049744 Bacteria 3395
2206 Ga0501083_0039700 3300049744 Bacteria 3196
2207 Ga0501083_0122165 3300049744 Bacteria 1708
2208 Ga0501083_0138289 3300049744 Bacteria 1595
2209 Ga0501083_0219204 3300049744 Bacteria 1239
2210 Ga0501083_0232372 3300049744 Bacteria 1201
2211 Ga0501083_0251035 3300049744 Bacteria 1151
2212 Ga0501035_0000160 3300049822 Bacteria 82214
2213 Ga0501035_0005931 3300049822 Bacteria 11499
2214 Ga0501035_0006382 3300049822 Bacteria 11088
2215 Ga0501035_0023586 3300049822 Bacteria 5644
2216 Ga0501035_0024284 3300049822 Bacteria 5560
2217 Ga0501035_0024934 3300049822 Bacteria 5484
2218 Ga0501035_0030092 3300049822 Bacteria 4950
2219 Ga0501035_0038345 3300049822 Bacteria 4339
2220 Ga0501035_0099561 3300049822 Bacteria 2551
2221 Ga0501035_0139961 3300049822 Bacteria 2104
2222 Ga0501035_0206482 3300049822 Bacteria 1683
2223 Ga0501035_0314276 3300049822 Bacteria 1317
2224 Ga0501044_0000544 3300049823 Bacteria 45911
2225 Ga0501044_0009814 3300049823 Bacteria 10410
2226 Ga0501044_0012437 3300049823 Bacteria 9216
2227 Ga0501044_0015755 3300049823 Bacteria 8141
2228 Ga0501044_0020968 3300049823 Bacteria 6978
2229 Ga0501044_0024732 3300049823 Bacteria 6370
2230 Ga0501044_0025827 3300049823 Bacteria 6226
2231 Ga0501044_0033457 3300049823 Bacteria 5402
2232 Ga0501044_0048954 3300049823 Bacteria 4363
2233 Ga0501044_0106319 3300049823 Bacteria 2818
2234 Ga0501044_0139488 3300049823 Bacteria 2413
2235 Ga0501044_0146154 3300049823 Bacteria 2349
2236 Ga0501044_0152785 3300049823 Bacteria 2290
2237 Ga0501044_0183938 3300049823 Bacteria 2055
2238 Ga0501044_0191494 3300049823 Bacteria 2007
2239 Ga0501044_0376465 3300049823 Bacteria 1335
2240 Ga0501044_0546422 3300049823 Bacteria 1056
2241 Ga0501045_0090970 3300049824 Bacteria 2255
2242 Ga0501045_0114518 3300049824 Bacteria 2000
2243 Ga0501045_0200097 3300049824 Bacteria 1488
2244 Ga0501045_0229332 3300049824 Bacteria 1382
2245 nmdc:mga03683_106558_c1 3300050489 Bacteria 1236
2246 nmdc:mga03683_1808_c1 3300050489 Bacteria 6487
2247 nmdc:mga03683_34186_c1 3300050489 Bacteria 2056
2248 nmdc:mga03n38_109370_c1 3300050490 Bacteria 1344
2249 nmdc:mga03n38_771_c1 3300050490 Bacteria 8497
2250 nmdc:mga03n38_8514_c1 3300050490 Bacteria 3685
2251 nmdc:mga00v17_2387_c1 3300050491 Bacteria 9614
2252 nmdc:mga00v17_269541_c1 3300050491 Bacteria 1105
2253 nmdc:mga00v17_376_c1 3300050491 Bacteria 25303
2254 nmdc:mga00v17_51538_c1 3300050491 Bacteria 2502
2255 nmdc:mga0yw44_18471_c1 3300050492 Bacteria 3821
2256 nmdc:mga0yw44_815_c1 3300050492 Bacteria 11618
2257 nmdc:mga0k408_10033_c1 3300050493 Bacteria 5115
2258 nmdc:mga0k408_101657_c1 3300050493 Bacteria 1695
2259 nmdc:mga0k408_33683_c1 3300050493 Bacteria 1662
2260 nmdc:mga06z11_12740_c1 3300050494 Bacteria 3667
2261 nmdc:mga06z11_7800_c1 3300050494 Bacteria 4425
2262 nmdc:mga04h51_93699_c1 3300050495 Bacteria 1085
2263 nmdc:mga07m45_6073_c1 3300050496 Bacteria 6083
2264 nmdc:mga05p37_109891_c1 3300050507 Bacteria 3392
2265 nmdc:mga05p37_139910_c1 3300050507 Bacteria 2966
2266 nmdc:mga05p37_153008_c1 3300050507 Bacteria 2820
2267 nmdc:mga05p37_2437_c1 3300050507 Bacteria 21635
2268 nmdc:mga05p37_306818_c1 3300050507 Bacteria 1883
2269 nmdc:mga05p37_49513_c1 3300050507 Bacteria 5168
2270 nmdc:mga05p37_58409_c1 3300050507 Bacteria 4751
2271 nmdc:mga05p37_62767_c1 3300050507 Bacteria 4573
2272 nmdc:mga09592_1370_c1 3300050508 Bacteria 19524
2273 nmdc:mga09592_284951_c1 3300050508 Bacteria 1433
2274 nmdc:mga0qj67_2465_c1 3300050509 Bacteria 13183
2275 nmdc:mga0qj67_270437_c1 3300050509 Bacteria 1378
2276 nmdc:mga0qj67_37265_c1 3300050509 Bacteria 3808
2277 nmdc:mga0qj67_63495_c1 3300050509 Bacteria 2937
2278 nmdc:mga0qj67_92209_c1 3300050509 Bacteria 2435
2279 nmdc:mga06r32_11149_c1 3300050510 Bacteria 8095
2280 nmdc:mga06r32_11500_c1 3300050510 Bacteria 7971
2281 nmdc:mga06r32_147432_c1 3300050510 Bacteria 2331
2282 nmdc:mga06r32_274856_c1 3300050510 Bacteria 1672
2283 nmdc:mga06r32_328722_c1 3300050510 Bacteria 1514
2284 nmdc:mga06r32_594366_c1 3300050510 Bacteria 1078
2285 nmdc:mga06r32_638_c1 3300050510 Bacteria 30472
2286 nmdc:mga06r32_660_c1 3300050510 Bacteria 30156
2287 nmdc:mga06r32_80366_c1 3300050510 Bacteria 3173
2288 nmdc:mga06r32_8073_c1 3300050510 Bacteria 9471
2289 nmdc:mga08y16_103801_c1 3300050511 Bacteria 2959
2290 nmdc:mga08y16_123400_c1 3300050511 Bacteria 2695
2291 nmdc:mga08y16_186176_c1 3300050511 Bacteria 2155
2292 nmdc:mga08y16_3117_c1 3300050511 Bacteria 17166
2293 nmdc:mga08y16_42994_c1 3300050511 Bacteria 4732
2294 nmdc:mga08y16_48086_c1 3300050511 Bacteria 4464
2295 nmdc:mga08y16_549_c1 3300050511 Bacteria 34756
2296 nmdc:mga08y16_9879_c2 3300050511 Bacteria 6288
2297 nmdc:mga0n895_101015_c1 3300050512 Bacteria 2894
2298 nmdc:mga0n895_19785_c1 3300050512 Bacteria 6264
2299 nmdc:mga0n895_223980_c1 3300050512 Bacteria 1909
2300 nmdc:mga0n895_2833_c1 3300050512 Bacteria 13734
2301 nmdc:mga0n895_283_c1 3300050512 Bacteria 33340
2302 nmdc:mga0n895_351825_c1 3300050512 Bacteria 1492
2303 nmdc:mga0n895_779639_c1 3300050512 Bacteria 948
2304 nmdc:mga0rr50_36067_c1 3300050513 Bacteria 3557
2305 nmdc:mga0rr50_36589_c1 3300050513 Bacteria 3537
2306 nmdc:mga0rr50_40885_c1 3300050513 Bacteria 3374
2307 nmdc:mga0rr50_449091_c1 3300050513 Bacteria 1093
2308 nmdc:mga0rr50_54931_c1 3300050513 Bacteria 2969
2309 nmdc:mga0rr50_59657_c1 3300050513 Bacteria 2866
2310 nmdc:mga0rr50_617153_c1 3300050513 Bacteria 925
2311 nmdc:mga0rr50_7174_c1 3300050513 Bacteria 5559
2312 nmdc:mga0rr50_90688_c1 3300050513 Bacteria 2379
2313 nmdc:mga08x19_14934_c1 3300050514 Bacteria 4717
2314 nmdc:mga08x19_177_c1 3300050514 Bacteria 51482
2315 nmdc:mga08x19_19179_c1 3300050514 Bacteria 4195
2316 nmdc:mga08x19_23_c1 3300050514 Bacteria 288286
2317 nmdc:mga08x19_39977_c1 3300050514 Bacteria 2984
2318 nmdc:mga0a205_159509_c1 3300050515 Bacteria 2153
2319 nmdc:mga0a205_188102_c1 3300050515 Bacteria 1957
2320 nmdc:mga0a205_2479_c1 3300050515 Bacteria 16274
2321 nmdc:mga0a205_387_c1 3300050515 Bacteria 33459
2322 nmdc:mga0a205_547340_c1 3300050515 Bacteria 1013
2323 nmdc:mga0a205_8273_c1 3300050515 Bacteria 9459
2324 nmdc:mga0sz30_126291_c1 3300050516 Bacteria 1126
2325 Ga0495601_0001193 3300053077 Bacteria 14223
2326 Ga0495601_0002336 3300053077 Bacteria 10730
2327 Ga0495601_0004742 3300053077 Bacteria 7882
2328 Ga0495601_0007365 3300053077 Bacteria 6453
2329 Ga0495601_0026137 3300053077 Bacteria 3602
2330 Ga0495601_0026610 3300053077 Bacteria 3572
2331 Ga0495601_0166105 3300053077 Bacteria 1442
2332 Ga0495612_0005860 3300053078 Bacteria 5070
2333 Ga0495612_0024812 3300053078 Bacteria 2407
2334 Ga0495612_0051182 3300053078 Bacteria 1697
2335 Ga0495595_0000532 3300053084 Bacteria 14535
2336 Ga0495595_0003797 3300053084 Bacteria 6011
2337 Ga0495595_0009768 3300053084 Bacteria 3976
2338 Ga0495595_0038662 3300053084 Bacteria 2175
2339 Ga0495595_0091506 3300053084 Bacteria 1459
2340 Ga0495619_0001164 3300053085 Bacteria 17272
2341 Ga0495619_0001481 3300053085 Bacteria 15481
2342 Ga0495619_0002703 3300053085 Bacteria 11595
2343 Ga0495619_0008778 3300053085 Bacteria 6391
2344 Ga0495619_0050587 3300053085 Bacteria 2744
2345 Ga0495619_0189998 3300053085 Bacteria 1421
2346 Ga0495619_0415263 3300053085 Bacteria 928
2347 Ga0500643_000003 3300053087 Bacteria 876659
2348 Ga0500566_0114687 3300053094 Bacteria 1460
2349 Ga0500641_0101009 3300053096 Bacteria 1237
2350 Ga0500555_043592 3300053103 Bacteria 1243
2351 Ga0500556_0000009 3300053104 Bacteria 288111
2352 Ga0500569_010361 3300053109 Bacteria 2194
2353 Ga0500592_011285 3300053116 Bacteria 1429
2354 Ga0500593_000058 3300053117 Bacteria 41070
2355 Ga0500595_003166 3300053119 Bacteria 7792
2356 Ga0500595_014727 3300053119 Bacteria 2958
2357 Ga0500595_042589 3300053119 Bacteria 1451
2358 Ga0500618_006217 3300053125 Bacteria 3527
2359 Ga0500618_009985 3300053125 Bacteria 2565
2360 Ga0500642_0028876 3300053130 Bacteria 2293
2361 Ga0500652_000024 3300053131 Bacteria 116239
2362 Ga0500559_0021975 3300053136 Bacteria 2706
2363 Ga0500561_0042637 3300053137 Bacteria 1205
2364 Ga0500568_0000001 3300053139 Bacteria 988705
2365 Ga0500568_0031032 3300053139 Bacteria 2209
2366 Ga0500573_0000452 3300053140 Bacteria 17648
2367 Ga0500604_0000294 3300053151 Bacteria 13881
2368 Ga0500616_0004053 3300053153 Bacteria 10652
2369 Ga0500616_0013161 3300053153 Bacteria 4816
2370 Ga0500616_0022813 3300053153 Bacteria 3492
2371 Ga0500616_0024839 3300053153 Bacteria 3326
2372 Ga0500616_0046151 3300053153 Bacteria 2317
2373 Ga0500622_0008990 3300053156 Bacteria 5552
2374 Ga0500627_0064034 3300053158 Bacteria 1621
2375 Ga0500627_0096880 3300053158 Bacteria 1322
2376 Ga0500634_0000031 3300053161 Bacteria 75547
2377 Ga0500636_0009188 3300053177 Bacteria 5746
2378 Ga0501084_0000175 3300054114 Bacteria 50123
2379 Ga0501084_0007620 3300054114 Bacteria 8925
2380 Ga0501084_0010490 3300054114 Bacteria 7658
2381 Ga0501084_0023050 3300054114 Bacteria 5196
2382 Ga0501084_0030163 3300054114 Bacteria 4535
2383 Ga0501084_0050020 3300054114 Bacteria 3499
2384 Ga0501084_0069776 3300054114 Bacteria 2943
2385 Ga0501084_0077972 3300054114 Bacteria 2777
2386 Ga0501084_0133750 3300054114 Bacteria 2087
2387 Ga0501084_0172400 3300054114 Bacteria 1826
2388 Ga0501084_0189781 3300054114 Bacteria 1734
2389 Ga0501084_0274220 3300054114 Bacteria 1424
2390 Ga0501084_0489226 3300054114 Bacteria 1040
2391 Ga0501084_0680004 3300054114 Bacteria 868
2392 Ga0587066_000149 3300059490 Bacteria 4364
2393 Ga0587077_000009 3300059493 Bacteria 7681
2394 Ga0587077_000686 3300059493 Bacteria 3134
2395 Ga0587077_000759 3300059493 Bacteria 3058
2396 Ga0587080_001057 3300059503 Bacteria 2799
2397 Ga0587082_001400 3300059504 Bacteria 2491
2398 Ga0587083_0000004 3300059505 Bacteria 9397
2399 Ga0587083_0001820 3300059505 Bacteria 2503
2400 Ga0587090_000009 3300059510 Bacteria 9016
2401 Ga0587090_019067 3300059510 Bacteria 1055
2402 Ga0587091_000006 3300059511 Bacteria 11735
2403 Ga0587098_000078 3300059604 Bacteria 4245
2404 Ga0587098_019869 3300059604 Bacteria 844
2405 Ga0587115_000100 3300059626 Bacteria 4441
2406 Ga0587062_001419 3300059639 Bacteria 2065
2407 Ga0587067_000169 3300059640 Bacteria 4723
2408 Ga0587068_000102 3300059641 Bacteria 5560
2409 Ga0587068_001047 3300059641 Bacteria 2932
2410 Ga0587072_000447 3300059643 Bacteria 4140
2411 Ga0587072_003910 3300059643 Bacteria 2128
2412 Ga0587072_029350 3300059643 Bacteria 1020
2413 Ga0587076_000044 3300059645 Bacteria 6077
2414 Ga0587076_000461 3300059645 Bacteria 3306
2415 Ga0587076_001185 3300059645 Bacteria 2575
2416 Ga0587078_002037 3300059646 Bacteria 1915
2417 Ga0587079_056451 3300059647 Bacteria 839
2418 Ga0587107_004123 3300059652 Bacteria 1456
2419 Ga0587108_000683 3300059653 Bacteria 1849
2420 Ga0587124_009674 3300059660 Bacteria 848
2421 Ga0501082_0015085 3300060353 Bacteria 6656
2422 Ga0501082_0017998 3300060353 Bacteria 6085
2423 Ga0501082_0049749 3300060353 Bacteria 3614
2424 Ga0501082_0161198 3300060353 Bacteria 1949
2425 Ga0501082_0173837 3300060353 Bacteria 1873
2426 Ga0501082_0204185 3300060353 Bacteria 1719
2427 Ga0501082_0220858 3300060353 Bacteria 1649
2428 Ga0501082_0238716 3300060353 Bacteria 1582
2429 Ga0501082_0282211 3300060353 Bacteria 1445
2430 Ga0501082_0306721 3300060353 Bacteria 1382
2431 Ga0501082_0345988 3300060353 Bacteria 1296
2432 Ga0501082_0572246 3300060353 Bacteria 988
2433 Ga0501082_0617540 3300060353 Bacteria 949
2434 Ga0501082_0802977 3300060353 Bacteria 823
2435 Ga0466962_0050095 3300061719 Bacteria 1996
2436 Ga0530510_0006306 3300061734 Bacteria 8251
2437 Ga0530510_0023207 3300061734 Bacteria 4419
2438 Ga0530510_0056862 3300061734 Bacteria 2827
2439 Ga0530510_0501622 3300061734 Bacteria 920

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2964712639 2964713682 144
2 3300048928 Ga0496125_0089238 Ga0496125_0089238_1672_2292 163
3 3300049744 Ga0501083_0035683 Ga0501083_0035683_13_633 163
4 3300035115 Ga0373941_0144616 Ga0373941_0144616_17_622 165
5 3300049743 Ga0501081_0160483 Ga0501081_0160483_986_1588 167
6 3300054114 Ga0501084_0680004 Ga0501084_0680004_20_742 172
7 iso_pu_bacteria 8004312739 8004316468 172
8 3300028800 Ga0265338_10017000 Ga0265338_100170007 174
9 3300014969 Ga0157376_10571240 Ga0157376_105712401 175
10 3300031247 Ga0265340_10021364 Ga0265340_100213647 175
11 3300048929 Ga0496126_0000480 Ga0496126_0000480_17342_18070 175
12 3300049574 Ga0501038_0280002 Ga0501038_0280002_94_819 176
13 3300049822 Ga0501035_0314276 Ga0501035_0314276_309_1034 176
14 3300005983 Ga0081540_1104290 Ga0081540_11042901 177
15 3300017792 Ga0163161_10000415 Ga0163161_100004153 177
16 3300021384 Ga0213876_10003189 Ga0213876_100031899 177
17 3300049570 Ga0501033_0005260 Ga0501033_0005260_2790_3530 177
18 3300049579 Ga0501043_0129225 Ga0501043_0129225_1171_1911 177
19 3300049822 Ga0501035_0206482 Ga0501035_0206482_810_1550 177
20 3300054114 Ga0501084_0000175 Ga0501084_0000175_45717_46436 177
21 3300006237 Ga0097621_100499666 Ga0097621_1004996661 178
22 3300006358 Ga0068871_100628603 Ga0068871_1006286032 178
23 3300039453 Ga0436362_0181583 Ga0436362_0181583_445_1170 178
24 3300049581 Ga0501047_0121226 Ga0501047_0121226_244_960 178
25 3300003215 JGI25153J46596_10000830 JGI25153J46596_1000083025 179
26 3300005563 Ga0068855_100200660 Ga0068855_1002006605 179
27 3300005577 Ga0068857_100224493 Ga0068857_1002244931 179
28 3300025297 Ga0209758_1000013 Ga0209758_1000013904 179
29 3300025915 Ga0207693_10135259 Ga0207693_101352595 179
30 3300026116 Ga0207674_10081317 Ga0207674_100813177 179
31 3300028577 Ga0265318_10048808 Ga0265318_100488082 179
32 3300037466 Ga0395898_0274724 Ga0395898_0274724_371_1102 179
33 3300049580 Ga0501046_0012992 Ga0501046_0012992_2100_2822 179
34 3300049581 Ga0501047_0027205 Ga0501047_0027205_2950_3672 179
35 3300049589 Ga0501073_0043107 Ga0501073_0043107_1036_1767 179
36 3300049742 Ga0501080_0202828 Ga0501080_0202828_987_1718 179
37 3300049822 Ga0501035_0024934 Ga0501035_0024934_947_1669 179
38 3300005344 Ga0070661_100149567 Ga0070661_1001495672 180
39 3300006237 Ga0097621_100261458 Ga0097621_1002614583 180
40 3300046642 Ga0495634_0165760 Ga0495634_0165760_61_759 180
41 3300046675 Ga0495657_0066740 Ga0495657_0066740_230_964 180
42 3300049586 Ga0501070_0487316 Ga0501070_0487316_258_980 180
43 3300053136 Ga0500559_0021975 Ga0500559_0021975_1846_2580 180
44 3300005327 Ga0070658_10246106 Ga0070658_102461061 181
45 3300005530 Ga0070679_100284185 Ga0070679_1002841852 181
46 3300005614 Ga0068856_100128535 Ga0068856_1001285356 181
47 3300025898 Ga0207692_10233009 Ga0207692_102330092 181
48 3300025909 Ga0207705_10422437 Ga0207705_104224372 181
49 3300025913 Ga0207695_10034689 Ga0207695_1003468910 181
50 3300025913 Ga0207695_10060808 Ga0207695_100608084 181
51 3300025921 Ga0207652_10258914 Ga0207652_102589143 181
52 3300025934 Ga0207686_10063006 Ga0207686_100630064 181
53 3300025949 Ga0207667_10032645 Ga0207667_100326454 181
54 3300026116 Ga0207674_10103964 Ga0207674_101039643 181
55 3300028573 Ga0265334_10040684 Ga0265334_100406842 181
56 3300028800 Ga0265338_10000017 Ga0265338_10000017284 181
57 3300031238 Ga0265332_10012502 Ga0265332_100125025 181
58 3300031241 Ga0265325_10000014 Ga0265325_10000014145 181
59 3300031241 Ga0265325_10012680 Ga0265325_100126802 181
60 3300031242 Ga0265329_10032828 Ga0265329_100328283 181
61 3300031249 Ga0265339_10000256 Ga0265339_1000025619 181
62 3300031249 Ga0265339_10007379 Ga0265339_100073793 181
63 3300031249 Ga0265339_10009282 Ga0265339_100092829 181
64 3300031250 Ga0265331_10018237 Ga0265331_100182375 181
65 3300031595 Ga0265313_10000800 Ga0265313_100008007 181
66 3300031711 Ga0265314_10009081 Ga0265314_100090818 181
67 3300031711 Ga0265314_10019382 Ga0265314_100193827 181
68 3300031711 Ga0265314_10027518 Ga0265314_100275189 181
69 3300031711 Ga0265314_10084434 Ga0265314_100844343 181
70 3300031712 Ga0265342_10030570 Ga0265342_100305706 181
71 3300031712 Ga0265342_10042585 Ga0265342_100425854 181
72 3300037312 Ga0395899_0026792 Ga0395899_0026792_2720_3442 181
73 3300037466 Ga0395898_0052542 Ga0395898_0052542_2982_3704 181
74 3300039437 Ga0436365_0731580 Ga0436365_0731580_218_940 181
75 3300039450 Ga0436363_1585904 Ga0436363_1585904_126_845 181
76 3300046535 Ga0495586_0191946 Ga0495586_0191946_19_738 181
77 3300047319 Ga0495674_0207723 Ga0495674_0207723_144_863 181
78 3300049581 Ga0501047_0109042 Ga0501047_0109042_1682_2404 181
79 3300049581 Ga0501047_0117831 Ga0501047_0117831_1272_1988 181
80 3300003214 JGI25165J46597_1001315 JGI25165J46597_100131519 182
81 3300005339 Ga0070660_100051230 Ga0070660_1000512302 182
82 3300005355 Ga0070671_100380986 Ga0070671_1003809862 182
83 3300005548 Ga0070665_100759557 Ga0070665_1007595572 182
84 3300005618 Ga0068864_100288199 Ga0068864_1002881993 182
85 3300006358 Ga0068871_100195885 Ga0068871_1001958852 182
86 3300025230 Ga0209563_103733 Ga0209563_1037332 182
87 3300025261 Ga0209233_1000013 Ga0209233_1000013733 182
88 3300025908 Ga0207643_10101468 Ga0207643_101014683 182
89 3300025911 Ga0207654_10024045 Ga0207654_100240454 182
90 3300025981 Ga0207640_10095916 Ga0207640_100959161 182
91 3300026095 Ga0207676_10064765 Ga0207676_100647652 182
92 3300028379 Ga0268266_10836611 Ga0268266_108366111 182
93 3300028800 Ga0265338_10084066 Ga0265338_100840664 182
94 3300031247 Ga0265340_10031774 Ga0265340_100317743 182
95 3300031249 Ga0265339_10077413 Ga0265339_100774133 182
96 3300031344 Ga0265316_10104221 Ga0265316_101042212 182
97 3300031730 Ga0307516_10110667 Ga0307516_101106673 182
98 3300039437 Ga0436365_0315304 Ga0436365_0315304_88_810 182
99 3300039437 Ga0436365_0580625 Ga0436365_0580625_1569_2300 182
100 3300039453 Ga0436362_0464518 Ga0436362_0464518_180_905 182
101 3300048089 Ga0495614_0191614 Ga0495614_0191614_186_908 182
102 3300048909 Ga0496106_0320238 Ga0496106_0320238_334_1059 182
103 3300048918 Ga0496115_0214681 Ga0496115_0214681_273_998 182
104 3300049570 Ga0501033_0130581 Ga0501033_0130581_758_1483 182
105 3300049583 Ga0501067_0305443 Ga0501067_0305443_81_800 182
106 3300053096 Ga0500641_0101009 Ga0500641_0101009_193_918 182
107 iso_pu_bacteria 8019678201 8019683046 182
108 3300005327 Ga0070658_10021396 Ga0070658_100213969 183
109 3300005329 Ga0070683_100084181 Ga0070683_1000841814 183
110 3300005336 Ga0070680_100002998 Ga0070680_10000299821 183
111 3300005336 Ga0070680_100024678 Ga0070680_10002467810 183
112 3300005344 Ga0070661_100504705 Ga0070661_1005047052 183
113 3300005458 Ga0070681_10000037 Ga0070681_100000379 183
114 3300005530 Ga0070679_100008411 Ga0070679_1000084119 183
115 3300005530 Ga0070679_100035943 Ga0070679_1000359438 183
116 3300005530 Ga0070679_100084772 Ga0070679_1000847724 183
117 3300005535 Ga0070684_100075494 Ga0070684_1000754944 183
118 3300005539 Ga0068853_100002020 Ga0068853_1000020208 183
119 3300005548 Ga0070665_100014624 Ga0070665_1000146249 183
120 3300005548 Ga0070665_100919321 Ga0070665_1009193211 183
121 3300009093 Ga0105240_10656230 Ga0105240_106562301 183
122 3300009176 Ga0105242_10397181 Ga0105242_103971812 183
123 3300010375 Ga0105239_10028473 Ga0105239_100284737 183
124 3300013104 Ga0157370_10224550 Ga0157370_102245504 183
125 3300013105 Ga0157369_10150003 Ga0157369_101500034 183
126 3300013105 Ga0157369_10777483 Ga0157369_107774831 183
127 3300025909 Ga0207705_10004720 Ga0207705_100047209 183
128 3300025911 Ga0207654_10103726 Ga0207654_101037262 183
129 3300025912 Ga0207707_10000011 Ga0207707_100000119 183
130 3300025917 Ga0207660_10003537 Ga0207660_100035379 183
131 3300025921 Ga0207652_10000824 Ga0207652_1000082435 183
132 3300025921 Ga0207652_10107912 Ga0207652_101079126 183
133 3300025921 Ga0207652_10563381 Ga0207652_105633812 183
134 3300025934 Ga0207686_10262639 Ga0207686_102626392 183
135 3300025949 Ga0207667_10059983 Ga0207667_100599837 183
136 3300028379 Ga0268266_10000557 Ga0268266_100005579 183
137 3300028379 Ga0268266_10149237 Ga0268266_101492373 183
138 3300028380 Ga0268265_10108682 Ga0268265_101086825 183
139 3300028800 Ga0265338_10023435 Ga0265338_100234357 183
140 3300031235 Ga0265330_10046835 Ga0265330_100468351 183
141 3300031238 Ga0265332_10017013 Ga0265332_100170134 183
142 3300031241 Ga0265325_10200478 Ga0265325_102004782 183
143 3300031250 Ga0265331_10014090 Ga0265331_100140905 183
144 3300031344 Ga0265316_10076581 Ga0265316_100765817 183
145 3300031595 Ga0265313_10031690 Ga0265313_100316903 183
146 3300031711 Ga0265314_10040994 Ga0265314_100409944 183
147 3300031712 Ga0265342_10046067 Ga0265342_100460672 183
148 3300036401 Ga0373937_0200254 Ga0373937_0200254_640_1362 183
149 3300044842 Ga0466957_0090403 Ga0466957_0090403_831_1553 183
150 3300045976 Ga0466967_0131550 Ga0466967_0131550_1286_2008 183
151 3300047320 Ga0495672_0237273 Ga0495672_0237273_127_849 183
152 3300049570 Ga0501033_0053353 Ga0501033_0053353_1050_1772 183
153 3300049571 Ga0501034_0263062 Ga0501034_0263062_396_1115 183
154 3300049581 Ga0501047_0117481 Ga0501047_0117481_507_1229 183
155 3300049742 Ga0501080_0414374 Ga0501080_0414374_119_841 183
156 3300049822 Ga0501035_0038345 Ga0501035_0038345_2151_2873 183
157 3300053087 Ga0500643_000003 Ga0500643_000003_25313_26035 183
158 3300005338 Ga0068868_100131481 Ga0068868_1001314813 184
159 3300005340 Ga0070689_100060425 Ga0070689_1000604254 184
160 3300005344 Ga0070661_100005946 Ga0070661_10000594612 184
161 3300005437 Ga0070710_10208805 Ga0070710_102088052 184
162 3300005455 Ga0070663_100099452 Ga0070663_1000994522 184
163 3300005618 Ga0068864_100198418 Ga0068864_1001984182 184
164 3300005718 Ga0068866_10028876 Ga0068866_100288765 184
165 3300005843 Ga0068860_100228154 Ga0068860_1002281542 184
166 3300009093 Ga0105240_10748939 Ga0105240_107489392 184
167 3300010375 Ga0105239_10836028 Ga0105239_108360281 184
168 3300013306 Ga0163162_10300098 Ga0163162_103000982 184
169 3300025913 Ga0207695_10047727 Ga0207695_100477272 184
170 3300025921 Ga0207652_10611943 Ga0207652_106119431 184
171 3300025942 Ga0207689_10048864 Ga0207689_100488647 184
172 3300025986 Ga0207658_10476475 Ga0207658_104764752 184
173 3300026035 Ga0207703_10083526 Ga0207703_100835262 184
174 3300026067 Ga0207678_10336599 Ga0207678_103365991 184
175 3300026116 Ga0207674_10269417 Ga0207674_102694174 184
176 3300028577 Ga0265318_10004765 Ga0265318_100047659 184
177 3300031250 Ga0265331_10004741 Ga0265331_100047417 184
178 3300031251 Ga0265327_10001297 Ga0265327_1000129738 184
179 3300031456 Ga0307513_10082281 Ga0307513_100822816 184
180 3300031595 Ga0265313_10016556 Ga0265313_100165562 184
181 3300046477 Ga0495664_0086743 Ga0495664_0086743_178_897 184
182 3300046516 Ga0495628_0122932 Ga0495628_0122932_181_900 184
183 3300046529 Ga0495652_0026548 Ga0495652_0026548_3590_4309 184
184 3300046539 Ga0495621_0107912 Ga0495621_0107912_253_984 184
185 3300046543 Ga0495645_0093461 Ga0495645_0093461_1045_1764 184
186 3300048088 Ga0495602_0372459 Ga0495602_0372459_35_754 184
187 3300048913 Ga0496110_0960134 Ga0496110_0960134_20_748 184
188 3300048924 Ga0496121_0006108 Ga0496121_0006108_9621_10346 184
189 3300048929 Ga0496126_0021992 Ga0496126_0021992_3056_3781 184
190 3300049581 Ga0501047_0423121 Ga0501047_0423121_103_822 184
191 3300053119 Ga0500595_014727 Ga0500595_014727_1241_1972 184
192 3300053119 Ga0500595_042589 Ga0500595_042589_156_881 184
193 3300053139 Ga0500568_0031032 Ga0500568_0031032_1289_2014 184
194 3300053140 Ga0500573_0000452 Ga0500573_0000452_13166_13894 184
195 iso_pu_bacteria 2979742915 2979743186 184
196 3300031712 Ga0265342_10061994 Ga0265342_100619943 185
197 3300039437 Ga0436365_1779536 Ga0436365_1779536_35_784 185
198 3300005327 Ga0070658_10474194 Ga0070658_104741942 186
199 3300006173 Ga0070716_100276309 Ga0070716_1002763092 186
200 3300006175 Ga0070712_100296281 Ga0070712_1002962812 187
201 3300049568 Ga0501031_0025716 Ga0501031_0025716_2262_2984 187
202 3300049569 Ga0501032_0004362 Ga0501032_0004362_9507_10229 187
203 3300049570 Ga0501033_0160129 Ga0501033_0160129_462_1184 187
204 3300049571 Ga0501034_0010632 Ga0501034_0010632_3090_3812 187
205 3300049572 Ga0501036_0005653 Ga0501036_0005653_3677_4399 187
206 3300049573 Ga0501037_0048165 Ga0501037_0048165_870_1592 187
207 3300049575 Ga0501039_0019053 Ga0501039_0019053_289_1011 187
208 3300049578 Ga0501042_0014227 Ga0501042_0014227_1033_1755 187
209 3300049579 Ga0501043_0010388 Ga0501043_0010388_5281_6003 187
210 3300049580 Ga0501046_0005416 Ga0501046_0005416_9395_10117 187
211 3300049581 Ga0501047_0188242 Ga0501047_0188242_1166_1888 187
212 3300049582 Ga0501048_0056621 Ga0501048_0056621_57_779 187
213 3300049583 Ga0501067_0001776 Ga0501067_0001776_7369_8091 187
214 3300049586 Ga0501070_0224329 Ga0501070_0224329_258_980 187
215 3300049589 Ga0501073_0001669 Ga0501073_0001669_15555_16277 187
216 3300049590 Ga0501074_0035296 Ga0501074_0035296_1016_1738 187
217 3300049741 Ga0501079_0001478 Ga0501079_0001478_3729_4451 187
218 3300049742 Ga0501080_0055626 Ga0501080_0055626_2213_2935 187
219 3300049824 Ga0501045_0090970 Ga0501045_0090970_40_762 187
220 3300054114 Ga0501084_0007620 Ga0501084_0007620_7362_8084 187
221 3300005290 Ga0065712_10032322 Ga0065712_100323222 188
222 3300005548 Ga0070665_100960738 Ga0070665_1009607382 188
223 3300005841 Ga0068863_100056946 Ga0068863_1000569467 188
224 3300005844 Ga0068862_100038406 Ga0068862_1000384066 188
225 3300009094 Ga0111539_10460054 Ga0111539_104600544 188
226 3300026088 Ga0207641_10096916 Ga0207641_100969162 188
227 3300028380 Ga0268265_10028090 Ga0268265_100280906 188
228 3300046689 Ga0495613_0087320 Ga0495613_0087320_416_1072 188
229 3300047321 Ga0495676_0191448 Ga0495676_0191448_739_1395 188
230 3300048089 Ga0495614_0150851 Ga0495614_0150851_30_686 188
231 3300049533 Ga0501317_018674 Ga0501317_018674_123_785 188
232 3300054114 Ga0501084_0030163 Ga0501084_0030163_373_1092 188
233 iso_pu_bacteria 2874131515 2874137248 188
234 3300005364 Ga0070673_100356387 Ga0070673_1003563872 189
235 3300035695 Ga0373927_0269383 Ga0373927_0269383_53_745 189
236 3300041405 Ga0439438_017474 Ga0439438_017474_269_1036 190
237 3300005336 Ga0070680_100214999 Ga0070680_1002149993 191
238 3300005341 Ga0070691_10000386 Ga0070691_1000038622 191
239 3300005434 Ga0070709_10003511 Ga0070709_100035119 191
240 3300005434 Ga0070709_10029058 Ga0070709_100290586 191
241 3300005435 Ga0070714_100180397 Ga0070714_1001803972 191
242 3300005436 Ga0070713_100000012 Ga0070713_100000012122 191
243 3300005458 Ga0070681_10234315 Ga0070681_102343154 191
244 3300005539 Ga0068853_100002660 Ga0068853_10000266017 191
245 3300005545 Ga0070695_100003098 Ga0070695_1000030983 191
246 3300005563 Ga0068855_100057023 Ga0068855_1000570238 191
247 3300005564 Ga0070664_100090651 Ga0070664_1000906515 191
248 3300005577 Ga0068857_100007896 Ga0068857_10000789613 191
249 3300005614 Ga0068856_100001032 Ga0068856_1000010329 191
250 3300005614 Ga0068856_100034393 Ga0068856_1000343939 191
251 3300005616 Ga0068852_100006800 Ga0068852_1000068007 191
252 3300005841 Ga0068863_100221748 Ga0068863_1002217482 191
253 3300006175 Ga0070712_100000902 Ga0070712_1000009028 191
254 3300006237 Ga0097621_100441315 Ga0097621_1004413151 191
255 3300006881 Ga0068865_100052261 Ga0068865_1000522613 191
256 3300006914 Ga0075436_100002564 Ga0075436_10000256415 191
257 3300006914 Ga0075436_100019157 Ga0075436_1000191578 191
258 3300006946 Ga0079104_1060067 Ga0079104_10600671 191
259 3300007076 Ga0075435_100104949 Ga0075435_1001049492 191
260 3300009093 Ga0105240_10017473 Ga0105240_100174739 191
261 3300009174 Ga0105241_10083130 Ga0105241_100831304 191
262 3300009551 Ga0105238_10001939 Ga0105238_100019399 191
263 3300010375 Ga0105239_10060445 Ga0105239_100604455 191
264 3300010375 Ga0105239_10459213 Ga0105239_104592133 191
265 3300013100 Ga0157373_10000820 Ga0157373_1000082030 191
266 3300013104 Ga0157370_10003448 Ga0157370_1000344824 191
267 3300013105 Ga0157369_10001535 Ga0157369_100015359 191
268 3300013296 Ga0157374_10322788 Ga0157374_103227883 191
269 3300013306 Ga0163162_10348498 Ga0163162_103484982 191
270 3300013306 Ga0163162_10461077 Ga0163162_104610772 191
271 3300014325 Ga0163163_10056493 Ga0163163_100564936 191
272 3300014968 Ga0157379_10183731 Ga0157379_101837312 191
273 3300025906 Ga0207699_10000164 Ga0207699_1000016431 191
274 3300025915 Ga0207693_10001929 Ga0207693_1000192924 191
275 3300025928 Ga0207700_10000295 Ga0207700_100002959 191
276 3300026078 Ga0207702_10000315 Ga0207702_1000031542 191
277 3300026088 Ga0207641_10202763 Ga0207641_102027633 191
278 3300026095 Ga0207676_10339638 Ga0207676_103396382 191
279 3300026142 Ga0207698_10164361 Ga0207698_101643612 191
280 3300031247 Ga0265340_10065829 Ga0265340_100658294 191
281 3300035691 Ga0373931_0304390 Ga0373931_0304390_169_888 191
282 3300035692 Ga0373935_0466510 Ga0373935_0466510_119_838 191
283 3300049460 Ga0495682_0160048 Ga0495682_0160048_46_768 191
284 3300050513 nmdc:mga0rr50_449091_c1 nmdc:mga0rr50_449091_c1_29_748 191
285 3300050514 nmdc:mga08x19_177_c1 nmdc:mga08x19_177_c1_18325_19044 191
286 3300006846 Ga0075430_100012358 Ga0075430_1000123586 192
287 3300006847 Ga0075431_100046747 Ga0075431_1000467477 192
288 3300009147 Ga0114129_10110222 Ga0114129_101102227 192
289 3300022739 Ga0228711_1000015 Ga0228711_100001533 192
290 3300022740 Ga0228710_1000015 Ga0228710_1000015115 192
291 3300025908 Ga0207643_10354663 Ga0207643_103546631 192
292 3300027111 Ga0209281_1001498 Ga0209281_100149819 192
293 3300027666 Ga0209282_1000054 Ga0209282_1000054100 192
294 3300031967 Ga0315914_1000013 Ga0315914_100001333 192
295 3300033430 Ga0315913_1000097 Ga0315913_100009733 192
296 3300033464 Ga0315915_1000001 Ga0315915_100000133 192
297 3300049589 Ga0501073_0054449 Ga0501073_0054449_1043_1720 192
298 3300049744 Ga0501083_0039700 Ga0501083_0039700_1272_1949 192
299 3300050509 nmdc:mga0qj67_37265_c1 nmdc:mga0qj67_37265_c1_875_1639 192
300 3300050510 nmdc:mga06r32_8073_c1 nmdc:mga06r32_8073_c1_7429_8193 192
301 3300054114 Ga0501084_0189781 Ga0501084_0189781_592_1269 192
302 3300060353 Ga0501082_0204185 Ga0501082_0204185_258_935 192
303 3300060353 Ga0501082_0345988 Ga0501082_0345988_310_987 192
304 iso_pu_bacteria 2671180139 2671694502 192
305 3300005337 Ga0070682_100353338 Ga0070682_1003533382 193
306 3300005344 Ga0070661_100049078 Ga0070661_1000490784 193
307 3300005539 Ga0068853_100000888 Ga0068853_1000008889 193
308 3300005548 Ga0070665_100116987 Ga0070665_1001169874 193
309 3300005548 Ga0070665_100241632 Ga0070665_1002416323 193
310 3300005563 Ga0068855_100132159 Ga0068855_1001321592 193
311 3300005578 Ga0068854_100225910 Ga0068854_1002259102 193
312 3300005616 Ga0068852_100026746 Ga0068852_1000267465 193
313 3300005618 Ga0068864_100047292 Ga0068864_1000472927 193
314 3300005834 Ga0068851_10011945 Ga0068851_100119452 193
315 3300005841 Ga0068863_100262074 Ga0068863_1002620742 193
316 3300005842 Ga0068858_100405268 Ga0068858_1004052682 193
317 3300009551 Ga0105238_10060184 Ga0105238_100601849 193
318 3300009553 Ga0105249_10238958 Ga0105249_102389583 193
319 3300010375 Ga0105239_10039505 Ga0105239_100395053 193
320 3300014325 Ga0163163_10008003 Ga0163163_1000800313 193
321 3300014968 Ga0157379_10018151 Ga0157379_100181519 193
322 3300025321 Ga0207656_10000708 Ga0207656_1000070813 193
323 3300025907 Ga0207645_10010484 Ga0207645_100104849 193
324 3300025913 Ga0207695_10109547 Ga0207695_101095474 193
325 3300025920 Ga0207649_10003305 Ga0207649_1000330512 193
326 3300025924 Ga0207694_10085496 Ga0207694_100854961 193
327 3300025949 Ga0207667_10119839 Ga0207667_101198396 193
328 3300025981 Ga0207640_10121661 Ga0207640_101216612 193
329 3300026041 Ga0207639_10002448 Ga0207639_1000244810 193
330 3300026078 Ga0207702_10858171 Ga0207702_108581711 193
331 3300026142 Ga0207698_10089559 Ga0207698_100895593 193
332 3300028800 Ga0265338_10007393 Ga0265338_1000739313 193
333 3300031241 Ga0265325_10036457 Ga0265325_100364576 193
334 3300031249 Ga0265339_10004598 Ga0265339_100045989 193
335 3300031250 Ga0265331_10034498 Ga0265331_100344985 193
336 3300031595 Ga0265313_10007021 Ga0265313_1000702110 193
337 3300031691 Ga0316579_10077344 Ga0316579_100773443 193
338 3300031711 Ga0265314_10025339 Ga0265314_100253394 193
339 3300031711 Ga0265314_10082484 Ga0265314_100824843 193
340 3300031712 Ga0265342_10030308 Ga0265342_100303084 193
341 3300032168 Ga0316593_10003175 Ga0316593_100031755 193
342 3300033524 Ga0316592_1000411 Ga0316592_10004119 193
343 3300033541 Ga0316596_1000644 Ga0316596_10006447 193
344 3300036647 Ga0316582_0012852 Ga0316582_0012852_358_1035 193
345 3300037588 Ga0316581_0001826 Ga0316581_0001826_2851_3528 193
346 3300045976 Ga0466967_0637777 Ga0466967_0637777_266_1009 193
347 3300046691 Ga0495670_0035476 Ga0495670_0035476_286_1017 193
348 3300048919 Ga0496116_0000092 Ga0496116_0000092_88427_89119 193
349 3300048920 Ga0496117_0014491 Ga0496117_0014491_4611_5303 193
350 3300048921 Ga0496118_0002782 Ga0496118_0002782_21757_22449 193
351 3300049571 Ga0501034_0023047 Ga0501034_0023047_1999_2793 193
352 3300049574 Ga0501038_0241573 Ga0501038_0241573_56_736 193
353 3300049581 Ga0501047_0002319 Ga0501047_0002319_13254_13934 193
354 3300049586 Ga0501070_0108827 Ga0501070_0108827_1081_1761 193
355 3300049823 Ga0501044_0048954 Ga0501044_0048954_818_1570 193
356 iso_pu_bacteria 2840878972 2840883977 193
357 iso_pu_bacteria 3000405567 3000406728 193
358 3300031239 Ga0265328_10013913 Ga0265328_100139133 194
359 3300031250 Ga0265331_10005768 Ga0265331_100057689 194
360 3300031251 Ga0265327_10014494 Ga0265327_100144942 194
361 3300031251 Ga0265327_10040029 Ga0265327_100400292 194
362 3300031251 Ga0265327_10091393 Ga0265327_100913933 194
363 3300038443 Ga0395901_0067405 Ga0395901_0067405_2944_3633 194
364 3300049570 Ga0501033_0029185 Ga0501033_0029185_3300_4028 194
365 3300049574 Ga0501038_0378541 Ga0501038_0378541_261_989 194
366 3300053151 Ga0500604_0000294 Ga0500604_0000294_2577_3326 194
367 iso_pu_bacteria 2889790730 2889793666 194
368 iso_pu_bacteria 2889914905 2889919536 194
369 iso_pu_bacteria 3000017691 3000019212 194
370 3300005327 Ga0070658_10546941 Ga0070658_105469411 195
371 3300050507 nmdc:mga05p37_153008_c1 nmdc:mga05p37_153008_c1_1094_1858 195
372 3300059604 Ga0587098_019869 Ga0587098_019869_96_797 195
373 iso_pu_bacteria 2643221551 2643775173 195
374 iso_pu_bacteria 2643221555 2643793619 195
375 iso_pu_bacteria 2903492973 2903495127 195
376 iso_pu_bacteria 2937843397 2937845876 195
377 3300001989 JGI24739J22299_10033386 JGI24739J22299_100333864 196
378 3300002774 JGI25150J39212_1023476 JGI25150J39212_10234761 196
379 3300002987 JGI25159J45721_1003109 JGI25159J45721_10031094 196
380 3300003354 JGI25160J50197_1004536 JGI25160J50197_10045369 196
381 3300003771 Ga0055526_1003723 Ga0055526_100372312 196
382 3300003781 Ga0055536_1005747 Ga0055536_10057479 196
383 3300003790 Ga0055528_1027652 Ga0055528_10276521 196
384 3300003791 Ga0055530_10039824 Ga0055530_100398241 196
385 3300003792 Ga0055540_1009828 Ga0055540_10098284 196
386 3300003792 Ga0055540_1010479 Ga0055540_10104797 196
387 3300003794 Ga0055531_10006856 Ga0055531_100068569 196
388 3300003794 Ga0055531_10021596 Ga0055531_100215964 196
389 3300004625 Ga0055543_1000856 Ga0055543_100085619 196
390 3300004625 Ga0055543_1006890 Ga0055543_10068903 196
391 3300005262 Ga0065165_1002620 Ga0065165_100262019 196
392 3300005441 Ga0070700_100205987 Ga0070700_1002059872 196
393 3300005545 Ga0070695_100002611 Ga0070695_1000026117 196
394 3300005937 Ga0081455_10001008 Ga0081455_1000100836 196
395 3300005983 Ga0081540_1000645 Ga0081540_10006459 196
396 3300005983 Ga0081540_1016488 Ga0081540_10164886 196
397 3300005983 Ga0081540_1066916 Ga0081540_10669162 196
398 3300005983 Ga0081540_1132292 Ga0081540_11322922 196
399 3300006038 Ga0075365_10074713 Ga0075365_100747131 196
400 3300006042 Ga0075368_10033606 Ga0075368_100336062 196
401 3300006163 Ga0070715_10002284 Ga0070715_100022846 196
402 3300006177 Ga0075362_10008904 Ga0075362_100089045 196
403 3300006186 Ga0075369_10033715 Ga0075369_100337152 196
404 3300006844 Ga0075428_100016989 Ga0075428_1000169896 196
405 3300006852 Ga0075433_10001194 Ga0075433_1000119423 196
406 3300006871 Ga0075434_100004950 Ga0075434_10000495017 196
407 3300007076 Ga0075435_100470532 Ga0075435_1004705321 196
408 3300009094 Ga0111539_10041077 Ga0111539_100410774 196
409 3300009094 Ga0111539_10114413 Ga0111539_101144137 196
410 3300009098 Ga0105245_10026779 Ga0105245_100267796 196
411 3300021377 Ga0213874_10005223 Ga0213874_100052235 196
412 3300025208 Ga0209436_102647 Ga0209436_1026479 196
413 3300025245 Ga0207425_1018210 Ga0207425_10182103 196
414 3300025258 Ga0209129_1009244 Ga0209129_10092443 196
415 3300025263 Ga0209565_1015168 Ga0209565_10151683 196
416 3300025273 Ga0209673_1000864 Ga0209673_100086444 196
417 3300025284 Ga0209130_1000007 Ga0209130_1000007328 196
418 3300025292 Ga0209676_1001545 Ga0209676_100154524 196
419 3300025292 Ga0209676_1026047 Ga0209676_10260472 196
420 3300025294 Ga0209025_1000303 Ga0209025_100030319 196
421 3300025294 Ga0209025_1011543 Ga0209025_10115439 196
422 3300025295 Ga0209564_1000140 Ga0209564_1000140170 196
423 3300025297 Ga0209758_1007810 Ga0209758_100781012 196
424 3300025298 Ga0209050_1002103 Ga0209050_10021039 196
425 3300025298 Ga0209050_1017582 Ga0209050_10175825 196
426 3300025299 Ga0209256_1010415 Ga0209256_10104155 196
427 3300025302 Ga0207426_1000064 Ga0207426_1000064328 196
428 3300025302 Ga0207426_1016359 Ga0207426_10163594 196
429 3300025303 Ga0209051_1002149 Ga0209051_10021499 196
430 3300025303 Ga0209051_1029797 Ga0209051_10297973 196
431 3300025304 Ga0209257_1000817 Ga0209257_100081724 196
432 3300025304 Ga0209257_1026877 Ga0209257_10268772 196
433 3300025903 Ga0207680_10087949 Ga0207680_100879494 196
434 3300025905 Ga0207685_10009749 Ga0207685_100097492 196
435 3300026067 Ga0207678_10380647 Ga0207678_103806472 196
436 3300026075 Ga0207708_10271234 Ga0207708_102712342 196
437 3300027866 Ga0209813_10038178 Ga0209813_100381782 196
438 3300027907 Ga0207428_10256809 Ga0207428_102568093 196
439 3300031665 Ga0316575_10106552 Ga0316575_101065522 196
440 3300033541 Ga0316596_1021562 Ga0316596_10215622 196
441 3300034816 Ga0373930_0009279 Ga0373930_0009279_504_1247 196
442 3300034820 Ga0373959_0007428 Ga0373959_0007428_778_1518 196
443 3300034957 Ga0373938_0012157 Ga0373938_0012157_420_1160 196
444 3300035088 Ga0373940_0009733 Ga0373940_0009733_754_1494 196
445 3300035088 Ga0373940_0018090 Ga0373940_0018090_1001_1741 196
446 3300035114 Ga0373939_0008019 Ga0373939_0008019_467_1207 196
447 3300035115 Ga0373941_0009300 Ga0373941_0009300_1329_2072 196
448 3300035121 Ga0373960_0005540 Ga0373960_0005540_960_1700 196
449 3300035121 Ga0373960_0046732 Ga0373960_0046732_16_756 196
450 3300035241 Ga0373961_0029192 Ga0373961_0029192_555_1295 196
451 3300035242 Ga0373962_0002272 Ga0373962_0002272_3736_4476 196
452 3300035398 Ga0316574_0009371 Ga0316574_0009371_3617_4342 196
453 3300035691 Ga0373931_0001781 Ga0373931_0001781_2309_3049 196
454 3300035691 Ga0373931_0017627 Ga0373931_0017627_917_1657 196
455 3300036647 Ga0316582_0082850 Ga0316582_0082850_932_1657 196
456 3300039447 Ga0436361_0643647 Ga0436361_0643647_1286_2017 196
457 3300039450 Ga0436363_1571548 Ga0436363_1571548_6191_6922 196
458 3300041491 Ga0451833_0093746 Ga0451833_0093746_742_1473 196
459 3300041492 Ga0451835_0028721 Ga0451835_0028721_3516_4247 196
460 3300041494 Ga0451837_0879643 Ga0451837_0879643_3166_3897 196
461 3300041496 Ga0451839_0229334 Ga0451839_0229334_2989_3720 196
462 3300041498 Ga0451841_0087010 Ga0451841_0087010_3996_4727 196
463 3300041501 Ga0451845_0062342 Ga0451845_0062342_4394_5125 196
464 3300041502 Ga0451846_01205 Ga0451846_01205_5608_6339 196
465 3300041503 Ga0451847_0040601 Ga0451847_0040601_47_778 196
466 3300041504 Ga0451848_08151 Ga0451848_08151_259_990 196
467 3300041505 Ga0451849_0038121 Ga0451849_0038121_1257_1988 196
468 3300041507 Ga0451851_0046308 Ga0451851_0046308_3314_4045 196
469 3300041510 Ga0451854_09647 Ga0451854_09647_276_1007 196
470 3300041512 Ga0451853_2317430 Ga0451853_2317430_4394_5125 196
471 3300041916 Ga0452271_14635 Ga0452271_14635_36_767 196
472 3300045051 Ga0451576_0354049 Ga0451576_0354049_452_1243 196
473 3300046491 Ga0495584_0016774 Ga0495584_0016774_88_828 196
474 3300048917 Ga0496114_0369177 Ga0496114_0369177_381_1121 196
475 3300048917 Ga0496114_0508239 Ga0496114_0508239_23_766 196
476 3300049569 Ga0501032_0001915 Ga0501032_0001915_7291_8007 196
477 3300049570 Ga0501033_0092675 Ga0501033_0092675_309_1016 196
478 3300049571 Ga0501034_0071741 Ga0501034_0071741_2419_3171 196
479 3300049572 Ga0501036_0027081 Ga0501036_0027081_986_1693 196
480 3300049574 Ga0501038_0140388 Ga0501038_0140388_702_1409 196
481 3300049579 Ga0501043_0012997 Ga0501043_0012997_2520_3236 196
482 3300049583 Ga0501067_0052681 Ga0501067_0052681_682_1398 196
483 3300049584 Ga0501068_0011134 Ga0501068_0011134_2152_2868 196
484 3300049589 Ga0501073_0000083 Ga0501073_0000083_44341_45057 196
485 3300049589 Ga0501073_0431995 Ga0501073_0431995_86_838 196
486 3300049593 Ga0501077_0000088 Ga0501077_0000088_13945_14661 196
487 3300049742 Ga0501080_0003162 Ga0501080_0003162_6933_7649 196
488 3300049822 Ga0501035_0024284 Ga0501035_0024284_1995_2702 196
489 3300049823 Ga0501044_0009814 Ga0501044_0009814_2548_3264 196
490 3300049823 Ga0501044_0376465 Ga0501044_0376465_175_882 196
491 3300050511 nmdc:mga08y16_42994_c1 nmdc:mga08y16_42994_c1_1720_2460 196
492 3300050512 nmdc:mga0n895_2833_c1 nmdc:mga0n895_2833_c1_3269_4009 196
493 3300050513 nmdc:mga0rr50_36067_c1 nmdc:mga0rr50_36067_c1_2656_3396 196
494 3300050515 nmdc:mga0a205_2479_c1 nmdc:mga0a205_2479_c1_6046_6786 196
495 3300059504 Ga0587082_001400 Ga0587082_001400_1514_2245 196
496 3300059510 Ga0587090_019067 Ga0587090_019067_230_961 196
497 3300059641 Ga0587068_001047 Ga0587068_001047_918_1649 196
498 3300059643 Ga0587072_003910 Ga0587072_003910_1303_2034 196
499 3300060353 Ga0501082_0161198 Ga0501082_0161198_1105_1821 196
500 3300060353 Ga0501082_0802977 Ga0501082_0802977_11_718 196
501 iso_pu_bacteria 2510461069 2510843940 196
502 iso_pu_bacteria 2511231027 2511390479 196
503 iso_pu_bacteria 2513237159 2514002408 196
504 iso_pu_bacteria 2534681786 2535484942 196
505 iso_pu_bacteria 2537561587 2537874326 196
506 iso_pu_bacteria 2554235003 2554248089 196
507 iso_pu_bacteria 2558860242 2559295206 196
508 iso_pu_bacteria 2558860983 2561468197 196
509 iso_pu_bacteria 2582581283 2585168169 196
510 iso_pu_bacteria 2582581306 2585268784 196
511 iso_pu_bacteria 2582581865 2585390962 196
512 iso_pu_bacteria 2582581866 2585398188 196
513 iso_pu_bacteria 2599185210 2599601526 196
514 iso_pu_bacteria 2600255279 2601612155 196
515 iso_pu_bacteria 2600255308 2601749061 196
516 iso_pu_bacteria 2643221582 2643919628 196
517 iso_pu_bacteria 2643221607 2644049690 196
518 iso_pu_bacteria 2643221636 2644203902 196
519 iso_pu_bacteria 2643221637 2644207714 196
520 iso_pu_bacteria 2643221653 2644300114 196
521 iso_pu_bacteria 2643221686 2644482723 196
522 iso_pu_bacteria 2643221688 2644494821 196
523 iso_pu_bacteria 2643221689 2644499214 196
524 iso_pu_bacteria 2643221693 2644520149 196
525 iso_pu_bacteria 2643221718 2644654479 196
526 iso_pu_bacteria 2643221719 2644658340 196
527 iso_pu_bacteria 2738541317 2738945232 196
528 iso_pu_bacteria 2751185800 2753359571 196
529 iso_pu_bacteria 2757320392 2757572016 196
530 iso_pu_bacteria 2758568016 2758641832 196
531 iso_pu_bacteria 2765235802 2765465539 196
532 iso_pu_bacteria 2767802442 2770195564 196
533 iso_pu_bacteria 2775506902 2776271574 196
534 iso_pu_bacteria 2775506904 2776279914 196
535 iso_pu_bacteria 2775507049 2776913082 196
536 iso_pu_bacteria 2808606387 2808985076 196
537 iso_pu_bacteria 2818991272 2819242271 196
538 iso_pu_bacteria 2818991439 2819559504 196
539 iso_pu_bacteria 2837651117 2837653695 196
540 iso_pu_bacteria 2837678835 2837679311 196
541 iso_pu_bacteria 2837678835 2837682789 196
542 iso_pu_bacteria 2838675328 2838675939 196
543 iso_pu_bacteria 2838714209 2838714821 196
544 iso_pu_bacteria 2838719591 2838721378 196
545 iso_pu_bacteria 2838724970 2838725581 196
546 iso_pu_bacteria 2839993093 2839995593 196
547 iso_pu_bacteria 2840764183 2840768020 196
548 iso_pu_bacteria 2841846520 2841848345 196
549 iso_pu_bacteria 2841859092 2841859100 196
550 iso_pu_bacteria 2842124991 2842125625 196
551 iso_pu_bacteria 2842130223 2842130834 196
552 iso_pu_bacteria 2842152218 2842153996 196
553 iso_pu_bacteria 2842170452 2842171065 196
554 iso_pu_bacteria 2842175837 2842177616 196
555 iso_pu_bacteria 2842187318 2842187930 196
556 iso_pu_bacteria 2842211629 2842212241 196
557 iso_pu_bacteria 2842224351 2842226140 196
558 iso_pu_bacteria 2842515876 2842515884 196
559 iso_pu_bacteria 2842521101 2842527572 196
560 iso_pu_bacteria 2842871566 2842872904 196
561 iso_pu_bacteria 2847670302 2847670795 196
562 iso_pu_bacteria 2847686936 2847687068 196
563 iso_pu_bacteria 2854911287 2854912163 196
564 iso_pu_bacteria 2856314179 2856316252 196
565 iso_pu_bacteria 2871444079 2871448836 196
566 iso_pu_bacteria 2871495908 2871500458 196
567 iso_pu_bacteria 2874102143 2874106569 196
568 iso_pu_bacteria 2876369609 2876377610 196
569 iso_pu_bacteria 2876392853 2876395265 196
570 iso_pu_bacteria 2878035449 2878041575 196
571 iso_pu_bacteria 2878760144 2878764547 196
572 iso_pu_bacteria 2878767105 2878771648 196
573 iso_pu_bacteria 2881147464 2881152552 196
574 iso_pu_bacteria 2881161766 2881161792 196
575 iso_pu_bacteria 2885305155 2885310677 196
576 iso_pu_bacteria 2885326080 2885326322 196
577 iso_pu_bacteria 2891048133 2891050824 196
578 iso_pu_bacteria 2891373044 2891377318 196
579 iso_pu_bacteria 2894652903 2894654239 196
580 iso_pu_bacteria 2894817345 2894818631 196
581 iso_pu_bacteria 2899792073 2899794881 196
582 iso_pu_bacteria 2899803654 2899807802 196
583 iso_pu_bacteria 2899845264 2899848102 196
584 iso_pu_bacteria 2903540706 2903545271 196
585 iso_pu_bacteria 2904578770 2904583230 196
586 iso_pu_bacteria 2904659560 2904661895 196
587 iso_pu_bacteria 2906328253 2906328360 196
588 iso_pu_bacteria 2906414383 2906416389 196
589 iso_pu_bacteria 2913308742 2913309934 196
590 iso_pu_bacteria 2915650412 2915654127 196
591 iso_pu_bacteria 2919114240 2919114910 196
592 iso_pu_bacteria 2919119836 2919123878 196
593 iso_pu_bacteria 2922158528 2922159634 196
594 iso_pu_bacteria 2924726620 2924727279 196
595 iso_pu_bacteria 2926754445 2926755876 196
596 iso_pu_bacteria 2926760298 2926762974 196
597 iso_pu_bacteria 2928521798 2928524361 196
598 iso_pu_bacteria 2929138655 2929140714 196
599 iso_pu_bacteria 2933006813 2933008641 196
600 iso_pu_bacteria 2933011516 2933011740 196
601 iso_pu_bacteria 2933594066 2933596756 196
602 iso_pu_bacteria 2937891427 2937898208 196
603 iso_pu_bacteria 2937994558 2937999121 196
604 iso_pu_bacteria 2954011201 2954015363 196
605 iso_pu_bacteria 2958115193 2958122496 196
606 iso_pu_bacteria 2958165035 2958169595 196
607 iso_pu_bacteria 2961114664 2961117048 196
608 iso_pu_bacteria 2961163497 2961168055 196
609 iso_pu_bacteria 2965018300 2965022874 196
610 iso_pu_bacteria 2965062239 2965066166 196
611 iso_pu_bacteria 2968091066 2968092504 196
612 iso_pu_bacteria 2968097103 2968102408 196
613 iso_pu_bacteria 2968110612 2968112956 196
614 iso_pu_bacteria 2968128360 2968128765 196
615 iso_pu_bacteria 2968171901 2968176455 196
616 iso_pu_bacteria 2970554993 2970559394 196
617 iso_pu_bacteria 2977858184 2977860267 196
618 iso_pu_bacteria 2977864932 2977871957 196
619 iso_pu_bacteria 2979089926 2979094533 196
620 iso_pu_bacteria 2979095461 2979098084 196
621 iso_pu_bacteria 2979100975 2979103775 196
622 iso_pu_bacteria 2979779861 2979783037 196
623 iso_pu_bacteria 2984509177 2984511659 196
624 iso_pu_bacteria 2984518228 2984521980 196
625 iso_pu_bacteria 2984537506 2984541278 196
626 iso_pu_bacteria 2984601300 2984603556 196
627 iso_pu_bacteria 2987659509 2987664069 196
628 iso_pu_bacteria 2989771324 2989775896 196
629 iso_pu_bacteria 2989776772 2989778451 196
630 iso_pu_bacteria 2995392953 2995397025 196
631 iso_pu_bacteria 2996341866 2996347147 196
632 iso_pu_bacteria 3002141150 3002143946 196
633 iso_pu_bacteria 3004188549 3004193124 196
634 iso_pu_bacteria 650716007 650740412 196
635 iso_pu_bacteria 8003570095 8003571474 196
636 iso_pu_bacteria 8004445564 8004451615 196
637 iso_pu_bacteria 8004703790 8004714456 196
638 iso_pu_bacteria 8005246636 8005251043 196
639 iso_pu_bacteria 8005658619 8005659730 196
640 iso_pu_bacteria 8024486573 8024489498 196
641 iso_pu_bacteria 8045864390 8045865501 196
642 iso_pu_bacteria 8055431914 8055435777 196
643 3300001979 JGI24740J21852_10003174 JGI24740J21852_100031749 197
644 3300002704 JGI25155J39150_1000061 JGI25155J39150_100006110 197
645 3300002705 JGI25156J39149_1002868 JGI25156J39149_100286810 197
646 3300002738 JGI25154J39366_1002032 JGI25154J39366_10020324 197
647 3300002741 JGI25157J39369_1000106 JGI25157J39369_100010610 197
648 3300002987 JGI25159J45721_1003394 JGI25159J45721_10033944 197
649 3300003214 JGI25165J46597_1009422 JGI25165J46597_10094222 197
650 3300003354 JGI25160J50197_1004964 JGI25160J50197_10049644 197
651 3300003374 JGI25161J50226_1001962 JGI25161J50226_10019624 197
652 3300004625 Ga0055543_1000880 Ga0055543_10008809 197
653 3300005262 Ga0065165_1002688 Ga0065165_100268819 197
654 3300005354 Ga0070675_100484270 Ga0070675_1004842702 197
655 3300005563 Ga0068855_100299852 Ga0068855_1002998522 197
656 3300005614 Ga0068856_100114856 Ga0068856_1001148562 197
657 3300005615 Ga0070702_100358290 Ga0070702_1003582902 197
658 3300005616 Ga0068852_100426593 Ga0068852_1004265932 197
659 3300005937 Ga0081455_10068347 Ga0081455_100683474 197
660 3300006051 Ga0075364_10081228 Ga0075364_100812284 197
661 3300006852 Ga0075433_10407426 Ga0075433_104074262 197
662 3300006871 Ga0075434_100201192 Ga0075434_1002011924 197
663 3300009093 Ga0105240_10000005 Ga0105240_100000059 197
664 3300009147 Ga0114129_10278251 Ga0114129_102782512 197
665 3300009148 Ga0105243_10212915 Ga0105243_102129154 197
666 3300009177 Ga0105248_10346812 Ga0105248_103468122 197
667 3300009545 Ga0105237_10001070 Ga0105237_1000107043 197
668 3300010375 Ga0105239_10030108 Ga0105239_100301089 197
669 3300013306 Ga0163162_10099317 Ga0163162_100993176 197
670 3300025206 Ga0209435_100024 Ga0209435_100024191 197
671 3300025233 Ga0209437_100969 Ga0209437_1009693 197
672 3300025233 Ga0209437_100970 Ga0209437_1009703 197
673 3300025246 Ga0209646_1000064 Ga0209646_1000064191 197
674 3300025250 Ga0209026_1000053 Ga0209026_1000053191 197
675 3300025253 Ga0209677_101193 Ga0209677_1011934 197
676 3300025256 Ga0209759_1000042 Ga0209759_1000042191 197
677 3300025261 Ga0209233_1003146 Ga0209233_10031465 197
678 3300025261 Ga0209233_1004786 Ga0209233_10047865 197
679 3300025284 Ga0209130_1001130 Ga0209130_100113026 197
680 3300025302 Ga0207426_1000044 Ga0207426_1000044397 197
681 3300025906 Ga0207699_10068253 Ga0207699_100682534 197
682 3300025912 Ga0207707_10589425 Ga0207707_105894252 197
683 3300025913 Ga0207695_10000011 Ga0207695_10000011905 197
684 3300025913 Ga0207695_10036358 Ga0207695_100363584 197
685 3300025914 Ga0207671_10001852 Ga0207671_1000185230 197
686 3300025914 Ga0207671_10016535 Ga0207671_100165359 197
687 3300025917 Ga0207660_10699184 Ga0207660_106991842 197
688 3300025924 Ga0207694_10008694 Ga0207694_1000869410 197
689 3300025929 Ga0207664_10598571 Ga0207664_105985711 197
690 3300025941 Ga0207711_10127202 Ga0207711_101272022 197
691 3300025945 Ga0207679_10102987 Ga0207679_101029873 197
692 3300025949 Ga0207667_10006198 Ga0207667_100061984 197
693 3300026041 Ga0207639_10010763 Ga0207639_100107634 197
694 3300026078 Ga0207702_10009824 Ga0207702_100098249 197
695 3300026116 Ga0207674_10001605 Ga0207674_1000160532 197
696 3300026116 Ga0207674_10364721 Ga0207674_103647212 197
697 3300026118 Ga0207675_100309836 Ga0207675_1003098363 197
698 3300026142 Ga0207698_10012405 Ga0207698_1001240510 197
699 3300027312 Ga0209371_1002385 Ga0209371_100238510 197
700 3300028794 Ga0307515_10091937 Ga0307515_100919375 197
701 3300030500 Ga0268256_1002127 Ga0268256_100212710 197
702 3300031239 Ga0265328_10002900 Ga0265328_1000290015 197
703 3300032168 Ga0316593_10048236 Ga0316593_100482362 197
704 3300038735 Ga0400485_07971 Ga0400485_07971_589_1314 197
705 3300039062 Ga0400483_260675 Ga0400483_260675_732_1448 197
706 3300046472 Ga0495580_0118153 Ga0495580_0118153_971_1675 197
707 3300046538 Ga0495609_0117575 Ga0495609_0117575_16_714 197
708 3300048903 Ga0496100_0139615 Ga0496100_0139615_41_808 197
709 3300048905 Ga0496102_0043525 Ga0496102_0043525_2407_3174 197
710 3300048907 Ga0496104_0016470 Ga0496104_0016470_4005_4772 197
711 3300048909 Ga0496106_0143840 Ga0496106_0143840_724_1491 197
712 3300048911 Ga0496108_0118495 Ga0496108_0118495_1361_2131 197
713 3300048911 Ga0496108_0124272 Ga0496108_0124272_254_1021 197
714 3300048912 Ga0496109_0238380 Ga0496109_0238380_445_1197 197
715 3300048913 Ga0496110_0137054 Ga0496110_0137054_763_1533 197
716 3300048914 Ga0496111_0132202 Ga0496111_0132202_585_1352 197
717 3300048917 Ga0496114_0076700 Ga0496114_0076700_29_796 197
718 3300048925 Ga0496122_0084711 Ga0496122_0084711_1135_1875 197
719 3300048927 Ga0496124_0095630 Ga0496124_0095630_840_1580 197
720 3300048928 Ga0496125_0000815 Ga0496125_0000815_34457_35197 197
721 3300049161 Ga0501305_002601 Ga0501305_002601_137_877 197
722 3300049162 Ga0501307_001858 Ga0501307_001858_247_987 197
723 3300049527 Ga0501311_000868 Ga0501311_000868_467_1207 197
724 3300049528 Ga0501312_003063 Ga0501312_003063_63_803 197
725 3300049591 Ga0501075_0265762 Ga0501075_0265762_426_1127 197
726 3300050491 nmdc:mga00v17_2387_c1 nmdc:mga00v17_2387_c1_2646_3413 197
727 3300050508 nmdc:mga09592_284951_c1 nmdc:mga09592_284951_c1_577_1341 197
728 3300050509 nmdc:mga0qj67_63495_c1 nmdc:mga0qj67_63495_c1_576_1340 197
729 3300050510 nmdc:mga06r32_80366_c1 nmdc:mga06r32_80366_c1_2258_3022 197
730 3300050514 nmdc:mga08x19_14934_c1 nmdc:mga08x19_14934_c1_603_1325 197
731 3300054114 Ga0501084_0274220 Ga0501084_0274220_645_1349 197
732 3300059503 Ga0587080_001057 Ga0587080_001057_1514_2239 197
733 3300059505 Ga0587083_0001820 Ga0587083_0001820_1448_2173 197
734 3300059643 Ga0587072_029350 Ga0587072_029350_201_926 197
735 3300059645 Ga0587076_001185 Ga0587076_001185_352_1077 197
736 3300059652 Ga0587107_004123 Ga0587107_004123_586_1311 197
737 iso_pu_bacteria 2503198000 2503202661 197
738 iso_pu_bacteria 2508501122 2509112678 197
739 iso_pu_bacteria 2508501123 2509117724 197
740 iso_pu_bacteria 2508501127 2509143591 197
741 iso_pu_bacteria 2509276018 2509372994 197
742 iso_pu_bacteria 2509276019 2509380432 197
743 iso_pu_bacteria 2509276021 2509387447 197
744 iso_pu_bacteria 2509276022 2509397166 197
745 iso_pu_bacteria 2509276033 2509442837 197
746 iso_pu_bacteria 2510065019 2510132540 197
747 iso_pu_bacteria 2510065057 2510308392 197
748 iso_pu_bacteria 2510065059 2510319914 197
749 iso_pu_bacteria 2510461076 2510893885 197
750 iso_pu_bacteria 2510461076 2510898910 197
751 iso_pu_bacteria 2510917022 2511132378 197
752 iso_pu_bacteria 2510917028 2511181300 197
753 iso_pu_bacteria 2510917030 2511193802 197
754 iso_pu_bacteria 2511231052 2511501263 197
755 iso_pu_bacteria 2512047086 2512532688 197
756 iso_pu_bacteria 2512875016 2512930565 197
757 iso_pu_bacteria 2512875024 2512958297 197
758 iso_pu_bacteria 2512875026 2512971983 197
759 iso_pu_bacteria 2513237084 2513574112 197
760 iso_pu_bacteria 2513237085 2513579032 197
761 iso_pu_bacteria 2513237086 2513587125 197
762 iso_pu_bacteria 2513237088 2513599759 197
763 iso_pu_bacteria 2513237089 2513607072 197
764 iso_pu_bacteria 2513237090 2513612128 197
765 iso_pu_bacteria 2513237091 2513620846 197
766 iso_pu_bacteria 2513237093 2513632531 197
767 iso_pu_bacteria 2513237103 2513708980 197
768 iso_pu_bacteria 2513237138 2513866873 197
769 iso_pu_bacteria 2513237140 2513886835 197
770 iso_pu_bacteria 2513237143 2513906976 197
771 iso_pu_bacteria 2513237144 2513909588 197
772 iso_pu_bacteria 2513237146 2513929480 197
773 iso_pu_bacteria 2513237156 2513987833 197
774 iso_pu_bacteria 2513237160 2514008888 197
775 iso_pu_bacteria 2513237162 2514019589 197
776 iso_pu_bacteria 2513237164 2514032570 197
777 iso_pu_bacteria 2513237305 2514422081 197
778 iso_pu_bacteria 2513237351 2514589868 197
779 iso_pu_bacteria 2515075009 2515111530 197
780 iso_pu_bacteria 2515154107 2515613323 197
781 iso_pu_bacteria 2515154113 2515639313 197
782 iso_pu_bacteria 2515154114 2515646531 197
783 iso_pu_bacteria 2515154116 2515661963 197
784 iso_pu_bacteria 2515154134 2515744454 197
785 iso_pu_bacteria 2516143018 2516209141 197
786 iso_pu_bacteria 2516653046 2516892545 197
787 iso_pu_bacteria 2516653077 2517040176 197
788 iso_pu_bacteria 2516653085 2517075718 197
789 iso_pu_bacteria 2517093000 2517094307 197
790 iso_pu_bacteria 2517287029 2517406109 197
791 iso_pu_bacteria 2517487022 2517569357 197
792 iso_pu_bacteria 2519899620 2520378618 197
793 iso_pu_bacteria 2524023207 2524454320 197
794 iso_pu_bacteria 2524023209 2524461392 197
795 iso_pu_bacteria 2529292951 2530643649 197
796 iso_pu_bacteria 2534681796 2535515860 197
797 iso_pu_bacteria 2551306084 2551678263 197
798 iso_pu_bacteria 2551306085 2551687654 197
799 iso_pu_bacteria 2551306086 2551695278 197
800 iso_pu_bacteria 2551306087 2551699376 197
801 iso_pu_bacteria 2551306089 2551711318 197
802 iso_pu_bacteria 2551306090 2551723065 197
803 iso_pu_bacteria 2551306091 2551728459 197
804 iso_pu_bacteria 2551306092 2551734000 197
805 iso_pu_bacteria 2551306093 2551742258 197
806 iso_pu_bacteria 2558860100 2558863236 197
807 iso_pu_bacteria 2582581294 2585199606 197
808 iso_pu_bacteria 2582581298 2585226135 197
809 iso_pu_bacteria 2582581299 2585231202 197
810 iso_pu_bacteria 2582581304 2585254073 197
811 iso_pu_bacteria 2582581307 2585273010 197
812 iso_pu_bacteria 2582581308 2585282868 197
813 iso_pu_bacteria 2582581315 2585325234 197
814 iso_pu_bacteria 2582581316 2585333349 197
815 iso_pu_bacteria 2582581867 2585400384 197
816 iso_pu_bacteria 2585427526 2585529491 197
817 iso_pu_bacteria 2585427527 2585534950 197
818 iso_pu_bacteria 2585427528 2585543726 197
819 iso_pu_bacteria 2585427529 2585547169 197
820 iso_pu_bacteria 2585427530 2585551603 197
821 iso_pu_bacteria 2585427531 2585558031 197
822 iso_pu_bacteria 2585427590 2585824510 197
823 iso_pu_bacteria 2585427593 2585842036 197
824 iso_pu_bacteria 2585427594 2585845533 197
825 iso_pu_bacteria 2585427608 2585897482 197
826 iso_pu_bacteria 2585427609 2585904931 197
827 iso_pu_bacteria 2585428125 2587979953 197
828 iso_pu_bacteria 2588253730 2588516207 197
829 iso_pu_bacteria 2597489875 2597813654 197
830 iso_pu_bacteria 2599185156 2599333516 197
831 iso_pu_bacteria 2599185170 2599418325 197
832 iso_pu_bacteria 2599185236 2599721220 197
833 iso_pu_bacteria 2599185301 2599939542 197
834 iso_pu_bacteria 2599185352 2600192207 197
835 iso_pu_bacteria 2600254933 2600375475 197
836 iso_pu_bacteria 2615840624 2616298089 197
837 iso_pu_bacteria 2615840626 2616308119 197
838 iso_pu_bacteria 2615840698 2616556861 197
839 iso_pu_bacteria 2617270742 2617381479 197
840 iso_pu_bacteria 2643221550 2643773787 197
841 iso_pu_bacteria 2643221557 2643808287 197
842 iso_pu_bacteria 2643221558 2643812215 197
843 iso_pu_bacteria 2643221564 2643837525 197
844 iso_pu_bacteria 2643221595 2643987302 197
845 iso_pu_bacteria 2643221599 2644006170 197
846 iso_pu_bacteria 2643221610 2644068107 197
847 iso_pu_bacteria 2643221618 2644108024 197
848 iso_pu_bacteria 2643221623 2644131930 197
849 iso_pu_bacteria 2643221626 2644150534 197
850 iso_pu_bacteria 2643221627 2644155626 197
851 iso_pu_bacteria 2643221634 2644191291 197
852 iso_pu_bacteria 2643221643 2644240110 197
853 iso_pu_bacteria 2643221655 2644310110 197
854 iso_pu_bacteria 2643221659 2644335296 197
855 iso_pu_bacteria 2643221668 2644379277 197
856 iso_pu_bacteria 2643221675 2644419051 197
857 iso_pu_bacteria 2643221680 2644450430 197
858 iso_pu_bacteria 2643221698 2644544811 197
859 iso_pu_bacteria 2643221712 2644617138 197
860 iso_pu_bacteria 2643221723 2644677784 197
861 iso_pu_bacteria 2643221726 2644687275 197
862 iso_pu_bacteria 2657244999 2657686422 197
863 iso_pu_bacteria 2667528174 2671114767 197
864 iso_pu_bacteria 2687453392 2688599063 197
865 iso_pu_bacteria 2690316117 2692316542 197
866 iso_pu_bacteria 2693429783 2694631912 197
867 iso_pu_bacteria 2693429784 2694634667 197
868 iso_pu_bacteria 2718217882 2719180515 197
869 iso_pu_bacteria 2718217927 2719385109 197
870 iso_pu_bacteria 2718217997 2719664868 197
871 iso_pu_bacteria 2718218009 2719731264 197
872 iso_pu_bacteria 2718218199 2720491288 197
873 iso_pu_bacteria 2718218232 2720612648 197
874 iso_pu_bacteria 2718218233 2720619486 197
875 iso_pu_bacteria 2718218235 2720630942 197
876 iso_pu_bacteria 2718218269 2720774580 197
877 iso_pu_bacteria 2718218363 2721146609 197
878 iso_pu_bacteria 2718218365 2721158134 197
879 iso_pu_bacteria 2718218366 2721163488 197
880 iso_pu_bacteria 2718218423 2721398829 197
881 iso_pu_bacteria 2721755514 2722839658 197
882 iso_pu_bacteria 2721755556 2723026305 197
883 iso_pu_bacteria 2721755684 2723559848 197
884 iso_pu_bacteria 2721755685 2723566468 197
885 iso_pu_bacteria 2721755686 2723576067 197
886 iso_pu_bacteria 2721755809 2724037642 197
887 iso_pu_bacteria 2721755810 2724044020 197
888 iso_pu_bacteria 2721755819 2724089187 197
889 iso_pu_bacteria 2721755822 2724103733 197
890 iso_pu_bacteria 2721755823 2724109571 197
891 iso_pu_bacteria 2724679232 2725948686 197
892 iso_pu_bacteria 2728369352 2730107241 197
893 iso_pu_bacteria 2728369365 2730163752 197
894 iso_pu_bacteria 2728369397 2730297766 197
895 iso_pu_bacteria 2738541293 2738799615 197
896 iso_pu_bacteria 2738541333 2739038930 197
897 iso_pu_bacteria 2738543024 2739309048 197
898 iso_pu_bacteria 2751185821 2753460143 197
899 iso_pu_bacteria 2756170246 2756677757 197
900 iso_pu_bacteria 2765235942 2766063718 197
901 iso_pu_bacteria 2775507266 2778176268 197
902 iso_pu_bacteria 2791355082 2792581306 197
903 iso_pu_bacteria 2791355091 2792624828 197
904 iso_pu_bacteria 2791355092 2792630862 197
905 iso_pu_bacteria 2791355094 2792642392 197
906 iso_pu_bacteria 2791355123 2792750750 197
907 iso_pu_bacteria 2791355253 2793282390 197
908 iso_pu_bacteria 2791355256 2793299590 197
909 iso_pu_bacteria 2791355259 2793318477 197
910 iso_pu_bacteria 2791355260 2793325200 197
911 iso_pu_bacteria 2791355261 2793331442 197
912 iso_pu_bacteria 2791355262 2793337884 197
913 iso_pu_bacteria 2791355263 2793344749 197
914 iso_pu_bacteria 2791355264 2793351009 197
915 iso_pu_bacteria 2791355265 2793357338 197
916 iso_pu_bacteria 2791355266 2793364033 197
917 iso_pu_bacteria 2791355267 2793371089 197
918 iso_pu_bacteria 2802428858 2802719370 197
919 iso_pu_bacteria 2802428859 2802723069 197
920 iso_pu_bacteria 2802428860 2802734746 197
921 iso_pu_bacteria 2802428861 2802741306 197
922 iso_pu_bacteria 2802428862 2802745055 197
923 iso_pu_bacteria 2802428863 2802751490 197
924 iso_pu_bacteria 2802429268 2804751738 197
925 iso_pu_bacteria 2802429605 2805931646 197
926 iso_pu_bacteria 2802429606 2805937761 197
927 iso_pu_bacteria 2802429633 2806049351 197
928 iso_pu_bacteria 2802429634 2806056359 197
929 iso_pu_bacteria 2802429635 2806063417 197
930 iso_pu_bacteria 2802429636 2806070963 197
931 iso_pu_bacteria 2802429637 2806077777 197
932 iso_pu_bacteria 2818991448 2819610718 197
933 iso_pu_bacteria 2818991453 2819638368 197
934 iso_pu_bacteria 2821123053 2821124578 197
935 iso_pu_bacteria 2834578030 2834579293 197
936 iso_pu_bacteria 2838016132 2838017536 197
937 iso_pu_bacteria 2838022645 2838022896 197
938 iso_pu_bacteria 2838029111 2838032391 197
939 iso_pu_bacteria 2838035591 2838041264 197
940 iso_pu_bacteria 2838042994 2838046183 197
941 iso_pu_bacteria 2838048938 2838048982 197
942 iso_pu_bacteria 2838061910 2838063587 197
943 iso_pu_bacteria 2838068647 2838072760 197
944 iso_pu_bacteria 2838074704 2838079212 197
945 iso_pu_bacteria 2838661181 2838662983 197
946 iso_pu_bacteria 2838668709 2838674920 197
947 iso_pu_bacteria 2838680041 2838681614 197
948 iso_pu_bacteria 2838686498 2838692729 197
949 iso_pu_bacteria 2838694306 2838694349 197
950 iso_pu_bacteria 2838701080 2838707223 197
951 iso_pu_bacteria 2838707686 2838707729 197
952 iso_pu_bacteria 2838729681 2838735085 197
953 iso_pu_bacteria 2838736955 2838742453 197
954 iso_pu_bacteria 2838742623 2838747556 197
955 iso_pu_bacteria 2841734538 2841740452 197
956 iso_pu_bacteria 2841840854 2841846390 197
957 iso_pu_bacteria 2841851746 2841857321 197
958 iso_pu_bacteria 2841864319 2841865228 197
959 iso_pu_bacteria 2842077413 2842081041 197
960 iso_pu_bacteria 2842110456 2842117517 197
961 iso_pu_bacteria 2842118031 2842121660 197
962 iso_pu_bacteria 2842140634 2842146132 197
963 iso_pu_bacteria 2842146304 2842151867 197
964 iso_pu_bacteria 2842156927 2842163221 197
965 iso_pu_bacteria 2842163707 2842170312 197
966 iso_pu_bacteria 2842180545 2842186879 197
967 iso_pu_bacteria 2842192696 2842197632 197
968 iso_pu_bacteria 2842198810 2842199325 197
969 iso_pu_bacteria 2842205361 2842210153 197
970 iso_pu_bacteria 2842217011 2842224203 197
971 iso_pu_bacteria 2842229732 2842234885 197
972 iso_pu_bacteria 2842237096 2842237139 197
973 iso_pu_bacteria 2842243621 2842248950 197
974 iso_pu_bacteria 2842250916 2842257061 197
975 iso_pu_bacteria 2842257432 2842262760 197
976 iso_pu_bacteria 2842264693 2842268747 197
977 iso_pu_bacteria 2842271015 2842277198 197
978 iso_pu_bacteria 2842278818 2842283607 197
979 iso_pu_bacteria 2842285085 2842286885 197
980 iso_pu_bacteria 2842291075 2842294698 197
981 iso_pu_bacteria 2842298080 2842302981 197
982 iso_pu_bacteria 2842304105 2842310993 197
983 iso_pu_bacteria 2842311132 2842317336 197
984 iso_pu_bacteria 2842317721 2842324074 197
985 iso_pu_bacteria 2842341865 2842343350 197
986 iso_pu_bacteria 2842357229 2842361832 197
987 iso_pu_bacteria 2842363717 2842365510 197
988 iso_pu_bacteria 2842370503 2842372078 197
989 iso_pu_bacteria 2842377471 2842381096 197
990 iso_pu_bacteria 2842384541 2842388167 197
991 iso_pu_bacteria 2842395702 2842402245 197
992 iso_pu_bacteria 2842402390 2842404153 197
993 iso_pu_bacteria 2842409023 2842411162 197
994 iso_pu_bacteria 2842415677 2842417382 197
995 iso_pu_bacteria 2842422224 2842426555 197
996 iso_pu_bacteria 2842428310 2842432880 197
997 iso_pu_bacteria 2842434925 2842439185 197
998 iso_pu_bacteria 2842441272 2842445814 197
999 iso_pu_bacteria 2842447887 2842451336 197
1000 iso_pu_bacteria 2842462802 2842466834 197
1001 iso_pu_bacteria 2842469257 2842473799 197
1002 iso_pu_bacteria 2842475841 2842478980 197
1003 iso_pu_bacteria 2842482326 2842483110 197
1004 iso_pu_bacteria 2842489311 2842495145 197
1005 iso_pu_bacteria 2842495871 2842502323 197
1006 iso_pu_bacteria 2842502639 2842506300 197
1007 iso_pu_bacteria 2842509118 2842509986 197
1008 iso_pu_bacteria 2842922631 2842925076 197
1009 iso_pu_bacteria 2844002411 2844006797 197
1010 iso_pu_bacteria 2844009547 2844014462 197
1011 iso_pu_bacteria 2844163670 2844169499 197
1012 iso_pu_bacteria 2844454524 2844454880 197
1013 iso_pu_bacteria 2847417321 2847418392 197
1014 iso_pu_bacteria 2848992105 2848993371 197
1015 iso_pu_bacteria 2850079185 2850081029 197
1016 iso_pu_bacteria 2852387548 2852389356 197
1017 iso_pu_bacteria 2854681122 2854685324 197
1018 iso_pu_bacteria 2854896431 2854901787 197
1019 iso_pu_bacteria 2854916844 2854919406 197
1020 iso_pu_bacteria 2855020534 2855020895 197
1021 iso_pu_bacteria 2855825444 2855831615 197
1022 iso_pu_bacteria 2855839649 2855840733 197
1023 iso_pu_bacteria 2855872281 2855873443 197
1024 iso_pu_bacteria 2856320880 2856325076 197
1025 iso_pu_bacteria 2856328259 2856330566 197
1026 iso_pu_bacteria 2856334872 2856340866 197
1027 iso_pu_bacteria 2856342000 2856345834 197
1028 iso_pu_bacteria 2856349417 2856349740 197
1029 iso_pu_bacteria 2856356410 2856359234 197
1030 iso_pu_bacteria 2856364286 2856369150 197
1031 iso_pu_bacteria 2857349434 2857355586 197
1032 iso_pu_bacteria 2857367948 2857372580 197
1033 iso_pu_bacteria 2857516855 2857521653 197
1034 iso_pu_bacteria 2857531043 2857532159 197
1035 iso_pu_bacteria 2858800743 2858801260 197
1036 iso_pu_bacteria 2869162929 2869168977 197
1037 iso_pu_bacteria 2869169390 2869174090 197
1038 iso_pu_bacteria 2869234852 2869237162 197
1039 iso_pu_bacteria 2869242130 2869243188 197
1040 iso_pu_bacteria 2869249662 2869252741 197
1041 iso_pu_bacteria 2869256925 2869262746 197
1042 iso_pu_bacteria 2869264136 2869270263 197
1043 iso_pu_bacteria 2869271264 2869273279 197
1044 iso_pu_bacteria 2869278585 2869280902 197
1045 iso_pu_bacteria 2869285874 2869288392 197
1046 iso_pu_bacteria 2871429161 2871432101 197
1047 iso_pu_bacteria 2871435913 2871439288 197
1048 iso_pu_bacteria 2871451962 2871455262 197
1049 iso_pu_bacteria 2871459585 2871459675 197
1050 iso_pu_bacteria 2871466892 2871470930 197
1051 iso_pu_bacteria 2871474448 2871480990 197
1052 iso_pu_bacteria 2871481445 2871484308 197
1053 iso_pu_bacteria 2871488783 2871495252 197
1054 iso_pu_bacteria 2874116593 2874120800 197
1055 iso_pu_bacteria 2874123672 2874125709 197
1056 iso_pu_bacteria 2874139085 2874141430 197
1057 iso_pu_bacteria 2874146452 2874150980 197
1058 iso_pu_bacteria 2874155637 2874157319 197
1059 iso_pu_bacteria 2874162495 2874163766 197
1060 iso_pu_bacteria 2874168670 2874172573 197
1061 iso_pu_bacteria 2876363079 2876368089 197
1062 iso_pu_bacteria 2876386047 2876392720 197
1063 iso_pu_bacteria 2876406927 2876409341 197
1064 iso_pu_bacteria 2876413966 2876417009 197
1065 iso_pu_bacteria 2876420981 2876427162 197
1066 iso_pu_bacteria 2876761206 2876765730 197
1067 iso_pu_bacteria 2878730984 2878734407 197
1068 iso_pu_bacteria 2878738818 2878743159 197
1069 iso_pu_bacteria 2878745973 2878748820 197
1070 iso_pu_bacteria 2878753008 2878758082 197
1071 iso_pu_bacteria 2878774303 2878776387 197
1072 iso_pu_bacteria 2878781027 2878782382 197
1073 iso_pu_bacteria 2878788777 2878796104 197
1074 iso_pu_bacteria 2881155292 2881155979 197
1075 iso_pu_bacteria 2881845957 2881846266 197
1076 iso_pu_bacteria 2881853255 2881859810 197
1077 iso_pu_bacteria 2881861095 2881862929 197
1078 iso_pu_bacteria 2882632389 2882633063 197
1079 iso_pu_bacteria 2882912400 2882916441 197
1080 iso_pu_bacteria 2885312484 2885317441 197
1081 iso_pu_bacteria 2885318864 2885322433 197
1082 iso_pu_bacteria 2885342637 2885344966 197
1083 iso_pu_bacteria 2885350715 2885356347 197
1084 iso_pu_bacteria 2888337043 2888340693 197
1085 iso_pu_bacteria 2888343758 2888347872 197
1086 iso_pu_bacteria 2888350351 2888356889 197
1087 iso_pu_bacteria 2889010040 2889011936 197
1088 iso_pu_bacteria 2889016732 2889023132 197
1089 iso_pu_bacteria 2896384573 2896386883 197
1090 iso_pu_bacteria 2899275550 2899277174 197
1091 iso_pu_bacteria 2903448605 2903452109 197
1092 iso_pu_bacteria 2903492973 2903496186 197
1093 iso_pu_bacteria 2903513507 2903514952 197
1094 iso_pu_bacteria 2903521522 2903527085 197
1095 iso_pu_bacteria 2903528002 2903533312 197
1096 iso_pu_bacteria 2906308376 2906311172 197
1097 iso_pu_bacteria 2906321335 2906323939 197
1098 iso_pu_bacteria 2906354277 2906362586 197
1099 iso_pu_bacteria 2906363423 2906370619 197
1100 iso_pu_bacteria 2906370794 2906374323 197
1101 iso_pu_bacteria 2906386501 2906391758 197
1102 iso_pu_bacteria 2906393657 2906398071 197
1103 iso_pu_bacteria 2906408224 2906410573 197
1104 iso_pu_bacteria 2906427513 2906432080 197
1105 iso_pu_bacteria 2913295892 2913301786 197
1106 iso_pu_bacteria 2915980308 2915985677 197
1107 iso_pu_bacteria 2915986958 2915991792 197
1108 iso_pu_bacteria 2915993759 2916000595 197
1109 iso_pu_bacteria 2916000859 2916007573 197
1110 iso_pu_bacteria 2916007675 2916008891 197
1111 iso_pu_bacteria 2916014648 2916018784 197
1112 iso_pu_bacteria 2916021584 2916026392 197
1113 iso_pu_bacteria 2916028427 2916034641 197
1114 iso_pu_bacteria 2916035215 2916040622 197
1115 iso_pu_bacteria 2916041962 2916048210 197
1116 iso_pu_bacteria 2916048683 2916054399 197
1117 iso_pu_bacteria 2916055098 2916060808 197
1118 iso_pu_bacteria 2916061851 2916068158 197
1119 iso_pu_bacteria 2916076590 2916078678 197
1120 iso_pu_bacteria 2919100787 2919104082 197
1121 iso_pu_bacteria 2919408235 2919409566 197
1122 iso_pu_bacteria 2919679072 2919679995 197
1123 iso_pu_bacteria 2920760137 2920765470 197
1124 iso_pu_bacteria 2920822456 2920824098 197
1125 iso_pu_bacteria 2921201388 2921208173 197
1126 iso_pu_bacteria 2921208531 2921209434 197
1127 iso_pu_bacteria 2921237296 2921242276 197
1128 iso_pu_bacteria 2921244191 2921248063 197
1129 iso_pu_bacteria 2921250672 2921256113 197
1130 iso_pu_bacteria 2921257292 2921263449 197
1131 iso_pu_bacteria 2921263974 2921270100 197
1132 iso_pu_bacteria 2921282425 2921285918 197
1133 iso_pu_bacteria 2921289301 2921296767 197
1134 iso_pu_bacteria 2922130491 2922136227 197
1135 iso_pu_bacteria 2922151315 2922154899 197
1136 iso_pu_bacteria 2922172374 2922175801 197
1137 iso_pu_bacteria 2922178524 2922182767 197
1138 iso_pu_bacteria 2922185730 2922191545 197
1139 iso_pu_bacteria 2923556063 2923562193 197
1140 iso_pu_bacteria 2924144063 2924147658 197
1141 iso_pu_bacteria 2924150972 2924157715 197
1142 iso_pu_bacteria 2924158325 2924165040 197
1143 iso_pu_bacteria 2924165586 2924172860 197
1144 iso_pu_bacteria 2924172951 2924179199 197
1145 iso_pu_bacteria 2924179722 2924184594 197
1146 iso_pu_bacteria 2924186466 2924192978 197
1147 iso_pu_bacteria 2924193448 2924199588 197
1148 iso_pu_bacteria 2924200457 2924204264 197
1149 iso_pu_bacteria 2924207177 2924213338 197
1150 iso_pu_bacteria 2924214083 2924214796 197
1151 iso_pu_bacteria 2924221636 2924221981 197
1152 iso_pu_bacteria 2924228884 2924233687 197
1153 iso_pu_bacteria 2924710171 2924716987 197
1154 iso_pu_bacteria 2924718760 2924725444 197
1155 iso_pu_bacteria 2924733363 2924736137 197
1156 iso_pu_bacteria 2924741084 2924744182 197
1157 iso_pu_bacteria 2924748358 2924750382 197
1158 iso_pu_bacteria 2924754689 2924759041 197
1159 iso_pu_bacteria 2924762789 2924763826 197
1160 iso_pu_bacteria 2924776078 2924777273 197
1161 iso_pu_bacteria 2924784321 2924785823 197
1162 iso_pu_bacteria 2932401849 2932403068 197
1163 iso_pu_bacteria 2933016740 2933021261 197
1164 iso_pu_bacteria 2933570622 2933577520 197
1165 iso_pu_bacteria 2933586486 2933593614 197
1166 iso_pu_bacteria 2933599457 2933603689 197
1167 iso_pu_bacteria 2935894831 2935894874 197
1168 iso_pu_bacteria 2935901341 2935908198 197
1169 iso_pu_bacteria 2936367885 2936371444 197
1170 iso_pu_bacteria 2936375103 2936379466 197
1171 iso_pu_bacteria 2936381700 2936387935 197
1172 iso_pu_bacteria 2936996657 2937001422 197
1173 iso_pu_bacteria 2937002841 2937008142 197
1174 iso_pu_bacteria 2937009748 2937015650 197
1175 iso_pu_bacteria 2937016420 2937019590 197
1176 iso_pu_bacteria 2937023124 2937028379 197
1177 iso_pu_bacteria 2937029754 2937034839 197
1178 iso_pu_bacteria 2937036028 2937040781 197
1179 iso_pu_bacteria 2937042894 2937049368 197
1180 iso_pu_bacteria 2937049772 2937056380 197
1181 iso_pu_bacteria 2937056579 2937060859 197
1182 iso_pu_bacteria 2937063883 2937069353 197
1183 iso_pu_bacteria 2937071275 2937076543 197
1184 iso_pu_bacteria 2937078374 2937079354 197
1185 iso_pu_bacteria 2937084907 2937088459 197
1186 iso_pu_bacteria 2937091812 2937096841 197
1187 iso_pu_bacteria 2937098957 2937105910 197
1188 iso_pu_bacteria 2937106411 2937113074 197
1189 iso_pu_bacteria 2937113482 2937118546 197
1190 iso_pu_bacteria 2937119839 2937125248 197
1191 iso_pu_bacteria 2937126314 2937129959 197
1192 iso_pu_bacteria 2937813078 2937813393 197
1193 iso_pu_bacteria 2937822353 2937826674 197
1194 iso_pu_bacteria 2937836603 2937839994 197
1195 iso_pu_bacteria 2937848649 2937853629 197
1196 iso_pu_bacteria 2937861824 2937864415 197
1197 iso_pu_bacteria 2937868953 2937869773 197
1198 iso_pu_bacteria 2937877337 2937879322 197
1199 iso_pu_bacteria 2937972304 2937974944 197
1200 iso_pu_bacteria 2938014810 2938019868 197
1201 iso_pu_bacteria 2939669807 2939671387 197
1202 iso_pu_bacteria 2941499720 2941499955 197
1203 iso_pu_bacteria 2957375807 2957377141 197
1204 iso_pu_bacteria 2957382221 2957385721 197
1205 iso_pu_bacteria 2957388812 2957388844 197
1206 iso_pu_bacteria 2957395598 2957401734 197
1207 iso_pu_bacteria 2957402308 2957406450 197
1208 iso_pu_bacteria 2957408893 2957414189 197
1209 iso_pu_bacteria 2957415311 2957418177 197
1210 iso_pu_bacteria 2957422303 2957429142 197
1211 iso_pu_bacteria 2957430029 2957435571 197
1212 iso_pu_bacteria 2957437181 2957443025 197
1213 iso_pu_bacteria 2957443900 2957449784 197
1214 iso_pu_bacteria 2957450854 2957453207 197
1215 iso_pu_bacteria 2957457609 2957464207 197
1216 iso_pu_bacteria 2957464669 2957468125 197
1217 iso_pu_bacteria 2957471148 2957477684 197
1218 iso_pu_bacteria 2957478035 2957483703 197
1219 iso_pu_bacteria 2957484790 2957491280 197
1220 iso_pu_bacteria 2957491536 2957496683 197
1221 iso_pu_bacteria 2957498199 2957504901 197
1222 iso_pu_bacteria 2957505466 2957512921 197
1223 iso_pu_bacteria 2958034702 2958036865 197
1224 iso_pu_bacteria 2958041894 2958050487 197
1225 iso_pu_bacteria 2958064165 2958070269 197
1226 iso_pu_bacteria 2958071322 2958072567 197
1227 iso_pu_bacteria 2958084443 2958086497 197
1228 iso_pu_bacteria 2958100919 2958101583 197
1229 iso_pu_bacteria 2958122699 2958130103 197
1230 iso_pu_bacteria 2958130278 2958132793 197
1231 iso_pu_bacteria 2958137437 2958142865 197
1232 iso_pu_bacteria 2958144490 2958145626 197
1233 iso_pu_bacteria 2958158011 2958162967 197
1234 iso_pu_bacteria 2958172287 2958177804 197
1235 iso_pu_bacteria 2958179912 2958182925 197
1236 iso_pu_bacteria 2960584000 2960587246 197
1237 iso_pu_bacteria 2960591022 2960593514 197
1238 iso_pu_bacteria 2960597568 2960602377 197
1239 iso_pu_bacteria 2960603979 2960608990 197
1240 iso_pu_bacteria 2960610863 2960616773 197
1241 iso_pu_bacteria 2960617483 2960623092 197
1242 iso_pu_bacteria 2960624210 2960630985 197
1243 iso_pu_bacteria 2960631154 2960636887 197
1244 iso_pu_bacteria 2960637947 2960639637 197
1245 iso_pu_bacteria 2960645483 2960652502 197
1246 iso_pu_bacteria 2960652885 2960655276 197
1247 iso_pu_bacteria 2960660292 2960666661 197
1248 iso_pu_bacteria 2960667422 2960673098 197
1249 iso_pu_bacteria 2960674078 2960677304 197
1250 iso_pu_bacteria 2960680706 2960686296 197
1251 iso_pu_bacteria 2960687367 2960693525 197
1252 iso_pu_bacteria 2960693952 2960700498 197
1253 iso_pu_bacteria 2961077736 2961080805 197
1254 iso_pu_bacteria 2961127735 2961133187 197
1255 iso_pu_bacteria 2961136820 2961139067 197
1256 iso_pu_bacteria 2961170736 2961174712 197
1257 iso_pu_bacteria 2961183825 2961186460 197
1258 iso_pu_bacteria 2963644680 2963648662 197
1259 iso_pu_bacteria 2964607997 2964611288 197
1260 iso_pu_bacteria 2964615318 2964621263 197
1261 iso_pu_bacteria 2964621998 2964626439 197
1262 iso_pu_bacteria 2964628898 2964635545 197
1263 iso_pu_bacteria 2964636051 2964641208 197
1264 iso_pu_bacteria 2964643177 2964647055 197
1265 iso_pu_bacteria 2964649959 2964655508 197
1266 iso_pu_bacteria 2964656573 2964661957 197
1267 iso_pu_bacteria 2964663802 2964670126 197
1268 iso_pu_bacteria 2964670856 2964677229 197
1269 iso_pu_bacteria 2964678106 2964684927 197
1270 iso_pu_bacteria 2964685014 2964691761 197
1271 iso_pu_bacteria 2964691889 2964698512 197
1272 iso_pu_bacteria 2964698721 2964703416 197
1273 iso_pu_bacteria 2964705432 2964710565 197
1274 iso_pu_bacteria 2964719344 2964721096 197
1275 iso_pu_bacteria 2965025482 2965027341 197
1276 iso_pu_bacteria 2965032056 2965033142 197
1277 iso_pu_bacteria 2965040258 2965040813 197
1278 iso_pu_bacteria 2965089291 2965091046 197
1279 iso_pu_bacteria 2965102966 2965109558 197
1280 iso_pu_bacteria 2965110997 2965118069 197
1281 iso_pu_bacteria 2965119406 2965122193 197
1282 iso_pu_bacteria 2967664464 2967671058 197
1283 iso_pu_bacteria 2967671571 2967672382 197
1284 iso_pu_bacteria 2967678726 2967683418 197
1285 iso_pu_bacteria 2967686174 2967692224 197
1286 iso_pu_bacteria 2967693043 2967694506 197
1287 iso_pu_bacteria 2967699805 2967702486 197
1288 iso_pu_bacteria 2967706974 2967714204 197
1289 iso_pu_bacteria 2967714385 2967718833 197
1290 iso_pu_bacteria 2967721400 2967726181 197
1291 iso_pu_bacteria 2967728569 2967729661 197
1292 iso_pu_bacteria 2967735183 2967739553 197
1293 iso_pu_bacteria 2967742019 2967745169 197
1294 iso_pu_bacteria 2967748971 2967754760 197
1295 iso_pu_bacteria 2967755722 2967762217 197
1296 iso_pu_bacteria 2967762386 2967766749 197
1297 iso_pu_bacteria 2967769361 2967775209 197
1298 iso_pu_bacteria 2967775926 2967782618 197
1299 iso_pu_bacteria 2967996073 2968000647 197
1300 iso_pu_bacteria 2968003550 2968009980 197
1301 iso_pu_bacteria 2968016561 2968017460 197
1302 iso_pu_bacteria 2968083720 2968083889 197
1303 iso_pu_bacteria 2968117919 2968122811 197
1304 iso_pu_bacteria 2968138860 2968146575 197
1305 iso_pu_bacteria 2970019648 2970026352 197
1306 iso_pu_bacteria 2970026789 2970033111 197
1307 iso_pu_bacteria 2970033650 2970034158 197
1308 iso_pu_bacteria 2970040964 2970046980 197
1309 iso_pu_bacteria 2970047711 2970051785 197
1310 iso_pu_bacteria 2970054988 2970060496 197
1311 iso_pu_bacteria 2970061556 2970062291 197
1312 iso_pu_bacteria 2970068827 2970069241 197
1313 iso_pu_bacteria 2970076120 2970079537 197
1314 iso_pu_bacteria 2970082768 2970086667 197
1315 iso_pu_bacteria 2970088815 2970091748 197
1316 iso_pu_bacteria 2970095765 2970102549 197
1317 iso_pu_bacteria 2970102677 2970107847 197
1318 iso_pu_bacteria 2970109326 2970115546 197
1319 iso_pu_bacteria 2970116247 2970120772 197
1320 iso_pu_bacteria 2970122695 2970128529 197
1321 iso_pu_bacteria 2970129317 2970129804 197
1322 iso_pu_bacteria 2970136068 2970143461 197
1323 iso_pu_bacteria 2970143518 2970149801 197
1324 iso_pu_bacteria 2970149975 2970156346 197
1325 iso_pu_bacteria 2970156795 2970158351 197
1326 iso_pu_bacteria 2970164137 2970167597 197
1327 iso_pu_bacteria 2970170962 2970173598 197
1328 iso_pu_bacteria 2970177841 2970178677 197
1329 iso_pu_bacteria 2970184632 2970190737 197
1330 iso_pu_bacteria 2970191845 2970198226 197
1331 iso_pu_bacteria 2970469710 2970472364 197
1332 iso_pu_bacteria 2970489779 2970490911 197
1333 iso_pu_bacteria 2970503327 2970507298 197
1334 iso_pu_bacteria 2970510686 2970513853 197
1335 iso_pu_bacteria 2970524798 2970530011 197
1336 iso_pu_bacteria 2970540015 2970546596 197
1337 iso_pu_bacteria 2970593180 2970595506 197
1338 iso_pu_bacteria 2970619444 2970620322 197
1339 iso_pu_bacteria 2970627176 2970631994 197
1340 iso_pu_bacteria 2977516862 2977520512 197
1341 iso_pu_bacteria 2977523885 2977530235 197
1342 iso_pu_bacteria 2977530762 2977532335 197
1343 iso_pu_bacteria 2977537788 2977541437 197
1344 iso_pu_bacteria 2977544691 2977551382 197
1345 iso_pu_bacteria 2977551784 2977557509 197
1346 iso_pu_bacteria 2977558990 2977561297 197
1347 iso_pu_bacteria 2977565890 2977569819 197
1348 iso_pu_bacteria 2977572785 2977578829 197
1349 iso_pu_bacteria 2977579622 2977583933 197
1350 iso_pu_bacteria 2977821940 2977828844 197
1351 iso_pu_bacteria 2977828996 2977829833 197
1352 iso_pu_bacteria 2977843712 2977845393 197
1353 iso_pu_bacteria 2977851361 2977851790 197
1354 iso_pu_bacteria 2977872689 2977877373 197
1355 iso_pu_bacteria 2977898635 2977906635 197
1356 iso_pu_bacteria 2977907340 2977911817 197
1357 iso_pu_bacteria 2977915119 2977917215 197
1358 iso_pu_bacteria 2977922695 2977928128 197
1359 iso_pu_bacteria 2977935797 2977939439 197
1360 iso_pu_bacteria 2977942078 2977946926 197
1361 iso_pu_bacteria 2977950692 2977951363 197
1362 iso_pu_bacteria 2977957713 2977958672 197
1363 iso_pu_bacteria 2977971508 2977976589 197
1364 iso_pu_bacteria 2977986579 2977989488 197
1365 iso_pu_bacteria 2979710463 2979716965 197
1366 iso_pu_bacteria 2979764755 2979765766 197
1367 iso_pu_bacteria 2979772303 2979777660 197
1368 iso_pu_bacteria 2979793036 2979798555 197
1369 iso_pu_bacteria 2979808191 2979812494 197
1370 iso_pu_bacteria 2987636660 2987640720 197
1371 iso_pu_bacteria 2987645492 2987647817 197
1372 iso_pu_bacteria 2987652177 2987652490 197
1373 iso_pu_bacteria 2987666974 2987670294 197
1374 iso_pu_bacteria 2987673487 2987674290 197
1375 iso_pu_bacteria 2996336353 2996340572 197
1376 iso_pu_bacteria 2996348954 2996351235 197
1377 iso_pu_bacteria 2996386984 2996390910 197
1378 iso_pu_bacteria 2996887358 2996888837 197
1379 iso_pu_bacteria 2996893221 2996898873 197
1380 iso_pu_bacteria 3000135777 3000136169 197
1381 iso_pu_bacteria 3003930520 3003933068 197
1382 iso_pu_bacteria 3004167301 3004170189 197
1383 iso_pu_bacteria 3004195979 3004197763 197
1384 iso_pu_bacteria 3004203850 3004208917 197
1385 iso_pu_bacteria 3004211236 3004213103 197
1386 iso_pu_bacteria 3004218560 3004222134 197
1387 iso_pu_bacteria 3004232784 3004239289 197
1388 iso_pu_bacteria 3004239961 3004242911 197
1389 iso_pu_bacteria 3004248173 3004253244 197
1390 iso_pu_bacteria 3004268573 3004273805 197
1391 iso_pu_bacteria 3004275668 3004277933 197
1392 iso_pu_bacteria 3004289098 3004290232 197
1393 iso_pu_bacteria 3004334049 3004340241 197
1394 iso_pu_bacteria 3005409236 3005412748 197
1395 iso_pu_bacteria 3005416602 3005417893 197
1396 iso_pu_bacteria 3005445848 3005446985 197
1397 iso_pu_bacteria 3005452660 3005453618 197
1398 iso_pu_bacteria 637000159 637073560 197
1399 iso_pu_bacteria 639633055 639647665 197
1400 iso_pu_bacteria 643692032 643825402 197
1401 iso_pu_bacteria 648276728 648741344 197
1402 iso_pu_bacteria 649633066 649873496 197
1403 iso_pu_bacteria 8002285264 8002285921 197
1404 iso_pu_bacteria 8003992118 8003993231 197
1405 iso_pu_bacteria 8003999396 8004000488 197
1406 iso_pu_bacteria 8004300914 8004304429 197
1407 iso_pu_bacteria 8004361976 8004366440 197
1408 iso_pu_bacteria 8004374579 8004379594 197
1409 iso_pu_bacteria 8004387939 8004390923 197
1410 iso_pu_bacteria 8004395343 8004402339 197
1411 iso_pu_bacteria 8004633249 8004638922 197
1412 iso_pu_bacteria 8004640170 8004643106 197
1413 iso_pu_bacteria 8004695233 8004701072 197
1414 iso_pu_bacteria 8004714634 8004717475 197
1415 iso_pu_bacteria 8004727605 8004731771 197
1416 iso_pu_bacteria 8005258706 8005260108 197
1417 iso_pu_bacteria 8005275841 8005279880 197
1418 iso_pu_bacteria 8005282627 8005286960 197
1419 iso_pu_bacteria 8005289223 8005293025 197
1420 iso_pu_bacteria 8005301065 8005304837 197
1421 iso_pu_bacteria 8005307578 8005308627 197
1422 iso_pu_bacteria 8005314921 8005316457 197
1423 iso_pu_bacteria 8005321885 8005323364 197
1424 iso_pu_bacteria 8005376324 8005376370 197
1425 iso_pu_bacteria 8005382845 8005385756 197
1426 iso_pu_bacteria 8005395548 8005400596 197
1427 iso_pu_bacteria 8005430974 8005435322 197
1428 iso_pu_bacteria 8005460587 8005462178 197
1429 iso_pu_bacteria 8005484373 8005487101 197
1430 iso_pu_bacteria 8005497431 8005499597 197
1431 iso_pu_bacteria 8005542996 8005544496 197
1432 iso_pu_bacteria 8005556819 8005559785 197
1433 iso_pu_bacteria 8005563573 8005564957 197
1434 iso_pu_bacteria 8005570704 8005570865 197
1435 iso_pu_bacteria 8005619151 8005620777 197
1436 iso_pu_bacteria 8005626139 8005628929 197
1437 iso_pu_bacteria 8005645114 8005646545 197
1438 iso_pu_bacteria 8005668836 8005671014 197
1439 iso_pu_bacteria 8005682033 8005686574 197
1440 iso_pu_bacteria 8005688590 8005691262 197
1441 iso_pu_bacteria 8005695170 8005698531 197
1442 iso_pu_bacteria 8018127388 8018131569 197
1443 iso_pu_bacteria 8018150411 8018150802 197
1444 iso_pu_bacteria 8018163183 8018169250 197
1445 iso_pu_bacteria 8018176218 8018180149 197
1446 iso_pu_bacteria 8023680758 8023681974 197
1447 iso_pu_bacteria 8024479707 8024482495 197
1448 iso_pu_bacteria 8024501048 8024503014 197
1449 iso_pu_bacteria 8046767195 8046768483 197
1450 iso_pu_bacteria 8049293176 8049294283 197
1451 iso_pu_bacteria 8054558443 8054562923 197
1452 iso_pu_bacteria 8054563764 8054566750 197
1453 iso_pu_bacteria 8055617313 8055622005 197
1454 iso_pu_bacteria 8056375014 8056380970 197
1455 iso_pu_bacteria 8056382006 8056384504 197
1456 iso_pu_bacteria 8056875544 8056879571 197
1457 iso_pu_bacteria 8057132660 8057134787 197
1458 iso_pu_bacteria 8057575449 8057577970 197
1459 iso_pu_bacteria 8057874678 8057876550 197
1460 3300003187 JGI25151J46595_10000038 JGI25151J46595_100000389 198
1461 3300005546 Ga0070696_100651256 Ga0070696_1006512561 198
1462 3300005614 Ga0068856_100210039 Ga0068856_1002100391 198
1463 3300006038 Ga0075365_10010146 Ga0075365_100101469 198
1464 3300006038 Ga0075365_10465813 Ga0075365_104658131 198
1465 3300006042 Ga0075368_10003116 Ga0075368_100031166 198
1466 3300006051 Ga0075364_10028265 Ga0075364_100282657 198
1467 3300006178 Ga0075367_10175029 Ga0075367_101750292 198
1468 3300006195 Ga0075366_10121590 Ga0075366_101215903 198
1469 3300006844 Ga0075428_100812557 Ga0075428_1008125572 198
1470 3300006852 Ga0075433_10240648 Ga0075433_102406482 198
1471 3300007076 Ga0075435_100040317 Ga0075435_1000403172 198
1472 3300009094 Ga0111539_10009902 Ga0111539_100099023 198
1473 3300009094 Ga0111539_10092029 Ga0111539_100920296 198
1474 3300009147 Ga0114129_10079719 Ga0114129_100797197 198
1475 3300013250 Ga0171462_1042 Ga0171462_104267 198
1476 3300021384 Ga0213876_10000421 Ga0213876_1000042110 198
1477 3300025292 Ga0209676_1010666 Ga0209676_10106661 198
1478 3300025294 Ga0209025_1000014 Ga0209025_10000143 198
1479 3300025295 Ga0209564_1009622 Ga0209564_10096221 198
1480 3300025299 Ga0209256_1000540 Ga0209256_100054062 198
1481 3300025933 Ga0207706_10598655 Ga0207706_105986551 198
1482 3300025937 Ga0207669_10282956 Ga0207669_102829562 198
1483 3300026078 Ga0207702_10599284 Ga0207702_105992842 198
1484 3300027866 Ga0209813_10000406 Ga0209813_1000040613 198
1485 3300027907 Ga0207428_10020203 Ga0207428_100202038 198
1486 3300028577 Ga0265318_10046641 Ga0265318_100466412 198
1487 3300031242 Ga0265329_10054789 Ga0265329_100547893 198
1488 3300031247 Ga0265340_10062403 Ga0265340_100624033 198
1489 3300031249 Ga0265339_10045403 Ga0265339_100454033 198
1490 3300031344 Ga0265316_10015933 Ga0265316_1001593312 198
1491 3300031595 Ga0265313_10022840 Ga0265313_100228406 198
1492 3300031711 Ga0265314_10008857 Ga0265314_100088574 198
1493 3300031728 Ga0316578_10041698 Ga0316578_100416985 198
1494 3300032137 Ga0316585_10085954 Ga0316585_100859542 198
1495 3300032168 Ga0316593_10103732 Ga0316593_101037321 198
1496 3300033541 Ga0316596_1051566 Ga0316596_10515662 198
1497 3300036647 Ga0316582_0120148 Ga0316582_0120148_945_1649 198
1498 3300036712 Ga0316584_0135941 Ga0316584_0135941_414_1118 198
1499 3300037068 Ga0373925_0125298 Ga0373925_0125298_565_1329 198
1500 3300039062 Ga0400483_042328 Ga0400483_042328_1142_1864 198
1501 3300039062 Ga0400483_191097 Ga0400483_191097_215_931 198
1502 3300039437 Ga0436365_1637588 Ga0436365_1637588_28453_29169 198
1503 3300048924 Ga0496121_0264467 Ga0496121_0264467_23_754 198
1504 3300049571 Ga0501034_0014987 Ga0501034_0014987_2981_3679 198
1505 3300049571 Ga0501034_0191684 Ga0501034_0191684_344_1045 198
1506 3300049577 Ga0501041_0307741 Ga0501041_0307741_39_773 198
1507 3300049579 Ga0501043_0113305 Ga0501043_0113305_1158_1856 198
1508 3300049580 Ga0501046_0126860 Ga0501046_0126860_891_1655 198
1509 3300049583 Ga0501067_0016370 Ga0501067_0016370_2835_3554 198
1510 3300049584 Ga0501068_0015296 Ga0501068_0015296_963_1661 198
1511 3300049586 Ga0501070_0057678 Ga0501070_0057678_1002_1700 198
1512 3300049590 Ga0501074_0029786 Ga0501074_0029786_3020_3718 198
1513 3300049593 Ga0501077_0142095 Ga0501077_0142095_653_1372 198
1514 3300049741 Ga0501079_0186711 Ga0501079_0186711_85_804 198
1515 3300049742 Ga0501080_0009625 Ga0501080_0009625_7958_8656 198
1516 3300049744 Ga0501083_0219204 Ga0501083_0219204_158_877 198
1517 3300049823 Ga0501044_0025827 Ga0501044_0025827_4553_5251 198
1518 3300050491 nmdc:mga00v17_51538_c1 nmdc:mga00v17_51538_c1_1186_1920 198
1519 3300050493 nmdc:mga0k408_101657_c1 nmdc:mga0k408_101657_c1_421_1155 198
1520 3300050495 nmdc:mga04h51_93699_c1 nmdc:mga04h51_93699_c1_338_1072 198
1521 3300050507 nmdc:mga05p37_58409_c1 nmdc:mga05p37_58409_c1_1436_2197 198
1522 3300050511 nmdc:mga08y16_9879_c2 nmdc:mga08y16_9879_c2_3718_4476 198
1523 3300050513 nmdc:mga0rr50_7174_c1 nmdc:mga0rr50_7174_c1_3238_4005 198
1524 3300050515 nmdc:mga0a205_159509_c1 nmdc:mga0a205_159509_c1_359_1132 198
1525 3300054114 Ga0501084_0489226 Ga0501084_0489226_67_765 198
1526 3300060353 Ga0501082_0017998 Ga0501082_0017998_949_1668 198
1527 3300061734 Ga0530510_0056862 Ga0530510_0056862_1861_2580 198
1528 3300061734 Ga0530510_0501622 Ga0530510_0501622_133_894 198
1529 iso_pu_bacteria 2508501128 2509149628 198
1530 iso_pu_bacteria 2510917026 2511174074 198
1531 iso_pu_bacteria 2513237094 2513644591 198
1532 iso_pu_bacteria 2513237096 2513658394 198
1533 iso_pu_bacteria 2513237098 2513678613 198
1534 iso_pu_bacteria 2513237102 2513701037 198
1535 iso_pu_bacteria 2513237137 2513857530 198
1536 iso_pu_bacteria 2513237141 2513894233 198
1537 iso_pu_bacteria 2513237145 2513920114 198
1538 iso_pu_bacteria 2517572143 2517893483 198
1539 iso_pu_bacteria 2524023210 2524469975 198
1540 iso_pu_bacteria 2524023228 2524537988 198
1541 iso_pu_bacteria 2585427633 2585995378 198
1542 iso_pu_bacteria 2585427634 2585999933 198
1543 iso_pu_bacteria 2643221547 2643755785 198
1544 iso_pu_bacteria 2643221568 2643857831 198
1545 iso_pu_bacteria 2643221580 2643911586 198
1546 iso_pu_bacteria 2643221591 2643963614 198
1547 iso_pu_bacteria 2643221651 2644287958 198
1548 iso_pu_bacteria 2643221674 2644410378 198
1549 iso_pu_bacteria 2643221733 2644729057 198
1550 iso_pu_bacteria 2667528175 2671118121 198
1551 iso_pu_bacteria 2728368998 2728747754 198
1552 iso_pu_bacteria 2791355197 2793071760 198
1553 iso_pu_bacteria 2818991461 2819683823 198
1554 iso_pu_bacteria 2824617872 2824620085 198
1555 iso_pu_bacteria 2824626560 2824627704 198
1556 iso_pu_bacteria 2824635225 2824636727 198
1557 iso_pu_bacteria 2824644064 2824645020 198
1558 iso_pu_bacteria 2824714736 2824715418 198
1559 iso_pu_bacteria 2824723954 2824724727 198
1560 iso_pu_bacteria 2841911363 2841913385 198
1561 iso_pu_bacteria 2841917233 2841919132 198
1562 iso_pu_bacteria 2876808645 2876810437 198
1563 iso_pu_bacteria 2879110137 2879110536 198
1564 iso_pu_bacteria 2885374607 2885380944 198
1565 iso_pu_bacteria 2885383462 2885384441 198
1566 iso_pu_bacteria 2903748898 2903758261 198
1567 iso_pu_bacteria 2903768456 2903770858 198
1568 iso_pu_bacteria 2904690495 2904696897 198
1569 iso_pu_bacteria 2904699407 2904701660 198
1570 iso_pu_bacteria 2906610324 2906610368 198
1571 iso_pu_bacteria 2906635258 2906642783 198
1572 iso_pu_bacteria 2906660503 2906665918 198
1573 iso_pu_bacteria 2908739725 2908743889 198
1574 iso_pu_bacteria 2908756301 2908761473 198
1575 iso_pu_bacteria 2919166419 2919168002 198
1576 iso_pu_bacteria 2919171160 2919175598 198
1577 iso_pu_bacteria 2919450847 2919456087 198
1578 iso_pu_bacteria 2922361189 2922361963 198
1579 iso_pu_bacteria 2922425934 2922428993 198
1580 iso_pu_bacteria 2935630451 2935637744 198
1581 iso_pu_bacteria 2935959822 2935966955 198
1582 iso_pu_bacteria 2941507105 2941514417 198
1583 iso_pu_bacteria 2941515067 2941522313 198
1584 iso_pu_bacteria 2941523033 2941530168 198
1585 iso_pu_bacteria 2970547951 2970548664 198
1586 iso_pu_bacteria 2978969890 2978974453 198
1587 iso_pu_bacteria 2984587000 2984589791 198
1588 iso_pu_bacteria 2989349275 2989353411 198
1589 iso_pu_bacteria 2996310559 2996310955 198
1590 iso_pu_bacteria 3005474847 3005479138 198
1591 iso_pu_bacteria 3005710791 3005713751 198
1592 iso_pu_bacteria 8001845381 8001845402 198
1593 iso_pu_bacteria 8002060224 8002061403 198
1594 iso_pu_bacteria 8006926726 8006930393 198
1595 iso_pu_bacteria 8006933436 8006942210 198
1596 iso_pu_bacteria 8006973647 8006981944 198
1597 iso_pu_bacteria 8006984368 8006986860 198
1598 iso_pu_bacteria 8019555841 8019557931 198
1599 iso_pu_bacteria 8019565922 8019567354 198
1600 iso_pu_bacteria 8054460903 8054462007 198
1601 iso_pu_bacteria 8056681323 8056684524 198
1602 iso_pu_bacteria 8056689827 8056691234 198
1603 3300003203 JGI25406J46586_10001918 JGI25406J46586_1000191814 199
1604 3300005435 Ga0070714_100152013 Ga0070714_1001520134 199
1605 3300005467 Ga0070706_100528828 Ga0070706_1005288281 199
1606 3300005985 Ga0081539_10004419 Ga0081539_100044199 199
1607 3300006038 Ga0075365_10009705 Ga0075365_100097055 199
1608 3300006048 Ga0075363_100228193 Ga0075363_1002281931 199
1609 3300006177 Ga0075362_10010315 Ga0075362_100103151 199
1610 3300006177 Ga0075362_10035551 Ga0075362_100355513 199
1611 3300006844 Ga0075428_100085887 Ga0075428_1000858877 199
1612 3300006847 Ga0075431_100004125 Ga0075431_10000412519 199
1613 3300006880 Ga0075429_100031579 Ga0075429_1000315792 199
1614 3300013307 Ga0157372_10023820 Ga0157372_1002382010 199
1615 3300013307 Ga0157372_10101268 Ga0157372_101012684 199
1616 3300021321 Ga0214542_1019955 Ga0214542_10199552 199
1617 3300021327 Ga0214543_1005345 Ga0214543_10053455 199
1618 3300021377 Ga0213874_10004012 Ga0213874_100040125 199
1619 3300035241 Ga0373961_0023022 Ga0373961_0023022_212_967 199
1620 3300039450 Ga0436363_1404294 Ga0436363_1404294_2045_2764 199
1621 3300041408 Ga0439453_0008967 Ga0439453_0008967_641_1342 199
1622 3300045051 Ga0451576_0010751 Ga0451576_0010751_806_1585 199
1623 3300048904 Ga0496101_0010556 Ga0496101_0010556_4656_5399 199
1624 3300048908 Ga0496105_0005504 Ga0496105_0005504_5071_5814 199
1625 3300048913 Ga0496110_0008141 Ga0496110_0008141_6599_7342 199
1626 3300048914 Ga0496111_0023962 Ga0496111_0023962_2702_3445 199
1627 3300048915 Ga0496112_0034695 Ga0496112_0034695_3993_4736 199
1628 3300048916 Ga0496113_0004259 Ga0496113_0004259_3831_4574 199
1629 3300048917 Ga0496114_0273158 Ga0496114_0273158_81_824 199
1630 3300048918 Ga0496115_0337391 Ga0496115_0337391_38_781 199
1631 3300048918 Ga0496115_0398147 Ga0496115_0398147_34_777 199
1632 3300048922 Ga0496119_0004353 Ga0496119_0004353_9565_10308 199
1633 3300048928 Ga0496125_0017448 Ga0496125_0017448_3311_4054 199
1634 3300049161 Ga0501305_035288 Ga0501305_035288_51_785 199
1635 3300049579 Ga0501043_0021749 Ga0501043_0021749_2320_3060 199
1636 3300050489 nmdc:mga03683_106558_c1 nmdc:mga03683_106558_c1_294_1016 199
1637 3300050490 nmdc:mga03n38_109370_c1 nmdc:mga03n38_109370_c1_97_819 199
1638 3300050510 nmdc:mga06r32_660_c1 nmdc:mga06r32_660_c1_3780_4550 199
1639 3300053153 Ga0500616_0046151 Ga0500616_0046151_1421_2185 199
1640 iso_pu_bacteria 2508501009 2508543792 199
1641 iso_pu_bacteria 2508501042 2508698420 199
1642 iso_pu_bacteria 2511231028 2511396976 199
1643 iso_pu_bacteria 2513237092 2513625274 199
1644 iso_pu_bacteria 2513237095 2513646158 199
1645 iso_pu_bacteria 2513237101 2513695935 199
1646 iso_pu_bacteria 2513237104 2513715014 199
1647 iso_pu_bacteria 2513237139 2513875854 199
1648 iso_pu_bacteria 2513237161 2514011479 199
1649 iso_pu_bacteria 2515154112 2515630012 199
1650 iso_pu_bacteria 2517093001 2517103524 199
1651 iso_pu_bacteria 2523231067 2523469236 199
1652 iso_pu_bacteria 2524023205 2524441033 199
1653 iso_pu_bacteria 2528768022 2528856459 199
1654 iso_pu_bacteria 2617270735 2617349300 199
1655 iso_pu_bacteria 2617270741 2617378177 199
1656 iso_pu_bacteria 2643221662 2644347093 199
1657 iso_pu_bacteria 2643221734 2644735413 199
1658 iso_pu_bacteria 2643221736 2644747752 199
1659 iso_pu_bacteria 2721755755 2723846167 199
1660 iso_pu_bacteria 2738543031 2739347265 199
1661 iso_pu_bacteria 2744054633 2745082444 199
1662 iso_pu_bacteria 2791355196 2793060250 199
1663 iso_pu_bacteria 2791355199 2793076663 199
1664 iso_pu_bacteria 2802429603 2805917616 199
1665 iso_pu_bacteria 2816332527 2818241503 199
1666 iso_pu_bacteria 2818991467 2819720926 199
1667 iso_pu_bacteria 2824600985 2824602119 199
1668 iso_pu_bacteria 2824609381 2824610107 199
1669 iso_pu_bacteria 2824653114 2824654963 199
1670 iso_pu_bacteria 2824661429 2824662361 199
1671 iso_pu_bacteria 2824671348 2824672610 199
1672 iso_pu_bacteria 2824679649 2824680840 199
1673 iso_pu_bacteria 2824687955 2824689057 199
1674 iso_pu_bacteria 2824696289 2824697424 199
1675 iso_pu_bacteria 2824704595 2824706678 199
1676 iso_pu_bacteria 2824732956 2824733555 199
1677 iso_pu_bacteria 2824746037 2824746930 199
1678 iso_pu_bacteria 2824753945 2824759420 199
1679 iso_pu_bacteria 2824763712 2824769656 199
1680 iso_pu_bacteria 2824773399 2824774033 199
1681 iso_pu_bacteria 2838122688 2838130082 199
1682 iso_pu_bacteria 2841760612 2841761382 199
1683 iso_pu_bacteria 2841941048 2841941239 199
1684 iso_pu_bacteria 2841949485 2841952734 199
1685 iso_pu_bacteria 2841957949 2841962247 199
1686 iso_pu_bacteria 2841966195 2841967394 199
1687 iso_pu_bacteria 2841974524 2841979208 199
1688 iso_pu_bacteria 2841983080 2841990784 199
1689 iso_pu_bacteria 2842038055 2842038624 199
1690 iso_pu_bacteria 2842045827 2842048431 199
1691 iso_pu_bacteria 2844104063 2844104407 199
1692 iso_pu_bacteria 2844315083 2844318022 199
1693 iso_pu_bacteria 2847930680 2847934833 199
1694 iso_pu_bacteria 2847939898 2847945398 199
1695 iso_pu_bacteria 2849076700 2849080414 199
1696 iso_pu_bacteria 2851182111 2851184454 199
1697 iso_pu_bacteria 2851246043 2851247395 199
1698 iso_pu_bacteria 2857509624 2857510233 199
1699 iso_pu_bacteria 2874590934 2874595115 199
1700 iso_pu_bacteria 2874612657 2874615652 199
1701 iso_pu_bacteria 2874620515 2874621675 199
1702 iso_pu_bacteria 2874628541 2874632691 199
1703 iso_pu_bacteria 2874645413 2874650976 199
1704 iso_pu_bacteria 2876771140 2876775051 199
1705 iso_pu_bacteria 2876818435 2876823866 199
1706 iso_pu_bacteria 2879074833 2879080494 199
1707 iso_pu_bacteria 2879083081 2879089280 199
1708 iso_pu_bacteria 2879099564 2879109342 199
1709 iso_pu_bacteria 2879127579 2879134900 199
1710 iso_pu_bacteria 2879142872 2879149211 199
1711 iso_pu_bacteria 2881364244 2881366227 199
1712 iso_pu_bacteria 2881665667 2881671568 199
1713 iso_pu_bacteria 2885366525 2885372820 199
1714 iso_pu_bacteria 2885409591 2885413057 199
1715 iso_pu_bacteria 2888378607 2888382819 199
1716 iso_pu_bacteria 2888388044 2888394981 199
1717 iso_pu_bacteria 2888419890 2888423298 199
1718 iso_pu_bacteria 2889033259 2889041116 199
1719 iso_pu_bacteria 2903727486 2903729669 199
1720 iso_pu_bacteria 2904666416 2904668608 199
1721 iso_pu_bacteria 2904711408 2904716670 199
1722 iso_pu_bacteria 2906602504 2906605817 199
1723 iso_pu_bacteria 2906626472 2906628267 199
1724 iso_pu_bacteria 2906643746 2906644200 199
1725 iso_pu_bacteria 2908775508 2908778941 199
1726 iso_pu_bacteria 2917554339 2917555105 199
1727 iso_pu_bacteria 2917699015 2917699271 199
1728 iso_pu_bacteria 2922368715 2922375221 199
1729 iso_pu_bacteria 2922386360 2922392031 199
1730 iso_pu_bacteria 2922393267 2922395227 199
1731 iso_pu_bacteria 2929615660 2929615909 199
1732 iso_pu_bacteria 2929624759 2929630522 199
1733 iso_pu_bacteria 2932784394 2932792453 199
1734 iso_pu_bacteria 2932794094 2932800401 199
1735 iso_pu_bacteria 2932801729 2932804574 199
1736 iso_pu_bacteria 2932809354 2932813952 199
1737 iso_pu_bacteria 2932818245 2932819536 199
1738 iso_pu_bacteria 2932828146 2932833758 199
1739 iso_pu_bacteria 2933577622 2933578805 199
1740 iso_pu_bacteria 2935608549 2935611365 199
1741 iso_pu_bacteria 2935616580 2935618738 199
1742 iso_pu_bacteria 2935638405 2935644422 199
1743 iso_pu_bacteria 2935648319 2935648749 199
1744 iso_pu_bacteria 2935656913 2935657168 199
1745 iso_pu_bacteria 2935665750 2935674160 199
1746 iso_pu_bacteria 2935675223 2935678558 199
1747 iso_pu_bacteria 2935684952 2935687945 199
1748 iso_pu_bacteria 2935694250 2935701443 199
1749 iso_pu_bacteria 2935703347 2935708279 199
1750 iso_pu_bacteria 2935713505 2935714965 199
1751 iso_pu_bacteria 2935722832 2935726470 199
1752 iso_pu_bacteria 2935732158 2935733783 199
1753 iso_pu_bacteria 2935741537 2935743162 199
1754 iso_pu_bacteria 2935750917 2935754799 199
1755 iso_pu_bacteria 2935760218 2935765507 199
1756 iso_pu_bacteria 2935769743 2935775260 199
1757 iso_pu_bacteria 2935777560 2935779540 199
1758 iso_pu_bacteria 2935785616 2935791542 199
1759 iso_pu_bacteria 2935793552 2935799854 199
1760 iso_pu_bacteria 2935801545 2935805460 199
1761 iso_pu_bacteria 2935810662 2935816754 199
1762 iso_pu_bacteria 2935819856 2935820842 199
1763 iso_pu_bacteria 2935827899 2935833829 199
1764 iso_pu_bacteria 2935837841 2935839486 199
1765 iso_pu_bacteria 2935847175 2935850898 199
1766 iso_pu_bacteria 2935855204 2935857103 199
1767 iso_pu_bacteria 2935864058 2935864647 199
1768 iso_pu_bacteria 2935873716 2935876425 199
1769 iso_pu_bacteria 2935883170 2935889768 199
1770 iso_pu_bacteria 2935908558 2935913735 199
1771 iso_pu_bacteria 2935916978 2935920275 199
1772 iso_pu_bacteria 2935926038 2935930614 199
1773 iso_pu_bacteria 2935934488 2935939413 199
1774 iso_pu_bacteria 2935942939 2935946362 199
1775 iso_pu_bacteria 2935951376 2935955799 199
1776 iso_pu_bacteria 2935967501 2935972491 199
1777 iso_pu_bacteria 2935975950 2935981678 199
1778 iso_pu_bacteria 2935984226 2935991053 199
1779 iso_pu_bacteria 2935992306 2935997606 199
1780 iso_pu_bacteria 2936002035 2936007124 199
1781 iso_pu_bacteria 2936011229 2936011659 199
1782 iso_pu_bacteria 2936019824 2936020254 199
1783 iso_pu_bacteria 2936028420 2936028949 199
1784 iso_pu_bacteria 2936037263 2936042984 199
1785 iso_pu_bacteria 2936046547 2936046977 199
1786 iso_pu_bacteria 2936055302 2936058143 199
1787 iso_pu_bacteria 2940556831 2940559824 199
1788 iso_pu_bacteria 2941531003 2941536086 199
1789 iso_pu_bacteria 2941538514 2941540175 199
1790 iso_pu_bacteria 3005483717 3005488147 199
1791 iso_pu_bacteria 3005506211 3005512705 199
1792 iso_pu_bacteria 3005587118 3005590471 199
1793 iso_pu_bacteria 3005594810 3005598072 199
1794 iso_pu_bacteria 3005718088 3005721262 199
1795 iso_pu_bacteria 8006964411 8006964521 199
1796 iso_pu_bacteria 8006994254 8006996079 199
1797 iso_pu_bacteria 8016511872 8016514679 199
1798 iso_pu_bacteria 8016522445 8016530778 199
1799 iso_pu_bacteria 8016530956 8016536069 199
1800 iso_pu_bacteria 8016539877 8016540348 199
1801 iso_pu_bacteria 8016548790 8016552882 199
1802 iso_pu_bacteria 8016557553 8016561261 199
1803 iso_pu_bacteria 8016566248 8016574415 199
1804 iso_pu_bacteria 8016575299 8016578512 199
1805 iso_pu_bacteria 8016595262 8016599118 199
1806 iso_pu_bacteria 8016603502 8016611930 199
1807 iso_pu_bacteria 8016613128 8016621874 199
1808 iso_pu_bacteria 8016622563 8016627980 199
1809 iso_pu_bacteria 8016630954 8016632303 199
1810 iso_pu_bacteria 8017057580 8017061755 199
1811 iso_pu_bacteria 8019530166 8019535794 199
1812 iso_pu_bacteria 8019576017 8019581255 199
1813 iso_pu_bacteria 8019586578 8019588882 199
1814 iso_pu_bacteria 8019597564 8019602352 199
1815 iso_pu_bacteria 8019608314 8019616209 199
1816 iso_pu_bacteria 8019619141 8019626829 199
1817 iso_pu_bacteria 8019629233 8019635683 199
1818 iso_pu_bacteria 8019638758 8019644002 199
1819 iso_pu_bacteria 8019648815 8019656999 199
1820 iso_pu_bacteria 8019659431 8019663480 199
1821 iso_pu_bacteria 8019668869 8019673093 199
1822 iso_pu_bacteria 8019687851 8019688744 199
1823 iso_pu_bacteria 8055742211 8055747556 199
1824 iso_pu_bacteria 8056673599 8056680469 199
1825 iso_pu_bacteria 8056967851 8056972368 199
1826 iso_pu_bacteria 8057529695 8057530435 199
1827 3300002773 JGI25152J39213_1007293 JGI25152J39213_10072935 200
1828 3300002774 JGI25150J39212_1004887 JGI25150J39212_10048873 200
1829 3300003187 JGI25151J46595_10019741 JGI25151J46595_100197413 200
1830 3300003187 JGI25151J46595_10026766 JGI25151J46595_100267663 200
1831 3300003300 Ga0006758J48902_1009309 Ga0006758J48902_10093092 200
1832 3300003354 JGI25160J50197_1007159 JGI25160J50197_10071593 200
1833 3300003578 Ga0006562J51391_1011078 Ga0006562J51391_10110788 200
1834 3300003693 Ga0032354_1024703 Ga0032354_10247039 200
1835 3300003771 Ga0055526_1038833 Ga0055526_10388331 200
1836 3300003781 Ga0055536_1005568 Ga0055536_10055685 200
1837 3300003791 Ga0055530_10011178 Ga0055530_100111784 200
1838 3300003792 Ga0055540_1004924 Ga0055540_10049248 200
1839 3300003792 Ga0055540_1013480 Ga0055540_10134802 200
1840 3300003792 Ga0055540_1015732 Ga0055540_10157324 200
1841 3300003794 Ga0055531_10008090 Ga0055531_100080904 200
1842 3300003856 Ga0058692_1004593 Ga0058692_10045936 200
1843 3300005262 Ga0065165_1017228 Ga0065165_10172282 200
1844 3300005289 Ga0065704_10105469 Ga0065704_101054692 200
1845 3300005330 Ga0070690_100032710 Ga0070690_1000327104 200
1846 3300005331 Ga0070670_100003237 Ga0070670_1000032372 200
1847 3300005353 Ga0070669_100013136 Ga0070669_1000131369 200
1848 3300005355 Ga0070671_100028610 Ga0070671_1000286101 200
1849 3300005455 Ga0070663_100247892 Ga0070663_1002478921 200
1850 3300005457 Ga0070662_100112197 Ga0070662_1001121972 200
1851 3300005546 Ga0070696_100050054 Ga0070696_1000500542 200
1852 3300005548 Ga0070665_100006166 Ga0070665_1000061669 200
1853 3300005548 Ga0070665_100044684 Ga0070665_1000446848 200
1854 3300005937 Ga0081455_10012098 Ga0081455_100120989 200
1855 3300005983 Ga0081540_1002663 Ga0081540_100266310 200
1856 3300005985 Ga0081539_10031106 Ga0081539_100311064 200
1857 3300006038 Ga0075365_10069048 Ga0075365_100690482 200
1858 3300006042 Ga0075368_10000564 Ga0075368_1000056415 200
1859 3300006042 Ga0075368_10060949 Ga0075368_100609491 200
1860 3300006048 Ga0075363_100115484 Ga0075363_1001154842 200
1861 3300006051 Ga0075364_10019371 Ga0075364_100193714 200
1862 3300006051 Ga0075364_10245182 Ga0075364_102451821 200
1863 3300006177 Ga0075362_10013066 Ga0075362_100130663 200
1864 3300006178 Ga0075367_10001854 Ga0075367_1000185414 200
1865 3300006178 Ga0075367_10041209 Ga0075367_100412093 200
1866 3300006186 Ga0075369_10031240 Ga0075369_100312404 200
1867 3300006186 Ga0075369_10100179 Ga0075369_101001791 200
1868 3300006195 Ga0075366_10000815 Ga0075366_100008157 200
1869 3300006353 Ga0075370_10006197 Ga0075370_100061979 200
1870 3300006353 Ga0075370_10063824 Ga0075370_100638246 200
1871 3300006844 Ga0075428_100547567 Ga0075428_1005475672 200
1872 3300006847 Ga0075431_100516073 Ga0075431_1005160732 200
1873 3300006946 Ga0079104_1060066 Ga0079104_10600661 200
1874 3300006948 Ga0099826_10030933 Ga0099826_100309336 200
1875 3300009092 Ga0105250_10039803 Ga0105250_100398034 200
1876 3300009148 Ga0105243_10015043 Ga0105243_100150438 200
1877 3300009177 Ga0105248_10725852 Ga0105248_107258522 200
1878 3300009553 Ga0105249_10539453 Ga0105249_105394532 200
1879 3300009765 Ga0123341_1017290 Ga0123341_101729012 200
1880 3300009766 Ga0123342_1036794 Ga0123342_10367943 200
1881 3300010375 Ga0105239_10132704 Ga0105239_101327045 200
1882 3300013102 Ga0157371_10009953 Ga0157371_100099538 200
1883 3300013104 Ga0157370_10001829 Ga0157370_100018299 200
1884 3300014326 Ga0157380_10227059 Ga0157380_102270592 200
1885 3300021320 Ga0214544_1002211 Ga0214544_100221146 200
1886 3300021321 Ga0214542_1002553 Ga0214542_100255346 200
1887 3300021327 Ga0214543_1000032 Ga0214543_1000032181 200
1888 3300025245 Ga0207425_1002690 Ga0207425_10026909 200
1889 3300025258 Ga0209129_1006151 Ga0209129_10061515 200
1890 3300025258 Ga0209129_1016631 Ga0209129_10166313 200
1891 3300025273 Ga0209673_1000825 Ga0209673_10008259 200
1892 3300025273 Ga0209673_1004573 Ga0209673_10045738 200
1893 3300025273 Ga0209673_1021339 Ga0209673_10213393 200
1894 3300025284 Ga0209130_1029764 Ga0209130_10297642 200
1895 3300025292 Ga0209676_1002955 Ga0209676_100295515 200
1896 3300025294 Ga0209025_1000320 Ga0209025_10003209 200
1897 3300025294 Ga0209025_1000405 Ga0209025_100040510 200
1898 3300025294 Ga0209025_1010834 Ga0209025_10108349 200
1899 3300025294 Ga0209025_1010837 Ga0209025_10108375 200
1900 3300025295 Ga0209564_1012959 Ga0209564_10129593 200
1901 3300025297 Ga0209758_1010916 Ga0209758_10109169 200
1902 3300025297 Ga0209758_1013305 Ga0209758_10133056 200
1903 3300025297 Ga0209758_1060988 Ga0209758_10609882 200
1904 3300025298 Ga0209050_1003219 Ga0209050_10032199 200
1905 3300025299 Ga0209256_1004663 Ga0209256_10046639 200
1906 3300025302 Ga0207426_1014855 Ga0207426_10148555 200
1907 3300025303 Ga0209051_1000914 Ga0209051_100091438 200
1908 3300025303 Ga0209051_1026165 Ga0209051_10261655 200
1909 3300025303 Ga0209051_1050281 Ga0209051_10502812 200
1910 3300025304 Ga0209257_1002507 Ga0209257_100250724 200
1911 3300025304 Ga0209257_1045286 Ga0209257_10452862 200
1912 3300025923 Ga0207681_10020623 Ga0207681_100206236 200
1913 3300025923 Ga0207681_10181132 Ga0207681_101811322 200
1914 3300025925 Ga0207650_10002132 Ga0207650_100021324 200
1915 3300025931 Ga0207644_10037330 Ga0207644_100373307 200
1916 3300025941 Ga0207711_10230737 Ga0207711_102307372 200
1917 3300026067 Ga0207678_10021836 Ga0207678_100218365 200
1918 3300027312 Ga0209371_1000058 Ga0209371_1000058264 200
1919 3300027312 Ga0209371_1003464 Ga0209371_10034649 200
1920 3300027666 Ga0209282_1018246 Ga0209282_10182465 200
1921 3300027866 Ga0209813_10000248 Ga0209813_1000024824 200
1922 3300028379 Ga0268266_10012480 Ga0268266_1001248010 200
1923 3300028379 Ga0268266_10036033 Ga0268266_100360333 200
1924 3300028577 Ga0265318_10000037 Ga0265318_100000379 200
1925 3300028794 Ga0307515_10001393 Ga0307515_1000139366 200
1926 3300028794 Ga0307515_10038448 Ga0307515_100384489 200
1927 3300028794 Ga0307515_10168973 Ga0307515_101689732 200
1928 3300030500 Ga0268256_1000056 Ga0268256_1000056254 200
1929 3300030744 Ga0316181_1138026 Ga0316181_11380262 200
1930 3300031239 Ga0265328_10000041 Ga0265328_1000004190 200
1931 3300031456 Ga0307513_10005182 Ga0307513_100051828 200
1932 3300031456 Ga0307513_10028569 Ga0307513_100285697 200
1933 3300031548 Ga0307408_100012729 Ga0307408_1000127293 200
1934 3300031649 Ga0307514_10164714 Ga0307514_101647142 200
1935 3300031730 Ga0307516_10057860 Ga0307516_100578605 200
1936 3300031730 Ga0307516_10199083 Ga0307516_101990834 200
1937 3300031731 Ga0307405_10032436 Ga0307405_100324367 200
1938 3300032002 Ga0307416_100319767 Ga0307416_1003197674 200
1939 3300032004 Ga0307414_10010544 Ga0307414_100105444 200
1940 3300032126 Ga0307415_100698057 Ga0307415_1006980572 200
1941 3300032168 Ga0316593_10000860 Ga0316593_100008605 200
1942 3300035398 Ga0316574_0347791 Ga0316574_0347791_28_729 200
1943 3300035695 Ga0373927_0000971 Ga0373927_0000971_17248_17958 200
1944 3300035725 Ga0373947_0061291 Ga0373947_0061291_431_1192 200
1945 3300037471 Ga0395905_0012867 Ga0395905_0012867_3101_3811 200
1946 3300037471 Ga0395905_0033796 Ga0395905_0033796_4043_4753 200
1947 3300037471 Ga0395905_0257703 Ga0395905_0257703_502_1287 200
1948 3300038742 Ga0400486_32139 Ga0400486_32139_1325_2056 200
1949 3300039062 Ga0400483_079140 Ga0400483_079140_4924_5649 200
1950 3300041446 Ga0451794_39427 Ga0451794_39427_288_1004 200
1951 3300042007 Ga0439449_0002592 Ga0439449_0002592_151_864 200
1952 3300046460 Ga0495638_0040593 Ga0495638_0040593_879_1589 200
1953 3300046809 Ga0495600_0214737 Ga0495600_0214737_235_954 200
1954 3300048919 Ga0496116_0035292 Ga0496116_0035292_2050_2781 200
1955 3300048920 Ga0496117_0000002 Ga0496117_0000002_633788_634519 200
1956 3300048920 Ga0496117_0019906 Ga0496117_0019906_2751_3482 200
1957 3300048921 Ga0496118_0020025 Ga0496118_0020025_4014_4745 200
1958 3300048924 Ga0496121_0000003 Ga0496121_0000003_235541_236272 200
1959 3300048925 Ga0496122_0000001 Ga0496122_0000001_343_1074 200
1960 3300048925 Ga0496122_0000651 Ga0496122_0000651_65586_66317 200
1961 3300048925 Ga0496122_0091138 Ga0496122_0091138_1265_1996 200
1962 3300048926 Ga0496123_0000001 Ga0496123_0000001_4074_4805 200
1963 3300048926 Ga0496123_0023779 Ga0496123_0023779_1766_2497 200
1964 3300048927 Ga0496124_0004355 Ga0496124_0004355_4156_4887 200
1965 3300048928 Ga0496125_0000141 Ga0496125_0000141_156377_157108 200
1966 3300048928 Ga0496125_0004886 Ga0496125_0004886_4056_4787 200
1967 3300048929 Ga0496126_0085885 Ga0496126_0085885_2017_2748 200
1968 3300048929 Ga0496126_0093217 Ga0496126_0093217_1876_2607 200
1969 3300049128 Ga0501308_005861 Ga0501308_005861_246_974 200
1970 3300049161 Ga0501305_004840 Ga0501305_004840_350_1078 200
1971 3300049162 Ga0501307_002581 Ga0501307_002581_192_920 200
1972 3300049530 Ga0501314_003537 Ga0501314_003537_317_1045 200
1973 3300049568 Ga0501031_0003843 Ga0501031_0003843_3874_4659 200
1974 3300049568 Ga0501031_0004402 Ga0501031_0004402_6629_7360 200
1975 3300049569 Ga0501032_0003488 Ga0501032_0003488_7597_8310 200
1976 3300049569 Ga0501032_0012326 Ga0501032_0012326_2524_3309 200
1977 3300049569 Ga0501032_0028510 Ga0501032_0028510_643_1383 200
1978 3300049569 Ga0501032_0332669 Ga0501032_0332669_198_905 200
1979 3300049570 Ga0501033_0000121 Ga0501033_0000121_42075_42788 200
1980 3300049570 Ga0501033_0006462 Ga0501033_0006462_8407_9114 200
1981 3300049570 Ga0501033_0007122 Ga0501033_0007122_5224_5955 200
1982 3300049570 Ga0501033_0017879 Ga0501033_0017879_2029_2748 200
1983 3300049570 Ga0501033_0037361 Ga0501033_0037361_515_1300 200
1984 3300049571 Ga0501034_0000298 Ga0501034_0000298_83730_84443 200
1985 3300049571 Ga0501034_0009013 Ga0501034_0009013_5282_5992 200
1986 3300049571 Ga0501034_0014685 Ga0501034_0014685_5921_6628 200
1987 3300049571 Ga0501034_0034843 Ga0501034_0034843_232_951 200
1988 3300049571 Ga0501034_0056638 Ga0501034_0056638_530_1270 200
1989 3300049571 Ga0501034_0064759 Ga0501034_0064759_580_1287 200
1990 3300049572 Ga0501036_0000724 Ga0501036_0000724_20322_21035 200
1991 3300049572 Ga0501036_0014004 Ga0501036_0014004_1589_2374 200
1992 3300049572 Ga0501036_0021849 Ga0501036_0021849_2909_3649 200
1993 3300049573 Ga0501037_0000191 Ga0501037_0000191_52404_53111 200
1994 3300049573 Ga0501037_0000195 Ga0501037_0000195_54635_55348 200
1995 3300049573 Ga0501037_0034293 Ga0501037_0034293_1255_1974 200
1996 3300049573 Ga0501037_0050247 Ga0501037_0050247_95_814 200
1997 3300049574 Ga0501038_0005274 Ga0501038_0005274_7597_8310 200
1998 3300049574 Ga0501038_0007256 Ga0501038_0007256_4456_5175 200
1999 3300049574 Ga0501038_0029459 Ga0501038_0029459_1743_2528 200
2000 3300049574 Ga0501038_0115386 Ga0501038_0115386_1332_2063 200
2001 3300049575 Ga0501039_0000080 Ga0501039_0000080_68095_68808 200
2002 3300049575 Ga0501039_0018138 Ga0501039_0018138_116_901 200
2003 3300049575 Ga0501039_0126935 Ga0501039_0126935_166_906 200
2004 3300049579 Ga0501043_0000080 Ga0501043_0000080_3729_4436 200
2005 3300049579 Ga0501043_0004023 Ga0501043_0004023_3712_4425 200
2006 3300049579 Ga0501043_0006867 Ga0501043_0006867_5753_6484 200
2007 3300049579 Ga0501043_0009304 Ga0501043_0009304_2239_2958 200
2008 3300049581 Ga0501047_0100301 Ga0501047_0100301_1108_1893 200
2009 3300049581 Ga0501047_0163204 Ga0501047_0163204_787_1527 200
2010 3300049581 Ga0501047_0181203 Ga0501047_0181203_414_1127 200
2011 3300049581 Ga0501047_0329898 Ga0501047_0329898_318_1037 200
2012 3300049581 Ga0501047_0335131 Ga0501047_0335131_579_1286 200
2013 3300049582 Ga0501048_0245313 Ga0501048_0245313_395_1114 200
2014 3300049584 Ga0501068_0093639 Ga0501068_0093639_357_1097 200
2015 3300049585 Ga0501069_0060723 Ga0501069_0060723_596_1303 200
2016 3300049586 Ga0501070_0006284 Ga0501070_0006284_4850_5635 200
2017 3300049586 Ga0501070_0014064 Ga0501070_0014064_2302_3009 200
2018 3300049587 Ga0501071_0101470 Ga0501071_0101470_870_1577 200
2019 3300049589 Ga0501073_0086647 Ga0501073_0086647_584_1324 200
2020 3300049589 Ga0501073_0128507 Ga0501073_0128507_488_1195 200
2021 3300049590 Ga0501074_0002583 Ga0501074_0002583_3708_4415 200
2022 3300049593 Ga0501077_0173517 Ga0501077_0173517_333_1049 200
2023 3300049742 Ga0501080_0006111 Ga0501080_0006111_347_1066 200
2024 3300049742 Ga0501080_0181639 Ga0501080_0181639_177_884 200
2025 3300049742 Ga0501080_0834694 Ga0501080_0834694_31_771 200
2026 3300049744 Ga0501083_0001214 Ga0501083_0001214_13016_13723 200
2027 3300049822 Ga0501035_0000160 Ga0501035_0000160_3702_4415 200
2028 3300049822 Ga0501035_0006382 Ga0501035_0006382_9766_10485 200
2029 3300049822 Ga0501035_0023586 Ga0501035_0023586_3978_4763 200
2030 3300049822 Ga0501035_0030092 Ga0501035_0030092_3683_4423 200
2031 3300049822 Ga0501035_0139961 Ga0501035_0139961_800_1507 200
2032 3300049823 Ga0501044_0000544 Ga0501044_0000544_44479_45186 200
2033 3300049823 Ga0501044_0012437 Ga0501044_0012437_4391_5110 200
2034 3300049823 Ga0501044_0015755 Ga0501044_0015755_6097_6837 200
2035 3300049823 Ga0501044_0024732 Ga0501044_0024732_1800_2585 200
2036 3300049823 Ga0501044_0106319 Ga0501044_0106319_1570_2289 200
2037 3300050489 nmdc:mga03683_1808_c1 nmdc:mga03683_1808_c1_2282_3013 200
2038 3300050490 nmdc:mga03n38_771_c1 nmdc:mga03n38_771_c1_4143_4874 200
2039 3300050491 nmdc:mga00v17_376_c1 nmdc:mga00v17_376_c1_44_775 200
2040 3300050492 nmdc:mga0yw44_815_c1 nmdc:mga0yw44_815_c1_6845_7576 200
2041 3300050494 nmdc:mga06z11_12740_c1 nmdc:mga06z11_12740_c1_1913_2644 200
2042 3300050496 nmdc:mga07m45_6073_c1 nmdc:mga07m45_6073_c1_1913_2644 200
2043 3300050510 nmdc:mga06r32_594366_c1 nmdc:mga06r32_594366_c1_174_884 200
2044 3300050516 nmdc:mga0sz30_126291_c1 nmdc:mga0sz30_126291_c1_352_1083 200
2045 3300053103 Ga0500555_043592 Ga0500555_043592_95_808 200
2046 3300053137 Ga0500561_0042637 Ga0500561_0042637_25_756 200
2047 3300053153 Ga0500616_0004053 Ga0500616_0004053_3839_4579 200
2048 3300053153 Ga0500616_0024839 Ga0500616_0024839_435_1145 200
2049 3300053158 Ga0500627_0064034 Ga0500627_0064034_851_1579 200
2050 3300053158 Ga0500627_0096880 Ga0500627_0096880_295_1005 200
2051 3300059490 Ga0587066_000149 Ga0587066_000149_3216_3947 200
2052 3300059493 Ga0587077_000686 Ga0587077_000686_1501_2211 200
2053 3300059493 Ga0587077_000759 Ga0587077_000759_2031_2762 200
2054 3300059505 Ga0587083_0000004 Ga0587083_0000004_3163_3894 200
2055 3300059510 Ga0587090_000009 Ga0587090_000009_424_1155 200
2056 3300059511 Ga0587091_000006 Ga0587091_000006_7837_8568 200
2057 3300059604 Ga0587098_000078 Ga0587098_000078_305_1036 200
2058 3300059626 Ga0587115_000100 Ga0587115_000100_3191_3922 200
2059 3300059639 Ga0587062_001419 Ga0587062_001419_1170_1901 200
2060 3300059640 Ga0587067_000169 Ga0587067_000169_731_1462 200
2061 3300059641 Ga0587068_000102 Ga0587068_000102_3580_4311 200
2062 3300059643 Ga0587072_000447 Ga0587072_000447_2139_2870 200
2063 3300059645 Ga0587076_000044 Ga0587076_000044_3464_4195 200
2064 3300059646 Ga0587078_002037 Ga0587078_002037_1096_1827 200
2065 3300059647 Ga0587079_056451 Ga0587079_056451_26_757 200
2066 3300059653 Ga0587108_000683 Ga0587108_000683_195_905 200
2067 3300059660 Ga0587124_009674 Ga0587124_009674_73_804 200
2068 3300002739 JGI25158J39367_1000460 JGI25158J39367_10004609 201
2069 3300002773 JGI25152J39213_1011184 JGI25152J39213_10111842 201
2070 3300002987 JGI25159J45721_1003302 JGI25159J45721_10033024 201
2071 3300003354 JGI25160J50197_1008863 JGI25160J50197_10088637 201
2072 3300003374 JGI25161J50226_1004961 JGI25161J50226_10049614 201
2073 3300003775 Ga0055524_1009499 Ga0055524_10094998 201
2074 3300003775 Ga0055524_1034597 Ga0055524_10345973 201
2075 3300003794 Ga0055531_10035388 Ga0055531_100353883 201
2076 3300004625 Ga0055543_1006650 Ga0055543_10066504 201
2077 3300005262 Ga0065165_1007230 Ga0065165_10072309 201
2078 3300005262 Ga0065165_1023746 Ga0065165_10237461 201
2079 3300005330 Ga0070690_100209294 Ga0070690_1002092943 201
2080 3300005440 Ga0070705_100365550 Ga0070705_1003655502 201
2081 3300005536 Ga0070697_100003225 Ga0070697_10000322513 201
2082 3300005548 Ga0070665_101033666 Ga0070665_1010336661 201
2083 3300006038 Ga0075365_10165421 Ga0075365_101654213 201
2084 3300006038 Ga0075365_10170405 Ga0075365_101704053 201
2085 3300006178 Ga0075367_10130793 Ga0075367_101307931 201
2086 3300006844 Ga0075428_100268781 Ga0075428_1002687814 201
2087 3300006871 Ga0075434_100431176 Ga0075434_1004311762 201
2088 3300006914 Ga0075436_100014756 Ga0075436_1000147562 201
2089 3300006946 Ga0079104_1000547 Ga0079104_100054749 201
2090 3300007076 Ga0075435_100034006 Ga0075435_1000340065 201
2091 3300007076 Ga0075435_100114165 Ga0075435_1001141655 201
2092 3300013105 Ga0157369_10030062 Ga0157369_1003006212 201
2093 3300013249 Ga0171463_1011 Ga0171463_101132 201
2094 3300014497 Ga0182008_10192790 Ga0182008_101927901 201
2095 3300015690 Ga0183363_1181 Ga0183363_118114 201
2096 3300025208 Ga0209436_101533 Ga0209436_1015339 201
2097 3300025245 Ga0207425_1004689 Ga0207425_10046896 201
2098 3300025258 Ga0209129_1004899 Ga0209129_10048997 201
2099 3300025258 Ga0209129_1018693 Ga0209129_10186932 201
2100 3300025284 Ga0209130_1000006 Ga0209130_1000006292 201
2101 3300025294 Ga0209025_1016908 Ga0209025_10169086 201
2102 3300025297 Ga0209758_1007716 Ga0209758_100771612 201
2103 3300025297 Ga0209758_1056458 Ga0209758_10564581 201
2104 3300025299 Ga0209256_1002683 Ga0209256_100268319 201
2105 3300025299 Ga0209256_1004555 Ga0209256_10045559 201
2106 3300025302 Ga0207426_1000003 Ga0207426_10000031153 201
2107 3300025303 Ga0209051_1010708 Ga0209051_10107089 201
2108 3300025304 Ga0209257_1024790 Ga0209257_10247904 201
2109 3300025939 Ga0207665_10088220 Ga0207665_100882201 201
2110 3300025939 Ga0207665_10532161 Ga0207665_105321612 201
2111 3300026067 Ga0207678_10472587 Ga0207678_104725871 201
2112 3300027111 Ga0209281_1000573 Ga0209281_10005739 201
2113 3300028379 Ga0268266_10865957 Ga0268266_108659571 201
2114 3300028380 Ga0268265_10118353 Ga0268265_101183534 201
2115 3300031235 Ga0265330_10107712 Ga0265330_101077122 201
2116 3300031239 Ga0265328_10005203 Ga0265328_100052034 201
2117 3300031239 Ga0265328_10009346 Ga0265328_100093465 201
2118 3300031239 Ga0265328_10039260 Ga0265328_100392601 201
2119 3300031241 Ga0265325_10015753 Ga0265325_100157532 201
2120 3300031241 Ga0265325_10016753 Ga0265325_100167536 201
2121 3300031247 Ga0265340_10001769 Ga0265340_1000176914 201
2122 3300031247 Ga0265340_10006375 Ga0265340_100063752 201
2123 3300031249 Ga0265339_10002105 Ga0265339_100021057 201
2124 3300031250 Ga0265331_10029937 Ga0265331_100299375 201
2125 3300031250 Ga0265331_10087123 Ga0265331_100871231 201
2126 3300031344 Ga0265316_10030464 Ga0265316_100304647 201
2127 3300031595 Ga0265313_10000031 Ga0265313_1000003185 201
2128 3300031595 Ga0265313_10081585 Ga0265313_100815853 201
2129 3300031711 Ga0265314_10093736 Ga0265314_100937364 201
2130 3300031712 Ga0265342_10004137 Ga0265342_100041379 201
2131 3300031731 Ga0307405_10006207 Ga0307405_100062074 201
2132 3300031852 Ga0307410_10026483 Ga0307410_100264839 201
2133 3300031995 Ga0307409_100305882 Ga0307409_1003058823 201
2134 3300032004 Ga0307414_10034165 Ga0307414_100341655 201
2135 3300035113 Ga0373936_0047071 Ga0373936_0047071_244_969 201
2136 3300035170 Ga0373943_0191945 Ga0373943_0191945_196_921 201
2137 3300035692 Ga0373935_0003403 Ga0373935_0003403_3297_4022 201
2138 3300035725 Ga0373947_0009172 Ga0373947_0009172_1456_2181 201
2139 3300035725 Ga0373947_0106611 Ga0373947_0106611_691_1416 201
2140 3300036401 Ga0373937_0058492 Ga0373937_0058492_200_922 201
2141 3300036647 Ga0316582_0075521 Ga0316582_0075521_141_848 201
2142 3300037068 Ga0373925_0002514 Ga0373925_0002514_5217_5942 201
2143 3300037853 Ga0436364_0638689 Ga0436364_0638689_255_986 201
2144 3300039110 Ga0400487_17567 Ga0400487_17567_1364_2086 201
2145 3300039437 Ga0436365_0037314 Ga0436365_0037314_216_926 201
2146 3300039450 Ga0436363_0441746 Ga0436363_0441746_627_1346 201
2147 3300041413 Ga0439465_0040351 Ga0439465_0040351_175_909 201
2148 3300044656 Ga0466969_0085473 Ga0466969_0085473_643_1374 201
2149 3300045049 Ga0466959_0011129 Ga0466959_0011129_2402_3133 201
2150 3300046459 Ga0495629_0077709 Ga0495629_0077709_209_934 201
2151 3300046460 Ga0495638_0030598 Ga0495638_0030598_36_758 201
2152 3300046472 Ga0495580_0003736 Ga0495580_0003736_1200_1925 201
2153 3300046512 Ga0495610_0133827 Ga0495610_0133827_76_882 201
2154 3300046530 Ga0495654_0000169 Ga0495654_0000169_61214_61951 201
2155 3300046542 Ga0495597_0172058 Ga0495597_0172058_50_865 201
2156 3300046660 Ga0495625_0355227 Ga0495625_0355227_171_893 201
2157 3300046675 Ga0495657_0268203 Ga0495657_0268203_220_942 201
2158 3300046683 Ga0495658_0001492 Ga0495658_0001492_5179_5904 201
2159 3300047319 Ga0495674_0266237 Ga0495674_0266237_274_999 201
2160 3300047320 Ga0495672_0126057 Ga0495672_0126057_240_950 201
2161 3300048914 Ga0496111_0010053 Ga0496111_0010053_312_1049 201
2162 3300048925 Ga0496122_0000179 Ga0496122_0000179_3882_4619 201
2163 3300048925 Ga0496122_0032790 Ga0496122_0032790_469_1206 201
2164 3300048926 Ga0496123_0000305 Ga0496123_0000305_1827_2564 201
2165 3300048928 Ga0496125_0134455 Ga0496125_0134455_235_945 201
2166 3300049546 Ga0501330_001328 Ga0501330_001328_472_1182 201
2167 3300049569 Ga0501032_0243901 Ga0501032_0243901_321_1031 201
2168 3300049570 Ga0501033_0023272 Ga0501033_0023272_3800_4516 201
2169 3300049571 Ga0501034_0000482 Ga0501034_0000482_44031_44753 201
2170 3300049571 Ga0501034_0035212 Ga0501034_0035212_2017_2733 201
2171 3300049571 Ga0501034_0099673 Ga0501034_0099673_991_1686 201
2172 3300049571 Ga0501034_0101512 Ga0501034_0101512_189_899 201
2173 3300049571 Ga0501034_0131817 Ga0501034_0131817_1711_2421 201
2174 3300049571 Ga0501034_0185421 Ga0501034_0185421_99_815 201
2175 3300049571 Ga0501034_0187610 Ga0501034_0187610_1228_1938 201
2176 3300049571 Ga0501034_0250497 Ga0501034_0250497_621_1328 201
2177 3300049572 Ga0501036_0273417 Ga0501036_0273417_388_1098 201
2178 3300049574 Ga0501038_0023939 Ga0501038_0023939_638_1348 201
2179 3300049574 Ga0501038_0039812 Ga0501038_0039812_82_798 201
2180 3300049574 Ga0501038_0131427 Ga0501038_0131427_1142_1852 201
2181 3300049579 Ga0501043_0099954 Ga0501043_0099954_346_1056 201
2182 3300049581 Ga0501047_0037488 Ga0501047_0037488_1024_1734 201
2183 3300049581 Ga0501047_0127913 Ga0501047_0127913_574_1284 201
2184 3300049581 Ga0501047_0289265 Ga0501047_0289265_723_1439 201
2185 3300049581 Ga0501047_0611852 Ga0501047_0611852_107_817 201
2186 3300049582 Ga0501048_0303968 Ga0501048_0303968_275_991 201
2187 3300049583 Ga0501067_0192651 Ga0501067_0192651_79_789 201
2188 3300049583 Ga0501067_0234264 Ga0501067_0234264_143_877 201
2189 3300049585 Ga0501069_0004122 Ga0501069_0004122_5793_6503 201
2190 3300049586 Ga0501070_0031071 Ga0501070_0031071_419_1141 201
2191 3300049586 Ga0501070_0040568 Ga0501070_0040568_1043_1759 201
2192 3300049586 Ga0501070_0060281 Ga0501070_0060281_1394_2104 201
2193 3300049586 Ga0501070_0275478 Ga0501070_0275478_163_873 201
2194 3300049586 Ga0501070_0468434 Ga0501070_0468434_16_726 201
2195 3300049588 Ga0501072_0184065 Ga0501072_0184065_391_1107 201
2196 3300049588 Ga0501072_0338405 Ga0501072_0338405_37_747 201
2197 3300049589 Ga0501073_0015881 Ga0501073_0015881_2311_3021 201
2198 3300049589 Ga0501073_0042595 Ga0501073_0042595_1532_2242 201
2199 3300049589 Ga0501073_0098248 Ga0501073_0098248_76_786 201
2200 3300049589 Ga0501073_0126741 Ga0501073_0126741_273_983 201
2201 3300049589 Ga0501073_0158889 Ga0501073_0158889_637_1347 201
2202 3300049590 Ga0501074_0035107 Ga0501074_0035107_1644_2354 201
2203 3300049742 Ga0501080_0010339 Ga0501080_0010339_7479_8189 201
2204 3300049742 Ga0501080_0018049 Ga0501080_0018049_2085_2795 201
2205 3300049742 Ga0501080_0201688 Ga0501080_0201688_1010_1705 201
2206 3300049742 Ga0501080_0229455 Ga0501080_0229455_443_1159 201
2207 3300049744 Ga0501083_0003307 Ga0501083_0003307_845_1561 201
2208 3300049744 Ga0501083_0020957 Ga0501083_0020957_1968_2678 201
2209 3300049822 Ga0501035_0099561 Ga0501035_0099561_733_1449 201
2210 3300049823 Ga0501044_0020968 Ga0501044_0020968_3714_4424 201
2211 3300049823 Ga0501044_0033457 Ga0501044_0033457_2982_3692 201
2212 3300049823 Ga0501044_0139488 Ga0501044_0139488_367_1077 201
2213 3300049823 Ga0501044_0191494 Ga0501044_0191494_1137_1853 201
2214 3300049823 Ga0501044_0546422 Ga0501044_0546422_139_846 201
2215 3300050492 nmdc:mga0yw44_18471_c1 nmdc:mga0yw44_18471_c1_2666_3397 201
2216 3300050512 nmdc:mga0n895_101015_c1 nmdc:mga0n895_101015_c1_1374_2069 201
2217 3300050513 nmdc:mga0rr50_54931_c1 nmdc:mga0rr50_54931_c1_310_1017 201
2218 3300050514 nmdc:mga08x19_23_c1 nmdc:mga08x19_23_c1_112399_113106 201
2219 3300053117 Ga0500593_000058 Ga0500593_000058_3793_4506 201
2220 3300053125 Ga0500618_006217 Ga0500618_006217_1558_2295 201
2221 3300053125 Ga0500618_009985 Ga0500618_009985_1353_2087 201
2222 3300053130 Ga0500642_0028876 Ga0500642_0028876_774_1472 201
2223 3300053139 Ga0500568_0000001 Ga0500568_0000001_4484_5197 201
2224 3300053153 Ga0500616_0013161 Ga0500616_0013161_1044_1742 201
2225 3300053153 Ga0500616_0022813 Ga0500616_0022813_22_744 201
2226 3300054114 Ga0501084_0023050 Ga0501084_0023050_1623_2333 201
2227 3300054114 Ga0501084_0077972 Ga0501084_0077972_267_962 201
2228 3300059493 Ga0587077_000009 Ga0587077_000009_5559_6278 201
2229 3300059645 Ga0587076_000461 Ga0587076_000461_635_1354 201
2230 3300060353 Ga0501082_0049749 Ga0501082_0049749_2130_2840 201
2231 3300060353 Ga0501082_0220858 Ga0501082_0220858_758_1468 201
2232 3300060353 Ga0501082_0306721 Ga0501082_0306721_365_1081 201
2233 3300002077 JGI24744J21845_10010859 JGI24744J21845_100108594 202
2234 3300005336 Ga0070680_100125958 Ga0070680_1001259583 202
2235 3300005339 Ga0070660_100020152 Ga0070660_1000201524 202
2236 3300005344 Ga0070661_100163613 Ga0070661_1001636134 202
2237 3300005354 Ga0070675_100265261 Ga0070675_1002652612 202
2238 3300005356 Ga0070674_100106879 Ga0070674_1001068793 202
2239 3300005366 Ga0070659_100173078 Ga0070659_1001730782 202
2240 3300005366 Ga0070659_100794602 Ga0070659_1007946021 202
2241 3300005435 Ga0070714_100065873 Ga0070714_1000658734 202
2242 3300005439 Ga0070711_100030956 Ga0070711_1000309563 202
2243 3300005456 Ga0070678_100178873 Ga0070678_1001788733 202
2244 3300005530 Ga0070679_100428233 Ga0070679_1004282331 202
2245 3300005539 Ga0068853_100570137 Ga0068853_1005701371 202
2246 3300005544 Ga0070686_100457413 Ga0070686_1004574132 202
2247 3300005616 Ga0068852_100593367 Ga0068852_1005933671 202
2248 3300005616 Ga0068852_101044254 Ga0068852_1010442541 202
2249 3300005983 Ga0081540_1093559 Ga0081540_10935592 202
2250 3300006048 Ga0075363_100064107 Ga0075363_1000641074 202
2251 3300006847 Ga0075431_100368290 Ga0075431_1003682903 202
2252 3300009098 Ga0105245_10854387 Ga0105245_108543872 202
2253 3300009551 Ga0105238_10146346 Ga0105238_101463465 202
2254 3300009551 Ga0105238_10190252 Ga0105238_101902525 202
2255 3300013102 Ga0157371_10009195 Ga0157371_100091958 202
2256 3300013105 Ga0157369_10028075 Ga0157369_100280755 202
2257 3300013105 Ga0157369_10195577 Ga0157369_101955774 202
2258 3300020082 Ga0206353_10183169 Ga0206353_101831692 202
2259 3300025905 Ga0207685_10141936 Ga0207685_101419362 202
2260 3300025909 Ga0207705_10124003 Ga0207705_101240032 202
2261 3300025912 Ga0207707_10051244 Ga0207707_100512444 202
2262 3300025919 Ga0207657_10113792 Ga0207657_101137925 202
2263 3300025920 Ga0207649_10126434 Ga0207649_101264344 202
2264 3300025921 Ga0207652_10154533 Ga0207652_101545334 202
2265 3300025924 Ga0207694_10011574 Ga0207694_100115747 202
2266 3300025926 Ga0207659_10177303 Ga0207659_101773031 202
2267 3300025932 Ga0207690_10270071 Ga0207690_102700712 202
2268 3300025932 Ga0207690_10388850 Ga0207690_103888502 202
2269 3300025932 Ga0207690_10618028 Ga0207690_106180281 202
2270 3300025936 Ga0207670_10594259 Ga0207670_105942591 202
2271 3300025937 Ga0207669_10024031 Ga0207669_100240317 202
2272 3300025939 Ga0207665_10076554 Ga0207665_100765544 202
2273 3300025949 Ga0207667_10090231 Ga0207667_100902314 202
2274 3300026121 Ga0207683_10177349 Ga0207683_101773492 202
2275 3300026142 Ga0207698_11026729 Ga0207698_110267291 202
2276 3300028800 Ga0265338_10080854 Ga0265338_100808542 202
2277 3300030745 Ga0316182_1083286 Ga0316182_10832864 202
2278 3300031235 Ga0265330_10010675 Ga0265330_100106752 202
2279 3300031241 Ga0265325_10007856 Ga0265325_1000785613 202
2280 3300031241 Ga0265325_10048954 Ga0265325_100489542 202
2281 3300031247 Ga0265340_10006598 Ga0265340_100065989 202
2282 3300031595 Ga0265313_10009717 Ga0265313_1000971714 202
2283 3300031595 Ga0265313_10019153 Ga0265313_100191531 202
2284 3300031665 Ga0316575_10000986 Ga0316575_1000098615 202
2285 3300031712 Ga0265342_10000677 Ga0265342_1000067735 202
2286 3300031712 Ga0265342_10065337 Ga0265342_100653375 202
2287 3300031727 Ga0316576_10005834 Ga0316576_100058344 202
2288 3300031728 Ga0316578_10029177 Ga0316578_100291775 202
2289 3300031733 Ga0316577_10009939 Ga0316577_100099395 202
2290 3300031995 Ga0307409_100146156 Ga0307409_1001461561 202
2291 3300032133 Ga0316583_10004306 Ga0316583_100043065 202
2292 3300032168 Ga0316593_10000349 Ga0316593_1000034912 202
2293 3300033524 Ga0316592_1000190 Ga0316592_10001901 202
2294 3300033527 Ga0316586_1002540 Ga0316586_10025402 202
2295 3300033528 Ga0316588_1000167 Ga0316588_10001672 202
2296 3300033541 Ga0316596_1000615 Ga0316596_10006153 202
2297 3300035083 Ga0373926_0016936 Ga0373926_0016936_1488_2189 202
2298 3300035398 Ga0316574_0001643 Ga0316574_0001643_5586_6299 202
2299 3300036647 Ga0316582_0009543 Ga0316582_0009543_1931_2644 202
2300 3300036712 Ga0316584_0001849 Ga0316584_0001849_5999_6712 202
2301 3300037312 Ga0395899_0081310 Ga0395899_0081310_879_1577 202
2302 3300037418 Ga0395900_0022401 Ga0395900_0022401_897_1595 202
2303 3300037466 Ga0395898_0021752 Ga0395898_0021752_3766_4464 202
2304 3300037588 Ga0316581_0000487 Ga0316581_0000487_1649_2362 202
2305 3300039437 Ga0436365_0956500 Ga0436365_0956500_428_1126 202
2306 3300039437 Ga0436365_1609996 Ga0436365_1609996_5499_6203 202
2307 3300044694 Ga0466963_0016197 Ga0466963_0016197_2368_3066 202
2308 3300044842 Ga0466957_0429825 Ga0466957_0429825_91_789 202
2309 3300045976 Ga0466967_0011664 Ga0466967_0011664_2444_3142 202
2310 3300046517 Ga0495630_0344292 Ga0495630_0344292_69_794 202
2311 3300048913 Ga0496110_0721388 Ga0496110_0721388_78_878 202
2312 3300048919 Ga0496116_0003281 Ga0496116_0003281_9746_10477 202
2313 3300048922 Ga0496119_0000372 Ga0496119_0000372_35547_36254 202
2314 3300048925 Ga0496122_0006451 Ga0496122_0006451_12475_13182 202
2315 3300048926 Ga0496123_0017126 Ga0496123_0017126_3730_4437 202
2316 3300048927 Ga0496124_0004631 Ga0496124_0004631_11123_11854 202
2317 3300048927 Ga0496124_0011120 Ga0496124_0011120_4269_5000 202
2318 3300048929 Ga0496126_0027409 Ga0496126_0027409_390_1121 202
2319 3300048929 Ga0496126_0273833 Ga0496126_0273833_100_801 202
2320 3300049568 Ga0501031_0110797 Ga0501031_0110797_321_1019 202
2321 3300049569 Ga0501032_0071493 Ga0501032_0071493_268_966 202
2322 3300049571 Ga0501034_0058496 Ga0501034_0058496_1366_2064 202
2323 3300049571 Ga0501034_0512915 Ga0501034_0512915_45_785 202
2324 3300049572 Ga0501036_0071269 Ga0501036_0071269_815_1513 202
2325 3300049573 Ga0501037_0069851 Ga0501037_0069851_522_1220 202
2326 3300049574 Ga0501038_0012441 Ga0501038_0012441_6181_6879 202
2327 3300049575 Ga0501039_0082862 Ga0501039_0082862_1467_2165 202
2328 3300049578 Ga0501042_0217545 Ga0501042_0217545_390_1088 202
2329 3300049579 Ga0501043_0124264 Ga0501043_0124264_313_1011 202
2330 3300049581 Ga0501047_0108871 Ga0501047_0108871_1347_2045 202
2331 3300049581 Ga0501047_0158759 Ga0501047_0158759_1268_1966 202
2332 3300049581 Ga0501047_0350156 Ga0501047_0350156_58_756 202
2333 3300049589 Ga0501073_0074091 Ga0501073_0074091_493_1191 202
2334 3300049590 Ga0501074_0015922 Ga0501074_0015922_2683_3381 202
2335 3300049590 Ga0501074_0096885 Ga0501074_0096885_730_1428 202
2336 3300049742 Ga0501080_0090495 Ga0501080_0090495_780_1478 202
2337 3300049823 Ga0501044_0146154 Ga0501044_0146154_1378_2076 202
2338 3300049823 Ga0501044_0183938 Ga0501044_0183938_815_1513 202
2339 3300050490 nmdc:mga03n38_8514_c1 nmdc:mga03n38_8514_c1_867_1577 202
2340 3300050491 nmdc:mga00v17_269541_c1 nmdc:mga00v17_269541_c1_148_888 202
2341 3300050493 nmdc:mga0k408_33683_c1 nmdc:mga0k408_33683_c1_68_778 202
2342 3300050507 nmdc:mga05p37_306818_c1 nmdc:mga05p37_306818_c1_503_1201 202
2343 3300050509 nmdc:mga0qj67_92209_c1 nmdc:mga0qj67_92209_c1_1619_2317 202
2344 3300050510 nmdc:mga06r32_147432_c1 nmdc:mga06r32_147432_c1_723_1421 202
2345 3300053094 Ga0500566_0114687 Ga0500566_0114687_683_1387 202
2346 3300053104 Ga0500556_0000009 Ga0500556_0000009_148995_149702 202
2347 3300053116 Ga0500592_011285 Ga0500592_011285_479_1186 202
2348 3300053119 Ga0500595_003166 Ga0500595_003166_4221_4925 202
2349 3300053131 Ga0500652_000024 Ga0500652_000024_111928_112632 202
2350 3300053161 Ga0500634_0000031 Ga0500634_0000031_6483_7223 202
2351 3300060353 Ga0501082_0617540 Ga0501082_0617540_241_939 202
2352 2209111006 2214600497 2213637923 203
2353 3300000041 ARcpr5oldR_c000035 ARcpr5oldR_00003530 203
2354 3300000042 ARSoilYngRDRAFT_c00061 ARSoilYngRDRAFT_0006123 203
2355 3300000043 ARcpr5yngRDRAFT_c000075 ARcpr5yngRDRAFT_0000754 203
2356 3300000044 ARSoilOldRDRAFT_c000053 ARSoilOldRDRAFT_0000534 203
2357 3300000045 ARCol0oldRDRAFT_c01419 ARCol0oldRDRAFT_014192 203
2358 3300000652 ARCol0yngRDRAFT_1000025 ARCol0yngRDRAFT_10000258 203
2359 3300001977 JGI24746J21847_1000313 JGI24746J21847_10003137 203
2360 3300001977 JGI24746J21847_1003445 JGI24746J21847_10034453 203
2361 3300001978 JGI24747J21853_1000061 JGI24747J21853_10000615 203
2362 3300001979 JGI24740J21852_10023908 JGI24740J21852_100239084 203
2363 3300001989 JGI24739J22299_10001271 JGI24739J22299_1000127110 203
2364 3300001990 JGI24737J22298_10002957 JGI24737J22298_100029578 203
2365 3300002067 JGI24735J21928_10031068 JGI24735J21928_100310684 203
2366 3300002070 JGI24750J21931_1001646 JGI24750J21931_10016464 203
2367 3300002070 JGI24750J21931_1003325 JGI24750J21931_10033252 203
2368 3300002073 JGI24745J21846_1000034 JGI24745J21846_10000348 203
2369 3300002074 JGI24748J21848_1002374 JGI24748J21848_10023744 203
2370 3300002075 JGI24738J21930_10001067 JGI24738J21930_100010676 203
2371 3300002076 JGI24749J21850_1002276 JGI24749J21850_10022764 203
2372 3300002076 JGI24749J21850_1022172 JGI24749J21850_10221722 203
2373 3300002077 JGI24744J21845_10000241 JGI24744J21845_100002412 203
2374 3300002126 JGI24035J26624_1000089 JGI24035J26624_100008910 203
2375 3300002126 JGI24035J26624_1000142 JGI24035J26624_100014214 203
2376 3300002155 JGI24033J26618_1001337 JGI24033J26618_10013374 203
2377 3300002239 JGI24034J26672_10000419 JGI24034J26672_100004195 203
2378 3300002239 JGI24034J26672_10004985 JGI24034J26672_100049853 203
2379 3300002459 JGI24751J29686_10003449 JGI24751J29686_100034492 203
2380 3300002987 JGI25159J45721_1002997 JGI25159J45721_10029976 203
2381 3300003187 JGI25151J46595_10048471 JGI25151J46595_100484712 203
2382 3300003215 JGI25153J46596_10008996 JGI25153J46596_100089968 203
2383 3300003215 JGI25153J46596_10017054 JGI25153J46596_100170546 203
2384 3300003371 JGI26145J50221_1008735 JGI26145J50221_10087351 203
2385 3300003659 JGI25404J52841_10000285 JGI25404J52841_100002854 203
2386 3300005262 Ga0065165_1000631 Ga0065165_10006319 203
2387 3300005277 Ga0065716_1004957 Ga0065716_10049571 203
2388 3300005289 Ga0065704_10137584 Ga0065704_101375842 203
2389 3300005290 Ga0065712_10073769 Ga0065712_100737697 203
2390 3300005290 Ga0065712_10086308 Ga0065712_100863083 203
2391 3300005290 Ga0065712_10174400 Ga0065712_101744002 203
2392 3300005293 Ga0065715_10002813 Ga0065715_100028139 203
2393 3300005293 Ga0065715_10006156 Ga0065715_100061565 203
2394 3300005295 Ga0065707_10256958 Ga0065707_102569582 203
2395 3300005327 Ga0070658_10076960 Ga0070658_100769604 203
2396 3300005328 Ga0070676_10001242 Ga0070676_100012425 203
2397 3300005328 Ga0070676_10033602 Ga0070676_100336023 203
2398 3300005328 Ga0070676_10061261 Ga0070676_100612613 203
2399 3300005329 Ga0070683_100002064 Ga0070683_1000020645 203
2400 3300005329 Ga0070683_100014681 Ga0070683_1000146816 203
2401 3300005329 Ga0070683_100023089 Ga0070683_1000230896 203
2402 3300005330 Ga0070690_100007778 Ga0070690_1000077789 203
2403 3300005330 Ga0070690_100023262 Ga0070690_1000232623 203
2404 3300005330 Ga0070690_100222909 Ga0070690_1002229093 203
2405 3300005331 Ga0070670_100000376 Ga0070670_10000037628 203
2406 3300005331 Ga0070670_100006103 Ga0070670_10000610315 203
2407 3300005331 Ga0070670_100043548 Ga0070670_1000435484 203
2408 3300005331 Ga0070670_100221823 Ga0070670_1002218232 203
2409 3300005333 Ga0070677_10003234 Ga0070677_100032349 203
2410 3300005334 Ga0068869_100000755 Ga0068869_10000075512 203
2411 3300005334 Ga0068869_100289812 Ga0068869_1002898122 203
2412 3300005334 Ga0068869_100526918 Ga0068869_1005269181 203
2413 3300005335 Ga0070666_10004644 Ga0070666_100046447 203
2414 3300005335 Ga0070666_10039473 Ga0070666_100394733 203
2415 3300005336 Ga0070680_100008294 Ga0070680_1000082944 203
2416 3300005336 Ga0070680_100492483 Ga0070680_1004924832 203
2417 3300005337 Ga0070682_100000693 Ga0070682_10000069315 203
2418 3300005337 Ga0070682_100002069 Ga0070682_1000020691 203
2419 3300005337 Ga0070682_100008998 Ga0070682_1000089982 203
2420 3300005337 Ga0070682_100009331 Ga0070682_1000093314 203
2421 3300005338 Ga0068868_100011054 Ga0068868_1000110545 203
2422 3300005338 Ga0068868_100026839 Ga0068868_1000268393 203
2423 3300005339 Ga0070660_100000686 Ga0070660_10000068613 203
2424 3300005339 Ga0070660_100103046 Ga0070660_1001030461 203
2425 3300005339 Ga0070660_100106441 Ga0070660_1001064412 203
2426 3300005340 Ga0070689_100000122 Ga0070689_10000012230 203
2427 3300005340 Ga0070689_100018438 Ga0070689_1000184384 203
2428 3300005340 Ga0070689_100041149 Ga0070689_1000411492 203
2429 3300005340 Ga0070689_100062210 Ga0070689_1000622104 203
2430 3300005340 Ga0070689_100107242 Ga0070689_1001072424 203
2431 3300005341 Ga0070691_10000273 Ga0070691_1000027326 203
2432 3300005341 Ga0070691_10007803 Ga0070691_100078037 203
2433 3300005341 Ga0070691_10020829 Ga0070691_100208292 203
2434 3300005343 Ga0070687_100000768 Ga0070687_1000007684 203
2435 3300005343 Ga0070687_100251803 Ga0070687_1002518032 203
2436 3300005343 Ga0070687_100271210 Ga0070687_1002712102 203
2437 3300005344 Ga0070661_100000385 Ga0070661_10000038515 203
2438 3300005344 Ga0070661_100006236 Ga0070661_1000062365 203
2439 3300005344 Ga0070661_100087287 Ga0070661_1000872871 203
2440 3300005344 Ga0070661_100249255 Ga0070661_1002492552 203
2441 3300005345 Ga0070692_10011527 Ga0070692_100115274 203
2442 3300005347 Ga0070668_100002043 Ga0070668_10000204314 203
2443 3300005347 Ga0070668_100032428 Ga0070668_1000324284 203
2444 3300005347 Ga0070668_100120669 Ga0070668_1001206695 203
2445 3300005347 Ga0070668_100169909 Ga0070668_1001699093 203
2446 3300005347 Ga0070668_100406048 Ga0070668_1004060482 203
2447 3300005353 Ga0070669_100002082 Ga0070669_10000208214 203
2448 3300005353 Ga0070669_100004204 Ga0070669_1000042045 203
2449 3300005353 Ga0070669_100136297 Ga0070669_1001362972 203
2450 3300005354 Ga0070675_100004033 Ga0070675_1000040334 203
2451 3300005354 Ga0070675_100016237 Ga0070675_1000162378 203
2452 3300005354 Ga0070675_100086075 Ga0070675_1000860753 203
2453 3300005355 Ga0070671_100001283 Ga0070671_10000128312 203
2454 3300005355 Ga0070671_100070233 Ga0070671_1000702334 203
2455 3300005355 Ga0070671_100122166 Ga0070671_1001221665 203
2456 3300005355 Ga0070671_100129708 Ga0070671_1001297082 203
2457 3300005356 Ga0070674_100000649 Ga0070674_10000064913 203
2458 3300005356 Ga0070674_100001294 Ga0070674_1000012949 203
2459 3300005356 Ga0070674_100065137 Ga0070674_1000651373 203
2460 3300005356 Ga0070674_100069691 Ga0070674_1000696912 203
2461 3300005364 Ga0070673_100002163 Ga0070673_10000216316 203
2462 3300005364 Ga0070673_100002364 Ga0070673_10000236413 203
2463 3300005364 Ga0070673_100038437 Ga0070673_1000384376 203
2464 3300005364 Ga0070673_100113453 Ga0070673_1001134532 203
2465 3300005365 Ga0070688_100000217 Ga0070688_10000021725 203
2466 3300005365 Ga0070688_100007596 Ga0070688_1000075966 203
2467 3300005365 Ga0070688_100012304 Ga0070688_1000123047 203
2468 3300005365 Ga0070688_100019070 Ga0070688_1000190702 203
2469 3300005365 Ga0070688_100029336 Ga0070688_1000293363 203
2470 3300005365 Ga0070688_100086886 Ga0070688_1000868862 203
2471 3300005366 Ga0070659_100003485 Ga0070659_10000348510 203
2472 3300005366 Ga0070659_100005048 Ga0070659_1000050483 203
2473 3300005366 Ga0070659_100037037 Ga0070659_1000370375 203
2474 3300005366 Ga0070659_100058933 Ga0070659_1000589334 203
2475 3300005366 Ga0070659_100156142 Ga0070659_1001561423 203
2476 3300005366 Ga0070659_100248237 Ga0070659_1002482373 203
2477 3300005367 Ga0070667_100003614 Ga0070667_10000361418 203
2478 3300005367 Ga0070667_100010781 Ga0070667_1000107815 203
2479 3300005367 Ga0070667_100072538 Ga0070667_1000725385 203
2480 3300005367 Ga0070667_100221474 Ga0070667_1002214742 203
2481 3300005367 Ga0070667_100259816 Ga0070667_1002598162 203
2482 3300005434 Ga0070709_10001353 Ga0070709_100013534 203
2483 3300005434 Ga0070709_10010455 Ga0070709_100104555 203
2484 3300005434 Ga0070709_10023639 Ga0070709_100236395 203
2485 3300005434 Ga0070709_10029946 Ga0070709_100299462 203
2486 3300005434 Ga0070709_10095361 Ga0070709_100953613 203
2487 3300005435 Ga0070714_100006925 Ga0070714_1000069254 203
2488 3300005435 Ga0070714_100027595 Ga0070714_1000275951 203
2489 3300005435 Ga0070714_100063995 Ga0070714_1000639952 203
2490 3300005436 Ga0070713_100001694 Ga0070713_1000016943 203
2491 3300005436 Ga0070713_100046417 Ga0070713_1000464172 203
2492 3300005436 Ga0070713_100056910 Ga0070713_1000569106 203
2493 3300005437 Ga0070710_10005298 Ga0070710_100052984 203
2494 3300005437 Ga0070710_10008237 Ga0070710_100082374 203
2495 3300005437 Ga0070710_10045905 Ga0070710_100459054 203
2496 3300005437 Ga0070710_10058489 Ga0070710_100584892 203
2497 3300005438 Ga0070701_10000897 Ga0070701_100008977 203
2498 3300005438 Ga0070701_10025750 Ga0070701_100257502 203
2499 3300005439 Ga0070711_100000834 Ga0070711_10000083413 203
2500 3300005439 Ga0070711_100539060 Ga0070711_1005390601 203
2501 3300005440 Ga0070705_100001475 Ga0070705_1000014753 203
2502 3300005440 Ga0070705_100001981 Ga0070705_1000019819 203
2503 3300005440 Ga0070705_100163011 Ga0070705_1001630112 203
2504 3300005440 Ga0070705_100330170 Ga0070705_1003301701 203
2505 3300005441 Ga0070700_100010431 Ga0070700_1000104314 203
2506 3300005441 Ga0070700_100044432 Ga0070700_1000444322 203
2507 3300005441 Ga0070700_100222353 Ga0070700_1002223532 203
2508 3300005444 Ga0070694_100000195 Ga0070694_10000019518 203
2509 3300005444 Ga0070694_100010924 Ga0070694_1000109243 203
2510 3300005445 Ga0070708_100171035 Ga0070708_1001710355 203
2511 3300005455 Ga0070663_100000352 Ga0070663_10000035221 203
2512 3300005455 Ga0070663_100010153 Ga0070663_1000101539 203
2513 3300005455 Ga0070663_100041358 Ga0070663_1000413582 203
2514 3300005455 Ga0070663_100329866 Ga0070663_1003298662 203
2515 3300005456 Ga0070678_100001146 Ga0070678_1000011467 203
2516 3300005456 Ga0070678_100004700 Ga0070678_1000047008 203
2517 3300005456 Ga0070678_100010048 Ga0070678_1000100488 203
2518 3300005456 Ga0070678_100030537 Ga0070678_1000305374 203
2519 3300005457 Ga0070662_100000412 Ga0070662_10000041225 203
2520 3300005457 Ga0070662_100007011 Ga0070662_10000701110 203
2521 3300005457 Ga0070662_100024005 Ga0070662_1000240053 203
2522 3300005457 Ga0070662_100061180 Ga0070662_1000611803 203
2523 3300005457 Ga0070662_100345141 Ga0070662_1003451412 203
2524 3300005458 Ga0070681_10029025 Ga0070681_100290252 203
2525 3300005458 Ga0070681_10089017 Ga0070681_100890176 203
2526 3300005458 Ga0070681_10191377 Ga0070681_101913775 203
2527 3300005458 Ga0070681_10242511 Ga0070681_102425112 203
2528 3300005459 Ga0068867_100003543 Ga0068867_1000035439 203
2529 3300005466 Ga0070685_10013328 Ga0070685_100133284 203
2530 3300005466 Ga0070685_10033923 Ga0070685_100339234 203
2531 3300005468 Ga0070707_100119123 Ga0070707_1001191232 203
2532 3300005530 Ga0070679_100040109 Ga0070679_1000401092 203
2533 3300005530 Ga0070679_100049456 Ga0070679_1000494563 203
2534 3300005530 Ga0070679_100236676 Ga0070679_1002366761 203
2535 3300005535 Ga0070684_100007624 Ga0070684_1000076244 203
2536 3300005535 Ga0070684_100057198 Ga0070684_1000571983 203
2537 3300005535 Ga0070684_100109327 Ga0070684_1001093273 203
2538 3300005536 Ga0070697_100000391 Ga0070697_10000039128 203
2539 3300005536 Ga0070697_100313263 Ga0070697_1003132631 203
2540 3300005539 Ga0068853_100001082 Ga0068853_10000108210 203
2541 3300005539 Ga0068853_100595721 Ga0068853_1005957212 203
2542 3300005539 Ga0068853_100836299 Ga0068853_1008362992 203
2543 3300005543 Ga0070672_100002637 Ga0070672_1000026376 203
2544 3300005543 Ga0070672_100035019 Ga0070672_1000350197 203
2545 3300005544 Ga0070686_100001391 Ga0070686_1000013917 203
2546 3300005544 Ga0070686_100049366 Ga0070686_1000493665 203
2547 3300005544 Ga0070686_100072127 Ga0070686_1000721274 203
2548 3300005544 Ga0070686_100093249 Ga0070686_1000932493 203
2549 3300005545 Ga0070695_100000238 Ga0070695_10000023825 203
2550 3300005545 Ga0070695_100037816 Ga0070695_1000378164 203
2551 3300005546 Ga0070696_100000815 Ga0070696_10000081514 203
2552 3300005546 Ga0070696_100091134 Ga0070696_1000911345 203
2553 3300005546 Ga0070696_100094139 Ga0070696_1000941393 203
2554 3300005546 Ga0070696_100349467 Ga0070696_1003494672 203
2555 3300005547 Ga0070693_100000455 Ga0070693_10000045520 203
2556 3300005547 Ga0070693_100010280 Ga0070693_1000102804 203
2557 3300005547 Ga0070693_100016709 Ga0070693_1000167095 203
2558 3300005548 Ga0070665_100054832 Ga0070665_1000548327 203
2559 3300005548 Ga0070665_100233446 Ga0070665_1002334463 203
2560 3300005549 Ga0070704_100000124 Ga0070704_10000012420 203
2561 3300005549 Ga0070704_100058612 Ga0070704_1000586124 203
2562 3300005563 Ga0068855_100002691 Ga0068855_10000269113 203
2563 3300005563 Ga0068855_100076631 Ga0068855_1000766312 203
2564 3300005563 Ga0068855_100270018 Ga0068855_1002700183 203
2565 3300005563 Ga0068855_100289062 Ga0068855_1002890624 203
2566 3300005564 Ga0070664_100002450 Ga0070664_10000245016 203
2567 3300005564 Ga0070664_100004534 Ga0070664_1000045345 203
2568 3300005564 Ga0070664_100097992 Ga0070664_1000979922 203
2569 3300005564 Ga0070664_100121742 Ga0070664_1001217422 203
2570 3300005577 Ga0068857_100006037 Ga0068857_1000060379 203
2571 3300005577 Ga0068857_100008457 Ga0068857_1000084577 203
2572 3300005578 Ga0068854_100006037 Ga0068854_1000060377 203
2573 3300005578 Ga0068854_100007856 Ga0068854_1000078565 203
2574 3300005614 Ga0068856_100005122 Ga0068856_10000512216 203
2575 3300005614 Ga0068856_100008706 Ga0068856_1000087065 203
2576 3300005615 Ga0070702_100000018 Ga0070702_10000001816 203
2577 3300005615 Ga0070702_100000378 Ga0070702_10000037814 203
2578 3300005615 Ga0070702_100041319 Ga0070702_1000413195 203
2579 3300005615 Ga0070702_100062278 Ga0070702_1000622784 203
2580 3300005616 Ga0068852_100010938 Ga0068852_1000109389 203
2581 3300005616 Ga0068852_100017082 Ga0068852_1000170828 203
2582 3300005616 Ga0068852_100663922 Ga0068852_1006639222 203
2583 3300005617 Ga0068859_100007402 Ga0068859_10000740213 203
2584 3300005617 Ga0068859_100029393 Ga0068859_1000293938 203
2585 3300005617 Ga0068859_100030651 Ga0068859_1000306517 203
2586 3300005617 Ga0068859_100076838 Ga0068859_1000768387 203
2587 3300005617 Ga0068859_100323648 Ga0068859_1003236482 203
2588 3300005617 Ga0068859_100950915 Ga0068859_1009509151 203
2589 3300005618 Ga0068864_100000595 Ga0068864_10000059530 203
2590 3300005618 Ga0068864_100002243 Ga0068864_10000224314 203
2591 3300005618 Ga0068864_101114684 Ga0068864_1011146841 203
2592 3300005718 Ga0068866_10000834 Ga0068866_1000083420 203
2593 3300005718 Ga0068866_10001983 Ga0068866_1000198310 203
2594 3300005718 Ga0068866_10024794 Ga0068866_100247944 203
2595 3300005718 Ga0068866_10028552 Ga0068866_100285522 203
2596 3300005719 Ga0068861_100000942 Ga0068861_10000094221 203
2597 3300005719 Ga0068861_100002973 Ga0068861_1000029735 203
2598 3300005719 Ga0068861_100039077 Ga0068861_1000390774 203
2599 3300005719 Ga0068861_100163854 Ga0068861_1001638542 203
2600 3300005719 Ga0068861_100440079 Ga0068861_1004400792 203
2601 3300005834 Ga0068851_10084680 Ga0068851_100846802 203
2602 3300005840 Ga0068870_10000216 Ga0068870_1000021615 203
2603 3300005841 Ga0068863_100007838 Ga0068863_1000078389 203
2604 3300005841 Ga0068863_100022557 Ga0068863_1000225579 203
2605 3300005841 Ga0068863_100424170 Ga0068863_1004241702 203
2606 3300005841 Ga0068863_100672713 Ga0068863_1006727132 203
2607 3300005841 Ga0068863_100816290 Ga0068863_1008162902 203
2608 3300005842 Ga0068858_100019589 Ga0068858_10001958910 203
2609 3300005842 Ga0068858_100024760 Ga0068858_1000247605 203
2610 3300005842 Ga0068858_100078512 Ga0068858_1000785123 203
2611 3300005842 Ga0068858_100141594 Ga0068858_1001415944 203
2612 3300005842 Ga0068858_100209082 Ga0068858_1002090824 203
2613 3300005842 Ga0068858_100462430 Ga0068858_1004624302 203
2614 3300005843 Ga0068860_100000598 Ga0068860_10000059827 203
2615 3300005843 Ga0068860_100007174 Ga0068860_1000071745 203
2616 3300005843 Ga0068860_100049233 Ga0068860_1000492335 203
2617 3300005843 Ga0068860_100198111 Ga0068860_1001981112 203
2618 3300005843 Ga0068860_100866220 Ga0068860_1008662202 203
2619 3300005844 Ga0068862_100017504 Ga0068862_1000175045 203
2620 3300005844 Ga0068862_100136266 Ga0068862_1001362662 203
2621 3300005844 Ga0068862_100137280 Ga0068862_1001372804 203
2622 3300005844 Ga0068862_100355311 Ga0068862_1003553113 203
2623 3300005937 Ga0081455_10000048 Ga0081455_1000004845 203
2624 3300005937 Ga0081455_10012767 Ga0081455_1001276712 203
2625 3300005937 Ga0081455_10014358 Ga0081455_100143584 203
2626 3300005983 Ga0081540_1001166 Ga0081540_100116615 203
2627 3300006028 Ga0070717_10034816 Ga0070717_100348165 203
2628 3300006058 Ga0075432_10000910 Ga0075432_100009107 203
2629 3300006163 Ga0070715_10003461 Ga0070715_1000346111 203
2630 3300006163 Ga0070715_10365018 Ga0070715_103650181 203
2631 3300006163 Ga0070715_10404540 Ga0070715_104045401 203
2632 3300006173 Ga0070716_100000346 Ga0070716_1000003465 203
2633 3300006173 Ga0070716_100001603 Ga0070716_1000016039 203
2634 3300006173 Ga0070716_100038559 Ga0070716_1000385593 203
2635 3300006175 Ga0070712_100027843 Ga0070712_1000278432 203
2636 3300006175 Ga0070712_100043397 Ga0070712_1000433974 203
2637 3300006175 Ga0070712_100052247 Ga0070712_1000522471 203
2638 3300006175 Ga0070712_100133693 Ga0070712_1001336934 203
2639 3300006175 Ga0070712_100437551 Ga0070712_1004375512 203
2640 3300006177 Ga0075362_10078492 Ga0075362_100784923 203
2641 3300006186 Ga0075369_10048331 Ga0075369_100483315 203
2642 3300006195 Ga0075366_10007231 Ga0075366_100072317 203
2643 3300006237 Ga0097621_100000600 Ga0097621_10000060024 203
2644 3300006237 Ga0097621_100147597 Ga0097621_1001475972 203
2645 3300006237 Ga0097621_100272520 Ga0097621_1002725202 203
2646 3300006358 Ga0068871_100000118 Ga0068871_1000001188 203
2647 3300006358 Ga0068871_100054371 Ga0068871_1000543712 203
2648 3300006358 Ga0068871_100461540 Ga0068871_1004615402 203
2649 3300006844 Ga0075428_100015890 Ga0075428_1000158909 203
2650 3300006844 Ga0075428_100054274 Ga0075428_1000542748 203
2651 3300006844 Ga0075428_100537004 Ga0075428_1005370042 203
2652 3300006846 Ga0075430_100000196 Ga0075430_10000019640 203
2653 3300006846 Ga0075430_100068070 Ga0075430_1000680705 203
2654 3300006847 Ga0075431_100003503 Ga0075431_1000035038 203
2655 3300006847 Ga0075431_100055672 Ga0075431_1000556727 203
2656 3300006847 Ga0075431_100058192 Ga0075431_1000581921 203
2657 3300006847 Ga0075431_100060290 Ga0075431_1000602902 203
2658 3300006847 Ga0075431_100191472 Ga0075431_1001914722 203
2659 3300006852 Ga0075433_10023032 Ga0075433_100230326 203
2660 3300006852 Ga0075433_10029412 Ga0075433_100294122 203
2661 3300006852 Ga0075433_10035758 Ga0075433_100357588 203
2662 3300006852 Ga0075433_10354914 Ga0075433_103549143 203
2663 3300006871 Ga0075434_100006955 Ga0075434_1000069553 203
2664 3300006871 Ga0075434_100031946 Ga0075434_1000319463 203
2665 3300006871 Ga0075434_100239666 Ga0075434_1002396664 203
2666 3300006871 Ga0075434_100402696 Ga0075434_1004026962 203
2667 3300006871 Ga0075434_100681676 Ga0075434_1006816762 203
2668 3300006880 Ga0075429_100000573 Ga0075429_10000057318 203
2669 3300006880 Ga0075429_100024809 Ga0075429_1000248099 203
2670 3300006881 Ga0068865_100007181 Ga0068865_1000071813 203
2671 3300006881 Ga0068865_100227133 Ga0068865_1002271333 203
2672 3300006881 Ga0068865_100635049 Ga0068865_1006350492 203
2673 3300006914 Ga0075436_100008941 Ga0075436_1000089412 203
2674 3300006914 Ga0075436_100173883 Ga0075436_1001738833 203
2675 3300006931 Ga0097620_100007402 Ga0097620_10000740213 203
2676 3300006931 Ga0097620_100029394 Ga0097620_1000293948 203
2677 3300006931 Ga0097620_100030651 Ga0097620_1000306517 203
2678 3300006931 Ga0097620_100076839 Ga0097620_1000768397 203
2679 3300006931 Ga0097620_100323639 Ga0097620_1003236394 203
2680 3300006931 Ga0097620_100950910 Ga0097620_1009509101 203
2681 3300007076 Ga0075435_100012698 Ga0075435_10001269811 203
2682 3300007076 Ga0075435_100013282 Ga0075435_10001328210 203
2683 3300007076 Ga0075435_100206962 Ga0075435_1002069623 203
2684 3300007076 Ga0075435_100762444 Ga0075435_1007624442 203
2685 3300009011 Ga0105251_10011425 Ga0105251_100114255 203
2686 3300009011 Ga0105251_10060798 Ga0105251_100607983 203
2687 3300009036 Ga0105244_10029155 Ga0105244_100291553 203
2688 3300009092 Ga0105250_10008602 Ga0105250_100086022 203
2689 3300009093 Ga0105240_10015848 Ga0105240_1001584818 203
2690 3300009093 Ga0105240_10130104 Ga0105240_101301045 203
2691 3300009093 Ga0105240_10167533 Ga0105240_101675334 203
2692 3300009093 Ga0105240_10338251 Ga0105240_103382514 203
2693 3300009094 Ga0111539_10000683 Ga0111539_1000068314 203
2694 3300009094 Ga0111539_10010079 Ga0111539_100100793 203
2695 3300009094 Ga0111539_10090609 Ga0111539_100906094 203
2696 3300009094 Ga0111539_10092356 Ga0111539_100923566 203
2697 3300009094 Ga0111539_10100865 Ga0111539_101008656 203
2698 3300009094 Ga0111539_10245567 Ga0111539_102455673 203
2699 3300009098 Ga0105245_10000718 Ga0105245_1000071813 203
2700 3300009098 Ga0105245_10017665 Ga0105245_100176659 203
2701 3300009098 Ga0105245_10061390 Ga0105245_100613906 203
2702 3300009098 Ga0105245_10192450 Ga0105245_101924503 203
2703 3300009101 Ga0105247_10001104 Ga0105247_1000110425 203
2704 3300009101 Ga0105247_10005639 Ga0105247_1000563912 203
2705 3300009101 Ga0105247_10017435 Ga0105247_100174355 203
2706 3300009101 Ga0105247_10050875 Ga0105247_100508753 203
2707 3300009147 Ga0114129_10008352 Ga0114129_1000835218 203
2708 3300009147 Ga0114129_10030751 Ga0114129_100307517 203
2709 3300009147 Ga0114129_10043173 Ga0114129_100431738 203
2710 3300009147 Ga0114129_10051465 Ga0114129_100514653 203
2711 3300009147 Ga0114129_10118024 Ga0114129_101180246 203
2712 3300009148 Ga0105243_10001752 Ga0105243_100017527 203
2713 3300009148 Ga0105243_10009714 Ga0105243_100097144 203
2714 3300009148 Ga0105243_10009969 Ga0105243_100099692 203
2715 3300009148 Ga0105243_10020823 Ga0105243_100208235 203
2716 3300009148 Ga0105243_10148326 Ga0105243_101483263 203
2717 3300009174 Ga0105241_10003357 Ga0105241_100033572 203
2718 3300009176 Ga0105242_10010515 Ga0105242_100105159 203
2719 3300009176 Ga0105242_10016828 Ga0105242_100168288 203
2720 3300009176 Ga0105242_10065726 Ga0105242_100657266 203
2721 3300009176 Ga0105242_10082759 Ga0105242_100827596 203
2722 3300009177 Ga0105248_10002832 Ga0105248_100028328 203
2723 3300009177 Ga0105248_10070068 Ga0105248_100700686 203
2724 3300009177 Ga0105248_10106162 Ga0105248_101061624 203
2725 3300009177 Ga0105248_10140934 Ga0105248_101409343 203
2726 3300009177 Ga0105248_10204250 Ga0105248_102042503 203
2727 3300009177 Ga0105248_10929750 Ga0105248_109297502 203
2728 3300009545 Ga0105237_10001618 Ga0105237_1000161815 203
2729 3300009545 Ga0105237_10059280 Ga0105237_100592804 203
2730 3300009545 Ga0105237_10210047 Ga0105237_102100474 203
2731 3300009545 Ga0105237_11039593 Ga0105237_110395932 203
2732 3300009551 Ga0105238_10007984 Ga0105238_1000798411 203
2733 3300009551 Ga0105238_10148250 Ga0105238_101482502 203
2734 3300009551 Ga0105238_10542462 Ga0105238_105424622 203
2735 3300009553 Ga0105249_10000814 Ga0105249_1000081433 203
2736 3300009553 Ga0105249_10002122 Ga0105249_1000212223 203
2737 3300009553 Ga0105249_10023350 Ga0105249_100233505 203
2738 3300009553 Ga0105249_10057216 Ga0105249_100572163 203
2739 3300010375 Ga0105239_10052904 Ga0105239_100529048 203
2740 3300010375 Ga0105239_10157527 Ga0105239_101575274 203
2741 3300010375 Ga0105239_10415482 Ga0105239_104154822 203
2742 3300011119 Ga0105246_10002439 Ga0105246_1000243912 203
2743 3300011119 Ga0105246_10002558 Ga0105246_1000255811 203
2744 3300011119 Ga0105246_10087255 Ga0105246_100872554 203
2745 3300011119 Ga0105246_10521650 Ga0105246_105216502 203
2746 3300011119 Ga0105246_10578245 Ga0105246_105782451 203
2747 3300013100 Ga0157373_10183707 Ga0157373_101837072 203
2748 3300013100 Ga0157373_10598985 Ga0157373_105989851 203
2749 3300013102 Ga0157371_10018898 Ga0157371_100188984 203
2750 3300013102 Ga0157371_10074676 Ga0157371_100746761 203
2751 3300013104 Ga0157370_10011636 Ga0157370_1001163615 203
2752 3300013105 Ga0157369_10001227 Ga0157369_100012274 203
2753 3300013296 Ga0157374_10021639 Ga0157374_100216396 203
2754 3300013296 Ga0157374_10028235 Ga0157374_100282353 203
2755 3300013297 Ga0157378_10000470 Ga0157378_1000047010 203
2756 3300013297 Ga0157378_10015153 Ga0157378_100151537 203
2757 3300013297 Ga0157378_10229421 Ga0157378_102294213 203
2758 3300013297 Ga0157378_10655439 Ga0157378_106554392 203
2759 3300013306 Ga0163162_10004532 Ga0163162_1000453213 203
2760 3300013306 Ga0163162_10028695 Ga0163162_100286958 203
2761 3300013306 Ga0163162_10120909 Ga0163162_101209094 203
2762 3300013306 Ga0163162_10232744 Ga0163162_102327444 203
2763 3300013307 Ga0157372_10001215 Ga0157372_100012159 203
2764 3300013307 Ga0157372_10128879 Ga0157372_101288796 203
2765 3300013307 Ga0157372_10189514 Ga0157372_101895144 203
2766 3300013307 Ga0157372_10996343 Ga0157372_109963431 203
2767 3300013308 Ga0157375_10007178 Ga0157375_100071788 203
2768 3300013308 Ga0157375_10007439 Ga0157375_100074396 203
2769 3300013308 Ga0157375_10020813 Ga0157375_100208137 203
2770 3300013308 Ga0157375_10105208 Ga0157375_101052083 203
2771 3300014325 Ga0163163_10005311 Ga0163163_100053118 203
2772 3300014325 Ga0163163_10020116 Ga0163163_1002011612 203
2773 3300014325 Ga0163163_10196364 Ga0163163_101963642 203
2774 3300014325 Ga0163163_10352185 Ga0163163_103521852 203
2775 3300014326 Ga0157380_10027055 Ga0157380_100270552 203
2776 3300014326 Ga0157380_10073142 Ga0157380_100731425 203
2777 3300014745 Ga0157377_10000628 Ga0157377_1000062813 203
2778 3300014745 Ga0157377_10006965 Ga0157377_100069656 203
2779 3300014968 Ga0157379_10001927 Ga0157379_1000192710 203
2780 3300014968 Ga0157379_10021324 Ga0157379_100213247 203
2781 3300014968 Ga0157379_10033322 Ga0157379_100333226 203
2782 3300014968 Ga0157379_10395879 Ga0157379_103958792 203
2783 3300014969 Ga0157376_10000606 Ga0157376_1000060619 203
2784 3300014969 Ga0157376_10006966 Ga0157376_100069666 203
2785 3300014969 Ga0157376_10019101 Ga0157376_100191017 203
2786 3300014969 Ga0157376_10132510 Ga0157376_101325105 203
2787 3300014969 Ga0157376_10176068 Ga0157376_101760685 203
2788 3300014969 Ga0157376_10258956 Ga0157376_102589562 203
2789 3300017792 Ga0163161_10002394 Ga0163161_1000239413 203
2790 3300017792 Ga0163161_10009359 Ga0163161_1000935910 203
2791 3300017792 Ga0163161_10045363 Ga0163161_100453636 203
2792 3300025271 Ga0207666_1000185 Ga0207666_10001858 203
2793 3300025271 Ga0207666_1017327 Ga0207666_10173271 203
2794 3300025284 Ga0209130_1001794 Ga0209130_10017944 203
2795 3300025290 Ga0207673_1000115 Ga0207673_10001156 203
2796 3300025291 Ga0209675_1002527 Ga0209675_10025276 203
2797 3300025295 Ga0209564_1002872 Ga0209564_10028724 203
2798 3300025297 Ga0209758_1000548 Ga0209758_100054852 203
2799 3300025299 Ga0209256_1000108 Ga0209256_1000108193 203
2800 3300025302 Ga0207426_1004654 Ga0207426_10046541 203
2801 3300025315 Ga0207697_10003861 Ga0207697_100038613 203
2802 3300025735 Ga0207713_1025626 Ga0207713_10256264 203
2803 3300025885 Ga0207653_10017893 Ga0207653_100178934 203
2804 3300025893 Ga0207682_10000350 Ga0207682_100003509 203
2805 3300025898 Ga0207692_10012995 Ga0207692_100129956 203
2806 3300025898 Ga0207692_10043007 Ga0207692_100430072 203
2807 3300025899 Ga0207642_10001478 Ga0207642_100014787 203
2808 3300025899 Ga0207642_10002270 Ga0207642_1000227011 203
2809 3300025899 Ga0207642_10025851 Ga0207642_100258514 203
2810 3300025899 Ga0207642_10032220 Ga0207642_100322204 203
2811 3300025900 Ga0207710_10003497 Ga0207710_100034977 203
2812 3300025900 Ga0207710_10008108 Ga0207710_100081086 203
2813 3300025900 Ga0207710_10035506 Ga0207710_100355064 203
2814 3300025901 Ga0207688_10002614 Ga0207688_1000261415 203
2815 3300025901 Ga0207688_10007287 Ga0207688_100072879 203
2816 3300025901 Ga0207688_10101952 Ga0207688_101019522 203
2817 3300025901 Ga0207688_10150216 Ga0207688_101502162 203
2818 3300025903 Ga0207680_10006344 Ga0207680_100063442 203
2819 3300025903 Ga0207680_10074338 Ga0207680_100743384 203
2820 3300025903 Ga0207680_10079452 Ga0207680_100794524 203
2821 3300025904 Ga0207647_10001458 Ga0207647_100014584 203
2822 3300025904 Ga0207647_10053013 Ga0207647_100530134 203
2823 3300025904 Ga0207647_10088707 Ga0207647_100887071 203
2824 3300025905 Ga0207685_10000290 Ga0207685_1000029015 203
2825 3300025906 Ga0207699_10011603 Ga0207699_100116035 203
2826 3300025906 Ga0207699_10045934 Ga0207699_100459342 203
2827 3300025907 Ga0207645_10000222 Ga0207645_1000022257 203
2828 3300025907 Ga0207645_10041455 Ga0207645_100414554 203
2829 3300025907 Ga0207645_10148037 Ga0207645_101480372 203
2830 3300025907 Ga0207645_10151959 Ga0207645_101519593 203
2831 3300025908 Ga0207643_10000009 Ga0207643_1000000913 203
2832 3300025911 Ga0207654_10003285 Ga0207654_1000328510 203
2833 3300025911 Ga0207654_10012590 Ga0207654_100125907 203
2834 3300025911 Ga0207654_10023567 Ga0207654_100235672 203
2835 3300025912 Ga0207707_10004335 Ga0207707_1000433514 203
2836 3300025912 Ga0207707_10006091 Ga0207707_1000609110 203
2837 3300025912 Ga0207707_10379643 Ga0207707_103796432 203
2838 3300025912 Ga0207707_10557285 Ga0207707_105572852 203
2839 3300025913 Ga0207695_10141820 Ga0207695_101418204 203
2840 3300025914 Ga0207671_10117979 Ga0207671_101179794 203
2841 3300025914 Ga0207671_10169816 Ga0207671_101698162 203
2842 3300025915 Ga0207693_10000493 Ga0207693_1000049337 203
2843 3300025915 Ga0207693_10015635 Ga0207693_100156359 203
2844 3300025915 Ga0207693_10090686 Ga0207693_100906864 203
2845 3300025916 Ga0207663_10001067 Ga0207663_1000106710 203
2846 3300025916 Ga0207663_10145258 Ga0207663_101452584 203
2847 3300025916 Ga0207663_10233518 Ga0207663_102335182 203
2848 3300025917 Ga0207660_10000197 Ga0207660_1000019739 203
2849 3300025917 Ga0207660_10450141 Ga0207660_104501411 203
2850 3300025917 Ga0207660_10482583 Ga0207660_104825832 203
2851 3300025918 Ga0207662_10002067 Ga0207662_1000206712 203
2852 3300025918 Ga0207662_10010568 Ga0207662_100105689 203
2853 3300025918 Ga0207662_10180235 Ga0207662_101802352 203
2854 3300025918 Ga0207662_10267266 Ga0207662_102672662 203
2855 3300025919 Ga0207657_10000282 Ga0207657_1000028229 203
2856 3300025919 Ga0207657_10022013 Ga0207657_100220137 203
2857 3300025919 Ga0207657_10028527 Ga0207657_100285273 203
2858 3300025919 Ga0207657_10030957 Ga0207657_100309573 203
2859 3300025919 Ga0207657_10121967 Ga0207657_101219673 203
2860 3300025919 Ga0207657_10172620 Ga0207657_101726202 203
2861 3300025920 Ga0207649_10000052 Ga0207649_10000052117 203
2862 3300025920 Ga0207649_10017750 Ga0207649_100177505 203
2863 3300025921 Ga0207652_10004826 Ga0207652_1000482610 203
2864 3300025921 Ga0207652_10007272 Ga0207652_1000727210 203
2865 3300025921 Ga0207652_10147609 Ga0207652_101476092 203
2866 3300025921 Ga0207652_10156241 Ga0207652_101562413 203
2867 3300025921 Ga0207652_10176721 Ga0207652_101767214 203
2868 3300025922 Ga0207646_10411174 Ga0207646_104111742 203
2869 3300025923 Ga0207681_10001135 Ga0207681_1000113514 203
2870 3300025924 Ga0207694_10019951 Ga0207694_100199519 203
2871 3300025924 Ga0207694_10064378 Ga0207694_100643785 203
2872 3300025924 Ga0207694_10112695 Ga0207694_101126952 203
2873 3300025924 Ga0207694_10702792 Ga0207694_107027922 203
2874 3300025925 Ga0207650_10002693 Ga0207650_100026939 203
2875 3300025925 Ga0207650_10115626 Ga0207650_101156264 203
2876 3300025925 Ga0207650_10201869 Ga0207650_102018692 203
2877 3300025926 Ga0207659_10002396 Ga0207659_100023965 203
2878 3300025926 Ga0207659_10005250 Ga0207659_100052507 203
2879 3300025926 Ga0207659_10148016 Ga0207659_101480164 203
2880 3300025927 Ga0207687_10008117 Ga0207687_100081173 203
2881 3300025927 Ga0207687_10008551 Ga0207687_100085519 203
2882 3300025928 Ga0207700_10022753 Ga0207700_100227533 203
2883 3300025928 Ga0207700_10115423 Ga0207700_101154235 203
2884 3300025928 Ga0207700_10259527 Ga0207700_102595273 203
2885 3300025928 Ga0207700_10558935 Ga0207700_105589352 203
2886 3300025929 Ga0207664_10012756 Ga0207664_100127567 203
2887 3300025931 Ga0207644_10000212 Ga0207644_1000021239 203
2888 3300025931 Ga0207644_10017754 Ga0207644_1001775411 203
2889 3300025931 Ga0207644_10032576 Ga0207644_100325762 203
2890 3300025931 Ga0207644_10154463 Ga0207644_101544631 203
2891 3300025932 Ga0207690_10001288 Ga0207690_1000128818 203
2892 3300025932 Ga0207690_10003444 Ga0207690_1000344410 203
2893 3300025932 Ga0207690_10214062 Ga0207690_102140623 203
2894 3300025933 Ga0207706_10000270 Ga0207706_1000027030 203
2895 3300025933 Ga0207706_10016311 Ga0207706_100163118 203
2896 3300025933 Ga0207706_10107179 Ga0207706_101071795 203
2897 3300025933 Ga0207706_10204141 Ga0207706_102041413 203
2898 3300025933 Ga0207706_10218770 Ga0207706_102187703 203
2899 3300025933 Ga0207706_10496828 Ga0207706_104968281 203
2900 3300025934 Ga0207686_10002314 Ga0207686_100023146 203
2901 3300025934 Ga0207686_10010731 Ga0207686_100107316 203
2902 3300025934 Ga0207686_10146162 Ga0207686_101461622 203
2903 3300025935 Ga0207709_10000530 Ga0207709_1000053034 203
2904 3300025935 Ga0207709_10027072 Ga0207709_100270724 203
2905 3300025935 Ga0207709_10032580 Ga0207709_100325802 203
2906 3300025936 Ga0207670_10011341 Ga0207670_100113415 203
2907 3300025936 Ga0207670_10015207 Ga0207670_100152079 203
2908 3300025936 Ga0207670_10025739 Ga0207670_100257394 203
2909 3300025936 Ga0207670_10175513 Ga0207670_101755132 203
2910 3300025937 Ga0207669_10000235 Ga0207669_1000023513 203
2911 3300025937 Ga0207669_10002208 Ga0207669_1000220810 203
2912 3300025938 Ga0207704_10000198 Ga0207704_1000019812 203
2913 3300025938 Ga0207704_10021735 Ga0207704_100217353 203
2914 3300025938 Ga0207704_10066691 Ga0207704_100666914 203
2915 3300025939 Ga0207665_10000273 Ga0207665_100002735 203
2916 3300025939 Ga0207665_10001538 Ga0207665_100015388 203
2917 3300025939 Ga0207665_10048387 Ga0207665_100483873 203
2918 3300025939 Ga0207665_10369237 Ga0207665_103692372 203
2919 3300025940 Ga0207691_10053192 Ga0207691_100531922 203
2920 3300025940 Ga0207691_10067644 Ga0207691_100676442 203
2921 3300025940 Ga0207691_10102538 Ga0207691_101025384 203
2922 3300025940 Ga0207691_10512124 Ga0207691_105121242 203
2923 3300025941 Ga0207711_10151001 Ga0207711_101510014 203
2924 3300025941 Ga0207711_10759270 Ga0207711_107592702 203
2925 3300025942 Ga0207689_10000031 Ga0207689_10000031103 203
2926 3300025942 Ga0207689_10006518 Ga0207689_1000651819 203
2927 3300025942 Ga0207689_10473180 Ga0207689_104731802 203
2928 3300025944 Ga0207661_10003727 Ga0207661_100037275 203
2929 3300025944 Ga0207661_10022097 Ga0207661_1002209711 203
2930 3300025944 Ga0207661_10858952 Ga0207661_108589521 203
2931 3300025945 Ga0207679_10000183 Ga0207679_1000018352 203
2932 3300025945 Ga0207679_10004166 Ga0207679_1000416610 203
2933 3300025945 Ga0207679_10132890 Ga0207679_101328904 203
2934 3300025945 Ga0207679_10324181 Ga0207679_103241812 203
2935 3300025945 Ga0207679_10462893 Ga0207679_104628931 203
2936 3300025949 Ga0207667_10004001 Ga0207667_1000400121 203
2937 3300025949 Ga0207667_10011595 Ga0207667_1001159510 203
2938 3300025949 Ga0207667_10099077 Ga0207667_100990775 203
2939 3300025960 Ga0207651_10000051 Ga0207651_1000005114 203
2940 3300025960 Ga0207651_10093180 Ga0207651_100931802 203
2941 3300025960 Ga0207651_10269508 Ga0207651_102695082 203
2942 3300025961 Ga0207712_10001703 Ga0207712_1000170312 203
2943 3300025961 Ga0207712_10037061 Ga0207712_100370614 203
2944 3300025961 Ga0207712_10042972 Ga0207712_100429722 203
2945 3300025961 Ga0207712_10115402 Ga0207712_101154025 203
2946 3300025972 Ga0207668_10001057 Ga0207668_1000105724 203
2947 3300025972 Ga0207668_10001674 Ga0207668_100016745 203
2948 3300025972 Ga0207668_10029024 Ga0207668_100290246 203
2949 3300025972 Ga0207668_10105875 Ga0207668_101058753 203
2950 3300025972 Ga0207668_10125743 Ga0207668_101257433 203
2951 3300025972 Ga0207668_10183896 Ga0207668_101838962 203
2952 3300025972 Ga0207668_10574644 Ga0207668_105746442 203
2953 3300025981 Ga0207640_10000343 Ga0207640_1000034325 203
2954 3300025981 Ga0207640_10003639 Ga0207640_1000363910 203
2955 3300025981 Ga0207640_10019616 Ga0207640_100196167 203
2956 3300025986 Ga0207658_10007478 Ga0207658_1000747815 203
2957 3300025986 Ga0207658_10066111 Ga0207658_100661115 203
2958 3300025986 Ga0207658_10109450 Ga0207658_101094504 203
2959 3300025986 Ga0207658_10139551 Ga0207658_101395514 203
2960 3300025986 Ga0207658_10675322 Ga0207658_106753222 203
2961 3300026023 Ga0207677_10003168 Ga0207677_1000316814 203
2962 3300026023 Ga0207677_10040326 Ga0207677_100403267 203
2963 3300026023 Ga0207677_10046226 Ga0207677_100462267 203
2964 3300026035 Ga0207703_10010584 Ga0207703_1001058415 203
2965 3300026035 Ga0207703_10039114 Ga0207703_100391147 203
2966 3300026035 Ga0207703_10351386 Ga0207703_103513861 203
2967 3300026035 Ga0207703_10424934 Ga0207703_104249341 203
2968 3300026041 Ga0207639_10052582 Ga0207639_100525823 203
2969 3300026041 Ga0207639_10237229 Ga0207639_102372292 203
2970 3300026041 Ga0207639_10506251 Ga0207639_105062512 203
2971 3300026067 Ga0207678_10000477 Ga0207678_1000047740 203
2972 3300026067 Ga0207678_10005779 Ga0207678_1000577916 203
2973 3300026067 Ga0207678_10024280 Ga0207678_100242803 203
2974 3300026067 Ga0207678_10166893 Ga0207678_101668932 203
2975 3300026075 Ga0207708_10000337 Ga0207708_1000033710 203
2976 3300026075 Ga0207708_10014839 Ga0207708_100148398 203
2977 3300026075 Ga0207708_10016146 Ga0207708_1001614610 203
2978 3300026075 Ga0207708_10614434 Ga0207708_106144342 203
2979 3300026078 Ga0207702_10004643 Ga0207702_100046437 203
2980 3300026078 Ga0207702_10063888 Ga0207702_100638882 203
2981 3300026078 Ga0207702_10498314 Ga0207702_104983142 203
2982 3300026078 Ga0207702_10967464 Ga0207702_109674641 203
2983 3300026088 Ga0207641_10001831 Ga0207641_100018319 203
2984 3300026088 Ga0207641_10017486 Ga0207641_100174867 203
2985 3300026088 Ga0207641_10324756 Ga0207641_103247563 203
2986 3300026088 Ga0207641_10649489 Ga0207641_106494892 203
2987 3300026089 Ga0207648_10068585 Ga0207648_100685855 203
2988 3300026089 Ga0207648_10240702 Ga0207648_102407024 203
2989 3300026095 Ga0207676_10000124 Ga0207676_1000012469 203
2990 3300026095 Ga0207676_10028077 Ga0207676_100280774 203
2991 3300026095 Ga0207676_10250941 Ga0207676_102509414 203
2992 3300026116 Ga0207674_10016004 Ga0207674_1001600410 203
2993 3300026116 Ga0207674_10030575 Ga0207674_100305752 203
2994 3300026118 Ga0207675_100001292 Ga0207675_10000129228 203
2995 3300026118 Ga0207675_100022526 Ga0207675_10002252610 203
2996 3300026118 Ga0207675_100029702 Ga0207675_1000297028 203
2997 3300026118 Ga0207675_100262552 Ga0207675_1002625522 203
2998 3300026121 Ga0207683_10000242 Ga0207683_100002428 203
2999 3300026121 Ga0207683_10000681 Ga0207683_100006814 203
3000 3300026121 Ga0207683_10010724 Ga0207683_100107246 203
3001 3300026121 Ga0207683_10036836 Ga0207683_100368365 203
3002 3300026121 Ga0207683_10190520 Ga0207683_101905204 203
3003 3300026142 Ga0207698_10010960 Ga0207698_100109605 203
3004 3300026142 Ga0207698_10021538 Ga0207698_100215386 203
3005 3300027252 Ga0209973_1014002 Ga0209973_10140021 203
3006 3300027471 Ga0209995_1033375 Ga0209995_10333751 203
3007 3300027526 Ga0209968_1012500 Ga0209968_10125003 203
3008 3300027614 Ga0209970_1006501 Ga0209970_10065011 203
3009 3300027617 Ga0210002_1009632 Ga0210002_10096322 203
3010 3300027682 Ga0209971_1004807 Ga0209971_10048077 203
3011 3300027695 Ga0209966_1001282 Ga0209966_10012826 203
3012 3300027717 Ga0209998_10010168 Ga0209998_100101683 203
3013 3300027717 Ga0209998_10020523 Ga0209998_100205231 203
3014 3300027717 Ga0209998_10021393 Ga0209998_100213932 203
3015 3300027876 Ga0209974_10031999 Ga0209974_100319992 203
3016 3300027907 Ga0207428_10000037 Ga0207428_10000037218 203
3017 3300027907 Ga0207428_10002442 Ga0207428_1000244215 203
3018 3300027907 Ga0207428_10008303 Ga0207428_1000830310 203
3019 3300027907 Ga0207428_10044624 Ga0207428_100446245 203
3020 3300027907 Ga0207428_10189753 Ga0207428_101897534 203
3021 3300028379 Ga0268266_10007549 Ga0268266_100075494 203
3022 3300028379 Ga0268266_10037309 Ga0268266_100373097 203
3023 3300028379 Ga0268266_10194952 Ga0268266_101949522 203
3024 3300028379 Ga0268266_10250643 Ga0268266_102506432 203
3025 3300028379 Ga0268266_10467463 Ga0268266_104674632 203
3026 3300028380 Ga0268265_10003320 Ga0268265_100033205 203
3027 3300028380 Ga0268265_10028273 Ga0268265_100282735 203
3028 3300028380 Ga0268265_10158165 Ga0268265_101581653 203
3029 3300028380 Ga0268265_10628796 Ga0268265_106287962 203
3030 3300028381 Ga0268264_10003234 Ga0268264_100032346 203
3031 3300028381 Ga0268264_10020640 Ga0268264_1002064010 203
3032 3300028381 Ga0268264_10036227 Ga0268264_100362275 203
3033 3300028381 Ga0268264_10177216 Ga0268264_101772164 203
3034 3300028794 Ga0307515_10058447 Ga0307515_100584476 203
3035 3300031238 Ga0265332_10157487 Ga0265332_101574871 203
3036 3300031241 Ga0265325_10001071 Ga0265325_100010719 203
3037 3300031595 Ga0265313_10016370 Ga0265313_100163704 203
3038 3300031595 Ga0265313_10041902 Ga0265313_100419023 203
3039 3300031665 Ga0316575_10024618 Ga0316575_100246184 203
3040 3300031691 Ga0316579_10010091 Ga0316579_100100917 203
3041 3300032004 Ga0307414_10289309 Ga0307414_102893091 203
3042 3300032168 Ga0316593_10001189 Ga0316593_100011897 203
3043 3300034816 Ga0373930_0000191 Ga0373930_0000191_5730_6431 203
3044 3300034816 Ga0373930_0062679 Ga0373930_0062679_39_758 203
3045 3300034817 Ga0373948_0003080 Ga0373948_0003080_1811_2512 203
3046 3300034817 Ga0373948_0004234 Ga0373948_0004234_576_1277 203
3047 3300034818 Ga0373950_0000925 Ga0373950_0000925_2714_3415 203
3048 3300034818 Ga0373950_0006450 Ga0373950_0006450_217_936 203
3049 3300034819 Ga0373958_0022754 Ga0373958_0022754_360_1061 203
3050 3300034819 Ga0373958_0033155 Ga0373958_0033155_282_983 203
3051 3300034820 Ga0373959_0003719 Ga0373959_0003719_1117_1818 203
3052 3300034820 Ga0373959_0023996 Ga0373959_0023996_363_1064 203
3053 3300034957 Ga0373938_0004374 Ga0373938_0004374_1065_1766 203
3054 3300034957 Ga0373938_0012114 Ga0373938_0012114_77_796 203
3055 3300035083 Ga0373926_0084343 Ga0373926_0084343_225_944 203
3056 3300035084 Ga0373928_0006181 Ga0373928_0006181_784_1485 203
3057 3300035085 Ga0373929_0001907 Ga0373929_0001907_2046_2747 203
3058 3300035085 Ga0373929_0015106 Ga0373929_0015106_284_985 203
3059 3300035086 Ga0373934_0025835 Ga0373934_0025835_623_1324 203
3060 3300035086 Ga0373934_0026847 Ga0373934_0026847_1129_1830 203
3061 3300035086 Ga0373934_0047873 Ga0373934_0047873_662_1363 203
3062 3300035088 Ga0373940_0001317 Ga0373940_0001317_873_1574 203
3063 3300035089 Ga0373944_0002638 Ga0373944_0002638_752_1453 203
3064 3300035089 Ga0373944_0008486 Ga0373944_0008486_1599_2300 203
3065 3300035091 Ga0373951_0000552 Ga0373951_0000552_1494_2195 203
3066 3300035091 Ga0373951_0003581 Ga0373951_0003581_2600_3301 203
3067 3300035092 Ga0373952_0005332 Ga0373952_0005332_80_781 203
3068 3300035092 Ga0373952_0012492 Ga0373952_0012492_583_1284 203
3069 3300035092 Ga0373952_0046983 Ga0373952_0046983_43_744 203
3070 3300035111 Ga0373923_0000448 Ga0373923_0000448_6444_7145 203
3071 3300035111 Ga0373923_0046779 Ga0373923_0046779_217_918 203
3072 3300035112 Ga0373932_0002338 Ga0373932_0002338_2944_3645 203
3073 3300035112 Ga0373932_0002861 Ga0373932_0002861_1612_2313 203
3074 3300035113 Ga0373936_0037180 Ga0373936_0037180_793_1494 203
3075 3300035114 Ga0373939_0001965 Ga0373939_0001965_3306_4007 203
3076 3300035114 Ga0373939_0011849 Ga0373939_0011849_112_831 203
3077 3300035114 Ga0373939_0012977 Ga0373939_0012977_43_744 203
3078 3300035115 Ga0373941_0007550 Ga0373941_0007550_1157_1858 203
3079 3300035115 Ga0373941_0067047 Ga0373941_0067047_149_850 203
3080 3300035116 Ga0373945_0000882 Ga0373945_0000882_7435_8136 203
3081 3300035117 Ga0373953_0000440 Ga0373953_0000440_3206_3907 203
3082 3300035117 Ga0373953_0026149 Ga0373953_0026149_224_925 203
3083 3300035118 Ga0373954_0036748 Ga0373954_0036748_879_1580 203
3084 3300035118 Ga0373954_0105233 Ga0373954_0105233_38_739 203
3085 3300035119 Ga0373956_0006607 Ga0373956_0006607_2311_3012 203
3086 3300035119 Ga0373956_0012098 Ga0373956_0012098_1669_2370 203
3087 3300035119 Ga0373956_0013435 Ga0373956_0013435_1750_2451 203
3088 3300035120 Ga0373957_0004663 Ga0373957_0004663_2695_3396 203
3089 3300035120 Ga0373957_0018481 Ga0373957_0018481_630_1331 203
3090 3300035121 Ga0373960_0000068 Ga0373960_0000068_12227_12928 203
3091 3300035121 Ga0373960_0001622 Ga0373960_0001622_1072_1791 203
3092 3300035121 Ga0373960_0006767 Ga0373960_0006767_763_1464 203
3093 3300035170 Ga0373943_0006231 Ga0373943_0006231_3262_3981 203
3094 3300035171 Ga0373946_0014458 Ga0373946_0014458_1982_2683 203
3095 3300035171 Ga0373946_0022633 Ga0373946_0022633_941_1642 203
3096 3300035172 Ga0373955_0001179 Ga0373955_0001179_4246_4947 203
3097 3300035172 Ga0373955_0004283 Ga0373955_0004283_2377_3078 203
3098 3300035172 Ga0373955_0016494 Ga0373955_0016494_1948_2649 203
3099 3300035172 Ga0373955_0022992 Ga0373955_0022992_1379_2080 203
3100 3300035207 Ga0373942_0007725 Ga0373942_0007725_394_1095 203
3101 3300035207 Ga0373942_0014455 Ga0373942_0014455_913_1614 203
3102 3300035241 Ga0373961_0003115 Ga0373961_0003115_675_1376 203
3103 3300035241 Ga0373961_0044148 Ga0373961_0044148_562_1281 203
3104 3300035241 Ga0373961_0117116 Ga0373961_0117116_117_836 203
3105 3300035242 Ga0373962_0000112 Ga0373962_0000112_13565_14266 203
3106 3300035242 Ga0373962_0009631 Ga0373962_0009631_1016_1717 203
3107 3300035242 Ga0373962_0011330 Ga0373962_0011330_366_1067 203
3108 3300035242 Ga0373962_0022167 Ga0373962_0022167_789_1508 203
3109 3300035410 Ga0373924_0073776 Ga0373924_0073776_232_933 203
3110 3300035691 Ga0373931_0000305 Ga0373931_0000305_6127_6828 203
3111 3300035691 Ga0373931_0001634 Ga0373931_0001634_551_1252 203
3112 3300035691 Ga0373931_0004918 Ga0373931_0004918_1348_2067 203
3113 3300035691 Ga0373931_0028314 Ga0373931_0028314_1115_1816 203
3114 3300035691 Ga0373931_0045705 Ga0373931_0045705_172_891 203
3115 3300035692 Ga0373935_0030398 Ga0373935_0030398_1105_1806 203
3116 3300035692 Ga0373935_0062698 Ga0373935_0062698_852_1571 203
3117 3300035692 Ga0373935_0064874 Ga0373935_0064874_1455_2156 203
3118 3300035692 Ga0373935_0077710 Ga0373935_0077710_1225_1926 203
3119 3300035695 Ga0373927_0023717 Ga0373927_0023717_2843_3544 203
3120 3300035724 Ga0373933_0006317 Ga0373933_0006317_3460_4161 203
3121 3300035724 Ga0373933_0020677 Ga0373933_0020677_495_1196 203
3122 3300035724 Ga0373933_0032722 Ga0373933_0032722_1901_2602 203
3123 3300035724 Ga0373933_0036285 Ga0373933_0036285_1087_1788 203
3124 3300035724 Ga0373933_0078302 Ga0373933_0078302_339_1040 203
3125 3300035725 Ga0373947_0006238 Ga0373947_0006238_3046_3765 203
3126 3300035725 Ga0373947_0006914 Ga0373947_0006914_5643_6344 203
3127 3300035725 Ga0373947_0040331 Ga0373947_0040331_291_992 203
3128 3300036401 Ga0373937_0007608 Ga0373937_0007608_7050_7751 203
3129 3300036401 Ga0373937_0011350 Ga0373937_0011350_3776_4477 203
3130 3300036401 Ga0373937_0014628 Ga0373937_0014628_5395_6096 203
3131 3300036401 Ga0373937_0092550 Ga0373937_0092550_1660_2361 203
3132 3300036401 Ga0373937_0133914 Ga0373937_0133914_1133_1834 203
3133 3300036401 Ga0373937_0168260 Ga0373937_0168260_27_728 203
3134 3300036401 Ga0373937_0804191 Ga0373937_0804191_175_876 203
3135 3300036647 Ga0316582_0094924 Ga0316582_0094924_829_1548 203
3136 3300037068 Ga0373925_0011485 Ga0373925_0011485_4692_5411 203
3137 3300037068 Ga0373925_0032780 Ga0373925_0032780_845_1546 203
3138 3300037068 Ga0373925_0058813 Ga0373925_0058813_815_1516 203
3139 3300037068 Ga0373925_0269852 Ga0373925_0269852_89_790 203
3140 3300037312 Ga0395899_0289238 Ga0395899_0289238_202_903 203
3141 3300037418 Ga0395900_0087578 Ga0395900_0087578_462_1163 203
3142 3300037466 Ga0395898_0055115 Ga0395898_0055115_1857_2576 203
3143 3300037466 Ga0395898_0209677 Ga0395898_0209677_1024_1725 203
3144 3300037471 Ga0395905_0002506 Ga0395905_0002506_12537_13256 203
3145 3300037471 Ga0395905_0353396 Ga0395905_0353396_556_1275 203
3146 3300038443 Ga0395901_0002674 Ga0395901_0002674_1043_1762 203
3147 3300038443 Ga0395901_0478499 Ga0395901_0478499_445_1146 203
3148 3300038726 Ga0400490_40073 Ga0400490_40073_340_1071 203
3149 3300038996 Ga0242420_001850 Ga0242420_001850_1410_2111 203
3150 3300042005 Ga0439448_0017297 Ga0439448_0017297_568_1269 203
3151 3300042012 Ga0439455_0003014 Ga0439455_0003014_333_1034 203
3152 3300042016 Ga0439463_024157 Ga0439463_024157_315_1034 203
3153 3300042157 Ga0439458_0008522 Ga0439458_0008522_1207_1908 203
3154 3300042439 Ga0439464_0027732 Ga0439464_0027732_507_1208 203
3155 3300042461 Ga0439460_0007741 Ga0439460_0007741_948_1649 203
3156 3300044684 Ga0466966_0023993 Ga0466966_0023993_2711_3412 203
3157 3300044712 Ga0453684_0087005 Ga0453684_0087005_2582_3283 203
3158 3300044842 Ga0466957_0046178 Ga0466957_0046178_1927_2628 203
3159 3300045049 Ga0466959_0142031 Ga0466959_0142031_790_1491 203
3160 3300045051 Ga0451576_0073262 Ga0451576_0073262_2007_2708 203
3161 3300045976 Ga0466967_0541025 Ga0466967_0541025_373_1074 203
3162 3300046452 Ga0495617_044945 Ga0495617_044945_617_1318 203
3163 3300046454 Ga0495592_0001138 Ga0495592_0001138_9980_10681 203
3164 3300046454 Ga0495592_0073224 Ga0495592_0073224_1109_1810 203
3165 3300046454 Ga0495592_0128170 Ga0495592_0128170_263_964 203
3166 3300046454 Ga0495592_0226222 Ga0495592_0226222_265_966 203
3167 3300046455 Ga0495603_0000280 Ga0495603_0000280_24183_24902 203
3168 3300046455 Ga0495603_0012514 Ga0495603_0012514_477_1178 203
3169 3300046455 Ga0495603_0017036 Ga0495603_0017036_1821_2522 203
3170 3300046459 Ga0495629_0000177 Ga0495629_0000177_33330_34049 203
3171 3300046459 Ga0495629_0000317 Ga0495629_0000317_18530_19231 203
3172 3300046459 Ga0495629_0138137 Ga0495629_0138137_335_1036 203
3173 3300046461 Ga0495641_0009769 Ga0495641_0009769_883_1602 203
3174 3300046461 Ga0495641_0010544 Ga0495641_0010544_2953_3654 203
3175 3300046461 Ga0495641_0090972 Ga0495641_0090972_284_985 203
3176 3300046462 Ga0495651_0004850 Ga0495651_0004850_4753_5454 203
3177 3300046462 Ga0495651_0021253 Ga0495651_0021253_1642_2343 203
3178 3300046462 Ga0495651_0039704 Ga0495651_0039704_2503_3204 203
3179 3300046462 Ga0495651_0133660 Ga0495651_0133660_40_744 203
3180 3300046462 Ga0495651_0508101 Ga0495651_0508101_58_759 203
3181 3300046463 Ga0495653_0009077 Ga0495653_0009077_6411_7112 203
3182 3300046463 Ga0495653_0061061 Ga0495653_0061061_2070_2771 203
3183 3300046463 Ga0495653_0103856 Ga0495653_0103856_906_1607 203
3184 3300046472 Ga0495580_0000498 Ga0495580_0000498_2142_2861 203
3185 3300046472 Ga0495580_0489446 Ga0495580_0489446_54_773 203
3186 3300046473 Ga0495582_0000185 Ga0495582_0000185_12821_13540 203
3187 3300046473 Ga0495582_0007655 Ga0495582_0007655_2316_3017 203
3188 3300046473 Ga0495582_0014384 Ga0495582_0014384_2207_2908 203
3189 3300046473 Ga0495582_0018420 Ga0495582_0018420_1562_2263 203
3190 3300046475 Ga0495639_0001788 Ga0495639_0001788_4161_4880 203
3191 3300046475 Ga0495639_0014947 Ga0495639_0014947_661_1362 203
3192 3300046476 Ga0495662_0007059 Ga0495662_0007059_1698_2399 203
3193 3300046477 Ga0495664_0017680 Ga0495664_0017680_2620_3321 203
3194 3300046491 Ga0495584_0021305 Ga0495584_0021305_1781_2482 203
3195 3300046491 Ga0495584_0131949 Ga0495584_0131949_407_1126 203
3196 3300046492 Ga0495585_0004711 Ga0495585_0004711_7171_7872 203
3197 3300046499 Ga0495594_0000224 Ga0495594_0000224_1291_2010 203
3198 3300046499 Ga0495594_0017716 Ga0495594_0017716_15_716 203
3199 3300046499 Ga0495594_0096582 Ga0495594_0096582_722_1423 203
3200 3300046499 Ga0495594_0151982 Ga0495594_0151982_388_1089 203
3201 3300046501 Ga0495607_0005316 Ga0495607_0005316_6499_7200 203
3202 3300046506 Ga0495583_0144109 Ga0495583_0144109_78_797 203
3203 3300046506 Ga0495583_0161558 Ga0495583_0161558_82_801 203
3204 3300046511 Ga0495608_0003772 Ga0495608_0003772_19_720 203
3205 3300046511 Ga0495608_0007771 Ga0495608_0007771_1049_1750 203
3206 3300046511 Ga0495608_0039811 Ga0495608_0039811_1111_1812 203
3207 3300046511 Ga0495608_0072723 Ga0495608_0072723_1347_2048 203
3208 3300046512 Ga0495610_0049507 Ga0495610_0049507_429_1139 203
3209 3300046514 Ga0495618_0048059 Ga0495618_0048059_1698_2399 203
3210 3300046516 Ga0495628_0002285 Ga0495628_0002285_13367_14068 203
3211 3300046516 Ga0495628_0005831 Ga0495628_0005831_3934_4635 203
3212 3300046516 Ga0495628_0032936 Ga0495628_0032936_2617_3318 203
3213 3300046517 Ga0495630_0013363 Ga0495630_0013363_2622_3323 203
3214 3300046517 Ga0495630_0196354 Ga0495630_0196354_543_1247 203
3215 3300046520 Ga0495637_0023780 Ga0495637_0023780_1066_1767 203
3216 3300046520 Ga0495637_0097986 Ga0495637_0097986_357_1058 203
3217 3300046522 Ga0495643_0036171 Ga0495643_0036171_295_1005 203
3218 3300046523 Ga0495644_0000713 Ga0495644_0000713_12519_13220 203
3219 3300046523 Ga0495644_0087680 Ga0495644_0087680_131_850 203
3220 3300046525 Ga0495663_0001514 Ga0495663_0001514_4170_4871 203
3221 3300046526 Ga0495666_0016673 Ga0495666_0016673_2511_3212 203
3222 3300046529 Ga0495652_0005034 Ga0495652_0005034_2384_3085 203
3223 3300046529 Ga0495652_0080765 Ga0495652_0080765_1689_2390 203
3224 3300046529 Ga0495652_0269116 Ga0495652_0269116_432_1133 203
3225 3300046531 Ga0495665_0004028 Ga0495665_0004028_2622_3323 203
3226 3300046531 Ga0495665_0004234 Ga0495665_0004234_6116_6835 203
3227 3300046533 Ga0495640_0027827 Ga0495640_0027827_1120_1821 203
3228 3300046535 Ga0495586_0006192 Ga0495586_0006192_1344_2045 203
3229 3300046536 Ga0495587_0001073 Ga0495587_0001073_15965_16666 203
3230 3300046536 Ga0495587_0025139 Ga0495587_0025139_475_1176 203
3231 3300046536 Ga0495587_0117665 Ga0495587_0117665_312_1013 203
3232 3300046537 Ga0495598_0000729 Ga0495598_0000729_789_1490 203
3233 3300046538 Ga0495609_0085132 Ga0495609_0085132_275_976 203
3234 3300046543 Ga0495645_0005350 Ga0495645_0005350_3015_3716 203
3235 3300046543 Ga0495645_0031683 Ga0495645_0031683_2333_3034 203
3236 3300046543 Ga0495645_0071482 Ga0495645_0071482_1788_2489 203
3237 3300046557 Ga0495622_0000916 Ga0495622_0000916_3558_4277 203
3238 3300046557 Ga0495622_0014944 Ga0495622_0014944_1928_2629 203
3239 3300046558 Ga0495633_0000941 Ga0495633_0000941_5534_6235 203
3240 3300046559 Ga0495667_0004251 Ga0495667_0004251_8473_9174 203
3241 3300046559 Ga0495667_0006336 Ga0495667_0006336_5637_6338 203
3242 3300046559 Ga0495667_0011743 Ga0495667_0011743_4016_4717 203
3243 3300046559 Ga0495667_0135198 Ga0495667_0135198_622_1323 203
3244 3300046615 Ga0495656_0000589 Ga0495656_0000589_5854_6555 203
3245 3300046616 Ga0495668_0166107 Ga0495668_0166107_444_1163 203
3246 3300046642 Ga0495634_0003557 Ga0495634_0003557_11017_11736 203
3247 3300046642 Ga0495634_0017579 Ga0495634_0017579_3449_4150 203
3248 3300046642 Ga0495634_0065289 Ga0495634_0065289_295_996 203
3249 3300046648 Ga0495611_0001648 Ga0495611_0001648_2987_3688 203
3250 3300046663 Ga0495635_0008888 Ga0495635_0008888_2271_2972 203
3251 3300046663 Ga0495635_0011224 Ga0495635_0011224_2688_3389 203
3252 3300046663 Ga0495635_0021335 Ga0495635_0021335_1620_2339 203
3253 3300046664 Ga0495659_0003548 Ga0495659_0003548_3619_4320 203
3254 3300046665 Ga0495661_0090083 Ga0495661_0090083_622_1332 203
3255 3300046665 Ga0495661_0099349 Ga0495661_0099349_45_746 203
3256 3300046674 Ga0495588_0000617 Ga0495588_0000617_1313_2032 203
3257 3300046674 Ga0495588_0005432 Ga0495588_0005432_1157_1858 203
3258 3300046675 Ga0495657_0015052 Ga0495657_0015052_2046_2747 203
3259 3300046675 Ga0495657_0019703 Ga0495657_0019703_3938_4639 203
3260 3300046675 Ga0495657_0155950 Ga0495657_0155950_333_1034 203
3261 3300046678 Ga0495599_0011690 Ga0495599_0011690_3904_4605 203
3262 3300046678 Ga0495599_0024541 Ga0495599_0024541_1224_1925 203
3263 3300046679 Ga0495623_0000858 Ga0495623_0000858_5353_6054 203
3264 3300046680 Ga0495646_0001927 Ga0495646_0001927_1831_2532 203
3265 3300046680 Ga0495646_0007260 Ga0495646_0007260_1081_1782 203
3266 3300046681 Ga0495647_0008676 Ga0495647_0008676_226_927 203
3267 3300046681 Ga0495647_0012430 Ga0495647_0012430_595_1296 203
3268 3300046681 Ga0495647_0090310 Ga0495647_0090310_262_963 203
3269 3300046683 Ga0495658_0002288 Ga0495658_0002288_1164_1883 203
3270 3300046683 Ga0495658_0015585 Ga0495658_0015585_683_1384 203
3271 3300046683 Ga0495658_0022000 Ga0495658_0022000_1064_1765 203
3272 3300046689 Ga0495613_0013711 Ga0495613_0013711_4131_4850 203
3273 3300046689 Ga0495613_0031187 Ga0495613_0031187_568_1269 203
3274 3300046689 Ga0495613_0041650 Ga0495613_0041650_764_1465 203
3275 3300046689 Ga0495613_0064734 Ga0495613_0064734_392_1093 203
3276 3300046690 Ga0495624_0011751 Ga0495624_0011751_2850_3551 203
3277 3300046690 Ga0495624_0186813 Ga0495624_0186813_16_717 203
3278 3300046691 Ga0495670_0001016 Ga0495670_0001016_11374_12075 203
3279 3300046691 Ga0495670_0015418 Ga0495670_0015418_788_1507 203
3280 3300046692 Ga0495671_0116647 Ga0495671_0116647_538_1239 203
3281 3300046794 Ga0495589_0037315 Ga0495589_0037315_1230_1931 203
3282 3300046809 Ga0495600_0002535 Ga0495600_0002535_5877_6578 203
3283 3300046809 Ga0495600_0017451 Ga0495600_0017451_1435_2136 203
3284 3300046809 Ga0495600_0118752 Ga0495600_0118752_212_913 203
3285 3300046809 Ga0495600_0125819 Ga0495600_0125819_551_1252 203
3286 3300047315 Ga0495581_0001367 Ga0495581_0001367_11024_11743 203
3287 3300047315 Ga0495581_0114214 Ga0495581_0114214_575_1276 203
3288 3300047315 Ga0495581_0122051 Ga0495581_0122051_308_1009 203
3289 3300047317 Ga0495604_0003635 Ga0495604_0003635_755_1456 203
3290 3300047317 Ga0495604_0005022 Ga0495604_0005022_1947_2648 203
3291 3300047317 Ga0495604_0140180 Ga0495604_0140180_982_1683 203
3292 3300047319 Ga0495674_0027562 Ga0495674_0027562_3040_3741 203
3293 3300047321 Ga0495676_0008691 Ga0495676_0008691_3300_4001 203
3294 3300047321 Ga0495676_0050594 Ga0495676_0050594_2451_3152 203
3295 3300047321 Ga0495676_0087389 Ga0495676_0087389_145_864 203
3296 3300047322 Ga0495680_0013552 Ga0495680_0013552_2485_3186 203
3297 3300047322 Ga0495680_0027356 Ga0495680_0027356_737_1438 203
3298 3300047322 Ga0495680_0037737 Ga0495680_0037737_502_1203 203
3299 3300047322 Ga0495680_0042879 Ga0495680_0042879_569_1270 203
3300 3300047322 Ga0495680_0083046 Ga0495680_0083046_124_825 203
3301 3300047322 Ga0495680_0107123 Ga0495680_0107123_244_945 203
3302 3300047322 Ga0495680_0136655 Ga0495680_0136655_565_1284 203
3303 3300047322 Ga0495680_0192107 Ga0495680_0192107_557_1258 203
3304 3300047323 Ga0495683_0155731 Ga0495683_0155731_125_844 203
3305 3300047444 Ga0495675_0006492 Ga0495675_0006492_312_1013 203
3306 3300047444 Ga0495675_0033534 Ga0495675_0033534_1024_1725 203
3307 3300047444 Ga0495675_0060734 Ga0495675_0060734_1256_1957 203
3308 3300047444 Ga0495675_0141362 Ga0495675_0141362_268_993 203
3309 3300047445 Ga0495677_0026330 Ga0495677_0026330_195_896 203
3310 3300047445 Ga0495677_0068865 Ga0495677_0068865_575_1294 203
3311 3300047446 Ga0495679_007990 Ga0495679_007990_1171_1872 203
3312 3300047471 Ga0495684_0001009 Ga0495684_0001009_3028_3729 203
3313 3300047471 Ga0495684_0097147 Ga0495684_0097147_508_1233 203
3314 3300047673 Ga0495593_0001943 Ga0495593_0001943_4013_4732 203
3315 3300047673 Ga0495593_0066194 Ga0495593_0066194_941_1642 203
3316 3300048088 Ga0495602_0005814 Ga0495602_0005814_10949_11650 203
3317 3300048088 Ga0495602_0103585 Ga0495602_0103585_190_891 203
3318 3300048088 Ga0495602_0223847 Ga0495602_0223847_225_926 203
3319 3300048088 Ga0495602_0389607 Ga0495602_0389607_172_891 203
3320 3300048089 Ga0495614_0000618 Ga0495614_0000618_7959_8678 203
3321 3300048089 Ga0495614_0003011 Ga0495614_0003011_1119_1820 203
3322 3300048903 Ga0496100_0000345 Ga0496100_0000345_19570_20271 203
3323 3300048903 Ga0496100_0029207 Ga0496100_0029207_1946_2647 203
3324 3300048903 Ga0496100_0072649 Ga0496100_0072649_19_738 203
3325 3300048903 Ga0496100_0100037 Ga0496100_0100037_757_1476 203
3326 3300048904 Ga0496101_0000969 Ga0496101_0000969_10768_11469 203
3327 3300048904 Ga0496101_0013181 Ga0496101_0013181_3040_3759 203
3328 3300048904 Ga0496101_0060073 Ga0496101_0060073_576_1295 203
3329 3300048904 Ga0496101_0336746 Ga0496101_0336746_149_943 203
3330 3300048904 Ga0496101_0354302 Ga0496101_0354302_421_1122 203
3331 3300048904 Ga0496101_0539249 Ga0496101_0539249_99_800 203
3332 3300048905 Ga0496102_0004376 Ga0496102_0004376_4221_4922 203
3333 3300048905 Ga0496102_0021341 Ga0496102_0021341_3368_4087 203
3334 3300048905 Ga0496102_0024862 Ga0496102_0024862_1711_2430 203
3335 3300048905 Ga0496102_0132409 Ga0496102_0132409_982_1776 203
3336 3300048905 Ga0496102_0164407 Ga0496102_0164407_1097_1798 203
3337 3300048905 Ga0496102_0321597 Ga0496102_0321597_317_1036 203
3338 3300048905 Ga0496102_0328981 Ga0496102_0328981_242_961 203
3339 3300048905 Ga0496102_0331427 Ga0496102_0331427_103_804 203
3340 3300048906 Ga0496103_0001732 Ga0496103_0001732_2488_3189 203
3341 3300048906 Ga0496103_0030798 Ga0496103_0030798_2199_2918 203
3342 3300048906 Ga0496103_0365436 Ga0496103_0365436_161_862 203
3343 3300048907 Ga0496104_0000399 Ga0496104_0000399_33506_34207 203
3344 3300048907 Ga0496104_0045259 Ga0496104_0045259_2373_3092 203
3345 3300048907 Ga0496104_0052818 Ga0496104_0052818_2313_3014 203
3346 3300048907 Ga0496104_0171951 Ga0496104_0171951_751_1470 203
3347 3300048907 Ga0496104_0257745 Ga0496104_0257745_573_1274 203
3348 3300048907 Ga0496104_0263891 Ga0496104_0263891_805_1506 203
3349 3300048907 Ga0496104_0265624 Ga0496104_0265624_551_1270 203
3350 3300048907 Ga0496104_0269395 Ga0496104_0269395_121_840 203
3351 3300048908 Ga0496105_0002417 Ga0496105_0002417_9428_10129 203
3352 3300048908 Ga0496105_0039469 Ga0496105_0039469_677_1378 203
3353 3300048908 Ga0496105_0110910 Ga0496105_0110910_771_1472 203
3354 3300048908 Ga0496105_0179095 Ga0496105_0179095_545_1246 203
3355 3300048909 Ga0496106_0006762 Ga0496106_0006762_4838_5539 203
3356 3300048909 Ga0496106_0015788 Ga0496106_0015788_1200_1901 203
3357 3300048909 Ga0496106_0024149 Ga0496106_0024149_1514_2233 203
3358 3300048909 Ga0496106_0087648 Ga0496106_0087648_394_1113 203
3359 3300048909 Ga0496106_0164547 Ga0496106_0164547_653_1354 203
3360 3300048909 Ga0496106_0253074 Ga0496106_0253074_31_732 203
3361 3300048910 Ga0496107_0002978 Ga0496107_0002978_9833_10552 203
3362 3300048910 Ga0496107_0005598 Ga0496107_0005598_3812_4513 203
3363 3300048910 Ga0496107_0034153 Ga0496107_0034153_2349_3050 203
3364 3300048910 Ga0496107_0053345 Ga0496107_0053345_1016_1717 203
3365 3300048910 Ga0496107_0055486 Ga0496107_0055486_2039_2833 203
3366 3300048910 Ga0496107_0092297 Ga0496107_0092297_837_1556 203
3367 3300048910 Ga0496107_0133846 Ga0496107_0133846_216_917 203
3368 3300048911 Ga0496108_0031377 Ga0496108_0031377_3542_4243 203
3369 3300048911 Ga0496108_0447522 Ga0496108_0447522_128_847 203
3370 3300048911 Ga0496108_0561385 Ga0496108_0561385_68_769 203
3371 3300048912 Ga0496109_0005949 Ga0496109_0005949_5781_6482 203
3372 3300048912 Ga0496109_0012139 Ga0496109_0012139_5544_6263 203
3373 3300048912 Ga0496109_0017285 Ga0496109_0017285_857_1576 203
3374 3300048912 Ga0496109_0084667 Ga0496109_0084667_1051_1752 203
3375 3300048912 Ga0496109_0119997 Ga0496109_0119997_645_1346 203
3376 3300048912 Ga0496109_0164021 Ga0496109_0164021_996_1697 203
3377 3300048912 Ga0496109_0351157 Ga0496109_0351157_37_756 203
3378 3300048913 Ga0496110_0030562 Ga0496110_0030562_3181_3882 203
3379 3300048913 Ga0496110_0047748 Ga0496110_0047748_1982_2683 203
3380 3300048913 Ga0496110_0075335 Ga0496110_0075335_1683_2402 203
3381 3300048913 Ga0496110_0108094 Ga0496110_0108094_1487_2188 203
3382 3300048913 Ga0496110_0323206 Ga0496110_0323206_272_973 203
3383 3300048913 Ga0496110_0586790 Ga0496110_0586790_31_732 203
3384 3300048914 Ga0496111_0041173 Ga0496111_0041173_2173_2874 203
3385 3300048914 Ga0496111_0085209 Ga0496111_0085209_179_898 203
3386 3300048914 Ga0496111_0194640 Ga0496111_0194640_341_1042 203
3387 3300048914 Ga0496111_0232432 Ga0496111_0232432_133_834 203
3388 3300048915 Ga0496112_0003321 Ga0496112_0003321_83_784 203
3389 3300048915 Ga0496112_0056643 Ga0496112_0056643_2127_2846 203
3390 3300048915 Ga0496112_0094664 Ga0496112_0094664_1310_2029 203
3391 3300048915 Ga0496112_0113935 Ga0496112_0113935_849_1550 203
3392 3300048915 Ga0496112_0744497 Ga0496112_0744497_175_876 203
3393 3300048916 Ga0496113_0007674 Ga0496113_0007674_5912_6613 203
3394 3300048916 Ga0496113_0014734 Ga0496113_0014734_3773_4492 203
3395 3300048916 Ga0496113_0015868 Ga0496113_0015868_996_1697 203
3396 3300048916 Ga0496113_0016963 Ga0496113_0016963_4299_5018 203
3397 3300048916 Ga0496113_0119259 Ga0496113_0119259_667_1368 203
3398 3300048917 Ga0496114_0002647 Ga0496114_0002647_7479_8180 203
3399 3300048917 Ga0496114_0017438 Ga0496114_0017438_2071_2772 203
3400 3300048917 Ga0496114_0024283 Ga0496114_0024283_2784_3485 203
3401 3300048917 Ga0496114_0062704 Ga0496114_0062704_1473_2192 203
3402 3300048917 Ga0496114_0104199 Ga0496114_0104199_1258_1977 203
3403 3300048917 Ga0496114_0263208 Ga0496114_0263208_166_885 203
3404 3300048917 Ga0496114_0267595 Ga0496114_0267595_114_833 203
3405 3300048918 Ga0496115_0007035 Ga0496115_0007035_5627_6328 203
3406 3300048918 Ga0496115_0007121 Ga0496115_0007121_5832_6551 203
3407 3300048918 Ga0496115_0167415 Ga0496115_0167415_805_1506 203
3408 3300048918 Ga0496115_0429514 Ga0496115_0429514_127_828 203
3409 3300048929 Ga0496126_0167062 Ga0496126_0167062_426_1130 203
3410 3300049569 Ga0501032_0026774 Ga0501032_0026774_2354_3061 203
3411 3300049569 Ga0501032_0183915 Ga0501032_0183915_113_832 203
3412 3300049570 Ga0501033_0123672 Ga0501033_0123672_864_1583 203
3413 3300049570 Ga0501033_0172227 Ga0501033_0172227_352_1071 203
3414 3300049571 Ga0501034_0060135 Ga0501034_0060135_1318_2019 203
3415 3300049571 Ga0501034_0368612 Ga0501034_0368612_327_1034 203
3416 3300049572 Ga0501036_0005563 Ga0501036_0005563_6818_7525 203
3417 3300049572 Ga0501036_0018306 Ga0501036_0018306_3526_4245 203
3418 3300049572 Ga0501036_0042438 Ga0501036_0042438_691_1410 203
3419 3300049572 Ga0501036_0088809 Ga0501036_0088809_128_847 203
3420 3300049572 Ga0501036_0592171 Ga0501036_0592171_78_797 203
3421 3300049574 Ga0501038_0099119 Ga0501038_0099119_866_1585 203
3422 3300049574 Ga0501038_0231612 Ga0501038_0231612_636_1355 203
3423 3300049574 Ga0501038_0439836 Ga0501038_0439836_114_833 203
3424 3300049574 Ga0501038_0461700 Ga0501038_0461700_76_777 203
3425 3300049575 Ga0501039_0103496 Ga0501039_0103496_1181_1900 203
3426 3300049575 Ga0501039_0166413 Ga0501039_0166413_852_1571 203
3427 3300049576 Ga0501040_0028399 Ga0501040_0028399_2541_3260 203
3428 3300049576 Ga0501040_0099905 Ga0501040_0099905_751_1470 203
3429 3300049576 Ga0501040_0427749 Ga0501040_0427749_16_726 203
3430 3300049577 Ga0501041_0030131 Ga0501041_0030131_1750_2469 203
3431 3300049577 Ga0501041_0052753 Ga0501041_0052753_628_1347 203
3432 3300049577 Ga0501041_0081843 Ga0501041_0081843_301_1020 203
3433 3300049577 Ga0501041_0421402 Ga0501041_0421402_34_753 203
3434 3300049578 Ga0501042_0049150 Ga0501042_0049150_1011_1730 203
3435 3300049578 Ga0501042_0073631 Ga0501042_0073631_822_1541 203
3436 3300049578 Ga0501042_0099109 Ga0501042_0099109_1080_1790 203
3437 3300049578 Ga0501042_0112613 Ga0501042_0112613_585_1304 203
3438 3300049578 Ga0501042_0160509 Ga0501042_0160509_161_880 203
3439 3300049578 Ga0501042_0161539 Ga0501042_0161539_475_1227 203
3440 3300049578 Ga0501042_0196229 Ga0501042_0196229_372_1073 203
3441 3300049579 Ga0501043_0012919 Ga0501043_0012919_167_874 203
3442 3300049580 Ga0501046_0084789 Ga0501046_0084789_344_1063 203
3443 3300049580 Ga0501046_0141630 Ga0501046_0141630_927_1637 203
3444 3300049580 Ga0501046_0163291 Ga0501046_0163291_575_1294 203
3445 3300049580 Ga0501046_0178166 Ga0501046_0178166_304_1023 203
3446 3300049581 Ga0501047_0000235 Ga0501047_0000235_59981_60688 203
3447 3300049581 Ga0501047_0440868 Ga0501047_0440868_352_1056 203
3448 3300049582 Ga0501048_0006738 Ga0501048_0006738_164_871 203
3449 3300049582 Ga0501048_0066080 Ga0501048_0066080_193_912 203
3450 3300049582 Ga0501048_0125718 Ga0501048_0125718_924_1643 203
3451 3300049583 Ga0501067_0052037 Ga0501067_0052037_962_1681 203
3452 3300049583 Ga0501067_0163558 Ga0501067_0163558_291_1010 203
3453 3300049585 Ga0501069_0225969 Ga0501069_0225969_297_1016 203
3454 3300049585 Ga0501069_0329127 Ga0501069_0329127_137_844 203
3455 3300049586 Ga0501070_0026710 Ga0501070_0026710_2050_2757 203
3456 3300049586 Ga0501070_0037532 Ga0501070_0037532_1836_2537 203
3457 3300049587 Ga0501071_0017063 Ga0501071_0017063_2718_3437 203
3458 3300049587 Ga0501071_0024767 Ga0501071_0024767_1938_2657 203
3459 3300049587 Ga0501071_0038781 Ga0501071_0038781_538_1257 203
3460 3300049587 Ga0501071_0199116 Ga0501071_0199116_62_763 203
3461 3300049588 Ga0501072_0031734 Ga0501072_0031734_2321_3040 203
3462 3300049588 Ga0501072_0058632 Ga0501072_0058632_503_1222 203
3463 3300049588 Ga0501072_0062754 Ga0501072_0062754_78_797 203
3464 3300049588 Ga0501072_0242569 Ga0501072_0242569_187_906 203
3465 3300049589 Ga0501073_0046649 Ga0501073_0046649_1440_2147 203
3466 3300049589 Ga0501073_0069063 Ga0501073_0069063_1326_2030 203
3467 3300049589 Ga0501073_0075457 Ga0501073_0075457_625_1392 203
3468 3300049590 Ga0501074_0002757 Ga0501074_0002757_2852_3559 203
3469 3300049590 Ga0501074_0110230 Ga0501074_0110230_403_1122 203
3470 3300049590 Ga0501074_0295158 Ga0501074_0295158_149_868 203
3471 3300049591 Ga0501075_0013808 Ga0501075_0013808_4504_5223 203
3472 3300049591 Ga0501075_0116706 Ga0501075_0116706_477_1196 203
3473 3300049591 Ga0501075_0218575 Ga0501075_0218575_687_1406 203
3474 3300049591 Ga0501075_0275812 Ga0501075_0275812_431_1150 203
3475 3300049592 Ga0501076_0000421 Ga0501076_0000421_18962_19681 203
3476 3300049592 Ga0501076_0052511 Ga0501076_0052511_956_1657 203
3477 3300049592 Ga0501076_0081388 Ga0501076_0081388_19_729 203
3478 3300049592 Ga0501076_0094632 Ga0501076_0094632_536_1255 203
3479 3300049592 Ga0501076_0236554 Ga0501076_0236554_512_1231 203
3480 3300049592 Ga0501076_0339569 Ga0501076_0339569_288_1007 203
3481 3300049593 Ga0501077_0011866 Ga0501077_0011866_3732_4451 203
3482 3300049593 Ga0501077_0019499 Ga0501077_0019499_1284_1985 203
3483 3300049593 Ga0501077_0022721 Ga0501077_0022721_161_880 203
3484 3300049593 Ga0501077_0065891 Ga0501077_0065891_1185_1907 203
3485 3300049593 Ga0501077_0067033 Ga0501077_0067033_1043_1762 203
3486 3300049593 Ga0501077_0083731 Ga0501077_0083731_53_772 203
3487 3300049593 Ga0501077_0120730 Ga0501077_0120730_647_1366 203
3488 3300049593 Ga0501077_0161677 Ga0501077_0161677_208_975 203
3489 3300049741 Ga0501079_0041571 Ga0501079_0041571_2696_3415 203
3490 3300049741 Ga0501079_0166268 Ga0501079_0166268_445_1164 203
3491 3300049742 Ga0501080_0033886 Ga0501080_0033886_2550_3257 203
3492 3300049742 Ga0501080_0190633 Ga0501080_0190633_888_1589 203
3493 3300049742 Ga0501080_0374532 Ga0501080_0374532_259_978 203
3494 3300049743 Ga0501081_0255165 Ga0501081_0255165_85_804 203
3495 3300049744 Ga0501083_0008114 Ga0501083_0008114_3765_4469 203
3496 3300049744 Ga0501083_0122165 Ga0501083_0122165_541_1260 203
3497 3300049744 Ga0501083_0138289 Ga0501083_0138289_544_1263 203
3498 3300049744 Ga0501083_0232372 Ga0501083_0232372_354_1073 203
3499 3300049744 Ga0501083_0251035 Ga0501083_0251035_163_870 203
3500 3300049822 Ga0501035_0005931 Ga0501035_0005931_993_1700 203
3501 3300049823 Ga0501044_0152785 Ga0501044_0152785_869_1573 203
3502 3300049824 Ga0501045_0114518 Ga0501045_0114518_436_1137 203
3503 3300049824 Ga0501045_0200097 Ga0501045_0200097_135_854 203
3504 3300049824 Ga0501045_0229332 Ga0501045_0229332_575_1294 203
3505 3300050489 nmdc:mga03683_34186_c1 nmdc:mga03683_34186_c1_486_1187 203
3506 3300050493 nmdc:mga0k408_10033_c1 nmdc:mga0k408_10033_c1_2998_3699 203
3507 3300050494 nmdc:mga06z11_7800_c1 nmdc:mga06z11_7800_c1_1004_1705 203
3508 3300050507 nmdc:mga05p37_109891_c1 nmdc:mga05p37_109891_c1_2371_3090 203
3509 3300050507 nmdc:mga05p37_139910_c1 nmdc:mga05p37_139910_c1_466_1227 203
3510 3300050507 nmdc:mga05p37_2437_c1 nmdc:mga05p37_2437_c1_8969_9670 203
3511 3300050507 nmdc:mga05p37_49513_c1 nmdc:mga05p37_49513_c1_2002_2721 203
3512 3300050507 nmdc:mga05p37_62767_c1 nmdc:mga05p37_62767_c1_1954_2655 203
3513 3300050508 nmdc:mga09592_1370_c1 nmdc:mga09592_1370_c1_11218_11919 203
3514 3300050509 nmdc:mga0qj67_2465_c1 nmdc:mga0qj67_2465_c1_5005_5706 203
3515 3300050509 nmdc:mga0qj67_270437_c1 nmdc:mga0qj67_270437_c1_16_735 203
3516 3300050510 nmdc:mga06r32_11149_c1 nmdc:mga06r32_11149_c1_5912_6631 203
3517 3300050510 nmdc:mga06r32_11500_c1 nmdc:mga06r32_11500_c1_5480_6241 203
3518 3300050510 nmdc:mga06r32_274856_c1 nmdc:mga06r32_274856_c1_738_1457 203
3519 3300050510 nmdc:mga06r32_328722_c1 nmdc:mga06r32_328722_c1_350_1069 203
3520 3300050510 nmdc:mga06r32_638_c1 nmdc:mga06r32_638_c1_9029_9730 203
3521 3300050511 nmdc:mga08y16_103801_c1 nmdc:mga08y16_103801_c1_1151_1912 203
3522 3300050511 nmdc:mga08y16_123400_c1 nmdc:mga08y16_123400_c1_661_1380 203
3523 3300050511 nmdc:mga08y16_186176_c1 nmdc:mga08y16_186176_c1_431_1150 203
3524 3300050511 nmdc:mga08y16_3117_c1 nmdc:mga08y16_3117_c1_1736_2437 203
3525 3300050511 nmdc:mga08y16_48086_c1 nmdc:mga08y16_48086_c1_936_1637 203
3526 3300050511 nmdc:mga08y16_549_c1 nmdc:mga08y16_549_c1_9425_10126 203
3527 3300050512 nmdc:mga0n895_19785_c1 nmdc:mga0n895_19785_c1_1764_2465 203
3528 3300050512 nmdc:mga0n895_223980_c1 nmdc:mga0n895_223980_c1_296_1015 203
3529 3300050512 nmdc:mga0n895_283_c1 nmdc:mga0n895_283_c1_24339_25040 203
3530 3300050512 nmdc:mga0n895_351825_c1 nmdc:mga0n895_351825_c1_689_1390 203
3531 3300050512 nmdc:mga0n895_779639_c1 nmdc:mga0n895_779639_c1_205_906 203
3532 3300050513 nmdc:mga0rr50_36589_c1 nmdc:mga0rr50_36589_c1_1690_2391 203
3533 3300050513 nmdc:mga0rr50_40885_c1 nmdc:mga0rr50_40885_c1_2092_2811 203
3534 3300050513 nmdc:mga0rr50_59657_c1 nmdc:mga0rr50_59657_c1_395_1096 203
3535 3300050513 nmdc:mga0rr50_617153_c1 nmdc:mga0rr50_617153_c1_113_832 203
3536 3300050513 nmdc:mga0rr50_90688_c1 nmdc:mga0rr50_90688_c1_1233_1934 203
3537 3300050514 nmdc:mga08x19_19179_c1 nmdc:mga08x19_19179_c1_281_982 203
3538 3300050514 nmdc:mga08x19_39977_c1 nmdc:mga08x19_39977_c1_698_1417 203
3539 3300050515 nmdc:mga0a205_188102_c1 nmdc:mga0a205_188102_c1_1021_1722 203
3540 3300050515 nmdc:mga0a205_387_c1 nmdc:mga0a205_387_c1_5133_5834 203
3541 3300050515 nmdc:mga0a205_547340_c1 nmdc:mga0a205_547340_c1_90_809 203
3542 3300050515 nmdc:mga0a205_8273_c1 nmdc:mga0a205_8273_c1_1003_1704 203
3543 3300053077 Ga0495601_0001193 Ga0495601_0001193_752_1453 203
3544 3300053077 Ga0495601_0002336 Ga0495601_0002336_5233_5952 203
3545 3300053077 Ga0495601_0004742 Ga0495601_0004742_1183_1884 203
3546 3300053077 Ga0495601_0007365 Ga0495601_0007365_2232_2933 203
3547 3300053077 Ga0495601_0026137 Ga0495601_0026137_955_1656 203
3548 3300053077 Ga0495601_0026610 Ga0495601_0026610_2189_2890 203
3549 3300053077 Ga0495601_0166105 Ga0495601_0166105_185_886 203
3550 3300053078 Ga0495612_0005860 Ga0495612_0005860_1715_2416 203
3551 3300053078 Ga0495612_0024812 Ga0495612_0024812_630_1331 203
3552 3300053078 Ga0495612_0051182 Ga0495612_0051182_469_1188 203
3553 3300053084 Ga0495595_0000532 Ga0495595_0000532_3904_4605 203
3554 3300053084 Ga0495595_0003797 Ga0495595_0003797_793_1494 203
3555 3300053084 Ga0495595_0009768 Ga0495595_0009768_1659_2360 203
3556 3300053084 Ga0495595_0038662 Ga0495595_0038662_662_1363 203
3557 3300053084 Ga0495595_0091506 Ga0495595_0091506_175_876 203
3558 3300053085 Ga0495619_0001164 Ga0495619_0001164_4676_5395 203
3559 3300053085 Ga0495619_0001481 Ga0495619_0001481_8943_9644 203
3560 3300053085 Ga0495619_0002703 Ga0495619_0002703_9670_10371 203
3561 3300053085 Ga0495619_0008778 Ga0495619_0008778_1927_2628 203
3562 3300053085 Ga0495619_0050587 Ga0495619_0050587_1199_1900 203
3563 3300053085 Ga0495619_0189998 Ga0495619_0189998_516_1235 203
3564 3300053085 Ga0495619_0415263 Ga0495619_0415263_53_754 203
3565 3300053109 Ga0500569_010361 Ga0500569_010361_400_1110 203
3566 3300053156 Ga0500622_0008990 Ga0500622_0008990_3842_4552 203
3567 3300053177 Ga0500636_0009188 Ga0500636_0009188_1177_1887 203
3568 3300054114 Ga0501084_0010490 Ga0501084_0010490_881_1600 203
3569 3300054114 Ga0501084_0050020 Ga0501084_0050020_114_833 203
3570 3300054114 Ga0501084_0069776 Ga0501084_0069776_765_1475 203
3571 3300054114 Ga0501084_0133750 Ga0501084_0133750_1203_1922 203
3572 3300054114 Ga0501084_0172400 Ga0501084_0172400_1006_1710 203
3573 3300060353 Ga0501082_0015085 Ga0501082_0015085_959_1678 203
3574 3300060353 Ga0501082_0173837 Ga0501082_0173837_613_1332 203
3575 3300060353 Ga0501082_0238716 Ga0501082_0238716_541_1260 203
3576 3300060353 Ga0501082_0282211 Ga0501082_0282211_105_824 203
3577 3300060353 Ga0501082_0572246 Ga0501082_0572246_251_970 203
3578 3300061719 Ga0466962_0050095 Ga0466962_0050095_46_747 203
3579 3300061734 Ga0530510_0006306 Ga0530510_0006306_5873_6592 203
3580 3300061734 Ga0530510_0023207 Ga0530510_0023207_1682_2401 203

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00189

Ribosomal_S3_C

Ribosomal protein S3, C-terminal domain

116

198

0.99

PF07650

KH_2

KH domain

34

107

0.98

Feature Viewer

pLDDT pTM Quality
62.8 0.48 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map